1OL0A

Crystal structure of a camelised human vh
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
121
Chain Sequence
QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWFRQAPGKEREIVSAVSGSGGSTYYADSVRGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREPRIPRPPSFDYWGQGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN G
publication title Crystal Structure of a Human Vh: Requirements for Maintaining a Monomeric Fragment
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ol0A00
1M6OB 1H3TA 5DTFA 1OTSD 2WINB 5BS0E 2EDRA 1FFPB 3C8KB 4L4VD 2VJXA 4EXKA 3QEQD 2PKDA 4MWFB 4JDTH 5C0AA 5EH1A 1MWAH 5F7DB 2ICEB 2H32H 3G6JF 4N0YL 4MB3A 3PHSA 4H0HB 2A73A 3D0VA 4JRXE 4XVUC 2A9MH 1UVQB 3EYOA 4N0FB 3EHBD 3BDBA 3MUHL 4ODWA 5DEGA 2NY7L 2BCKA 1BIHA 3L3DA 1A6TB 1PYWB 2FGWH 1G0YR 2ZUXA 3NFPB 3K74B 5C07A 4O00A 3FQRA 4YAQB 2BK8A 1XCTB 3QYCA 1FVCB 2X1PA 3IFLH 1LE5B 5EZIH 2YC1A 4M5YH 1CDUA 4HGKC 5GGTL 2P42B 2L7UA 4N0UE 4OAWA 3SE9H 4U6VH 5KN5A 4L8SC 3ZT7A 3MLRH 3QUZD 3BN9D 2DKMA 4XVJH 3GMRB 2J8OA 3H2WA 3C5JA 4KRLB 5B38B 3QDAA 5DVKA 2G60L 4NN6C 5I1GH 3J7HA 2AJSH 4QHMA 5FA4B 1YQVH 1ZT4A 2R1XB 4WUUD 3SBWC 2VLMD 3C87A 2HRPH 4JY6B 4F33A 3KPMA 1A1NA 2AXGB 2XRAL 4GH7B 4JFEA 1ZA6B 3E6FB 1PD6A 4F9LA 2JF1A 1CD8A 3V5KB 2ZCKH 4DOHE 3L7EB 1WEJH 4LQFH 4PRID 5GJSH 5F6HJ 1YYLH 35C8L 3MR9B 3OMZA 3UZVB 1G7LA 5BJTB 5TDNA 1WJ3A 3H9ZA 1I7TA 4M1DL 2EEAA 2WQ8A 1G6RH 2RGSA 3B8SA 3F7RA 3PQYA 4MVBD 1HOCA 8FABB 1I7ZA 4GXUN 1RJCA 2NXZB 3DMMC 3PJSB 3MMEB 1EFXA 2V5YA 2NCMA 3L3KA 4KY1H 5GS1A 5I74C 2P43B 2UUDH 5DJYA 1YUHB 3CU1A 4LEOA 4KMTL 4NCDA 1G7QB 3BKCL 3QXDA 4K71C 3WUWB 1P9MC 4JHWL 3WO3B 1RURH 2B7DT 1E4XH 2XWJB 2NX5D 1ZGLB 3CFJA 1OCWL 1W0WB 3X12A 4P2QD 2GYSA 4K2UL 4GKOA 5F6IB 3WHXB 5ANMA 5I8KH 4JFHE 4UT6H 3LRGA 3B6SB 4O4YH 3SDYL 4JFFD 3VXQB 3X14A 5IMKA 4U6TA 2F53B 4PJXA 1J5OL 5C70A 3D2UD 1QQDA 1OT2A 3T0WA 2B2XH 5A3IC 1JBJA 4WV1B 2J5LB 4GKZB 5IGXH 1W0VB 2VABA 1H9VA 5FXCH 4LVHC 2EIZA 2F5BL 1C1EH 5D1XA 4IHOB 3U30B 1HDMB 3RZCA 1W72A 4OLVL 1N7MH 4RRPG 2IPKB 3M07A 2EDWA 1PZ5B 2WBJD 2VDNH 3IDUA 3MRQA 1OGAA 4G6FB 4RDQF 2ARWA 3D6GA 1J0KA 5DHVB 4P23C 1AE6L 3SKJH 4HPYL 4KZDL 3MZTA 5D7JC 5HHOB 4ODTL 2EXYD 3HE6B 4OZFB 2VLKA 3QPXH 3QO1A 3CDGA 3RKDC 4LMQI 5L9DL 3Q0HA 1J8KA 1CICC 4ODVL 4PJCA 3V6OE 1CQKA 1WWWX 3OKDB 4HWEH 4L3EA 3MROB 4MNQD 4QEGA 4X7EC 2HMIC 5SWSD 1RULH 3VXTB 3RY4A 1NBZA 4DGIH 4KJYB 1FZMA 5JHLH 5EZOL 5J0BA 4ORZC 5L2KB 2NPLX 4MNGA 4PLOB 5T3XD 1KFAH 1INEH 1PVHA 2GEEA 1WZMA 3L5HA 1R5IB 3V8CA 2VITA 4PB0H 1T5XB 5I1CH 2DLIA 2YKLL 2O61A 4G42A 5ELIA 5EUKB 1ZLUH 4ZG1A 4O9HH 4PJ9A 3RWDB 2PN5A 1LP9F 2GSGA 4Y4HA 5FCUH 2GJJA 1MCJA 4FP8L 3CC5A 1D6VH 4PJ8A 3CXHJ 3KYNB 4LPVA 4PS4L 1AC6A 2EKSA 5A2FA 5KG9B 3TPUB 1NEZB 1TJIL 2IJ0C 3Q6FA 2R2HB 3LKOB 2VSDA 2QQKH 1BQUA 1KCVL 3TBSA 2LTQC 4PY8J 2OZ4H 4D0CA 4AIXA 2LV4A 2A2QT 3ARED 2BNQD 3DUUA 3FOLB 1E27B 1ZA3B 2AI0H 5FYKE 2DQUH 5GRXG 4NOBA 1QSEA 2FJFA 2BOCB 1YPZF 3M8OL 4NKDB 2HKHH 1MWAA 1RUMH 4HS6B 3K80A 4I77L 1K3IA 2BX5A 4L9DA 4LPXA 3VFWB 3GRWH 3MO1A 2ZUWA 1J0JA 2V2XA 5HDBE 1UB6A 4LCWD 3SDXF 4HUXA 3P4OA 4HUNB 1GJIA 5FM5O 2GT9B 1S9KC 4WW2F 4J1UB 3BGAA 4UMGA 4I3RL 4PV9A 3L1OL 3LRSA 1EHAA 4TSBH 5I18H 2BHYA 1JNNH 5T3ZH 4YC2C 3N1MC 3QQ3B 1IQWL 5HI4D 4ODUB 7FABL 4RIRA 4IDJH 3KXFD 1TZGL 2CMRH 5TDOA 3QIWA 3SJVE 4CL7A 2DJSA 4QRPE 4R4FL 3TBVB 4X6CA 4MGXA 4IOSD 1CFQA 1PX4A 3Q5OA 3CU7A 2QBWA 2P8LB 3OPZL 3TA3A 3KPLA 5JHDD 1B6DA 2C5DC 4ZTPH 3I85A 2WP3T 5I1HL 4PJIF 1AXSB 5GGQH 3MLTB 3DNKA 1H0DB 3ULVH 2MCG1 2CSPA 1UH2A 4HJGA 3TIEA 2Z91B 3VXRA 1I9RH 4ZUTB 3LPFA 4OLZH 4XPAH 4MYWB 5BZDB 3RWFB 4LCCA 4GXVL 4K7FA 5DD3H 3D9AL 4CMMA 5GS2H 4TSCL 5D7SL 1X6LA 4OLYL 4HG4K 4GRLB 4J12A 4LASH 3EFDH 3O4LD 3VXOA 1LDSA 3EOBB 1BREA 5IV2A 4G3YH 1P84J 3O4OC 4S0SD 5HDQH 4OCRH 1IEAB 4G8GE 4FQLL 3VD7A 1I3VA 2RFXA 4WY7H 1D5IL 1PFCA 3BVNB 5IM7A 1SYSA 1OSPL 5HGDB 4XWOD 4RQQA 5E6IC 3OKLB 4XPFH 1VFUA 3IGAB 5BS0A 1JMXA 3WUZA 2E6QA 3VJ6A 4XBEH 1QVOA 1OLZA 1ZT1A 3EOAB 4JG0H 4DQOL 2NZIA 2X4PB 3LD8B 3CFIC 3B83A 4R2GD 5BVPL 4FQIL 5AWNL 5ICZB 3QIBD 4JDVA 4JRXA 3T0EB 4AH2A 1MAJA 1RHHB 3OGCB 1LMKA 4JVWA 4M62H 4ZDHB 4KUZL 1DVFC 2NY0C 2VXVH 3EDEA 1IGFL 1HK6A 3MJ9H 4OCYH 5TQ2L 3QDGB 3U79A 1JGVL 5IB5B 4Y4FC 4W6YB 3W2DL 2HTKC 1A14L 4XPTL 3DYOA 4K3GA 2GK0B 2R29L 2HWZL 5LXGH 2FHFA 2O5YL 3K3QA 3QEHB 1DQMH 2FJGB 3MPCA 3DBXB 4N0UA 4PRHD 2ZOKA 1MCFA 3KYKL 3F7VB 1GIGH 4R6UA 3FT3B 4JN2B 1II4E 1YMHB 5D70L 3RX8A 3MXWH 1JRHH 2DN7A 2IANB 5I15H 1MI5D 5IVXB 4HXBH 3C2AH 3TH2T 1RZKL 4PGJA 3EYFB 3GMQA 1OAUL 4M6AA 1NCAL 4K8RC 4FQJH 2W59A 4RDQG 4WFGE 2IPTH 2AQ2A 2VRAA 3HMWL 3QSKB 5B4MC 4M8QB 1R3IL 2UZIH 5JW4N 1J1OH 4MDIA 5DR5H 2AJ3A 3ZYJA 1AD9A 3L3HB 3TBTA 5CD5C 3LN5A 4M7LH 3HZYB 4OCMC 5FOJA 1G7MA 1PG7W 3U82B 3EJZC 4GAFB 2BSRA 4P5KA 2DMCA 2R2CA 3MRHA 4E5XB 3FB8A 3G5XB 1YEHH 3PV6A 5JO5A 3QUXB 4P9HC 1KB9J 3RA7L 4X5XA 3O6ML 5B3JE 1QFWM 5ADOH 1AJ7L 3MRBB 4D9QE 1WT5C 3JWNC 2FIRT 4JANA 1VFBA 5JOFA 5LGJA 4B7LA 3MBXH 2OJZH 4Y16A 5AG9A 1FPTH 1AHWB 2ERJC 2RHEA 5CEZH 1WBYA 3KAAA 4JM2F 5KW9H 1JZ8A 2Z8SA 1WFUA 3HZMB 3RWCB 