4H8WL

Crystal structure of non-neutralizing and adcc-potent antibody n5-i5 in complex with hiv-1 clade a/e gp120 and scd4.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
212
Chain Sequence
SALTQPASVSGSPGQSITISCTGTSSDVGSYNFVSWYQQHPGKAPKLMIYEVSERPSGISNRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGSTTFRVFGGGTKLTVRGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords HIV-1 CLADE A/E 93TH057 (H375S) GP120
publication title Structural Definition of an Antibody-Dependent Cellular Cytotoxicity Response Implicated in Reduced Risk for HIV-1 Infection.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h8wL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h8wL02
5JIHA 2BXZA 4CVWA 2IANB 2WANA 1JYWA 4GG6E 1BZ9B 2ARJA 4N5ED 1YNKH 1WGOA 5J9PB 2HFGH 2XY2A 3HMXA 3LEYH 4NOFA 2AK4A 5BCAA 5DVMA 1F2QA 1CXLA 4LHQB 3DVNA 2M1KA 4EQ2A 1S7SA 2R8SH 2ERJC 4NKIL 3MRLB 4QYOA 3HI5L 4XAWL 2XIDA 4F8QA 2NY2B 2IPKB 4N0CC 4XVTL 4ELMB 1A5FH 5D72L 2HH0H 1E28A 3VXUA 3VW3L 4ZTPH 1EXUA 3TNMB 1X5GA 5DYOB 3QEHA 5IFJA 4PJDB 1NAKL 4M61A 5K9OA 1EFXD 3F8UB 4HW6A 3O6MH 1GGCH 1A14H 1SHMA 3BZDA 2Q7YA 3AVEA 3O6FA 3WO3B 1ZWIB 1QYGL 1S78D 4FP8H 1KSRA 5E2UH 1MJ8L 1IC4L 3DX6A 2HJFA 1EVTC 1XCQA 4IBLT 1NAMB 5A2KH 2MTPA 3ARFB 1A47A 1QO3A 3GSVA 3U30C 5AZ2H 2A77H 3WHE1 2YRLA 3O8XC 5MP6L 3UC0L 4QXUL 4U6XA 5E9DA 5ICXB 4WDIA 3HE7B 1A0QH 1ZEAL 2V17H 3K4DA 4L9LB 5A2JH 2W91A 2IGFL 4OCWL 4XMKH 4DK3A 3K81A 3UBXI 3TP4A 1NQBA 2D7TH 4JRXB 1FNSL 1OF2A 4PS4H 1E4KA 1MAJA 5DURD 1HYSC 3SEPA 3EGSB 4DGIH 2Q6WB 2HN7A 2PYED 1ED3A 5F9OH 1PYWB 5ANMA 4HH8A 4YNYA 5I8CA 3MLYH 5C6WH 5DMGD 1X5FA 2DKSA 2UVFA 2DM2A 3KLSA 1AKJA 4MSWB 4UV4H 4ZFZA 1GJIA 1YMME 1X5AA 4HAGA 2Z4QB 1AY1H 1U8JA 2D7OA 5EWIL 2DTSA 4Q97A 2R0ZL 3P11H 1CQYA 3U4BH 1GZPA 3IDIB 4UQ2A 4G5ZL 1DLFH 4JO3H 1A9EA 1DQJB 2CDGA 1CXFA 5HHVH 1CZ8L 2P24A 4DKAA 4ALAH 1JHLL 5IG7A 4LNRA 3C60C 2PCPB 5HI3D 1IKNA 2J7LA 4F9PA 4AENA 3TZVC 4L4TB 2Z92B 4L3CA 1KIQA 3MLSH 3C60A 3FB6A 3QPQC 1KYOK 1E6JL 4PGBB 5DRNB 3SQBA 1CICA 4KK6C 1P7KA 4MAUH 2AS5M 5K9QI 3TZVA 4UT9H 1WC7B 5LCVL 2ADGB 3QRGL 2YBRB 3B2VL 3HZYB 4PJ8C 5BZDB 3R1GL 1J0ZA 1MLCB 4M1CC 3GGWA 2ZG1A 3FQUA 2CDEA 4OZFA 5JLZB 3OKYA 4A6YA 2C1OA 4P2OD 1YPZE 2D0FA 4EDXB 5IJKA 4K3DH 1QKZH 4Q2ZB 2XACC 1M6OA 1RZ7H 4OLZH 3DO7A 3QNYA 3Q3GA 4CBPA 2VXSL 4NKDB 4V1DD 5D96C 4KK9D 3Q1SL 3C5ZD 1LP9A 2KQNA 3KPMB 1G6RB 3EO0A 1U95B 3LZFL 4UOW0 4GW1B 2WBJB 3JWOC 4WCYH 3T0BA 2YOCA 3WS3A 2DN7A 2AXGA 1Q8MA 4JFOA 4XPGH 3GJEB 3BT2L 4KVNL 4OLVH 4JFFD 3ULUD 1TTGA 4Q58C 5EDXA 1BHGA 5E2WH 2IANE 2MFNA 5C86A 1T1ZB 2AERT 4J7RA 3MLVH 5GJTH 3MUZ1 4KK8C 2MMXA 4UDTB 2FIKA 3LN4A 1MUJB 4BZYA 3WO4B 2PTUA 5EOQH 2ED7A 5DZOA 5M7QA 3J7HA 3QUZA 3K8MA 4Y8AA 4AY0A 1HYRC 1R3JB 5F6HI 1YNLH 2H32H 3BD4A 4X9FA 2BHZA 2ICWJ 2AI0L 3EKCA 1QBMH 2W60A 3G6DH 4KQ4L 5C8JB 1OW0C 3SDXA 3PQYA 3B6SB 2ICWB 3LCYA 5E5RB 3HG1D 2D9CA 3QIBB 1ORQA 5J1AA 5I1DB 4K8RD 4AZ8A 3LHPH 5GS1C 1OW0A 4L3EA 5J56B 4OQTH 2YUVA 3I6LE 4LLMB 1F4XL 1IQWL 3I02A 4YXHL 4JHWH 3BH9B 5GS1A 4WUKL 3FT2B 4IJ3B 1MI5D 3C2SA 2E7BA 3AS3A 4EQ3A 1X7QB 3QFDB 5FKAB 4ZUVB 3A6OA 3JSSA 2Z93B 4PRNA 4QO1A 5DVNA 1NUNB 5ISZE 3CFBB 5F21B 5CEZH 4OIBA 4P2QA 4AM0A 3WMSA 2BSRB 1I1AB 4HKJB 2YWZA 2BOBA 2DJSA 1GH7A 1TJIH 3MA7B 3SJVB 3JV4B 4N9OB 4ZNCD 3P9LB 4PGDB 4XB8A 1J0KA 3OZ9H 3QFJD 1MJUL 5TH2A 5F89B 2F53A 1SYVA 3BQUB 4OCSL 3RKDC 3U2SA 1RFDH 3SO3C 5HHQB 1N4XH 4PYGA 3LVEA 4PREB 3GM0A 4RBPK 1EEYB 3BP6B 3QA3B 4LSUH 5KVDH 4JVPA 1JFQL 4PGEB 3S5LA 4EN3B 1P7QD 1HCVA 1RJZB 3ES6B 4MGXA 1VEPA 4ZOAA 4NO5A 2AQ1A 2NY4D 2BNRB 3LEVL 1RUMH 2EIZB 4XPTH 4HC1L 3H9SB 5F3BA 4YHLL 5IW1A 1CD8A 3UPCA 5C0GB 3RL1B 3AMLA 3B5HA 5DC4B 4MB5A 4OZHE 4GMSL 1YN7A 2I26N 3AB0B 4Z76A 1XGYL 1QPXA 3OX8B 2P8PB 5DEGA 3UDWC 5MEQA 3BHBA 4MZ3A 3SKMA 1Q1JH 5BO1L 1PDKA 4FHBD 3U6RB 4JM2B 2QADB 1BQLL 2YS4A 4U1LA 5ESVA 1WBXA 2LTQC 1KIUA 1LDSA 1WSST 3UDWA 4TNWK 4GRWB 2CPCA 3HMWL 43C9A 4R0LC 1A7OL 4D8PA 2CKNA 2LVEA 3DGGA 4CMMA 5A2FA 2QQLL 3ZYOA 1GGBL 5KSVB 5DHVH 1W0YT 2XQYK 4MQ7A 4MXQC 4R0LA 4OIIL 3I3BA 4IRJB 3BSZH 3FO0L 2O5XL 4NRYA 4XPAL 3X14B 4N1EA 4OF3A 4NNYA 2MCPH 4LSVL 3CSYB 5J6GA 4XGZB 5D2LB 3RNKA 4JZNB 4LCUB 1QFUL 1ZLUK 2VDQH 1CLCA 4HWBH 4PBWD 3CMGA 4JFDD 4K9EH 5I1HL 4FA8A 2F74B 5JQ6H 1R24A 1JF1B 1JNLH 4LVHB 4PJ9A 4AG4L 5GISH 5EORH 3CVHH 3GIVA 3ULVF 1NBYB 5GS0H 4L8SC 1HXMA 1FC2D 2NY7L 2R0WH 2DWDA 3B9VA 4Y19D 1OGAB 