2ICCA 5I1JL 4R90L 3MA9L 3O8XA 2EYSA 5C0NC 1EGJH 5CEXB 1J9CT 3RTQC 5D71H 3X3GH 1JGUL 2ZG2A 3GSWB 2EYRB 5J3HD 2VDRH 4FFWD 1RUPH 3BKMH 3VGAB 2J6EH 4KQ3H 1UADC 4HS3A 2AXFA 3UMTA 1T22B 2JCCB 3C5ZC 2C7UA 1MJ8H 3ARBB 5DJ8A 1L9NA 1TMCB 3O11A 1CIDA 2X4OA 1G9ML 1CFVL 1NGYB 5L8KB 4MSWB 1XGPA 1NFDF 4HCRA 4XP6L 1EPFA 1CF8L 2HAZA 1UZ6F 4HIXL 3GJEB 3WFHB 3HG1E 4N68A 2HFEA 1TNMA 1IGJA 1CT8A 1TDQA 5D4QA 4PG2A 5KS9F 4K3JL 4U2YA 3LRHA 4UTAH 3MCG1 1DTUA 1AGCB 1JWSB 5DD6A 5I6XC 3U4BL 4JO4H 4W4OC 5F70A 2H3NA 1WBXB 4YNYB 3L9RA 3O3DA 2F58L 3CSGA 1MELA 2VIRB 4BQ6A 4JJ5A 1ED3B 4P4RB 3V6OA 1WIOA 4N9GB 4QGTA 3LQAL 3S3JA 4GJTB 4W70A 1XAUA 4U0RC 5T1DL 5FKPB 5HI3D 4O5LH 3QUYC 1AR2A 2NXZD 1S9XA 4P57A 3UYRL 2EDLA 3DV4A 3Q3GA 3X13B 3B9KB 3GJFH 2IALB 1A9EA 2Z92A 4XH2B 1A6ZB 1U3HC 4YX2H 2Z93A 1MREL 4P5TD 4LU5L 3UBXG 1F4XL 5GQBA 5B39A 1I3GH 2D7OA 4Y5YB 3ZMRA 4KAQL 1GAFH 5EU4B 1C5BH 4NSKA 4OF3A 1OSZA 2DQEH 3WFEL 3AS1A 5DLMH 5BVJA 2BZDA 1EXUA 1F2QA 2CH8A 3ZTJH 2W0LA 4LSPH 1HEZA 1OP9A 3EYSL 4J23A 4U7KA 5C0BE 3QP3A 3QZWG 5DD0L 1BJ8A 4HULB 5GSRB 1A2YB 1CIUA 2F53D 4HHAB 3I3BA 1GGBH 5E8EA 3BP5B 1F4WL 3CH8A 3FO0L 4OQTH 2AJYH 4OTXH 4LHQB 4U3HA 2X09A 4FXKB 2LAGB 5HGHA 3IXTB 1EUUA 5D6CA 1QFUH 4NP4L 1E4JA 1LK3L 4TTDD 3RX7A 2KDGA 5GRVK 3F5WB 1T6VN 3ESVF 2E5EA 3VXPB 2DBJA 4NO5A 4YHKH 5FYLD 1UACL 3FZUC 4U1IA 3BGMA 2ESVD 4UTBH 2XNAB 3S5LA 3FFDA 1LQSR 4HFUL 1EMTH 5E2VL 4OJFH 2R2BB 2BNRB 1HH9A 3SDDC 4U1JB 3VWJD 4G43A 2FX8H 1CLCA 1JGDA 1KEMH 2A6IB 3PWPE 2VR4A 5D9SA 1YA5A 5F96H 3G6JB 3BP7B 5CD3B 4X4YB 4XNUH 1A6VL 3ULSB 3OZ9L 2WIIA 1DBAH 1GVIA 3SJVA 1E6JL 2XY2A 5GS0H 2D03L 5MENB 4QRPA 1L7TL 2BJMH 4ISVA 4ONOA 1NKOA 4P2OC 5A16B 1WV7T 1CGUA 1JWMA 4TRPH 1UJ3A 2GK2A 5TE7H 12E8H 3MLWH 3SDAD 4Z95L 5LQBL 3VH8B 2AJUH 1ADQL 3TT1H 3G6DL 4XNZB 3W9EB 3QCTH 5F7MC 3GBML 3C08L 3WLBB 5C2UB 4H88H 3TVMA 2XIDA 4RMVA 5HD8C 4QF1A 4X98B 1FO0L 2ICWA 3FQXB 2UYLB 3LN9A 4UV7L 3FCTB 3WEXB 3HNTL 1NCBL 5F1IA 5IB3A 1I1YB 2M8XA 2GJ6D 3G5ZB 5INDB 5IT2L 3ILPB 4F9PC 1MIEH 2XWBA 4QY8B 2VL5A 4HIIA 4G8GA 8CGTA 4N8VA 2DQGL 4FFVC 3MV7D 3DRQB 1YMMB 1IGIH 2X7LB 1JNLL 4ONGL 3OHXA 5J06A 4U3XA 3VDAA 2NR6C 2IC2A 4PRBA 4TOYH 2FDBP 4KRMB 2V2WB 1OTUC 4K23H 4PJXF 5EBWA 3OAYH 5I8OL 1YEDB 3HNSH 5DJ0A 1KT2B 5CGYC 2XI9A 4GUPA 5DD1H 2VXUL 5CP3A 4Q9BA 3T3PF 1VADA 2ICWI 2ZWLT 1NL0L 2X44D 5CINL 5FYJH 3VA2C 4GXUM 2VDOH 5GGSB 5IHUL 1G1CA 4HKJB 4M43H 2A6JA 3OJMB 1FP5A 4LCUA 3RAJH 1OOAA 1QRNB 2DM4A 3NPSB 4XNYL 5TFSL 3G9VA 1SM3H 5J6GB 5DMKA 1MCBA 2H8PA 3TLRA 4J3OC 4F3FB 1FFNB 4U1MA 5JUEL 3STBA 4RBPK 4OKDA 3WJJA 3BP4A 3B3IB 2PCPB 4LLWA 4BA8A 3K2UH 4BUGA 1E4KC 1S7UB 2VTFA 1MFCH 2FECI 4PJCF 4MZ2A 2BVPB 3TYGH 3D39E 4NKOB 2HLAB 1KJ2A 2RAMA 3O3AA 2AKRB 3DVIA 1OM3H 4FFZL 1HIMH 1WK0A 2R4RL 5DJZA 3OB0K 1MNUL 1WBZA 4MA8L 2F8XC 4R3SA 1F58L 4BH8A 1HHGB 4JQVC 4HDIB 4PRDB 4S1DD 3KPQB 5GIRB 3MGOA 1BBJA 2FBJH 1GZPB 2D31B 4P46A 4KKBC 3NCBB 4Y4HC 1IAII 5C0FA 3RL1B 4KPHH 1KJMA 4GRLD 3MREA 2H2PD 2YPKB 3QI9B 4F7CB 2DF3A 3S7GA 4CU7A 3C60D 3MFFB 4U1SA 1U58A 4Z7NF 4I48A 3S88L 1FN4B 3H7LA 1T80A 4HJJH 1VENA 3H3PH 1AKJA 1PG7L 4FZEL 4JJHA 1QSFB 4NQVB 4XMPL 5E00B 2OJEB 3OR7B 3KLAB 3MRJA 1C16B 4RFOL 3QRFM 3HMXL 4LSUH 3CFEA 1IKFL 4U1HA 4L8CA 4BSJA 1AY1L 3H9SD 4NJAL 5JXAL 4N8CL 2A9NH 4Y5XB 1A3RH 2YD4A 3O2WL 5CUSH 1F11A 2QADC 4AENA 3QDJD 2NNAB 3PWVA 2EH7H 3W0WE 3FKUS 3HNVL 3NACL 5I73C 3DO7A 5B8CC 3ZT6A 4WNQA 2BDNL 1CD0A 4MD0B 4AL8H 1S9VA 4ZXBA 1S3KH 4KDVA 4PJAE 4BFBD 4UUJA 3D18A 3NAAH 5DHYA 4LVNB 5D8JL 3CFKB 5J57B 2AEQL 1QNZH 3KPRD 4WJ5A 2DWEA 4XCEA 1VGKB 4HS8H 3GMMB 3IDJB 2R2EA 3HI5L 3QIWC 3F6LA 4BFIA 4ZUUB 4JPKL 1BECA 4OLEA 1NCNA 5DS8B 3V0WL 1LP9B 1S7SB 2IAND 4R4BA 1RZJH 2ZP0T 5EBGA 1Q9LB 1IM3B 3IDXL 4OZ4A 2HFFA 2W0FB 1XF5A 2Z0BA 3KPPA 1HE7A 1EJOL 1VGEL 4HXAH 2A77L 5IFJA 3TBYB 4PFEA 1NCCH 3PHOA 2PW2A 3BPLC 4PV8B 5D7IB 3OKMB 3F7YA 5IK3A 5BCAA 5F3BB 4WWKB 3SO3B 3HG1A 4IOIB 1KC5H 1PLGL 4GBXA 3EZ8A 1Q9OA 3WXVL 4YIQB 5J1TC 2K3TA 2R1YA 15C8L 1DDHA 4K7PX 3ME0A 2G9HB 1FNHA 2YUVA 4GG8B 1DBKH 2EEBA 3NIDF 4C55A 2ITCA 4I0PD 4YZFF 4KK5C 4HKZA 2O5ZL 3D0LA 2ENYA 4OGZA 2NXYB 1I3RA 3QUXD 1LNUB 4MB4A 3CUPB 2IF7A 5IW3A 3NIFE 2F74A 3BH9B 4DKEH 1HYSD 3MNWB 3SDXB 4FABH 2DM3A 1JK8A 1ORSB 5I66B 2RB8A 3ARDA 4OZGE 2BNUB 2XWTB 1C08B 4PLJD 5K9KA 2MQ3A 4PJHE 3JV6A 32C2A 4WTZA 2APVA 1NLBH 1C5CH 4TTGA 1HHKB 1EAPB 1JNHB 1I7UB 2DYPA 4EOWH 1M4KA 4FFYH 4JHBA 1CXLA 1FSKC 4GG6B 5CP7A 5AZEH 3QHZL 4OLWL 4ZYKB 5DRWB 5HY9B 4GT7A 4Z7WE 2OL3H 3S96A 3PXJA 5BW7A 5TGBB 5IMMB 2X70B 4MNHB 5DQJB 2OQJB 2BXYA 4L8DA 2FZ3A 2XPGA 1FCGA 5TE4L 5BZWA 3UBXB 2X4TA 4OM0H 2APFA 3N1QC 2HT4D 4YXHH 1JGEA 1FO0B 5C0BA 3TWCL 3C09B 4PLKD 5DC4B 4F57L 5F7LB 4M6OL 3EO0B 1LDPH 1WWAX 4IIQB 2Q6WB 2Q8AL 1J1XL 5T3XH 1FC1A 1VCAA 3PL6C 1MCOH 5I1IH 1ZLVH 5CSZA 1RFDH 3ARGB 3CZFB 3FT4A 2GI7A 3V4UL 1R24B 2D7NA 3LKQB 5DQ9B 1OTTC 3V7AG 3K81A 5E5RB 4GAYB 2H2SC 1JMZA 1DL7L 5KANI 3QZWB 3QNYB 5JOPD 3UDWA 3K4DA 1UFUA 3T1WA 4NJ9H 3DETD 4ZS6C 2EZ0C 1X5LA 4O2EB 1B4JH 3WIHH 5CMAB 5DWUH 1RJZA 1HWGB 3ECBB 3RGVD 1TZHA 1QYGL 1U95A 2DQTL 1KCSH 2P5EB 4HKBB 3HS0A 5C0JA 5JNYA 1U6AH 4NQED 5LKNA 3OG6B 3FB7A 4PGEB 1LGVA 3BQUA 5DQDL 2X4NA 1KEGL 4LSVL 3U46B 3PWPA 4TVSa 1ZLWH 4OD2B 5CBEA 4AEIL 4NRYB 3O2DH 2P8MB 4PYGA 1JHLL 1ZHKB 2VR9A 3B9KD 3C6SB 2E27H 5EO9B 3EJYC 3FB5A 3MRKA 1LO0H 2R39A 4U3CA 3HI6L 3MCKA 3WLWC 1NFIB 4OCXH 1N6VA 4QXUL 1UXSB 4KTDH 4G7YL 4Y16C 3R0NA 4JM4H 3P9LA 2XA8H 3QQ9C 3DVNB 4Y0GA 1JFQH 1RZ8B 3RPIB 3GO1H 1HHIB 4Z5RB 2I60H 4XXCA 1CK0H 1QO3B 1D5ZA 5KVFL 4J6RH 2V6HA 1VFMA 3BE1H 3X3FH 1A1MB 2DIAA 1Y18B 3IRZA 2EDFA 1CLOH 4IRSA 3PWUB 4JFPB 1Z9LA 4OGAC 3TH4T 3D48R 5ILTH 2A0LD 1T1WB 1HHJB 1PGRB 1N6QH 1T1XB 1OW0A 2GQHA 1BM3H 3GSQB 5B21A 1RZGB 1MHHB 1KN2L 3RVTC 4ZUWB 3WL9B 3QT2A 5IQ7L 5JXED 5BOPA 2BC4B 2LVCA 1XIWA 4MCZB 1FFOB 4U6XA 1DEDA 3MNZB 5DUPH 3MTRA 1KB5H 3NN8B 5GSVB 5HGBB 2UVEA 3NCJL 2HFGH 2Y5TA 3BZDA 1D9KC 3BEWB 1EV2E 3LY6A 1JPSH 1Q94A 4R96B 3O3UN 5C09B 4GW4A 1ZT7B 1XF4A 5JMRA 4Q9RH 2X41A 3MLXL 3SGJA 3UJJL 3F12B 3G5VA 4Z7VE 1OT1A 2PXYB 4NRZA 3GMNA 4YDIH 2ZSWB 1W72L 4HWBA 1TIUA 4BH7A 5BV7L 4NZRH 1E28B 1CLZL 1UQSA 2RBLA 5D1ZC 3IVKA 1P1ZA 2APBA 3RNKB 2HP4A 5EA0H 5GJTL 2QQQA 4F15C 1M1SA 1TCMA 1K8DB 4G8EA 3WIFB 3KS0J 4R0LC 2FSEB 3T4YB 4M7KH 5MEND 3VFTB 4Q6IA 1PSKH 3O9WA 3D39A 4H5SB 1JTPA 5IIEB 4G6KH 3E8UL 1ERNA 1U8IB 3I6LD 4Z7QE 5DVNA 2XKSA 4NQSA 1ES0B 1QBLH 4CVZB 4O2CA 4HF5H 2QQLL 1FG2A 4FN0A 3QPQD 3WS3B 3RWJB 1AD0B 4EDWH 1QFOA 4LIQL 1KGCD 2FH8A 2VH5L 4TUJB 2BRQA 2PUQT 3SKMB 3BYTA 3ULVC 5B3NA 3JV4B 4ZFZB 3SY0B 1SEBA 1N3NB 1NDMA 5TF1L 1S9WB 3D25A 1NC4D 1QTYT 2J4WH 1ZVSB 2XKUA 2NZ9D 3ARWA 4QGYA 3CFDA 3O6FA 4ZODA 5ESAA 4RX4A 1SEQH 1SJHA 5EDXA 4K7PH 4MXQD 4TQEL 1QFWH 1ZHBA 4RMUA 4LAQH 1YMMD 1JYWA 1BJ1H 3QIUA 43CAA 3GBNL 3I6GA 1NFDB 1MCSA 4OGXH 4G9DB 3GUTA 5F71A 1RUAH 3VFUA 2CDGA 3T0DA 4M1GH 4J4PA 1AQDA 1FJ1A 5F44A 4ZOBA 5KS9B 5EOTB 1P7QD 4XC3H 3OJ2C 1OLLA 3QDMB 1AI1H 3W0WA 1RZ7H 1S5IH 3L95B 3UP1A 2B39A 3AMKA 1QRND 4MJIB 1F5WA 3DV6B 2QHRH 4Y2DC 3HLAA 2IAMC 3X11B 3K46A 1IARB 4ZPTB 1KYOK 5A2JH 4PJAA 5F88B 1LO4H 1YY8B 4OQ1A 2KPNA 1XR8B 3MV01 4GW1B 3VXSB 2NY4B 5DTFB 5KVEL 5E8PA 5HDBF 1QD0A 4Y8AA 2HKFL 3U83A 3NCYP 5C0AB 4H1LG 2L0DA 4ZS7L 2DI9A 4X80L 3I2CL 2A73B 3D0VB 1KJ3L 5EIQA 3SDCB 3EYOB 3HCVA 4RGNC 2DAVA 3IJYB 3MXVL 5DEGB 1XZ0B 1H3XA 2P7TA 3Q1SH 3L3DB 1QLRA 3OWEA 1KELH 2W38A 3HR5B 4HIEA 1NAKH 1OAYL 3R8QA 1NBYB 3HPJA 3U2SB 1KLFA 5C07B 1RUQH 3KYMA 3FQRB 3QEGL 3QUMB 4XVTH 3T04D 5IBTL 4JLRB 4OFYA 3VFMA 1PW3A 4X4XB 5E9DB 3UPRB 4GSDL 5HTSA 2DRUA 2YC1B 2E6PA 3BAEL 4Q74A 5JLZA 5FOBA 4OAWB 4EEEA 4M7JH 5KN5B 4H25A 4MQTB 3DROA 4EUPA 3DSFH 3BKJH 1UCBH 4YXLH 1DP0A 5BRZB 2CUMA 3CVHA 4QOKB 1UCTA 3RQ3A 4YDVB 3ROOA 5DT1H 1NCWL 4QHMB 5F1SA 1DBBL 4P2RB 2HA1A 2BHZA 5IESL 3RVXC 1EO5A 4EN3D 4MAYB 2CRIA 4XRCA 1KTDA 3G5YA 5E95B 1JN6A 5MEQB 1RMFL 3P11H 5HDOA 3RBSA 3SGKA 5D7JD 4JFEB 4OZGA 2JIXD 3ALXA 4H8WH 3C6LA 1T20A 5DJ6B 4PJHA 1CICD 3AS3A 4DZ8B 5FEBA 1I9JH 4Q97A 2NW3A 3B9DA 1VDGA 1A02N 5HHOE 2A83B 1G7LB 2HT2C 3PHQB 5TDNB 2CK2A 1KPRA 4LSSL 2YPVL 1G0XA 4Z7WA 3ZE0E 1NGWA 2FLRT 4YHOL 2VL4A 5BMFL 1HOCB 1I7ZB 4KDWA 3KR3L 5LWYH 1EFXB 4NZUH 3P77B 2BRRH 5HGAA 5GS1B 1VKXB 2Y25A 4RGOH 5DJYB 5E4IA 3VI4E 1ETZB 4KHTH 1BQSA 4KTYA 5L2KE 4LEOB 1LO5B 4XCCH 3MOAH 2AXHA 4F7TA 3QXDB 1XH3A 4XXDA 4Z78A 3UJTH 4KKAC 1R6VA 3BDXA 1D7FA 4RAUB 4P46C 1CR9L 3HI1B 1OAQH 3MJ6A 4NC1E 1KIRB 2VERN 3DGGB 3LV3A 4WWKD 3X12B 2P8PA 3OBAA 3GEWB 5C6TL 3SCMA 4LFHD 3A6CH 1JHTA 5ANMB 2Q8BH 2IBBA 3TPKA 4NPYB 1J1PL 3CLFH 3UYPA 4LHUA 1L4IA 2PR4L 4PG9A 5E03A 3TZVA 3X14B 5IMKB 4UDUA 4DJMA 1T1ZA 2Q3AA 4PJXB 3O6KH 4BSVA 1TJGH 1DBMH 3V4VL 1QQDB 4ETQA 3H3KA 4U05A 4XPHL 2AK1L 1MHEB 5ADPH 3CMOL 2EIEA 5I1KL 2I07A 4LBEB 3IAGC 4LKCA 5F7EH 3DIFA 2DMKA 3QWQB 5D1XB 1W72B 2Z31C 1ORQA 4D0BA 3WO4B 1HSAA 3MRQB 2OI9B 4XZUA 2I5YH 4NN5B 4JCLA 5C08D 3TF7C 3CXHK 5FYLH 1XT5A 2DOCA 2IFFL 4GAGH 4JY4A 5E6ZA 4UU9A 43C9A 5B3JF 2VLKB 4TUOA 3CDGB 4XAWL 3QNXB 1B3JA 2UWEE 1IAOA 2YPLE 4S1QL 5D1QC 1WISA 5IHZB 4UIMA 2JJTA 3HB3C 3H42L 5DZNA 1EHLH 1NBZB 5F6HI 3F8UB 2VN4A 4HIHA 4X8JB 3S34L 1NMAL 5KSUA 2XQBL 5C3TA 3O81A 2EDBA 2HYMA 5KSAD 3E3QE 3CMGA 2BHUA 4MNGB 5HVWA 2ADJA 4MJ5B 1SMOA 1A5FH 4MD5B 3KLHC 4JN1L 1WITA 5EU7E 3CH1A 4JKPH 4JFDD 1ZLUK 5L0QB 1N5YL 1RIVL 4LPUA 4PRNB 4HV8A 4R26H 5EBMA 4PJ9B 4V1DE 3T8XA 2GSGB 3VG9C 1IRAY 3DURA 1R0AL 1QLEH 4PJ8B 4U1LA 2E9JA 3WIIL 4X5LA 4M5ZL 3HRZB 2EKSB 4X7TA 3QRGL 5DXWA 4QNPE 2JJUA 5IFAH 3DVGA 3CVIH 3LS5H 2OK0L 1E0OB 5IW1A 3QA3A 3KJ6H 1L0YA 3DXAD 2P5ED 2NY1C 5HSFA 4NO3B 2C3VA 3Q6FB 1EDQA 4HCRL 1RZFL 4D8PA 5JA9A 4Z7VA 5IVNA 2ENSA 3TBSB 5D72H 4ZNEE 2ZOLA 4QO1A 5DYOA 4KTEL 5HHMD 1A7OH 3F7PC 4D0CB 5FUCE 1Z3GL 4M7ZC 3OKKA 4JR9H 3P0YL 1UT9A 3DUUB 4U4BA 2DLFL 5FB8A 4HUMB 1M6OA 1MRFH 2FJFB 1KN4L 1AFVH 1WIUA 1FFPA 3C8KA 1BZ9A 3ZKSD 4ZAKD 3NGBC 5F9DC 4MWFA 2ZSVB 4JFXB 3MO1B 1WLHA 2VQTA 4UNUA 2ICEA 1DVFD 3PP4H 4HUXB 3P4OB 1J05A 5I71B 4TNVK 3T0EE 1MFAL 2HTKD 4N0YH 1UVQA 3LSOB 1IGTB 3K2MC 1IC7H 2E7LA 7CGTA 4YBQD 1K5NA 1ZS8A 5ID0B 1X44A 3EDKA 4RIRB 3QWRD 1Z5LB 5TDOB 3QDGE 4HUWA 5F97E 4HX1B 1PYWA 1WAAE 2JELL 2NY7H 3NFPA 1CFQB 1IC5L 2NTSP 3RDTA 4YAQA 2XXCB 5DJCA 1U8JA 