2KZWA 2D9QB 2R1WB 5BOZG 2RIKA 1JZ3A 5T5FH 5KZCB 3SE4A 4L8SA 1UJ3C 2XFXB 5B38B 1XIWA 3TA3B 2CGRH 2FJGB 5GRYA 3H3KA 4G8FA 1NBQA 2B5IB 1TQCC 4FTVE 4GRLA 3KS0J 1BGXL 1H3XA 3CSBA 4UQ3B 1QRNE 4JFQB 4NYLA 5DD0H 3RA7L 2PUQT 3THML 3DHMA 4DKFH 1DQTA 1RMFH 4IEFB 3FHQA 2R56L 3LRHA 4KK5C 1JPTL 4Q0XH 5D71L 4PB9H 4HLZH 2QR0B 3BAEH 1D5ZB 4KAQH 4PJAF 1JN6B 1FNAA 5ICYB 1K3ZA 3O2DH 2VXVL 5E7FA 4IM8A 1NBVL 1HOCB 1K8IB 4AIZB 1NC2D 3CFJB 5B22A 2Q86A 1OTTC 5CHNB 2W92A 1A6TB 2EO9A 2G60H 5D7SL 1IRAY 5F8RC 4FQIH 1X5HA 5L6YH 5EU6D 4XX1G 1I8IB 3L1OL 2C7UB 3OV6A 3VCLB 5GGRY 1IAMA 4LVEA 3MLTA 1KCRH 1OAUH 4ISVA 2X4PB 3VFMB 1U9KA 1JGEB 4DN3L 2OI9B 1CWVA 2GT9B 3SDAD 4YBLC 2FJFA 1KJ3L 1QOKA 1MIEL 1JRHI 2E9IA 5MI0B 1KIRB 2B1AL 3C5SB 4PJFF 1MWAL 3AROA 2XZQL 1FIGL 3M8OL 3SJVE 2M8XA 3OKDB 4RFOH 3NCFB 1VACA 3VGAC 2IG2H 3CAFA 3MV8A 1OCWH 4BUHA 3VFWA 2VXQH 5H35A 4M1DL 3V52L 1ULVA 3GM8A 1JZ2A 3O3BB 3RPIB 5C0DB 5I8KL 4EXKA 4GKSA 3MOBL 4FOMA 2I60H 3HC0A 2CXKA 4CN6A 2H9GA 2CR3A 2J6EA 4L5FL 2WAHA 3PDOB 1RZ8A 2FYYA 5BMFH 2UWEE 2A6IB 3KR3L 4EI5C 1A4JB 1NLBH 4OCYL 2ATPA 1AR1D 5I15L 4YHKL 2JJTA 5L88H 3ZKMC 3UROR 2YHGA 4FQLL 4KUZL 4OLUH 3MRDA 3PWUA 5D70L 1P1ZB 5EZJA 1IC1A 4JPVH 1ZAGA 3V7AG 2ENSA 3HCVB 4ZOBA 4L8DB 5CGYC 2BVQB 4H1LG 1CGWA 1GHFH 2F19H 3LAFA 5TDNA 2XZCL 3VGFA 2G5RA 2GTZB 3ME0A 4FFZH 4JY5L 5JW4Q 1ZT4A 1A6UL 2WM0A 2CO6B 2DBJA 4ZFFA 3BVNA 1XGTB 4HWZB 1NBZB 4X7CC 3MBEB 2FL5A 1TJGH 3ARDD 3FT3B 4OZGA 3MLRH 2YPLB 3OAZH 4G6AC 4DCQB 3O4LE 1XZ0A 5E6IC 2B7DT 4MA7L 4I2XB 4TULH 2MSPA 1D5IL 1F11B 3X3FL 4Y5VA 5CILL 1SY6A 3GMNB 3VE0B 1ZV5A 4FQXD 4QCIA 2YSSB 1TZIB 3RAJL 4RIRB 1DN0A 4QRSA 4XWOD 3NFPA 5D2LE 5JPMA 4XCEB 4TUJB 4IOIB 3W0WD 5I1JL 1RHFA 3HUJE 3KPSE 3VRJB 3OB0K 2PYEA 3H7BA 3DOSA 5F1NA 5DT1L 1JVKA 4APQB 3REVA 3PUCA 4M7ZC 1GC1L 2D2OA 2IPTL 4DVRL 3WNKA 2BC4B 4JGMA 4GQPH 1OGAE 2EKSB 3C08L 4X6FA 1C1EL 2BJMH 5EUKB 1NCAH 2JK5A 4YEFA 5C71A 4PJ7A 4EDWL 4C57C 5A2IH 4WFFD 4AT6A 3MJGX 3RIAF 2ARJB 3BJ91 4DFIA 4QXGH 1WBYB 5AAMA 3B8SA 1CYGA 4CL7A 2QQKH 3VXOA 1ZE3C 3BPLC 4YJZL 3K8KA 4MXWH 1UYWL 1FCGA 1S9VA 4LF3A 2Y6SC 1XF2A 3ARBC 1JRHH 4QYOB 3BESR 3H8NA 3PJSB 5HDQL 2ZSWA 5F7LB 4KJYA 3MRMA 3VH8G 3GSRA 1GCFA 4ENEC 1TLKA 1EXUB 4LKCA 2HLAA 5KVFH 3GRWL 1KJ2B 4Z8FH 1U3YA 5DQ9A 3QEHB 4F80A 4ZS6D 4M61B 2VQ1A 5K9OB 4P2OA 4MXVE 1PSKH 4KK9C 1DBAH 3P9MA 1LEIB 1F3DH 2CJUL 1JIBA 4MB4A 2Q7YB 3O6FB 4HIJB 3L3OA 4V1DA 5T3XH 4PG9A 1NLDH 2X05A 1XCQB 3C5ZA 4JKKA 2OR7A 4Z7UF 3MUGB 1KFAH 1QO3B 4WFHD 4XCYA 3GSVB 1BJMA 4TQEH 3QQ4B 2Z9TA 1QP1A 4WI6A 1T6VN 1XF1A 4CJ1A 2EXYD 4U6XB 5E9DB 3SQOH 4XC1L 4JFFA 5F72S 2FD6H 3HE6C 2A73A 4XWGH 3P30H 3PGDB 4JR9L 3T4YA 1OF2B 1RIHH 3HAEH 5L2KA 4JB9H 1TDQA 1HHIA 5HGBA 3RI5F 3VRLE 2KQMA 1ED3B 1ZHNB 4PBXA 5ANMB 3SDYL 3ZKND 4YNYB 1HHKB 3QAZC 4G42A 3CK0H 5TE7L 5I8CB 3RZWA 2NYYD 3IFPB 4WHDA 3NCEB 5EBLA 4X83A 5CD5D 1A7PL 3AAZB 4NJAL 4ZFZB 1IL1A 5ACZA 4HJ0C 3KJ6L 1U8JB 3P40A 5DC0A 4I3SL 4PY8I 2O61A 2DQFA 4WFED 1GZPB 3BUYB 4BQBA 1JGLL 4QLRA 2OBGA 5CIPA 4FABH 1A9EB 2CDGB 5F7WC 1QPPA 2BX5A 2P24B 4LIQL 4R97B 5IG7B 3BD3A 4X5WA 1MI5A 4U3CA 4B50A 5I16A 2YPLE 1IAIM 1ZA6A 3IDYB 4AENB 4NN5C 4Y5XB 1CVSC 2R23A 1JWMB 1KIQB 4L3CB 4U05A 1EA9C 3V9FA 3ARXA 3QUML 4JN1L 1CICB 1I7RA 1P7KB 2P43B 4OCXL 3FB7A 1A3QA 3HNSL 4X98A 4DUXA 5C0NC 5C07D 2CDEB 4OZFB 3UAJC 4A6YB 3QFJA 1FNLA 4FZ8L 3PGFH 3RVVD 3W2DL 4L9DA 2YUXA 3L6FA 1FE8H 4MNHB 2H8PA 4NWUH 1M6OB 3DO7B 1UM5H 3FFDA 1UQSA 3QNYB 3QUKA 3Q3GB 4FG6C 5FB8A 3VWKC 5IT2L 3DUUB 4XCCL 3O0RL 1Q9LA 4KI5E 4I0PD 1LP9B 1P7QA 1I8LA 1L7TH 1OTSC 3GSQA 4WHYH 4NZUH 4UIKL 3SGJC 3ESUF 3WS3B 4JFOB 2AXGB 2ZUVA 3BGAA 2CIKB 4JHAH 4OV5A 4WW2A 2PW1A 1H3UA 3RUGE 3RTQB 4DEPB 4DJMA 3MOQA 2FX7L 4LVOC 5EIQA 1NEZA 1KEGH 2ESVE 2W0FB 2EDQA 2VABB 4ODUA 2FIKB 4X99A 2LV4A 4G6FD 3LN4B 5T33H 5JMRA 1S5HA 3DURA 5GS3A 4XPFH 3S35H 4EUPG 4KTEH 5JIIA 4KKAC 4RX4D 5LAXA 5J12C 3QUZB 3CH1B 4Z95H 5HVHC 4G9DA 5GGVL 4PRIA 2VAJA 5J13C 2FRGP 3QULB 3PQYB 4ZYKA 2HMIC 4IRJC 5HHXL 5J1AB 2NXZD 2JCCA 4LLQB 2MQ3A 1G7JB 5FDYA 5C6TL 1DJSA 2B2XH 1WCBA 1S7XB 4NZRL 4JZJA 3WL9B 4UV7H 4JO4H 5EOCH 1RHHA 3I2CH 2A1WH 1F00I 1RUAH 4XI5D 1EHLL 3VXTA 2FX9L 4QXTA 3GMQA 4P5KA 1RZKH 1EO7A 1NFIA 4KWUA 2IMNA 4P2QB 4AM0B 3MGTA 4OUUA 4D9RE 1EERB 4YFLF 2BOBB 4Y19A 2IH3A 5HGDB 4Z0XA 4OCMC 1LK3L 4RBPH 5FYLD 5IV2A 4LSQL 4L4VD 3TA3C 4RDQF 1WZ1H 1DBML 4M00A 5TH2B 1G9NL 2F53B 5T3ZD 3EJYC 1M1SA 4M8QA 5IMMA 