5IVZA 1K4DB 4ZTOL 2QSCH 1J10A 5E7BA 5D96B 1L0QA 3JWDC 1X4YA 5GGTH 1S8DA 4N8VG 3BHBA 2OS7A 4HJGB 2DI7A 4YHMH 5IVXE 4LPYA 3PP3K 4WIQA 3WFBL 3CSYA 3V0VA 4TVPL 1ACZA 1U9KA 5ISZD 3VXOB 3V5DB 1QPPA 5C09D 4DGYH 4KC3B 2G60H 4TN9A 4JY5L 4YGAB 4MAUL 2RFXB 3EJZD 3QXAA 3HFMH 1SYSB 3MODL 1YEFH 3E6FA 2XRAH 4MDJB 4AM0B 3P40A 4RQQB 1F3DJ 4HK0B 3V5KA 1X5KA 3EDFA 2YMXL 4P5MB 3V7MA 1A3LL 1X5ZA 5JA8B 3VJ6B 1RPQA 2O5XL 4RFNC 1QVOB 2W92A 1GL4B 3BXNB 3L5IA 1F4YL 4JM2D 1FIEA 2W9DL 2JJVA 35C8H 4UB0L 4WO4D 3BIBX 4L4TD 1OTSC 4JRXB 4IRZL 8FABA 4N5UA 4FQHB 4DFHA 5J89A 3IDYB 4BSWB 2J88L 4NZTH 1MCDA 5FF6B 2X89D 1TPXB 5J56B 1CS6A 4OV5A 1T5WB 2EXWD 3AVEA 3RTQD 4H1LB 1CQYA 4YGVA 4JPIB 5JR1L 3EHBC 4I0KA 4KMTH 4MS8D 4M03A 5FGBA 3ARFB 3IT8D 5DVOA 5GS3A 3BRGC 1YEEH 4ODSL 1W0WA 2VISA 1TVBA 1EIBA 2ZOKB 3HE7D 4MXVE 4GKSB 2EYTB 1OCWH 1PKOA 1TCRB 1OW0C 5H2BA 3KHOA 3DLQR 2GY5A 4K2UH 3JVGA 3KG5A 5FO8B 2ZCLH 3FO9A 1GRWA 1GCFA 2V5TA 1LEIB 1FVEA 4HH9B 3QUZC 3CFBB 3BN9C 3QDMD 3SDYH 3U4EB 3GMQB 1BF2A 1J5OH 4GKZA 4Y5VC 1W0VA 3CDYA 5FDYA 3UPAA 4F7PB 1I7RA 1T7XA 4JE4B 2D7PA 4MJID 4RSVA 3VFGH 4P3DB 5K9QI 4IHOA 1BIIA 4MDIB 2FECL 5IROC 2IPKA 2F5BH 1AD9B 1A9BB 4DOHB 4OI7A 4MQXC 5JDSA 4OLVH 4XC1L 1HXMA 4QXGL 5DHVA 3QXTA 3C8HA 4S0TD 2BSRB 5HHOA 4YDLC 1NCUA 3HE6A 4OZFA 5TF0A 4PJGE 5C0AD 3P0VH 2ORBL 1AE6H 2G5BB 4HPYH 4YK4B 4NKIL 1DFBL 3BH8A 3IU4L 3OKDA 5JDJA 4PUBH 1FV1A 3HUJE 1LD9A 5GRVL 3VXTA 4HMEA 1IAIL 4JANB 3ZHKA 5LGJB 1SVZA 4OCNC 3MV11 3TC9A 2YA1A 5L2KA 1P7HL 1IGMH 3SGEH 5EZOH 4MVBC 4OUUA 4I9WE 1R5IA 1RZJC 4OV6F 1KJ2L 5C07D 2NTFA 5J11C 2EYSB 4Y19B 2HH0L 5EUKA 3NIGE 2QLVB 1SMAA 4PBVC 2FIKA 4JZJC 2YKLH 3QCUL 2XA3A 4JCMA 3ZTNL 5D7KD 2R0KL 3O6FC 5E2TL 2DD8H 5SWQA 3KYNA 4KHXH 3I9GL 4FP8H 3V6ZB 1G1YA 1Y0LB 3VDCA 2VE6B 4HS3B 2F19L 4PS4H 3BZEB 3NA4A 3TPUA 4PGDB 3K7UA 5CIPB 4AY0A 4RAHA 1NEZA 4K94L 5DJ8B 4QRRE 3UTOA 2C1PB 3L3OB 2R2HA 4I13B 4KRPC 1XGPB 4HEPG 1TJIH 1TITA 3QULA 3UEZA 3SE8H 4JFED 2HFEB 1CT8B 1KCVH 2GITA 4X5WB 3ORJA 3CDCA 4UDTB 3U36A 1CVSC 4HSQA 3VD5A 1OD9A 4TSAH 2BOCA 1WFOA 4NKDA 1KCUL 5SV3A 1Q38A 4HWZB 3O3DB 2MQ0A 2UWEA 4QHUB 3VFWA 2YPLA 1FL5A 3LDBB 4JJ5B 4D9LL 4WTWA 2XTJD 2BNRE 2WBJC 1SYVB 3PF2A 3PQYD 4PJAF 4Q9CA 1NCDL 2EXYC 3GI9H 1EFXD 3Q3GB 3G6JE 1A9EB 3QQ3A 4I3RH 3L1OH 5FHBL 4UQ3B 2Q7NA 1KENL 3U0WL 1GZQA 2EDTA 2AGJL 1IQWH 7FABH 3TBVA 5BO1L 2XZCL 1TZGH 4NSKB 4UT9L 4LVOB 4KXZH 1DUZA 1OSZB 1GOFA 4DEPC 1KTRL 4LLYB 1EXUB 4V1DA 1QKZL 2ADFH 3KPOA 1FYTE 4JPWL 2YUWA 3MLTA 3GIVA 2YXMA 4OLUL 4WWID 2Z91A 4ZUTA 4G5ZL 4LLMB 5BZDA 1BVKA 4ELMF 1UWGL 4PJFE 1NGZB 4L4JA 4GXVH 4M3KB 1NDGA 2B0SH 2NR6D 3D9AH 5E8EB 2C9AA 5HHQA 5D7SH 4FQPA 4EQ2A 1S5HB 3ARPA 2N7BA 2V9RA 3LIZH 2IH1A 3O3EA 4K9EH 4RMWA 5AUMA 1SVCP 2DKSA 4IRJA 4ZNEA 1OAXL 4FQLH 2EO1A 3BVNA 5D1XD 3RZCD 5FA3B 4P9ML 5HGDA 1Z9SA 4P3CL 1D5IH 3QFJE 3RWHA 1OQOA 4OCSL 3OKLA 1OGAD 2DL9A 4NKQB 3BGMB 3IGAA 4OIIH 1U2CA 2AJZB 3SGKC 4G6ML 3FFDB 2VLKD 5HYSG 2NY3C 3NIFF 2IMNA 3D3VA 3S37L 2K7QA 3JWOH 4OZGF 1HI6B 2FO4A 4L3ED 3BD4A 1SQ2N 3T0EA 4PJHF 3VD9A 4XVSL 5E08L 4FQIH 5F9AC 2E9WA 3OGCA 4HG4J 3T0XA 1HH6A 4ZDHA 1J86A 4HQQH 2CQVA 2WIIB 4K8RL 2W91A 3QJFA 3QDGA 4LAJH 1WAAA 4QRPB 3TFKC 1IGFH 5GISL 3LH2L 4Z7WF 2YR3A 1MQ8A 1DLFH 4NWUL 3UCRA 5HI4C 3W2DH 2ADGB 4P48A 4P4KB 1HNFA 1A14H 4LSTH 3LQZA 2ZKHH 4PJ9D 2FJGA 5DK2B 3CFCL 3WV0A 4Y4HD 4QT5B 5I75C 4J3UA 2R0WL 2V5RA 4PJ8D 1GPOL 3T08A 4P23B 2WV3A 4JN2A 4TULL 3KYKH 5I8CA 3R8BB 1NAML 4QF1B 5IVXA 1CDCA 3RWEA 3ISWA 5F1IB 1A6WH 3DPBA 3BPOC 3EYFA 2N7AA 3KDMB 3SCMC 1QRKA 5ITFB 1RZKH 4G8GB 1OARL 4MJ2A 4Q9QL 4N8VB 1HILA 5GGVY 1PBYA 4GLRH 3L3IB 5ITBH 1OAUH 5L8JB 1NCAH 4MNQE 4M8QA 5FKAB 1QSFE 1O0VA 1UA6H 2OYPA 3HMWH 5D6DC 3OAYK 2VXSL 1R3IH 4G7VH 4KUCD 1I8LA 3P3YA 1BD2B 3WN5C 5EBWB 1J0ZA 1QSED 1NANH 2DLTA 5FK9B 1JTTA 3BKYL 1TFHA 1VADB 4PGZA 4XWOC 4LPCA 3MLUH 4E5XA 3G5XA 2C3XA 1E4WL 3LKNB 5F7NC 1ND0A 1U8KA 3AC0A 4LCUB 3MRBA 4CMHC 4YFEA 2WLYA 4HBCL 3F65A 3RA7H 5DMKB 3D1MC 3O6MH 1AJ7H 3M17B 2OR9L 1T4KB 4U1KA 1GGCL 1SY6H 1AHWA 1RJLA 4LRIC 3U0TA 1RIHL 4LLWB 4KI5E 3QIBC 3QIWD 4JRYB 5J13B 25C8L 3CX2A 3RY5A 4FMKA 2CKBA 3ZSTA 3O3AB 1HKFA 4KVNL 4R90H 3TA3D 2X1QA 5CEXA 5DJZB 2GUOB 4X9GA 1FIGL 1H8OA 3GSWA 2WWMD 1ULVA 2EYRA 1JGUH 1B0WA 3NH7L 3PG2A 4A2MA 3VXRD 4OBRA 3OF6A 1BBJB 3HHRB 4KWUA 3QHFL 3MREB 2C1OA 1CU4L 3ARBA 1FNSL 1INQB 2DQJL 1NGYA 1U58B 1Q0XL 1T89A 1G9MH 5D7IE 1CFVH 4PPTA 4CW1B 3SQBA 1JF5A 2G2RA 3OXRB 4HIXH 3R1GL 3NTCH 1EK3A 4AEHL 3DVFA 1HINH 1JWSA 3BZFA 1BEYL 4UOJA 5BS0D 5K9OA 4K3JH 2VQ1B 1WBXA 1DQQA 1T03H 4Z7VF 4Z7UE 3TESA 4C57C 4PJGA 1F11B 2V17L 3U4BH 4AENB 3MCLL 3PWVB 1PG7X 4X6EA 1JZ6A 4KU1A 4N9GA 3LN4B 2F58H 4MD4B 4JRXD 3DO7B 3ZKND 3HUJA 1FZOB 4OBSA 3LQAH 4HWBL 4WNQB 1B9ZA 1SJEB 2Y5EA 1VEMA 3X13A 4ZXBB 2IALA 4XH2A 1UEMA 3O4OB 3TNMA 2PYFB 4ZSOB 3DI2B 3T0BA 1J88A 1F8TL 1V05A 2YXFA 2AJVL 4Z7QF 2F8OA 4GG6E 4XCEB 2EIBA 5IJKA 1CD9B 4KAQH 4CJ0A 3I50L 2R2EB 5E6IB 5CJXA 1G7IB 3C5SB 4CRPA 4BFIB 3FMGL 4HWNA 4UZGA 1A1OB 3IKCA 3KVQA 4R4BB 4WI6A 1CLYL 1TZIB 4WFHE 4OZ4B 5C0CE 4EUPG 2HFFB 3CIQA 2MCPL 3ZYOA 4EVNB 4X9BA 1A2YA 4DUXA 