3U2SB 5ILTH 5FGBC 4KQ3L 3CXDH 2BRRH 5EIIA 1WWWX 2QTEA 3HRZB 3EHBC 1W0VA 3OG6B 3L5XL 4H1LA 3S5LB 2CSPA 3K3QA 5C08E 5DHXB 4TOYH 1R3LA 2GAZA 4PTUA 4NO5B 1QSZA 5KG9A 2DM4A 5HDBF 1NC2A 5IIEA 1YQVL 4JM2F 1IKFL 5F3BB 1JTOA 4OGXL 4UZGA 5EU6A 4GRWF 4M6MH 4XNXH 2BCKA 1EZVY 3BKCH 1YN7B 4ZNEA 1DLHB 4NP4L 5BVJA 2EDTA 1FORL 5C0CD 4X4YA 3WNLA 3BRFA 3U82B 1I9IL 3PHSA 5MEQB 2VSCA 3BHBB 3SKMB 3OKOB 3KPOB 3O45A 1IFHH 1MIML 2HLFC 2DAVA 4P9HH 5IVXA 4U1LB 3SDAA 4NHCH 1EX0A 3P77A 4EZMA 1IC5H 1LE5A 5I6XC 2OL3A 43C9B 4D8PB 4LRNH 3DGGB 5D7KD 3RDTC 1YNKL 1BBDL 1H0DB 4MQ7B 1IM3A 2HFGL 3LEYL 1MCPH 5EBMA 1ZLUH 1SVCP 2UVEA 3QISA 3U83A 4U1MA 4NRYB 2CMRH 1O0VA 4LRIA 3IU4L 4ORGA 5IK3A 4HZLA 2R8SL 2KH2B 2FCBA 1B9ZA 2ADFH 1IEAB 1B2WH 5DHYB 5F9JB 2Z91A 2DDQL 5LGKA 2AGJH 1A5FL 2H45A 4NNXA 2HH0L 4PLOB 1JZ6A 1GAFH 1DTUA 2NXYB 1CGXA 3KLHC 1L9MA 4HQQL 4ZTPL 4OZIA 1R24B 4PJ9B 2ZUXA 4PLKD 5LWYH 4QRUB 3DMMD 3GIVB 3HLAB 3TH3T 1HWGB 2FEDC 1U3HB 1CTOA 2EXWC 4PJXB 1HXMB 2E9BA 1KCSH 4KMTH 4Z7VA 4OGYH 3O6ML 2XRAH 5DO2C 1GGCL 4XTRD 4UBDC 5E8NA 3VH8A 1XIWB 4GRLB 5DJ2B 4NQCE 4NYLB 5DJZA 2HWZL 3RWDB 1BBJA 1V05A 1H3GA 5AZ2L 2A77L 4FQ1H 4B53A 1RY7B 1A0QL 4XXCA 2V17L 3ARDA 3FZUC 3OPZH 5H94A 3V6OE 1AE6H 1U8MA 4XMKL 2ICEA 3IJHA 1PG7X 2D7TL 4PS4L 4OKDA 2AXHA 4YHYB 2KZ1B 4LU5H 1I1YA 4NJ9H 2UUDK 4ZO8A 1T22A 4P4KC 1MHHA 4GS7B 5FO8A 1HI6A 4FQXA 3MLTB 4ISVB 1GGUA 1PGRB 3N1FC 3MLYL 3TPUA 3TFKC 1KCVH 4MAYC 1T04B 3X3GH 2A6JA 3W0WA 1U0QA 3EFDH 2FJFB 4UV4L 1HK6A 1AY1L 1B0GA 4P3CH 4HKBA 4P2QE 5DFVC 3L7FB 1G0DA 3P11L 3U4BL 1RURH 3LDBB 5IKCB 3DXAD 5EUOF 1DLFL 4JO3L 3T09A 1VACB 3RWHB 2X7LA 5ALBH 5HHVL 1W72L 3MV8B 4M43H 3VFWB 5DZLA 3MXWH 1L0YA 2OSLA 4GW4A 1F8TH 1GIGL 4R8WH 1I9JH 2EIDA 1BQUA 5HYIA 3MLSL 3HC0B 4LQFH 3OGOE 3F62A 4MAUL 5DK2B 3BPNB 4Z7QE 4WI9A 2VZOA 5DTFA 1LO2H 4DKEH 1PQZB 2ATPB 2CH8A 4JO1H 3EFFA 1CXEA 1AFVH 4K3DL 1QKZL 1WZMA 3OKNA 3PP4H 3BEVB 3DX9A 5ACLA 5HYJE 3PWUB 3EDKA 1RQ5A 1RZ7L 2RGSA 5EZJB 4LCYA 1Q9WA 5IQ9B 1IT9H 1YEFH 2CDFA 5TDNB 3ZE2E 3CFCH 1HSAA 5I75B 1EFXB 3P0VH 4WCYL 4ORZC 4GLRI 4LGSB 3RX8A 4XPGL 3C2AL 1KUMA 4HS3B 1FVEA 4OLVL 4HLJA 1ZLSL 4ZFFB 3RY4A 1VFMA 5KANG 2C4FT 4UT6L 2FL5B 2N1KA 1WICA 5E2WL 4NFBA 4OZGB 5IMOA 2R39A 3MLVL 1XZ0B 3PGCB 4HUVA 1SBSL 3HNTH 3NFNB 5E8DH 4TVPD 1PAMA 4I4WA 4Y5VB 2CUMA 4ZUSB 4H88H 5EOQL 4DN4H 1L6XA 4NN6C 1OARH 1IARB 1S5IH 4QCIB 3JTSA 5GSVB 1DN0B 2Y7QB 2N7AA 1MCDA 4QRSB 4QWWD 1YNLL 1WLHA 5JPMB 2YRPA 2R2EA 1QBML 5C7XH 3G6DL 5DURB 4DUVA 5L2JB 3H7BB 3QQ3B 2ZKHH 1WIUA 4U7SA 1BOGA 3QCTH 4OIAA 3REVB 3LHPL 4PJXE 4YIQA 4EUPA 4KY1H 4OQTL 2XI9A 4YHPB 1TNNA 4IOSD 4X6FB 3WFCH 4JHWL 4KDVA 2IQ9L 3SHSA 1PX4A 4F15B 3PL6C 2WQRA 4AT6B 4P23C 5E2TH 4WGVB 1WISA 3QWOA 1V3KA 5TGBA 4XC3L 5CEZL 3SKUD 4G8IA 1KG0A 1NAMH 2NY3D 3BWAA 3MLZH 2VDLH 4GSDH 1TJIL 4LF3B 4N1HB 4O5LH 1XF2B 2CQVA 2FGWL 5FO7A 5DJXA 3OZ9L 1XF3A 1NJ9A 2ZSWB 4KJYB 4U33A 3MRMB 4U1IB 1RFDL 4LPCA 4LKCB 4LSUL 1MCEA 3PIQB 5D1XC 5KVDL 5ID0B 2DQUL 2ZCHH 1LWRA 5DQ9B 2Q8BH 4XAKE 5C07A 3ILPA 3DX8A 3INUL 2VQ1B 4YQXH 4P2OB 4HKZA 2OJZH 1F90H 4HK3J 4QTHA 1TQBB 3H9HA 3O81A 4GG8A 4DZ8A 1RUML 4MJID 4V1DB 1WAAA 4XPTL 3DUSA 1PW3A 3DI3B 3C5ZB 4H8WH 4I0PA 4YC2C 5DQJB 4GO6B 1ZHBA 1LEKB 1CDGA 4XCFL 1WJ3A 4R7DB 5SX4I 4WU5A 5AAWA 1MCIA 4PJCA 3IRZA 4JFFB 3BDYH 2EE3A 1Q1JL 5I1IH 4JFZH 3DYMA 1IZKA 3ET9F 2G75A 3QUXD 2K1MA 2A73B 3FOLA 2R29L 1BD2D 4Q9RL 4YFLI 3T4YB 4ZO6A 3E2HC 1DEDA 5ID1A 1HQ4A 2X4RA 3JV6A 1H3PH 4GLRH 5CUSH 5I8OH 1HHIB 5HGBB 4ZPTA 1A6ZB 1FNEA 1A3LH 1LE9A 3UZEA 4QHKJ 4OCRL 3GJFH 3WUWG 1INDH 3BSZL 4G42B 5AWNH 5F6IB 1UWEH 5EBLB 2MCPL 1IL1B 3VD3A 5ACZB 4U6YB 1D9KC 4K7PH 2VDQL 5E0QA 1RUPH 4HWBL 3HG1B 5E99H 4K9EL 2EZ0D 5JQ6L 5KJRL 2PTTA 1JNLL 4R2GC 5GISL 3PWVA 2R1XA 3CVHL 1N64H 2VKWA 4PJHA 1FVCA 2YPKB 5EORL 1J8HD 3BP7A 4LPUA 2Q20A 4A2MA 5CIPB 5GS0L 5IWLC 5F1KC 1G6RH 1P84J 1SMOA 2G2RB 2R0WL 3H3PH 4X5WB 3VFGH 1MI5B 2QJDA 5CINH 5EO0A 4MVBC 4ZUWB 5T5FL 2OR8A 3KLAB 5I16B 4OZGE 1ZA6B 1DQLH 2DICA 3MC0A 3IFLH 1EVUA 2CGRL 2R23B 2R4SH 4KKLD 1I7RB 1Y18A 5DD3H 4Y4FD 4ZXBC 2C3WA 4FQCH 1I7TA 4DKFL 3FB7B 2QHRH 5C0BD 3TJHC 1RMFL 2W9DH 4X98B 1F4HA 4Q0XL 3QWRD 3QWQB 4PB9L 2HT2C 4ZXBA 3BAEL 4GBXD 4KAQL 4X4MA 5F3HA 3ZT7A 1E4XI 1AR2A 2VE6B 3O2DL 5KS9A 2H8PB 1AGEA 2VNCA 4YDVA 3FFDB 3ETBF 3QUKB 2GK0A 5FB8B 1P4BH 5CP7A 1PKQA 5ERWA 4MQXC 1Q9LB 3DSNA 1P7QB 3EZ8A 5E24E 1G7HA 5D7LE 4U6VL 3T77A 1QEWB 4E41A 3J8F7 1U8HA 