3EYSH 2VXTL 5J3HC 4QRRA 3WKML 4FFWC 1JTOA 1JIBA 5IFJB 3HRPA 1YEIL 2PW2B 2DQFA 1F4WH 3FO0H 4B7IA 2MSPA 3HG1B 3I02A 3L3JA 4Y4FB 1FRGL 1MFEH 1LK3H 3W39A 1FGVL 3KWWB 3P4NB 1DDHB 2YWZA 1MRDL 3G04B 4H8WC 2BVYA 1UACH 2ITCB 5F89A 1N6UA 2F8VA 4Y88A 2BNRA 3V4PL 3D0LB 4U1JA 4HFUH 2B1HH 1BFVL 2F74B 3GKWH 2B5IB 4NO2A 2R1WB 3G6JA 3BP7A 4Y16D 5GZND 1WC7B 1UXWA 2F54E 32C2B 3ULSA 5HI3C 4UNVA 1A6VH 2DYPB 2NXZC 1E6JH 3O8XD 3EKCA 3HAEA 5CP7B 1JPGA 2D03H 1A4JB 1L7TH 3QHTC 2DDQH 3VXUB 4P5TC 4WHCA 1XGYL 1FYTA 3CLEH 3VH8A 2Y72A 2WZPD 3W9EA 3O2VH 2DTSA 5EO1B 5BZWB 1OWWA 3WLBA 5LQBH 2AEWA 1K2DB 2X4TB 5EOCL 1ADQH 4JFHD 3G6DH 4C83A 3QQ4B 2H9GA 1NAMB 3C08H 3GBMH 1UM5H 3FQXA 1JGEB 2UYLA 4PJFA 2YZ1A 3CJJA 1JZ3A 4NNXA 5KTEL 3RVTD 4G80A 4XNXL 5KVGL 4UV7H 3OAZH 3UTQB 3HNTH 3ABZA 5INDA 4TNVF 2XG5A 5CSZB 3U0PB 4LHUG 4QY8A 2ERJB 2AEIT 1CFNB 2X7LA 1BFTA 3V0AC 3S3PA 4TUKL 2ARJQ 2DQGH 3CK0L 5A43C 5HXMA 2VDLH 4NM8H 4ONGH 4RWYL 5FV2A 2V2WA 3QFJA 4WV1C 3VXNB 1KBGL 1H3VA 2J5LC 5ENWA 3RL2B 3VFPB 5TPWH 5GGVL 4RMTA 3T4AA 5JIHA 5T1MB 5IMLB 1KT2A 1YN6A 4TTDC 1RJZB 4ELKB 2Q7YA 1U95B 3U30C 4WI4A 3MQIA 1OHQA 4WI5A 3IDNA 5GGSA 4HKJA 1ZLWK 3BQUB 4L29B 2X4NB 2SEBB 1BLNA 1T7WA 5CBEB 5IHUH 5I0DA 1KLGA 3HE6C 3BT2L 1VB9A 4XNYH 3FB5B 3B3IA 5HYSB 2IQ9L 4WENB 4WHDA 2NY5H 3FQWA 1BZ7B 1XF1A 2Y7QA 3ZE0F 5IKCB 3SGDH 4PP2A 5I8EA 2I26N 1RQ5A 1D5ZB 3NABL 1HCVA 4FFZH 1F6FB 3VI4F 4PRDA 4HDIA 1JYVA 4MA8H 3L5WB 2LU7A 2VLJB 1F58H 2Y36L 3KPQA 4IRSB 2D31A 3FFCD 4CNIB 2QKIA 3RY6C 3RL1A 2MMXA 4F7CA 4HC1H 4RMRA 3VI3E 5EU3A 3MFFA 1FN4A 3U9PH 4E9LA 4MNQA 4LDOB 1QSFA 2OJEA 1XIWB 3OR7A 4U7SA 5IB4B 4KK6D 5CSBA 3FT2B 1C16A 3T2NL 4X6FA 4XMPH 5FYKD 3THML 4Z8FL 2FGWL 4YFLI 1TETL 4U6YA 4RFOH 4HZLA 2Y5TB 4FOMA 3GBLA 1IKFH 2X10A 4Y5XA 3V9FA 1AY1H 1IC1A 5EZIL 4NJAH 2QTEA 4JFOA 5JXAH 2VWEE 4N8CH 5TE6L 1XF4B 4U49A 2VLRE 3G5VB 2VR5A 1NCTA 4NRZB 2DLEA 3TO4B 4J2XA 4IEFB 3GMNB 3HNVH 1DSFL 3NACH 4BH7B 3DJ9A 4MD0A 3WS6A 3IVKB 1T0PB 3DUHA 1P1ZB 4KKLC 2BDNH 3STZB 3VXSE 3SJVD 2UWEF 3CFKA 4G8EB 2GHWB 1Q9WB 4QRPD 5GRUL 4O2FA 2YEZA 1M05A 3O9WB 2HRPL 5D8JH 1IGCH 1VFOA 4EI6B 5I1AA 3RUGE 3SKOA 3UZEA 3O3BB 3IDJA 3K8MA 3O41A 4NQSB 2M26A 1X5FA 4O2CB 4BJLA 4C58B 3HI5H 3QG6A 2ZCKL 2VC2L 3IJSA 3TVMD 1JZ2A 1WEJL 4JPKH 2MQCA 3SDDB 3V0WH 4F37K 2EDKA 2EE6A 4DZBA 2ESVE 1NDMB 5TDPB 3D25B 1MAKA 4S1DC 1Z6JT 3CFDB 5ESAB 1EJOH 4G8GD 3WNMA 1SHMA 1MLCB 2ZG3A 1P5VA 1VGEH 5E9DE 3ILQD 1ZHBB 4X8XA 2A77H 2DICA 3OKMA 5D7IA 1AO7E 5L8LB 4GRLC 4Z7OE 43CAB 1KXVC 4IOIA 4QNPF 1YDPA 3QG7H 3GUTB 3C60C 1MCPH 3IFNH 4YIQA 4NNYB 5BRZE 2ZJSH 2VDKL 4HAFA 4QOKE 1F45A 3WXVH 5CWSB 1FJ1B 1MPAH 4G6AD 5ACLA 15C8H 2I9LB 4ZUVA 4Z7UA 4YO0A 1IL1A 5FUCC 4P2RE 2H1PL 4OFKA 1LNUA 3CUPA 3Q2CA 2O5ZH 3IS1X 5DZLA 3E6HB 2EH8H 1ORSA 5B22A 5I66A 5L6YH 3UTTB 2EC8A 2YD1A 4U1GB 3KPSB 1DANT 3TCLA 5L88H 4PJAB 1C08A 3LD8C 4O4YL 4Z0XA 5C0IB 1FZJB 3GHBH 4PJ7B 4XMLL 4OFVA 4R7NA 5E8PB 4NN7C 1HHKA 1JNHA 5F72S 1I7UA 2OBGA 4JO3L 4ZD3L 3WDJA 4GG6A 1DQLH 4B53A 1IJ9A 3GMPA 2CIIB 4YE4H 5DRWA 3EW3B 4AQOA 4OLWH 4I18A 1MY7A 1ZHNB 5TGBA 4CU6A 2X70A 5DQJA 4RNRA 5K9QG 3N85H 3HCVB 4FTVB 1WAAF 3NCYS 2P7TB 5TE4H 4P46D 5C0CA 1FO0A 1G7PB 4HIEB 2Q6WA 2BY1A 5C0DB 3HPJB 5DVMA 4G6JH 4ELMB 4M6OH 4F57H 3KYMB 1NBVH 2XZZA 5IBUG 4HWEL 2VZUA 1KCRL 1J1XH 2HFTA 3CZFA 4JZNB 3O0RL 1R24A 1UGNA 4WFGD 5JLZB 5FOBB 1AKJD 5DQ9A 3F58H 2ED9A 3MV8B 4GAYA 4NHUA 5JHLL 5IVXF 3V4UH 2EDDA 4H25B 4EUPB 3QZWA 1LHZA 4GRWE 5DMYA 1V3LA 3VFNA 1FBIL 2X9YA 1KFAL 1LO2H 5ANME 1INEL 4YHNA 4W6WB 1IAIM 3P4MA 5FO7B 3ROOB 4OSUL 3INUL 4PB0L 5CMAA 5I1CL 3NZHL 1NKRA 1PKQE 5IBLD 5AD0A 3HC4L 4ZFGL 4HKBA 3FJTA 5E2WL 2BOBB 3V7AE 4O9HL 3IKKA 1QYGH 4YBLC 4PGEA 2DQTH 5FHAL 2AV7B 4B50A 1D6VL 4OZFG 1KTDB 3G5YB 1JN6B 4JFZL 5FUOL 4D9QD 4OD2A 4BQCA 1I1AB 2APWA 4NRYA 5DQDH 4MA7H 4LSVH 4OZGB 4DN4L 4ZXBD 3C6LB 1T20B 4AEIH 4PJHB 2F54A 3VFSB 1JHLH 1P2CA 1A7RL 3QUXC 2XY1A 2NW3B 1HYSC 5DUBB 4M61B 1NFIA 5CGMA 1UXSA 3HI6H 5IOPB 4PLJC 4ZOAA 1KPRB 2AK4B 4Z7WB 3DVNA 4G7YH 1RZ8A 2VXQL 4Z5RA 1HHIA 5AAWA 1QO3A 1F90L 1ZKAA 3RIFK 2EC9U 3E1F1 2V2TA 5C0GB 4LSRH 1DBJH 3TT3L 3LPWA 4XCYA 2QADB 2GTZA 2AW2A 4JFPA 4LIQE 3F62A 1O5DT 1T1WA 5I73B 3GSRB 4F7TB 1XH3B 3GRWL 1MF2H 4AEEA 2X4RB 5IB2B 3RI5F 5FAAA 4MXVF 3VGAC 2HT4C 3GSQA 1IM9B 4PLKC 1MHHA 2HJLB 5IEHA 2RCSH 3HG1D 4ZUWA 1MQKL 2BC4A 4GBXD 5C6PB 3UTSB 3WYRA 2NY1D 4MCZA 2EDYA 4FNLL 5IQ7H 2GY7B 2CUHA 4ESKA 3MNZA 3HMXA 2OM5A 3NN8A 2G75B 4LHUB 5GSVA 5HGBA 2ZUUA 4JAMA 1T1ZB 5JIKA 3BEWA 4WW1A 3OR6B 5T5FH 4R96A 3NCJH 3RFZC 1B2WL 3DETC 1ZT7A 3V2AR 2DWDB 3OAUL 1U8PA 2PXYA 3OKEA 5J1SC 1ZXQA 1CGWA 4NQXA 3RGVC 3MLXH 3UJJH 5EB9A 3B5GA 4OLZL 1P4BL 2HLFD 2M1KA 3ARDD 4JO1L 3NCFB 4D0BB 5HYJB 3RNKA 1W72H 5BV7H 4NO0B 5ETUB 4XZUB 4PJGF 4JRWA 1U3JA 1CLZH 1RY7B 3WIFA 5ABDE 2FSEA 3T4YA 2DYPD 2VMFA 5GJTH 4JY4B 4OKVA 4XP5L 4UU9B 4H5SA 4NRXB 5HDQL 43C9B 3B9KC 1PY4A 3OJVC 4TUOB 5IIEA 3HUJF 2P4AB 1IAMA 1U8IA 1TQBB 1Q72L 4UIMB 1PJ9A 4Y5YC 3RBGA 3ARRA 4ZNCD 3E8UH 4XBGA 4F8QA 1N5AB 1P6AB 5E1AA 3S4SG 5FIEA 2YD7A 5J4MA 5KSUB 4YLQT 1RU9L 4A6YA 2QQLH 1AD0A 5C0BD 1JHKL 3PGCA 3SKMA 