3FB8A 2NY4B 3T3ME 1OAUL 3CXHJ 5IB1A 4F37F 4OV5B 4HFWB 2PW1B 3NPZB 4XNZB 4X9GA 4RMVA 3SN6N 1ZT7A 1SQ2N 1NEZB 1RULH 4ETQB 2HJKA 4ZSOB 4ODUB 4UDUA 3DVFA 3IXTA 1U6AL 1SEQH 5C0CA 3BISA 4F58H 3WXVL 3SDXF 2V5RA 1FO0A 4RFOL 4R26H 1HE7A 2C4XA 5D5MA 3G6JE 5LAXB 1DUYA 5D2NA 5I71B 1OCWL 1H8NA 5DRZA 4G9DB 3U46A 1KB9J 2VXQL 3GMRA 5D7JD 2I07A 5SX4H 4O2EB 3BPCA 2E6JA 4QRRB 2EDXA 2OTUB 2EEAA 1TJHH 2I60L 3KPPA 1AGDA 4TPRH 4I18C 2FHFA 4MNGA 1FBIL 3KHQA 1V7NH 1NFDA 2JCCB 4OI8A 2NLJA 1OGTA 4HUWA 1CXKA 1WCBB 4EI6B 3NBNA 5BMFL 3I9GH 4JZJB 3G5YA 3QCUH 2LU3A 3PWPD 1NLBL 1RHHB 5L88L 4OLUL 5EO1A 4D9QD 4JFDB 2BNQE 2EE9A 1CFBA 3VXTB 2V2TA 4QXTB 2VZTA 4JPVL 4P5KB 4M1GL 3DMMA 1FLRH 4PJ5E 1VCAA 4LLYA 2F19L 3T0WA 3BPOC 3MGTB 4FZEL 3T2OA 1FYTD 1T4KB 3FMGH 3NMEA 3FOMA 1FH5H 4FFZL 2IH3B 4Y19B 3PHOB 4XP6H 3BD5A 3KHOA 5HYSG 4EVNB 2CRIA 2Y1VA 3HFML 2E8YA 1J0IA 2K7QA 2AABH 4MLSA 3I6KB 4NKMA 1U93B 3S9DB 1TJGL 2WP3O 1PVHA 3MLRL 3LN9A 5BS0D 1VGEH 1XGRA 3ULVD 5I1CH 4GRWH 5IBTH 3I75A 3C5JA 4TULL 5F7FA 1CLYH 1R3LB 4U1SA 2GAZB 3BP4B 1ZHLA 4OLWH 4PTUB 3EO9H 1A6AA 4QKXB 4ZAKC 1HDMB 3ZTJG 5KG9B 4NKOB 3H0TA 1NC2B 1WWAX 2Q8AH 4P2RA 1QFWM 3F12A 1U41A 4RQQA 5E03A 5I18H 3HG1E 1HH9A 3GKWH 1K3IA 4G6MH 4BA8A 5F7MC 2NY0D 3VMOA 4D9LL 1E4XH 4IDLA 5BVJB 3WLWD 3H3BC 1JYVA 4ZFOL 3O45B 1AHWC 2ZOLA 4MYWB 5IVXB 4K23H 3MRFA 1EJOH 3SDAB 2FLRT 2XICA 1NCAL 4RRPG 1U92A 2J8HA 3P77B 3RBSA 4DUWA 1LE5B 2OL3B 5L7XH 1SJEA 1CN4A 4WI2A 1MCCA 1IM3B 4QXGL 4Y5YA 5ITFA 3DXAA 3D9AH 5EBMB 2O5ZH 3IAPA 5LXGH 4PJEB 2QQKL 2Y5TA 3NFSH 4WTZG 5KSBE 1G7PA 3ZKXC 4MXWL 3MLWH 5C09D 4ORGB 5IK3B 3H42H 4HZLB 3OJVC 4N90D 2APBA 3KS0H 3S37H 3S97C 2Z91B 2D0GA 2I5YH 4X5LA 3CJJA 4NNXB 2H41A 4OZIB 4Y2OA 3F7VB 3FCTB 1J86A 5K33A 3X12A 1LQSR 5KVFL 1T0PB 1T5WA 3QDMD 4Z8FL 1RZIA 3DTXA 5D8JL 1WFUA 5CP3H 2DQGH 3I84A 4P3DA 2EIBA 1I85C 1PSKL 5IM7A 4Z7VB 1DBAL 5JOFB 5IHUH 4G6JH 1LEGB 4KXZI 5E8NB 1EDQA 4LIQE 3KYKH 5CS7A 1I85A 5T3XL 2LVCA 5GGTA 4ZSOE 2NMSA 1NLDL 2YD7A 4JCMA 4ONHA 5DJZB 4MHHG 2B20A 5C1MB 3EUUA 3VXRE 1WITA 1FP5A 3BN3B 4OAWA 3SQOL 5BXFB 2GTWA 3UEZA 1A7QH 3VI3F 2UUDH 3ARDB 3KPTA 5I74B 5CKGA 5H94B 2AJSH 3P30L 2HT4C 4KU1A 3BIKB 2ICEB 4IRSB 1VADA 4OLXH 4QRRE 4Z77A 5C0EB 3PABB 1BX2A 3ZT5A 5D1QD 2DYPD 1WBZA 1SEBA 2E9WA 1Z0NA 1I1YB 4MQSB 1T22B 1DE4A 1MHHB 4MCYA 2A6DA 3KGRA 4HJJL 1HHHA 3GO1H 4URTB 1ETZA 5FO8B 1NCWH 2VITA 4FQXB 4EIZC 3P73A 1P2CA 3OF6D 5GRZA 3PNWA 2A6JB 3BE1H 4WI8A 3W0WB 3DROA 4JFDE 1YMHA 4HGWA 3AU1A 4HKBB 3EYQC 1G7IB 2R0LL 3DNKA 4CGTA 2AJXH 1B4RA 1IVLA 2YXFA 4HF5L 3QG6A 3WUWA 1U8LA 1U8IB 4FABL 2V7NB 2X7LB 5B39G 2SEBA 2DM7A 1LDPH 3RY5A 1P6FA 4MMZC 4GW4B 2OSLB 3TC9A 3M17B 4DTGL 4OB5H 4P59H 3E1F1 1JPST 2HG5A 3QIUB 3T1FA 4UAOC 2BRQA 3CDCA 5DTFB 3E8UH 5KN5A 2NX5B 2OJEA 3BKJH 3IKCB 3KG5A 3EFFB 4HEPG 1JNJA 1FE8L 1U91B 3DX9B 4NWUL 4RAVA 1UM5L 4JPIA 2JB5H 5I1EH 3KJ4B 1Q9WB 2IFFH 3JVGC 3D0VA 3MJ6A 1JP5A 3IAGC 2AQ2A 4I1NB 1YEJL 1L7TL 3IFNH 4RGMB 4NZUL 1HSAB 3S7GA 5GHWH 4FFVC 1UZ8B 1GC1C 1K8DB 5IVXE 4QY8A 4JHAL 1P9MA 3RVXC 4J4PD 4MJIA 3STZB 4EJ1C 4F7MB 5HI5C 1J88A 3DO3A 1NCTA 2Z8WC 5L9DH 5IMOB 3GI9H 3ZMRA 4OT1H 4CU6A 2VWEE 1OTUD 4HUVB 3SE3C 3WSQH 1MCWW 2EDOA 5T33L 4ZUTA 4PJEE 2GCYA 3C09B 3D25A 5EBWB 4I4WB 4KXZH 1CDJA 3HKFA 3S35L 1T03H 1BFVH 4KHTH 3RGHA 4GMTH 3QUXA 2AVGA 2DBLH 4WFGD 1YA5A 4FXLA 4N8VG 1YC8A 1KTLB 1UWXK 1L6ZA 3ROLA 1ITBB 3VWJC 1BD2A 3JTSB 3MRGA 4Y16C 2R2EB 1K4DA 2W65A 3PF2A 1A7RH 2BP3A 4PJ7F 3VWJA 1PG7W 5A3IC 3LKNA 4Y16A 4JZOA 1AQKH 3H2WA 1T21A 4RWYH 1BOGB 4XP5H 2QQNH 4YIQB 5ICZA 4EUPB 3T0AA 2ZCLH 3UTPE 2B2XL 3VJ6A 2CK0H 1M71A 2VIRA 4KROC 5DR5L 3NH7H 2IAMD 4KKCD 4UV7L 8CGTA 4M7JH 4QHMA 2WP3T 1JUFA 4YPJA 2CLZA 4P46C 5EOCL 4PD4J 3O3AA 2NY5H 3O9WD 4LPXA 4PP1C 3VXNA 1MPAH 1RUAL 4ZFOA 1AO7A 1IGJA 3QWOB 2VLMD 3JWDH 1B0WA 1M7DA 1RZKL 1J8HA 5TGBB 1MREL 1DSFH 4M3JA 3RVUD 3QBTB 1K2DA 5JW4M 3MRKA 1KG0B 3U7YH 3BWAB 4JREB 2JIXA 3PWNA 3UPAA 4W70A 5B4MC 3N0PB 5DFWH 1D6VH 1WZ1L 1SBBA 2GITB 2OM5A 5DJXB 5FO7B 1XF3B 1NJ9B 3SDDC 3W11D 3BH8A 2R2HA 3PV7A 5F1IA 2MKLC 5ILTL 1CGYA 3FQWA 3CXDL 4G8EA 2BRRL 4Y4FA 1NUFA 5F9AC 3GSUA 5C0BA 3MRHA 3O6LH 3BRDA 1FZKA 4QRQA 5C07B 3ILPB 3QWRA 1NUDA 2MPAH 3DX8B 3H6JA 2LFGA 4GBXA 2DQJH 5E8OA 3UTTD 3ULSA 5HYSA 4QTHB 3FO1A 1X4XA 3MCKB 3S88H 4GG8B 3ULUF 4OFDA 4GH7B 1EO5A 1A7BA 5DD1H 1Q94A 3DUSB 1UB5A 4HXBH 6CGTA 1S7VB 4I0PB 4M6ML 1ZHBB 1FV1A 1DVFD 3BKCL 2B0SH 1H5BC 2XTJD 3ZLQC 2CLVA 4PRPD 5EU5A 2VTFA 4P5TC 4WU5B 3C8KB 4PJCB 2E6QA 4NO2A 5FECA 2YMXH 1ACZA 4XMPL 3NCYS 5KSAD 3WFEL 4PRDB 4P9HL 2JELH 1YEGH 5IBLC 1BQSA 3LKRA 1CD1A 3IF1A 2EDJA 4NHCL 1MHEA 2DM3A 4Y4HB 5JUEH 3QH3A 1CLZH 1HQ4B 2X4RB 3JV6B 4LRNL 1T7YA 4G6FB 4NNPL 3G08A 3P3YA 4NBYB 5JHLH 3B9EA 4XNMA 4ZPTB 2VR4A 3ZYZA 1LE9B 4J3XA 2AEPH 2OLDA 3TM6A 2NX5E 4YGVA 2CMRL 2FEEL 5D7JA 1N6VA 2KPNA 1BM3H 1B2WL 4U6HA 4RRPA 5IVZA 4OZFH 1P84K 4A6YH 1GOGA 1V3LA 5TQ2H 2AGJL 3AFLA 4MA3B 1GAFL 3EJZD 2NXZB 4Z6AT 4HX1A 3DSFH 2PTTB 2N4IA 5LWYL 3PWVB 2R1XB 4PJHB 5B3NA 1N0XH 1FVCB 4RGNC 2DQCH 3SCMD 5EU7C 4WTZA 3PWPA 4HAFA 5FGCB 4PV8A 1KCSL 3L5WA 5BQ7A 4KMTL 5EO0B 4OGYL 4IOFD 1Z6JT 3MLXH 2VN7A 1FNHA 4QRPD 1WIPA 1OPGH 3IGAA 1X5ZA 2WNGA 5I1LA 1Y18B 3C87A 1FYTA 4KUCD 1I7TB 2ATKA 1QSED 4FQ1L 4L4VB 4YHMH 5IROA 5ADOL 4R96B 4X0KB 3TVMD 2Y72A 3HZVB 3TNNB 3UJTH 1MCRA 1FFNA 5KS9B 1AGEB 2P45B 3SGKC 4YDVB 3E3QE 1EUUA 4WW2F 2GK0B 1Q72H 1EO8L 4QNPF 3WD5H 5CP7B 5ERWB 4F3FA 5CSBA 2BSED 5FFLA 4N0UE 4LU5L 4NJ9L 1LILA 5F6HJ 4OD1H 1G7HB 3TCLA 2VLKD 3T77B 4LOUD 3WXWH 4E9LA 4MA1C 1U8HB 3FB8B 2VLRD 5FYKH 5IB1B 1F02I 4E42A 4DQOL 1FJ1B 5DLMH 2PETA 1EAJA 3WLWC 1ZT7B 1JF5A 4NUGH 1A6VH 1B4JH 3EFDL 1N7MH 3O11A 1VESA 2MCG1 1KB9K 4ZG1A 3F7PC 1C5DA 2HJKB 4P3CL 4WFEE 4PRHA 3IXTB 5C0CB 5DJ0B 4DVBA 2JE8A 1B6UA 1FO0B 2QKIA 4DKDC 3B9DA 2JCCF 3OKMA 5D2NB 3MV7D 1MCFA 4ETYA 4M43L 5DRZB 2VQUA 3LH2L 4WW1A 1A6PA 3QO0A 3MXWL 3GMRB 4OD3H 3RL2A 4R8WL 1F8TL 2I07B 3MX0A 4PJGE 1G9NC 3QJFA 1KGCE 2VLJE 2JB6A 1Z9MA 3KPPB 1AGDB 4MNGB 2BY1A 3DETD 3KNBB 1NFDB 1GL4B 1IGMH 4N1CA 1S9XA 1OGTB 4HUWB 4QRTB 5IB5A 1I8KA 1WT5A 4ODWA 3FAXA 2ZG3A 1LO2L 3G5YB 5B39A 4DKEL 5GS2D 2ORBH 4JO1L 3IDMA 1AFVL 1J0HA 3PP4L 5EO1B 1XT5A 2GHWB 4LCCA 4IS6A 1MFAH 2A9NH 4XRCA 1EFQA 3DMMB 2AXFA 3DJ9A 3QDMA 4TTDD 2BY2A 1KN4L 1YEFL 3TBYA 3FOMB 4H25B 3FHAA 3P0VL 3FQTA 5CEZE 4LEOB 1E6OH 1QHPA 5HDLA 2Z0BA 3NIDE 1NANI 1Y6NR 5I19H 1P4IH 1XGRB 5JW3H 2GSGA 2P5WD 4PRAA 5FGRA 4QOKD 4U3HA 3I75B 3C5JB 1DDHB 5KAQF 3HNTL 1BIHA 3AMKA 2B4CH 3PDGA 5E8DL 1FZOA 4LKXA 4U1SB 4H88L 2GKIA 4DN4L 4CUCA 1A6AB 4IRSC 3SO5A 3CSPA 1S5IL 4FQHA 3BZFB 4M02A 2OX5A 4HD9A 5C7XL 4RQQB 5D1QA 2ZUQB 2DYPA 4PJBA 1HH9B 4Y2DD 1REIA 4WV1C 4ODXA 2VDNH 2WIIA 3BEWA 3BI9X 3WS6A 4ODBD 5BVPL 2R9HD 3LD8B 1CU4H 3QCTL 4JFHD 1RZFH 3L9RA 4MJ6A 3RIFF 2Q1EA 3MLUL 3OF6A 4RMSA 2ZOLB 4LMQI 4N8VA 4PGCA 5F9WC 4ZMAT 3MRRA 3MRFB 3WFCL 5JHDD 1U92B 5D7IE 2ZUYA 3ZZ1A 5CAYB 1OM3H 3IDJB 3B9KD 5E2TL 1SJEB 4DZBB 4YK4C 3KPRD 4D3CH 5ITFB 1OLLA 3DXAB 1PZUB 4L1DA 4L4VE 1NAML 2A6KA 2Y5TB 4OZIF 4YHIA 1MY5A 1QLEH 1G7PB 4GQ9H 3MLZL 3DHJA 1T1XA 2ITCA 4YPGB 4X4ME 5IHLB 1ADQH 4E5XA 3NACH 5T3ZE 1T0NB 4ZOEA 3VI4F 5KS9E 2A38A 4Z7VF 12E8H 2P8MA 2GY5A 2JF1A 3O4OC 3FAWA 1WQVT 1T5WB 1TNMA 2ZUWA 3UTSD 3V4PH 2Q8BL 3DTXB 4WNQA 1RK0A 3QDGD 1IM9D 4P3DB 2OJZL 1F90L 4PUBH 5IM7B 1WZKA 5CJ5A 2AJUL 2J5LC 1XH3B 4JPKH 3TN0C 1XF5A 3QIWC 1AQDB 2OTWB 2AJZA 3ARWA 2Q3ZA 4Q6IA 2NY1D 4KMLB 4ONHB 4KMQA 2DL9A 3B2UC 4H8WL 2CIIA 5C0CE 2X4SA 3S36X 4OAWB 3T8XA 1HEZA 3E6HA 4J4PA 3BDYL 2GTWB 2O93L 5I1IL 4JFZL 4JCLA 3OR6A 1F13A 3CVIH 1QR4A 2EH7H 4M7LH 1VADB 2PN5A 2BY0A 1H3PL 1W72A 2H3NA 1WBZB 4X6CA 1SEBB 5I8OL 1CE1H 5C9KA 5JA8B 5DJDA 3RWFA 1VKXA 1KB5A 1DE4B 4MCYB 1YNTA 2A6DB 3LB6C 1A3LL 4GXVH 3ILQC 4U1GB 4NN7C 4PJIE 1ETZB 4QF1A 1F4YH 1INDL 1NANH 2J6EH 3P73B 4TUOA 1P2CB 3B83A 4Z7UA 2F8XC 5AWNL 3RZCD 3E3QC 1MELA 1J05B 3PNWB 1F6AB 4W6WB 3CDGA 3W9DA 3DROB 3U9UA 1BREA 3P0YH 5JO5A 4FQQA 2NR6D 1F4AA 3DI2B 4QEGA 1RUPL 2IAMC 1ZGLA 3RUGF 5E99L 2FECL 4W4OC 4LFHD 5HHOE 2D03H 1N64L 1BVKA 4HPYH 4J6RH 1T0MA 1U8LB 2IAMA 3WUWB 3CMOH 2SEBB 3HPLA 1JWSB 1G6RL 4W4OA 3VFGL 3O9WA 3O6KH 5CINL 35C8H 2IBGA 3G5XA 3RVUC 1QUNA 1DQLL 3IFLL 5MEND 4OF6A 2MQCA 5IJVB 2GY7B 2NY3B 4WRLA 2HG5B 4FQCL 2QHRL 3T1FB 3EYOA 1G1CA 1T7ZA 2W9DL 1JTPA 2NPLX 4M93B 5KN5B 3D3VD 1FAIH 2OJEB 1H3TA 4WO4B 4LARH 3D2UD 1SY6H 1RZGA 4RAVB 3ZYJA 4JPIB 1CT8A 3HZKA 3GBNL 1YQ2A 1P4BL 4N0CD 3D0VB 1KJVA 3CUPA 3QXDA 3ALWA 2H32A 2YN3A 2BVYA 3UTTA 4TSBH 1EGJL 4RNRA 3QEQE 1KYOJ 3B3IA 5JW4R 3N1MC 1CLOH 4MJIB 3B9AA 3RGVC 1BP3B 1NMAH 3O2WH 3F7RA 4YZFE 4OQTA 1RULL 4NQDE 4WENB 1UWXH 5EA0H 3RGVA 1DVFA 2ITDA 5AG9A 3B43A 4PRPA 4RFNB 4HK0A 4BZ1L 1SEQL 2GCYB 3D25B 4YDKL 1AD0B 4U1NB 3WKNA 5KSAA 3QUXB 1OT2A 3OJMB 4G7VH 1N2RA 4Y4HC 4K55A 4YHNA 5AYQA 3O8XD 2NY6C 4LVNB 4G7YH 1BD2B 2WV3A 1HILA 3MRGB 