4TUJA 3NIGF 4JG0L 5H37H 1N3NA 2B1AL 3CH1B 1S9WA 3MRFA 2NYYD 3MOQA 1G6RB 1T2QL 5TF1H 4JO2H 3HPLA 1QFHA 3MBEA 1EBPA 2A0LC 5EOCJ 3DURB 4KROB 3LEXA 1KG0B 4TQEH 5I30L 3DUSB 4RA0C 4G9DA 1I1CA 4K9EC 3GBNH 4OCYL 1CD1B 3SE3C 4MLIA 4X7TB 4CU8A 1JF1B 5CAYB 1HQ4B 4APQB 3GHEL 5IW1B 4LPWA 4JB9H 2MOVA 5LXGL 5IG7A 1CFBA 2BY0A 1IC4L 3MRIB 2BSTA 5AYUH 2VLRA 1Q1JH 4Z7VB 3BQUD 3TYFA 3ZKXB 3PWPD 2CK0L 1L0XA 3D69A 4DN3L 3MXWL 3X11A 4HXBL 5AEAA 4P59H 5F88A 1X9QA 1A3QA 3PL6B 2XACC 3WFDL 1XR8A 3OKKB 2KH2B 4EQ3A 3ARQA 4GW1A 3VXSA 5GRJL 2E6JA 4KKCD 4IMKC 5JTWA 1MCWW 1L9MA 1URLA 1BZ9B 1U8LB 4UT7L 5A2LH 1G84A 5KVEH 4FQJL 1JVKA 2VQUA 5EU5B 3RUGA 1FE8H 2E9BA 2HKFH 1J05B 1CZ8H 1J1OL 1TLKA 4ZS7H 3SDCA 4X80H 3QFDA 3ARTA 4M7LL 1KJ3H 4HGWA 1S7VA 3ULUE 3IJYA 1K5NB 1XZ0A 2XICA 4IRSD 1ZS8B 3KYAA 3HR5A 5DFTA 4RA3A 3MXVH 4HUWB 1ZK9A 2ESVA 1NBYA 1X5YA 1IKNC 3U2SA 3QPQC 2I9TA 3OL2A 1OAYH 2Q20A 3QUMA 3RDTB 4JLRA 4PD4J 5ADOL 5FECB 4X4XA 5DJCB 1U8JB 2P5WE 1B88A 5E9DA 5IVZB 3UPRA 3ZKQD 1P53A 1KYOJ 5J7CC 3NMEA 1AO7A 3N9GL 5IBTH 4NBYB 1RZKC 1DE4B 2BFVH 3BAEH 1XIWD 4PJFF 2NZ9C 1S8DB 3BHBB 5CEZL 4EI5A 1KPUB 1CI5A 4ONHB 5BRZA 5T33L 5KW9L 4MXQC 4QOKA 2CDFB 4YDVA 5I1EH 2ED7A 3CSYB 3V0VB 1EEUA 5EIIA 1BVZA 4PLNC 3MNVB 4P2RA 3T0VA 3B9AA 3RU8L 1FZKA 3MOBL 4MAYA 1MCLA 4MQXD 3UROR 2BERA 2VDRL 2CO6B 5IESH 2DQHH 3MJ7B 5MEQA 1I1FB 1RUPL 3QH3A 3QXAB 1OPGL 1MCWM 1U8QB 4KQ3L 1Y6MR 5E2UL 5DJ6A 1RMFH 3G6AA 4QCIA 3M1BB 4K55A 4DZ8A 3REWA 2G5RA 3JTTB 3ARVA 5D2LB 3NPSC 1T1YA 3O9WD 3D39D 1HN1A 2B4CL 2A83A 4TNWK 5HI5D 1ZLSH 3PHQA 3T65A 5GRZA 1NLDL 2IG2L 3IS0X 5F1KC 1V7NH 5ACZA 5IWLC 4LSSH 1U3ZA 2YPVH 4YHIB 3AB0C 3U1SL 1N26A 4YHOH 5BMFH 1ZEAL 3P77A 1IAKA 1VKXA 4GOSA 2VZ3A 3O6LL 3KR3H 2ZUYA 4MMZC 5CJQL 4HUUB 3WSQL 1ETZA 2A6DA 1U2HA 4OV5B 1LO5A 4DGVH 3OV6A 4YGVB 3RIAK 3ZKMD 1EAJA 3O6FD 5DZOA 1L7IL 4RX4D 4Y19E 4RAUA 3DSNA 3HI1A 5CCKL 3MRCB 5D1ZB 1S7WB 1EJ6A 4YFLF 2VISB 1TVBB 1U8OA 2VAAB 1KIRA 5CZVL 3DGGA 3QI9C 4F15B 3QIUD 1CR9H 4Y89A 2OLDA 2E7HA 4HH8A 4YX2L 5H2BB 5E2JA 1G9MC 4KRPD 1TQCB 4OFDA 4NPYA 5IBUB 4J4PD 5GHWH 1C5BL 2VO5A 5DURB 3FO9B 1PKQA 1T7YA 2DQEL 1CE1L 5E1HB 1FVEB 3REVB 5DLML 2IBZY 1FVDB 5F9JA 2PR4H 1JI2A 2F15A 3ALWA 3IXAA 3W0WD 3F6IA 3NZ8A 3TM6A 3V4VH 1MHEA 3DX8A 3V95A 4ZMAT 1I7RB 3QCVL 4LBEA 4XPHH 4Y5XC 4D94A 2FX7L 1DJSA 1BIIB 5AG8A 5I1KH 2VSCA 4J3XA 5DFVC 3GKZA 3FRUB 4EN3C 2BVTA 3VWKA 5GGSY 3LQAC 3U7YL 5JDSB 4GMTL 1MJJB 2YUXA 5HHPA 1HXMB 2BMKA 2AJYL 5L2JB 5ESVA 2E7CA 3QNXA 1OP5K 2IFFH 3BH8B 1QLFA 5IF0B 4M6NH 4LVNC 5IHZA 1MCRA 1FV1B 3ARYA 4KDTA 4S1QH 1LD9B 1IEBA 4YHZL 4JQXC 4KI5F 3MLPA 4X8JA 2VDQL 3H42H 2OMNA 1CBVL 3VMNA 1FHGA 2WWKT 4U2ZA 1LE9B 3KYOA 3S34H 4PREB 1NMAH 4MJ5A 3AY4C 2XQBH 4MD5A 4OUUB 2R23A 3WXWL 2JJSA 2CXGA 5F7YC 2CKBL 5CJOL 4JKWA 4UNTA 4WDIB 2FX8L 2IAMB 2NTFB 4X7SL 4OFYD 3W9DB 4PRNA 4DW2L 1ITBB 1H15A 4J3TA 2FIKB 1RIVH 2XV6B 5F96L 4IOFD 1EVTC 2WANA 4XNUL 4MX7A 2D4DA 5SWQB 4C56E 1R0AH 5GS0L 2OP4L 3HRZA 5K59E 2PYEE 1CN4A 3WIIH 4CUCA 5SX5K 3EO1B 4WWKC 3SO3C 3QRGH 3EOTL 5DJDB 1VESA 4TVPE 2AERT 5D7IF 5FYJU 4LDEB 2OK0H 4NO3A 1T7VA 5FV1L 5J9PB 4OZHB 5IR1B 4DK6A 2XZAL 3QULB 4GQ9L 4HCRH 1UC6A 5D2NC 5DDHA 2X4SA 5BOZG 1IZJA 1ZANH 3KHQA 4G8FA 4XCFL 2V9TA 5ALBL 2GITB 3C6LD 2NY3D 2OSLA 1A7NL 4PJEE 4Z7UF 3U36B 3CZJA 4N1HB 2HVKA 4H20H 5E5UB 1MIEL 2WP3O 3TNNB 1GHFH 1KN4H 2UWEB 2ZSVA 2YPLB 4JFXA 4WW2C 1FL5B 4E0RA 3QJHB 5ICYA 1YNTB 4ZFOB 3HAEG 4M8VA 2CJUL 2KBGA 4TOYL 3TFKD 2W65A 3LSOA 1IGTA 1UZ8B 3SO5A 1FCCA 1W8NA 3VH8G 5ID0A 4GG6F 2M2DA 1GZQB 1Z5LA 3UC0L 4HX1A 5JW3L 3MLVH 3WD5H 5FYJL 1NC2D 1DUZB 1XGTA 4M43L 3S4SB 1K4DA 5HHXL 1A6UL 1IC5H 3C09C 4V1DB 5KSAC 1DZBA 3UPCA 3KPOB 1N4XL 4IIQC 4G8IA 3GB7B 2KQNA 3GIVB 5EOQL 1I85C 4ZTOH 4XNMB 2Q87A 5GGRA 3SCMD 3ARGC 1M7DB 3UAJD 3VFRA 3SE4C 1BVKB 5C0RL 1AQKH 3MRMB 1A7QL 1A7PH 1MH5A 3TZVD 3PGDB 3B2VH 3RWIB 4LKXA 3WJLC 1NDGB 1KPVA 1OM3L 2FRGP 3V5DA 5HHQB 1HIML 2D4FA 2FX9H 5EULV 1JYXA 2CR6A 1KF9B 2IH1B 3FO1A 3O3EB 3PWNB 5AUMB 2QQNL 4TPRL 4IRJB 4Y4KA 4RGMB 1CGYA 1KOAA 4MAUH 4MDJA 4F37F 4AM0A 1U42A 4HK0A 4MJ6A 3RWHB 1WSST 5E94B 5JMOC 4L9LA 1BD2E 3MODH 3TO2B 4P5MA 3SQOL 5HHVH 5FYKH 3G08A 2YMXH 3BD3A 3BXNA 1A3LH 3D3VB 2NY5C 4HJJL 2FO4B 1F4YH 4NQCB 2W9DH 4UAOC 4UB0H 1D6EB 4ZAKC 4FQHA 3S6CA 2P47B 4U31A 4W6XB 1NGXA 4BSWA 5CHNA 3BGFB 1HH6B 4PJBE 1T66C 1HHHB 4EJ1C 5FF6A 3IDMA 2A9NL 2WNGA 1T5WA 3QJFB 3LKPA 4H1LA 3S37X 4JRYE 4NUGL 5CUSL 4LLAA 3U7WH 4JPIA 1Q9KB 4AIOA 3LEVL 2FR4A 3ARFA 4YBQC 2P5WA 1QHPA 3LQZB 5JR1H 4QHNA 1R3LB 1LEKA 3JTSB 3TV3L 4KROD 4MB5A 4AL8L 4X6DB 3GM0A 5EC1A 4GKSA 2EYTA 4ODSH 2FB4H 1TCRA 1XCQB 4PJ5B 1I8IA 5I8CB 4E41E 4XBPB 3RWEB 1MOEA 1GGUA 5FO8A 1YQ2A 4LQ1A 1C5DA 1LEIA 4HH9A 3NBNA 3CFBA 3U4EA 5D93B 4FQXA 2Z35A 3KJ4C 3BN3B 5HPMB 1HILB 3BMVA 4M9OA 4F7PA 3BWAA 4P3DA 1RZJL 1KUMA 4WI3A 5LVEA 3FHQA 5EZLB 2O93L 1A9BA 2KZWA 3EYQC 1FNAA 2PXYC 4UILL 2GIYA 5EN2A 4HXAL 1K8IA 3VG9B 1NCCL 3LMJH 4XC1H 5CP3H 2G5BA 5ICXA 2XQYG 5E5MB 4YDKL 2XKNB 2D7MA 1ND0B 1KXTB 1KC5L 1U8KB 2ORBH 1DFBH 4HIJB 3IU4H 4QXTB 1X7QA 5HYFA 5JXEA 1NGPL 4S2SA 4G9FB 4JM2C 1FL3B 1BVLB 