3VGGA 1D5BB 4HMDA 2FATH 5D93B 1OAYH 2W65B 3RWCA 4DWHA 3QJHA 4PD4K 4LFHG 3LKNB 2IWGA 1TJHL 3A6BH 4JZOB 5B21A 4JPWH 4TPRL 3REWA 1T21B 3F7YB 1V7NL 5DS8A 4I9WE 1HYSD 4L1HA 5ICZB 3T08A 2WWMC 3MTRA 3VJ6B 1M71B 3I9GL 2HAZA 3QCUL 2EO1A 2VDOL 1UFUA 2W07A 3O3AB 3WIHA 3VXNB 1RZJH 3RFZC 1KLGA 4RGOH 2C3XA 2DIAA 4POUB 4PYHA 4XHJC 1FLRL 4Z7OF 4Q74A 1J8HB 4Y4KB 3SCMA 2Z31C 1S7TA 5C9JB 5GXBB 1K2DB 1S7WB 2PKDA 5TFSH 1FH5L 3MCG1 4XP6L 5HYQB 4XBGA 3VD4A 4JEGB 3PWNB 2Z31A 1INEL 5F7KC 4ONFH 1R3KA 5H8DA 3EO1A 1U8NA 2AABL 4QRPA 3ULUH 3BH8B 4YFDB 3TJEH 3FT4A 3SKOA 4MNQD 4G8EB 4MA8H 4Y4FB 5I1CL 2WK2A 4LHJB 3GSUB 5SV4A 1QSEA 5C0BB 3TZVD 2VDPH 1WAAF 3MRHB 5DJ6A 5IBTL 4LLDA 3NGBB 3QPQD 3CX5J 1FZKB 4QRQB 1FFPA 1CLYL 4X8JA 3TVMA 3TIEA 1TZHB 4KK6D 4GBXB 4OLWL 5E8OB 3ZSTA 4NQEE 3ULSB 2ZOKA 3D39E 3FO1B 3EO9L 5GZNC 4PJ8D 4M1CD 4KRPC 4PJCF 4LPYA 5IQ7H 1RUKL 5I73B 4I0CC 4JAMA 2WW8A 5EOCJ 5DWUH 4ZO9A 1Q94B 1VHPA 1UB5B 5I18L 3GKWL 1YEIH 3GHBL 1C5BH 4C54A 3VU2A 1FV1B 5TPWH 4O2FA 2XKNA 2GUOA 1Z5LA 2VLKA 4K9EC 4MCZB 2CLVB 4K8RH 2R4RH 2VLRA 2XNAB 3K2UH 1F5WA 4WTXA 3ZHDA 1SMAA 4HWBA 4OM1H 5JR1H 5GS0C 4BK4A 2G5BA 3LKRB 5CIPH 1CD1B 1EJOL 3IF1B 1DZBA 4BSJA 1KCLA 3CVHA 3QH3B 1L0XA 4PY8J 5FHBH 4CNIB 5INDA 4HKXA 1VPOL 3G08B 3KPQA 3A6CH 4NBXB 4XNMB 5J57B 4IDJL 1T83C 1RSFA 1KENH 1ACYH 2AEQH 3D9AL 2O5ZL 5LXGL 1BEYH 1A4KB 1DANU 3NFSL 1KCUH 3VG9B 3MV7A 4YGVB 3MLWL 1KIPA 4DK6A 3H42L 4U1JA 1JF6A 5T1KD 5D7JB 4LBEA 2PO6C 1KXTB 1FGVH 3HA0A 4U6HB 4WHYG 5IVZB 3BIBX 3IS1X 2ILLA 3KYOB 1NMCB 5HHPA 3RWEB 1M7IA 4ZFGH 1I9RH 2I5YL 5I2IB 3KYMA 1VERA 2F54D 4FNLH 4HX1B 4OLYL 1QFWI 4ODHH 4L3ED 2VN4A 1JGDA 4WI5A 1TPXB 2K7PA 3PWPB 2DQGL 5CSZB 4PV8B 3FQNA 3L5WB 1CFSB 3U4EA 5IHUL 3BKMH 4OD2A 4K3JH 3JWNC 4G6JL 3UPRB 1QNZL 3BZ4A 4J3UA 2EC9T 2RBLA 1NCCH 3IGAB 3KYKL 5I1LB 1M05A 1ZS8B 4OI9A 3BGFB 1R3IH 1FYTB 4G43A 4X6EA 5D1ZC 2VB5A 1E27A 2ATKB 1AGCA 4UILH 1K4CA 1QR1A 4WJ5A 3C8DA 1KT2A 5D1ZA 1A7QL 5J11C 4LHUD 1OB1A 4H20H 3UJJH 5AZEH 5LGHH 1FFNB 4Z7QF 5BS0B 2AJSL 3IFOB 2ID5A 5B8CC 4OLXL 2P5WA 3IVKB 4QOKA 1AP2A 4GJTB 5LGJA 4F3FB 1G7QB 3MRCA 5AUMA 3RKDD 3UTZA 2W9LA 6FABL 5B8CA 3LS4H 3ZE1F 3TCLB 3GO1L 1NCWL 3QI9C 5CLWA 4WWKC 4E42B 2G9HA 4BSVA 5HYEA 4P4RA 5F7UA 3MOAH 5D5MF 3QI9A 3BE1L 4RMQA 1VSCA 3DVGA 2NY0B 3U7WH 3O11B 1S7RA 4Z78A 5DZNA 1C5DB 5DRWA 1J8HE 1YZZA 3KYAA 1GVIA 4HIHA 2AJXL 4F33B 1T66D 3MNVA 2J8OA 4L8BA 4LLUA 5JDJA 4C4KO 1GZQB 4MJ5B 1QBBA 4Q9QH 5DD5H 2QKIB 1NFDF 2JLLA 1FDLH 1XGUA 3V4UL 5JHDA 1DUZB 5BV7B 5JOEA 1LDPL 4WHTB 1P5VA 3VFNA 2MHAA 4WW1B 2HVKA 4NM4H 3LEXB 3RL2B 2X4QB 3CLEL 1JTTA 3B9KA 2GSIB 3QJFB 3QZWG 4OB5L 4P59L 2JB6B 3KPRA 3ARGC 1MFCH 4LNVA 5C09B 1S9XB 4YR6B 1RAMA 1FFOA 4MXQD 2OZ4A 4ODWB 4H1LH 3E8UL 5B39B 4WUUE 3BKJL 5EOTA 1ES0A 3IDMB 2IBBA 1OT1A 3V0WH 2EDEA 3T0EE 4QT5A 5KSUA 5GGRA 1QRKA 4BQ9A 4LCCB 3T04D 2JB5L 4X7DC 5I1EL 1IGFH 2XQYG 4IS6B 2DLHA 4K71B 4XRCB 2AXFB 3QDMB 4EXPX 4H26A 1IM9A 3IFNL 4XBPA 3TBYB 3G9VA 4L29A 4Y8DC 3VXSE 3FFCA 3FQTB 3MV9E 5C0RH 4NHUB 2NTSP 1PEWA 1QFWH 3UO1H 5L9DL 1RIUL 1YMMD 3BO8B 2DQDH 3GI9L 4JN2A 4OT1L 1MAML 4PRAB 3WSQL 1G9MH 4KHXH 2OL3H 1MQKH 1FZOB 4LKXB 2NW3B 1T03L 4KHTL 2RCSH 1C12A 4I5BA 3TPKA 2DBLL 1TCMA 1CFQB 1JGUH 4FQHB 4KK5D 3D69B 1WEJH 1FAKT 1MFDL 1N6QH 3ELAT 4G6KH 5D1QB 2DYPB 5INCA 2CLRA 2Z35B 3CLFH 4ODXB 2YD3A 4HMEA 1AQKL 3OAZK 2ED9A 1OTTD 4XP5L 1CXIA 2VDRL 1J0JA 4F9LC 2QQNL 3T0VA 3RZCA 2ZCLL 1MAKA 2DLTA 4NPYA 1EV2E 2ZP0T 2EDLA 4N8VB 4PGCB 1KJ2L 3RBGA 3MRRB 3NH7L 4YAQA 4KZEH 4Z7WA 1D5MB 5EU4A 3S6CA 4D9QE 3LQAH 4M7JL 3QHFH 4X7SH 5L8KB 2NY5L 3S4SG 2NZ9C 3GNMH 2DD8H 4IHOA 2ENYA 4KJQC 4P5MA 1T2QH 3SKNA 4U0RB 4NZDA 3JWDL 3ARUA 1MVFA 3DWTA 4ELKA 3L5JA 2E7LC 3U7YL 4X6DA 3HB3C 4YHIB 2BHYA 2LU4A 2V9QA 4UT7H 1T1XB 4IRZL 1MH5A 2DWEA 4K3EH 2Y36L 2J8UE 1I8MA 1D6VL 3LQMA 2NTFA 4U1HB 5BS0E 5DMYA 3CFIC 5MENA 1MCQA 5DRXA 3O3DA 2IAND 1H8SA 4X9BA 1VA9A 5F70A 1L0QA 2J1KA 1UH4A 4X80H 4D0DA 3QEUA 4KRMB 4P57A 1QLFA 3O6LL 3TV3H 1ZKAA 2X4NB 3FRPA 3HZMA 2X4UB 2MPAL 3D3VA 2DQJL 1MF2L 2V5MA 3D2UA 3N9GH 2WWKO 3A67H 1S7QA 3S88L 2VISA 3IJSA 5ENWA 1XF5B 2D4FA 4EI5D 5I9QB 1AI1H 1OSPH 2AJZB 5DD1L 1Q9OA 4N0YH 4PJAE 4Q6IB 5LVEA 4HXBL 3EDEA 3ZKMD 4OSUL 2CIIB 5E94A 1X5IA 2B0SL 3LOWA 1XCTB 1UCBH 5DK3A 2X4SB 5CGYD 2DLEA 1TVBA 3T8XB 4DAGH 1HEZB 2DS4A 3E6HB 4CW1B 2EYTA 3I6LD 3FL7A 4Z5RA 3WDIA 3OR6B 1P4LA 5HPOA 2I9TA 2JELL 1YEGL 3GMPB 5SWZE 5JUEL 3EDFA 5IMKA 2PF6A 3MO1A 4MDJA 4D0CA 2GIYA 2VH5H 1KPRA 3L95A 1H3WM 4G6AD 4EBQH 5JHLL 5ISZD 3JBG7 5DJDB 4M9PA 3RWFB 1RVFL 3RU8H 1KB5B 1YNTB 1J7VR 4JY4A 1QSFD 5E6ID 5C09E 1RJYA 5FYJD 4QF1B 4N90E 1ITCA 3O8XA 2AEPL 3MXVH 1ZGLM 4Z7UB 5DGRA 3ECBA 3FJTA 4BFGA 2AEWA 2EYRA 4PJFE 3WJJC 1BM3L 3CDGB 3W9DB 5CBEA 4A6YL 3LKSA 1OVZA 5TQ2L 3T3MF 1LMKA 5FO9A 4JFEB 1ZGLB 3W39A 3DSFL 3Q48A 1T3FA 2H1PH 3IU3A 4MD0B 4XVSH 2DQCL 1BVKB 1HKFA 1CVRA 1EAPA 2P1YA 3HPLB 1PX3A 3MRPA 3UYPA 1IILE 2P46B 3O9WB 1CR9H 4HHAB 4F7PA 3G5XB 2R0KH 1FRGL 3LQZA 2BVTA 3KXFB 3MLXL 4LDOB 5ADPH 1X4YA 2GFBA 4Y4KC 4B7LA 5KOMC 1R5WB 2FR4A 1KPUA 1AXTH 3MACH 4HPOL 5C0FB 3EOYG 3L3IA 3EYOB 2B39A 1DEEA 1JHTB 3VXME 4Y1AA 4YHML 4O4YL 2XT1B 3I6GA 4GOSA 4ZTOL 1JJUA 2VDKH 1LK2A 5FUCE 43CAA 1RZGB 4WI3A 2Y6SD 3GJFB 5CFHA 3ARBD 5C0AD 4MNQA 4NRZB 1CT8B 1Q72L 4N9GA 3UP1A 3CUPB 4H0IA 1PKOA 1UH3A 2WMPA 3QUYC 4C4KT 3QXDB 4FFYH 1T1WA 4ENED 1YEDA 1PZ5A 4U0QB 1T89C 4OD1L 2ARWA 3UTTB 4EOWH 2W38A 4XAWH 5J1TC 2A74A 4PJ8A 3B3IB 4GW5A 5FYKL 4G8GA 3T0EC 4DGVL 2X6MA 5D72H 4YUEH 3HPJA 3V6FB 4EUPH 1XAUA 4KDTC 4NUGL 3R06A 1A6VL 3EIFA 5GRVK 3MRBA 1N7ML 2VOTA 3CDFA 3BDXA 1MFEH 1A9BA 4OFIA 5DA4A 2XTJB 4KDTA 4PRPB 4YHZH 4HK0B 1N5AA 1V8HA 4YH6A 1RZKC 1MHCA 4Q9CA 5KSAB 1H15B 5IGXH 3VFTA 1N2RB 2UYLA 4NBZB 2MWCA 4CMHB 4HUNB 3O3EA 1HILB 1QYGH 3SKJH 4OJFH 1CGTA 5DEFA 3LV3A 5L2KD 3HE6D 1ZHKB 4O51A 4OD3L 5C0IB 4NCDA 1N8ZA 4U2YA 3QJHB 4FTVD 2EDKA 5MERB 3REWB 3L3HB 4FS0A 3B5GA 1QRND 4QXUH 5SWQA 1H8OA 3QXVA 1MCJA 3IRPX 4NDMA 5FYKU 2C9AA 4XT1C 2XY1A 2FO4B 3STLA 2AV7A 4P2CG 3SDCB 4ELME 5T1KA 2XZZA 4OCWH 1RJLB 1ZLVK 4BFIB 2ORBL 3GB7A 1NMBH 3MMEA 2YD8A 1PFCA 1UVQB 3H7LA 1JL8A 1KLGB 25C8L 2F54A 4JG1H 3CGTA 3QZWA 4PJDE 4FQPA 1MFAL 2A9NL 4LCIH 3SCMB 3C6SA 4BQ8A 4HJ0D 1LD9A 3FQXA 1P5UA 1U58A 2E3VA 3CX5K 4XBGB 3BN9C 4UOW1 1R3KB 3EO1B 1U8NB 1E6OL 3MZGB 4IIQC 3S8WA 3KWWA 2IADA 4P9HC 1MNUH 3HC3H 3RHWF 5KSBF 1C16B 3FT4B 3PV6B 5I19L 1P4IL 2H26A 5JW3L 4IIQA 1J9CT 1QSEB 1BLNA 3HI1A 4LLDB 4J3WA 1JYXA 4WFGE 3LPFA 1FFPB 1CZ8H 1I1AD 2ZJSH 4X8JB 3TIEB 1MRFH 3EYUH 3TO2A 3TVMB 4LHUA 3WFZA 1QVOA 2A0LC 2F8VA 2ZOKB 4JRXE 2PXYB 2JJUA 3OXSA 3FTGB 4UUJA 5C0ND 3UAJD 2IPUK 4GG6A 3VFRA 3V6ZA 1MJJB 3C6LC 3LN5A 5B3JF 4JFEE 4IMLA 4P0DA 4FG6D 8FABA 2VDNL 3VWKD 4KKBD 4O2FB 2XKNB 2GUOB 2VLKB 1QFOA 3VFPA 4EN3D 3WBDA 1CU4L 5E70A 1RZFL 2VLRB 2Z8RA 2HRPH 1N0LA 3OAYK 5HHNA 2BMKA 4HK3N 1OTSD 2VXTH 2YEZA 5I76A 2G5BB 4HJGA 2J4WH 3KXFE 1T66C 1OHQA 32C2A 1OM3L 5INDB 3NCJH 1F3RB 3EJJX 4HKXB 3F65A 2BOCA 1IBGH 3C8HA 2E27H 2YD1A 4D3CL 2MKWA 3OKLA 3VRIB 4KVNH 2EDBA 4KJPC 5KANI 3MV7B 1QLEL 4GQ9L 2WWKT 4L4TE 3WFHA 1ADQL 1QTYT 2XG5A 3DBXA 3NACL 5FYLH 2FBJH 4PRID 5MHSE 4Y88A 3V0AC 2VLLB 4KKAD 3G5VA 5HHPB 4XXDA 1FVDA 1M7IB 4Z18A 3S4SA 12E8L 3HI6L 5T3ZH 4M8VA 1KF9B 3O4LD 1XGQB 1EMTH 5CWSA 2PYFA 1BF8A 1CFNA 5I8EB 3ROOB 1JGDB 3V4PL 5FV1L 2HMID 4IRJD 4YFEA 3CPLA 1Y6KR 2AI0H 3KPLA 2LAGB 3CIQA 5DUBB 5AYUH 3U4EB 4JANA 4KV5F 4OD2B 3TLRA 2JJVA 3V5KA 3G9AB 1GYAA 2V7HA 4JPKL 5EB9A 3LIZL 2UZXB 3QNXA 3RQ3A 1U36A 1FG9C 3M45A 3NPSB 1M05B 3KAAA 2DIBA 3KPSD 4G43B 5T5NF 4X6EB 5HGHA 1E27B 1UB6A 3QPXH 1AGCB 1TENA 4B41A 4HWNA 1K4CB 3T3PF 1QR1B 1DBBH 4MS8C 5E00A 3MJ8A 1OGAD 1KT2B 5FA3A 1QA9A 1OB1B 5CEXB 1FO0H 2CRMA 4NFCA 1YMMA 1C5CH 1UZ6F 4K2UL 2VKXA 5FM5O 3TA3D 4J3OC 2P5WB 1UJ3A 4AL8H 4QOKB 4X6BA 1AP2B 3HS0A 5LGJB 3BJLA 5K93A 3EJYD 3UTZB 3MNWA 1CE1L 4GAGH 3L5IA 1RIVH 2UZIH 4XCNA 3EHBD 2BVEA 5FUCC 3E6FA 3JZ7A 3Q5YA 1MJUH 4LP4A 2G9HB 4BSVB 4P4RB 3WN5C 4J23A 4JFXB 4Y2DB 1X4ZA 3PXJA 3DVGB 5HI4C 3WFDH 5J1SC 5HDOA 1WZLA 4Z78B 5DRWB 1IGYA 5I1AA 1TZGH 5IEKA 5ESQA 4HIHB 4WWID 3WHXA 3GFUA 4X4XB 4HPYL 3S34H 4J6RL 5L8JB 1YPZA 1G7LA 1XGUB 3CMOL 5JHDB 3TO4C 3AREC 3DECA 3O6KL 2MHAB 5CZXC 2HVKB 35C8L 3N1QC 1BZ7B 2HLFD 2X4OA 1GGIH 4G9FD 3KPNA 3B9KB 1DP0A 5KBNC 1I4FA 1XGYH 3KPRB 1QSEE 3LKOB 3MRNA 1JPSH 4JRYB 2P42B 2V2WA 3V2AR 1DQMH 3L5HA 1BOYA 5BO1H 1TVHA 5CZVH 4KC3B 3QEGH 3RDTD 3L3JA 1D5XA 5T1MB 1FAIL 5L0QB 5A40E 2DQHH 1ES0B 1IEBA 2IANA 3TBSB 4TUKH 1SY6L 1ZTXH 4QT5B 3K1KC 5EUOB 1GOFA 1YYML 4AMKH 3MLPA 3RWIA 2XG4A 3UTSB 5JORA 5ESAA 1V7MH 4H26B 3MA9H 2O5XH 2NY2C 3QDGB 5JXEC 5JIKA 4XPAH 1IM9B 2BNRE 4XBPB 3KLHD 5IHBA 3TBWA 1GOHA 4OV6F 1A1MA 4TSBL 4L29B 4S0TD 1G84A 5DJYA 3OJDA 4L8CA 5CZKA 1Z9OA 4J3VA 1R5IA 1I1FA 2FEDD 2FH8A 5B38G 1CLOL 3H9SE 5IFHH 4JY6A 1OP5H 1MRCH 2EXWD 4EI5A 3CZFA 5EFIB 2DQTL 