4WO4C 4U1KB 1IAIH 1RJLB 1PQZB 4YWGL 1LEGA 1DBKL 4R8WH 2WUBL 3U0TB 3AUVA 3TN0B 3RVUC 1JNJA 4ZSOE 1GGTA 5C8JA 2NY6B 2UVFA 1CTNA 4F80A 1XF3B 4JPVH 3ARXA 3ZDZE 2CKBB 3RDTD 3VD3A 4Y19A 4RCAA 1KJ2H 4J3WA 4M7ZB 5DA0B 5EORL 2EXWC 3W11C 1UWXK 2HH0H 5F7HA 2PO6B 4YPGA 4JFYB 3A6BH 4YEEA 4MS8C 1NLBL 3QISA 3V6ZA 4MHHI 2P44B 4LCIL 3FL7A 5E24E 1Y0LA 3VI3F 5E2TH 2VE6A 2J8HA 3I9GH 3BZEA 3RHWF 3EZJB 3P2TA 5AZEL 3HE7C 3KLSA 4PGDA 5CIPA 2C1OB 3GNMH 2F19H 3O45B 2C1PA 1L6ZA 1T04B 3L3OA 4K94H 4LDLB 4N90E 4OIBA 3RIFF 2FYYA 3R4DA 1AR1D 4OM0L 2XOTA 1IILE 3MLZH 1MHCA 2G2RB 2YK1L 4BK4A 4YXHL 4DKDC 4X5WA 4UDTA 1VFAA 3AXLA 1LDPL 3QWOA 3BZFB 3BI9X 2WBKA 3QXVA 2B20A 3OKNB 3MX0A 5INCA 5K9OB 2VZTA 1MCOL 5I1IL 2C4XA 4J3VA 2L4OA 4PRPB 1DQQB 4HWZA 1RFDL 1OAKL 4PJGB 4DUWA 1CL7I 4QYOB 1YECH 4QHUA 5EU6E 4X6EB 1KCUH 3PE9A 5D7LE 1MUJB 2HTLD 1SYVA 3HUJB 5DD5H 4FG6D 5LCVH 3BISA 4Y7MA 4NJ9L 1NCDH 2MHAA 2XFXB 4UQ3A 3TNMB 5T1LA 3SBWA 3NA9L 3PNWA 3RUGF 4M6MH 5FHBH 1KENH 1JYNA 4XAKE 2V7NB 2AGJH 2DI8A 2AEPL 2LFGA 4X7FC 5BO1H 1UJTA 2XZCH 4UT9H 4LLYA 2PTTB 4XB7A 3VXUE 5JORA 3IDGB 4BQ8A 2CGRL 4DCQA 1QKZH 4V2BA 3IKCB 4JPWH 4RFNB 4C56A 5MHSE 4JZOB 2PYEA 4LLMA 1ZWIA 1FC2D 4L3CA 5DURD 1C12A 4RBPH 1NGZA 4G5ZH 3BUTA 4ODHL 4QRRB 5ESQB 4L4VB 1UWGH 1BGXL 3DMMA 1S5HA 3QEQB 4Z7OF 2I60L 2A1WH 2DQFB 5CGTA 3I6KA 3BE1L 4FHBD 1RUKL 1T0NB 4M48L 3FO2B 3MUGA 3OB0H 3I02B 3L3JB 2GCYB 1EZVY 2GFBA 5FA3A 4YH6A 1RSFA 3W39B 1OAXH 1P9MA 3BP6A 3EDDA 4ONFL 4PJEA 4RMSA 5ILTL 4MAYC 4G6FD 4P9MH 1JPST 5AAMA 2DQIL 4P3CH 1N6QL 2Q76B 1RK1B 1TTFA 1WZ1L 5HGGS 4OCSH 2AJZA 3LEYH 5HHOD 2DQDH 3HE6D 1F4HA 5F89B 4F9LC 4NGHL 1KTKE 4LLQA 1ROWA 4OCWH 1B0RA 3BIAX 1HI6A 2W9LA 1ZE3C 2FATH 2GSIB 1H3GA 2VZVA 4KVCL 1ZGLM 4NO2B 3FN3A 2QL1A 3C8DA 2XTJC 4XVSH 5DMGD 1UXWB 4WFEE 3QDHA 5L2KD 1YJDL 4Y5VB 2YHGA 3BPCA 3HAEB 5GGUB 5GS1C 1JPGB 2ADGA 5FGRA 5GISH 3LH2H 4P4KA 4NWUH 3PABB 1FYTB 5DK2A 5FCSH 4YUEL 4QT5A 1UENA 4R7DB 5E8NA 2BSSB 4P23A 1KIPB 2P45B 5EWIL 2VLJE 2R0WH 4C83B 1GPOH 2H9GB 1DN0A 2ZCHL 4PJFB 4TULH 3LB6D 1CDBA 4NNXB 4PRIB 4JREB 5E7FA 4G80B 4G6KL 3KDMA 3A6OA 5ITFA 3JWDH 4GRWF 3L3IA 1OARH 1U93A 4Q9QH 5FKAA 1P4IL 3BSZL 3QFJB 3MYJA 1BD2A 5ENWB 1OP3H 3T4AB 3AU1B 1XFPA 3MRRB 2VXSH 1YN6B 4NT6B 4X9HA 5FK9A 1QBAA 5D1XC 2Q7YB 4BELD 3S97C 3RZCC 5BV7C 1G7HA 2BVOB 4EBQL 2YPLD 1BQLL 1MIMH 4LAQL 4ENEC 3WO4C 3IDNB 5SWZE 3BKYH 2OI9C 4KKLD 4NN5C 3LKNA 5EO0A 1FLRH 1P6FA 2ARJA 5CJBA 1BLNB 1LWRA 4N0RA 4QRTA 1KLGB 1BWMA 4P2QB 4QHKJ 5SV4A 4M1GL 1V7MH 3M17A 3WCYA 4PJBA 5T1KA 1T4KA 2LE9A 4HBCH 3CX5J 4ZO8A 3ROLB 4JRYA 2ITDB 2OR9H 3FQWB 1GGCH 3NFNA 2Y7QB 2IQAB 1AI1L 1KACB 1RIHH 1RZ7L 1CE6A 3VG0H 4YPJA 2E7MA 1AIFA 4NZDA 3D2UB 25C8H 4PP2B 5I8EB 4V1DD 4FXGB 5JIIA 2GUOA 2QHRL 2CLRB 4KVNH 4XI5D 3WMSA 4KQ4L 4XP1L 1LO4L 5L0QC 4WHYG 1TTUA 2R4SH 2DJUA 4E41A 3QAZB 4PJ9C 3NH7H 4NFBA 1IGYB 2WBJB 4TNWF 1QR1B 1RZIA 2QKIB 1EO8L 1MRCH 1RVFH 4BQ9A 4PJ8C 5DSCA 3I3EA 3QHFH 5EU3B 5K9JL 4KMLB 1INQA 1CU4H 5AZ2L 2YA2A 2Z8VC 4Q2ZB 2DQJH 5EZJB 1K4CA 4MNQB 2IH3B 5SWSB 1EBAA 4CW1A 2VAJA 3OXRA 4MQ7A 1ONQA 3R06A 4X6FB 3RIAF 3V8OA 1OAZL 3R1GH 4U6YB 4AEHH 4E42A 1RUQL 2VQ1A 4HZLB 4XVTL 2DS4A 1NMCB 3L6FA 1BEYH 4S1RL 2Z9TA 4JFOB 4U1NB 5E99L 1RK0B 3LN4A 1HNGA 2H45A 3MCLH 1YEJL 4MD4A 3T0ED 1FZOA 3BKJL 3QO0A 1UM6L 1UCBL 4P0DA 1QSVA 1SJEA 3UTTE 4GO6B 1C7TA 5I9QC 3KPSE 1D5BA 5DT1L 4HWBH 2FJHA 2PYFA 4ZSOA 4PJ7E 3QDGD 1S7RB 2FNBA 1CGVA 4O2FB 2YEZB 1M05B 4L5FH 1J12A 4YHPA 5I1AB 1QHOA 1F8TH 3SKOB 5C0EB 3T09A 2AJVH 1K6QL 2J3SA 4YDJA 1HXYA 5E6IA 2IGFL 3O41B 2PF6A 1W0YT 1G7IA 3C5SA 3I50H 2FEDD 4FQ2H 1A1OA 1WZKA 3QG6B 3IJSB 1I9JL 3TA3C 4A6YL 3EBAA 4FTVE 3UO1L 3AREB 1MVUA 1TZIA 1UKTA 2NY2B 5DUML 2BNQB 2JK5A 2WWMC 4EVNA 2V5SA 2JB5L 5GZOD 1CLYH 4DZBB 2MPAH 2UZYB 4ELME 1QA9A 1AGDB 2FHCA 1MEXL 2IADB 4LCCC 3WKMH 4LCWB 1UEYA 4IBLT 2DLHA 4KK8D 4WUKL 3MV8E 3OSKA 2X6MA 1BWWA 1YDPB 4Y4FA 4RGOL 4KHTL 4RAVA 3JBG7 2E3VA 3KWWA 2FCBA 1KULA 3P4NA 1U92B 1FGVH 3G04A 1TVHA 4MLSA 4ZUVB 4HPOL 4Z7UB 4YO0B 1IL1B 3VFOA 1MRDH 5EU6A 1C8PA 1OAQL 3GSNA 2ZUQB 5D7LA 4M93C 4EDXA 5JHDB 1X5XA 4HUKB 4LLUA 4NC2B 3V4PH 1XR9B 1EH9A 3U6RB 2R1WA 3VXME 3TCLB 4WU5B 1WC7A 4Z0XB 1ZV5A 2YSSA 5I76A 4FS0A 2R8SL 2NY6D 3O6KL 4X9IA 4R7NB 3ZKNC 1HSBA 2HRLA 2Z8RA 3PUCA 3IDYC 2CR3A 1WTGT 3GMPB 2YN5A 3MRDA 1A4JA 2X2YA 1TPXC 3VXUA 2AK4E 3A67L 3RNQB 4I18B 3ULUF 1P5UA 4CBPA 4O58L 4RNRB 2Y6SD 1XGYH 5DO2D 5EO1A 3I84A 4CN4A 1DEEA 1K2DA 3ARFC 2I5YL 3OF6D 4YQXL 3QQ4A 4PBXA 4GAJH 1NAMA 3UX9B 5C0CB 5DA4A 2CIKA 1HYRC 3ARBD 1QR4A 3UTQA 4HMDA 1WT5A 4WFFE 3QUML 3VGFA 5GGRY 2P24A 1IBGL 4KJWD 4XNXH 3U0PA 5KVGH 3OXSA 4JGJA 4POUB 1HQRB 5JW5B 5KJRL 3EYUL 4R2GB 1CFNA 1DLHB 5E8DL 2X1OA 2ICES 1DQDL 1YYML 4LRNH 4S1SL 4XPBH 4NHUB 5TQ0H 1TTGA 4X0KB 2FLBT 5EIVA 3UTSE 2X4UA 3VFNB 1YEKL 3VXNA 1G0DA 4EUPH 3VFPA 3RL2A 4YHNB 5C9JA 1CDGA 1MAMH 4RWYH 3P4MB 5T1MA 5IMLA 3CVHH 3RTQA 1KBGH 2EDXA 2YD5A 4ELKA 5GGVH 5AD0B 2AJXH 2VDMH 2Y06H 5C86A 4L29A 2R0ZL 2F5AH 2SEBA 5IEKA 1UM4H 3MJGX 2X1WL 3JZ7A 3IDIB 5DI8A 3C5ZA 4QTIH 1DUYB 4OB5H 4YK4C 4UOW0 2F54B 3V52L 5HVHB 4XWGH 3BT2H 1CXEA 2IPUK 5HYJE 1P2CB 5HYSA 1MI5B 4OT1L 1MFDL 4I9WD 1BZ7A 4YEFA 5EUOE 5JPMB 3IF1A 5CZXD 2IQ9H 5IKCA 4YJZL 5CBAA 2MKWA 4F58H 5GZNC 4XP4L 5H8DA 3T2QA 5HYQA 3IETA 3S3SA 4BZ2H 4LSDA 2R56L 1J7VR 2FEEI 2R0LL 4LSQL 4AG4L 1A7OL 1EEZB 3GI8H 4GW5B 4W4OA 3O8XC 4F7MB 3L5WA 2VLJA 3MUZ1 5FM4A 3RX5A 1G9NL 2F9BT 5JW4R 4JQIL 2V2TB 5IJVA 4XCYB 2HJFB 2C3HA 2GTZB 5MEPB 3HC3H 1M7IA 4CNIA 2Y36H 3VGDA 4QRQB 4QRRD 3V6FA 2YRZA 3QUYA 4NYLA 3PP4L 5FDWB 4IMLB 4BQBA 1N0XH 3CXDL 3GMOB 1U3HA 5IEHB 3TEUA 4XGZB 1KNOA 1IC7L 4DKFH 3EO9L 3MRGB 4BYHA 5IB4A 1HZHL 1DN2A 5CJ8A 4AQ1B 1RJYB 2DJ4A 3FT2A 4WEBH 2X9XA 4DVBA 1H3WM 3T2NH 1W2KT 4JAMB 3THMH 4WW1B 4Z8FH 1TETH 4PG2C 2QSCL 2BNRD 5SWZA 3IU3B 1U8PB 3OKEB 4UQ2A 3TO4A 4I2XB 2MTPA 2ZUVA 5TE6H 4NQXB 3MJ8A 4HLZH 4YHML 3BD5A 3LDBC 3FN0L 4FMFA 4JKMA 5LBSL 1MFNA 4JEGB 3X17A 5I19L 3V6OC 3H9YA 3EOYG 3STZA 1Q0YH 1DSFH 1WQVT 1Q9WA 4DGYL 4S10A 4D9RE 5JPNA 4OKVB 4EI6A 3VRJB 1OL0A 5GRUH 3GIZL 3O3BA 1T7ZA 2EIDA 5EC2B 1FYTD 4NNPL 5F8QC 3HFML 4WEMB 1PY9A 2DBLH 1YEFL 2IFGA 4XBGB 1U91A 1BOYA 4LVOC 5E1AB 1FNGA 4NIKB 2C4FU 4A6YB 1LVEA 3SDDA 3PGCB 4YXKL 2VC2H 1UWEL 2UZXB 5DC0A 3QXUA 2LU4A 4ODXA 4HKXB 1JF6A 4AT6A 5TDPA 3MRFB 5FM5M 3QXWA 1MLCA 4RISL 5JZ7D 5KAQG 2PTVA 3HPLB 3MBEB 3MUJA 4QRSB 5K59F 4JHZA 2C4FT 3LEXB 4NZTL 4XHJD 4O02L 2FBOJ 4RMQA 3QFJD 4Y1AE 4P2OA 4NNYA 3IFOB 1JWUA 2MWCA 3TCXA 5CWSA 3BEVB 4P5TB 5L7XH 2I9LA 2VDKH 4LNRB 3FTGB 4OFPA 2OCFD 2ATKB 5IG7B 4KK6C 1JCKA 1YEEL 2BSTB 1KCLA 5DMIL 2VLRB 1CDJA 3TYFB 2GJZA 2H1PH 2HG5B 3UJIL 2QJDA 4PJEF 3DX6A 3D69B 3E6HA 4PD4K 3UTTA 3NOIA 1UKQA 3KPSA 5CILL 4L3AA 2Y07L 5C0IA 3DO3A 2ZCLL 1FZJA 4F9PA 1N59B 3KPNA 4PJ7A 4FXLA 3C9NB 2EE3A 2D0HA 5D2LE 4NQDE 2YBRB 3HZKB 1D5MB 1BJ1J 2H41A 4XMLH 4EZMA 4F8TA 3U48A 3RUGB 2CIIA 2D7TL 4JO3H 4P2CG 4ZD3H 3KGRA 1ZTXH 1J8HE 1QOKA 1ZHNA 3VFGL 4BKLA 3QFDB 2J8UE 3T2PA 3VMOA 2VKWA 4P4KC 4HGWB 3GK8L 1S7VB 1UJ3C 4FTVA 2VDPL 1JUFA 3RRQA 1G7PA 3ZL4L 2ESVB 3QI9D 2CLZB 5C0DA 3P0VL 4CN6A 2I9TB 1T2XA 4K3EL 4ELMA 3TVMC 1FORL 2GAZA 4PUBL 4JZNA 3VWJB 1WFNA 1AO7B 1S9YB 1LK2A 2Q86B 1KCRH 3MV8A 1E4KA 1QSFD 1WWCA 3O0RH 5T3ZE 2X1XR 4EI5B 5IVOA 1IGML 2D0FA 3ILQC 1Q8MA 5FO7A 3Q48A 1FBIH 1T83A 3VGHA 5C2BL 5EIIB 5DVLA 4OSUH 3INUH 3NZHH 2BOBA 4JQVA 3CCHA 3SOBL 1U8MB 1FZKB 1Z0NA 5DFVD 3HC4H 4ZFGH 1NSNH 2K1MA 1KTLB 2AV7A 5E2WH 4G6AC 3PDOA 3SDAB 3ZYIA 4QRUA 2DD8L 1I1AA 5DEZA 4KHXL 5FHAH 3ULVE 3QH3B 4OIAA 3VXMA 2ZZUT 5FUOH 1EO7A 2BVEA 4JFZH 4MHHG 4D0DB 1GGIL 3G6AB 4QCIB 1BZQK 3VFSA 3REWB 4DN4H 4KI5D 4URTB 1M71B 4PTTB 5DUBA 4LGPB 3FFCE 4M61A 1T1YB 2EDJA 4Q58C 1A7RH 1GC1L 2GJ6B 5IOPA 4FZ8H 1H3UA 1T21B 3T65B 5IHLB 3WJJC 4PJDB 1CG9B 2AK4A 1XF2B 5ACZB 1GGYA 3SE8L 4ORGB 5E8OA 1MLBA 5J13C 4X7DC 3MV7B 3KNBA 4PJBF 2PETA 4YHYB 4MA1C 2VXQH 2LAAA 2UUDK 3LHPH 3ULUL 1IAKB 5C0GA 4NHCL 4XMKH 3IYLW 2XN9E 1F90H 4L8BB 2NY2D 3JV0A 4TSAL 2A6DB 4J8RB 3TT3H 4HZAA 4Q0XL 4ALAL 4H26B 1A47A 3GSRA 1BFOB 2X4RA 2EO9A 5B8CA 3LS4L 5IB2A 2H32A 3GSUB 1E6OH 2IWGA 1IM9A 4KGJA 1U8OB 2HJLA 3GI9L 3DECA 4K94C 1FH5L 4PGBA 3DYPA 4GRWB 3UTSA 3U7AA 1XGUA 1MQKH 3B2UD 2G75A 4FNLH 5HDLA 1PKQB 5DJAA 2EKJA 4FA8A 4F2MA 3OR6A 5F9JB 2ADFL 3IXAB 4HLJA 4YFDB 3NZ8B 2NXYD 2DWDA 4OZHE 4RGNE 3S9DB 3GDBA 4KJPD 3TJHC 2AABL 3DX8B 1B2WH 5SX4H 4POZC 1S7XA 5IBLC 1I9IL 2AXJA 3OAUH 3B4NA 5F8RC 2QSTA 3CSPA 4M02A 5HYJA 1UG9A 1P4BH 2WQRA 3VWKB 3EGSA 4NO0A 5ETUA 5E70A 1B0GB 3MFGB 3FAWA 2B0SL 4HWUA 4IJ3C 4JO1H 5HHPB 5EUOA 3H0TA 2BMKB 3PP3H 3VGBA 2QSQA 4NRXA 1HCFX 5DHVH 4P49A 4QTHA 4ZXBC 5ESVB 3LIZL 5CLWA 1VACA 4K9EL 4LGSB 5KOMC 3T3ME 1G9EA 4MCYB 4OZFH 3C60B 4XP5H 1QLFB 3FQNB 2FO1A 3P30L 1IEBB 1N5AA 4LARL 1Q72H 4PIRF 1K3ZA 5F3HB 2Q1EA 4OIIL 4WFHD 4X4ZA 3WBDA 3IAPA 1BAFH 4P2YA 3ZDZF 3PGFL 4CADB 5C0CD 3KYOB 5DF0A 2YS4A 1RU9H 2R23B 1P7KA 3H9SB 1JHKH 1KXQE 3JWOL 1LO3L 4Z18A 3ARGD 1G6RA 3QDJB 4HT1L 4LNVA 2B1AH 3EIFA 1IFHL 1H15B 1FNEB 1YZZA 3UTPE 2OTWA 1JP5A 3BZ4B 4WHTA 1T2QH 5GPRA 1KG0A 4NN7B 3SPVB 3DUSA 1G6VK 1G7JB 4HQQL 4MX7B 2Z8WC 3LKRA 4LEXL 3VW3H 1CD1A 5CEZE 2CD0A 5I30H 1CL7L 1JF1A 1F00I 1HQ4A 1DLFL 4APQA 5BXFA 4GMSH 4OLXL 4GBXC 4LSTL 1GOHA 2ZKHL 3H3BC 3KPRB 4ZQKA 3GHEH 3MRIA 1KLUA 2WUCL 4XT1C 1IC4H 5ID1A 5DDHB 1INDH 2X4SB 5J12C 3MRPA 3P9MB 4G8FB 4PTUA 4OFIA 1CCZA 5DJ2B 2CK0H 2OSLB 2F54D 3PL6A 4DN3H 1A6WL 3W82A 3GSVA 2W0KA 3GSOA 2LQRA 4UINH 3WFDH 2HVKB 1ZOXA 2B5IC 2I25N 1U8LA 5GRJH 2HLFC 3ARDC 5MI0B 3AM8A 5EU5A 4DAGL 3R0MA 4YHLL 4E0RB 5C71A 3DX7A 3L7FA 3D3VE 2AAVA 4UT7H 1T66D 5ITBL 1BJMA 5ICYB 4ERSL 1NGQL 1AC0A 1UA6L 4NQCE 1IEHA 1E4XI 2VLLB 4AIZB 4G7VL 1H5BB 2W65B 4C54A 5I17A 4NWTL 5KVDL 3DTXB 5KSBE 1FAKT 5BW7C 4YBLB 2AV1A 2CO7B 4N1EA 3BO8B 4D2NA 2MJWA 3OX8A 3MLUL 1XGTB 5E6YA 1VPOL 4I0PB 5FECA 4KV5E 3B9VA 4JFQA 5ECJE 4JVPA 3ARZA 3S35L 1PX3A 1RI8A 4G8IB 3BW9A 1QG3A 1DE4A 4X6DE 4KK9C 1SY6L 3N9GH 2NYYC 4CGTA 1R3JA 5GGRB 4PJ5E 5EFIA 1KPUA 4Y1AA 1HKLL 4ONHA 3VFRB 1BQHA 2CDFA 4JVUA 4H0GA 1MH5B 5T33H 3UYOD 4LKXB 2R9HD 3ZE1E 2OR8A 3CPLB 1KPVB 3MNVA 3UDWC 2OR7A 3FO1B 3EYQD 2PXYD 3RU8H 5F9OL 3MOBH 5BQ7B 3MJ7A 1QUNA 4Y4KB 1PAMA 1QACA 1I1FA 1EX0A 3WDIA 1U8QA 1JPFB 4HJ0D 3M1BA