5DMKB 1NMAL 2NY1B 1WFOA 3O2WL 3V0VA 5DO2D 1EEUA 4JN2B 3TNMA 1EPFA 2Z8SA 4UBDD 1Q0XH 4OFPA 5HDBE 2H2SC 5EA0L 2V2XA 5E4EB 1R3HB 4FMFA 4PJBF 2OQJA 4PTTA 1CK0L 3F7QA 1NEUA 2VUYA 1D3CA 1HHJA 1C12B 1FN4A 1T2JA 4GRWE 4I5BB 4H0GA 3TIDA 4G7VL 3ARFC 2V5YA 3QRFM 5KAQG 4XVUC 3WCYA 4G7YL 3P4MB 2LU7A 5F1SA 2FATL 1UKQA 1OAYL 2VL5B 1SJHB 2YA2A 1HCFX 3F58H 3FZUD 1I9EA 2MOVA 3HE7C 4JDVA 5ISZA 5INCB 1JNHA 4L9LC 5E6IA 1QSFA 3A6BL 4JPWL 3MRJB 1Y6MR 3V5HB 4WY7H 3W5MA 3RZCB 4P4KD 3LS5H 2VXVH 4LASH 4NPYB 1NBVH 4Z7WB 5JOPD 5FF6A 1LGVA 1MY7A 3ZDXF 1CF8L 2E7HA 1RZJL 4BH8A 1XGPA 3EGSA 3RX7A 3TFKD 3OKEA 4MAYD 4RGOL 4P5MB 1FSKB 4NSKA 3R0MA 4H8WC 1PYWA 4R4NC 4ELKB 5GGTH 4E0RB 3O2VH 1CE6A 3RIAK 1I7UA 3GKZA 5DFVD 5TFSL 1ROWA 1MH5B 3VDCA 1FNFA 2DWEB 3K4AA 4ONFL 5I66A 2NTFB 5DRXB 3JV0A 3ULUL 3O3DB 1T1YA 1UWGH 2P5ED 2AK4B 3FRUA 2ESVD 3QQ9C 5KVMC 2E5EA 4OZHA 3QEUB 4P57B 1QLFB 1YY9C 3DVNB 2DKMA 3TYFA 2EICA 1NGWA 3OGCA 1S7SB 1BF2A 3HZMB 3HR6A 4TVPH 1QSVA 4M1DH 3D2UB 2X2YA 3V52H 4OKVA 1E28B 1UCTA 2ERJB 3ARBA 5C0AA 5IQ7L 2Z92A 3VXUB 3IJSB 1QD0A 5DWUL 2CD0A 5DRNA 1Q9OB 4WEBH 5IFJB 1L4IA 3OAUH 4LLWA 1KEMH 1YEIL 5F93C 1C5BL 2VDMH 4HBQA 3HZYA 5E94B 5BZDA 4JO2H 2VZ1A 2F15A 4I3GA 4X6CF 4K8RL 2R4RL 1TVBB 3K2UL 3L7EA 2EYTB 3DLQR 4OM1L 4Z5RB 1MHPH 5JR1L 1EEQA 4ODSH 3DX6B 1DN2A 2M2DA 1AJ7L 2NNAA 3RVTC 2HJFB 4M7KL 2DRUA 1NH6A 4NKDA 2WBJC 3VXPA 5IMKB 3ZTNH 5FHBL 3OB8A 2WQ8A 3KPRE 4MDJB 4D0CB 4YBQC 5C2BL 4QXWA 1KPRB 3WIIH 1G6RA 3L95B 1CGVA 4JRYE 1U95A 3SOBL 4GW1A 1A3RL 3A6CL 1ND0A 4WDIB 3GK8H 4JY4B 4F7CA 1HH6A 4TN9A 3U30B 1KENL 3GJEA 1RJYB 4D9RD 1BEYL 3O8XB 1KCUL 3RI5K 1BPVA 4M7LT 5EO9A 3T2PA 2A9MH 2EC8A 1VGKA 3HE6A 1T1ZA 4RISH 2EYRB 1FGVL 4ZUUA 3WO4C 4QHNA 5EUOE 3KLDA 4FTVA 4ZFGL 1I9RL 4UDTA 2HN7B 5FO9B 1FYHB 1QRNA 3UTSE 1TTUA 3W39B 2LQRA 4FNLL 3QDGE 5CILH 3SDCC 1T3FB 2XWJA 4ODHL 1BVLA 4G80A 5C08D 4C83A 3K4ZA 3BRGC 1EAPB 3JTTA 1AKJB 2UY7A 3MRPB 2J12B 4R90H 3QIBC 4RCAA 2EEDA 4NWTH 3CH8A 3GJFK 2DMBA 2NQCA 3BKML 3LQZB 4K3JL 5I1JH 1ZK9A 4ODTH 3GSXA 2GFBB 4HIXL 3MFGB 1EGJA 3B6SA 1NCCL 2ICWA 5I1DA 3MJ9A 3OKKA 2FR4B 2YPVL 1KPUB 3PL6D 4UQ2B 5ITBH 2CKBA 4DVRH 1R3IL 3BIAX 1XR8A 4IJ3C 4P23D 1X5YA 2BFVL 4PJGF 3L3IB 4LNRB 3GBMH 3ZDYE 5BRZD 1DEEB 3C08H 3SE8H 3KVQA 4UILL 3I6GB 4EDWH 3RP1A 2QL1A 3UJJL 5AZEL 3C60B 3FB6B 4TNVF 4ZUVA 1BJ1J 1I1AC 1JZ5A 3NCMA 4I2XE 4MNQB 4YXKH 4CN1A 4HGMA 3GMLA 3TZVB 1BAFH 2WUBH 1I1AA 3GGWB 5HHMB 1T1WB 1UEMA 3FQUB 3D87B 1UYWH 1YEDB 1PZ5B 2C1OB 2PXYC 2DMKA 3MA7A 3SJVA 1T80A 3BQUC 1MRDL 1N3NA 5CBAA 5K9JH 4PJ8B 4GW5B 5D1XD 2HTKD 4AQ1B 2FJHA 5TJWK 1P53A 3HPJB 4KKBC 2P44B 1I7ZA 4EN3C 2R69H 5GRUH 4HS6A 3RKPA 2HFEA 5HHQA 3R06B 1J1PH 3MRBB 1EEYA 3BP6A 3EO0B 1A9BB 4OF8A 1O7VA 3VWKA 1OAXH 5D96B 4EN3A 4PGEA 5LQBH 5IVNA 3K74B 1K6QH 4AJ0A 5EN2A 1JNNH 2UWEA 4JE4B 1UGNA 1N59A 1UH2A 2CJUH 3SGJA 4Q9QL 5DD5L 3VFTB 2UYLB 3W9EA 5DC9B 3ARRA 1FDLL 4LSPH 4Z0BH 3AB0C 3RTQD 3WV0A 3OWEA 5DEFB 3WE6A 1RK1A 3LV3B 4NM4L 2AK4E 5C0GA 4MHHI 5JXAL 4JM2C 2QADC 3DV6A 3F5WA 1ZLVH 2P49B 3OX8A 1MFCL 2KUTA 4NQCD 5SWQB 4NDMB 4S10A 3EYVA 3STLB 3SGEI 1AIFA 5T1KB 2W60B 5I17A 4XP1H 1JPGA 3VXUE 1FL5A 3GB7B 5KOVC 3SDXB 2DJ4A 3MMEB 3O4LA 1ORQB 1CXHA 2F54B 1IGFL 3QZWB 4JGUA 4YWGH 2WUCH 4L3EB 1JV5A 1D9KD 3C6SB 4IRJA 1YJDH 3GSNA 1NDMA 1U8KA 3I02B 1LD9B 3FQXB 4KUCF 5GS1B 3X14A 5IHZA 1UEYA 4R2GD 1A7PH 3CSYA 2IALA 4XGZA 4LVHC 3HR5A 5D2LA 3V6BR 1RJCA 3KWWB 2IADB 4PRNB 1QFWL 3PWLA 3UO1L 2FSEA 5H37G 1NL0H 4MVBD 5TF0A 3ZTJH 3HUJA 3KPSA 2H26B 1TCRA 5E9DE 1BLNB 3HI1B 1G9ML 4KHXL 5CEYA 2OL3L 1OP9A 4OBRA 1MQKL 4D2NA 1OGAA 2B5IC 4LHUB 2RCSL 4ZXBD 1QVOB 1U3JA 3OBAA 5CLTA 1SYVB 3TJHD 3OXSB 1JGUL 2XFXA 4UUJB 5B38A 3TA3A 3LSOA 4EEEA 4LSRH 1WEJL 2HT2D 5AD0A 3OAYH 1CDUA 4JN1H 3VFRB 3V6ZB 4G6KL 5E2VH 3LN5B 3N50A 5GGSA 4OCXH 4IMLB 1YY8A 5FGBA 5ANME 3SO3B 3BZEA 3CLFL 2VZSA 1FFQA 3VFPB 4MQXD 4E41D 2ICES 5HHNB 3W2DH 2BMKB 2C4FU 2YEZB 5I76B 3RY6C 4HJGB 4KZEL 5IW1B 2IH1A 3QHFL 1FGNH 4X7SL 5HYJD 3ZKSD 4Z76B 2BOCB 2LABA 3BW9A 1G0YR 5DEGB 1T2QL 2C7UA 2OI9C 5SX5H 1QFPA 3IXAA 3OKLB 5ESVB 1IGIH 3AXLA 1WBXB 1CFTA 4FXGA 3DRQA 5DJAA 1TTFA 4OF0A 2OCFD 4UT7L 5MI0C 3DBXB 2GT9A 4Q7DA 4CMMB 4G9FA 4UU9A 4X4ZA 4PJIF 3G5VB 2LTQB 4UMGA 2WINA 4ZODA 4XXDB 1FVDB 3ZHKA 2R15A 5DVOA 4OTXH 4R0LB 5TE6H 1KIRA 4X80L 3ULVH 5HHME 3BP5A 3RDTA 2PYFB 3VA2C 3QCVH 3T0XA 3TV3L 2QSCH 3GDBA 4NNYB 1WUNT 4HCRA 5J6GB 5GGVH 3RNKB 3N9GL 2YD5A 4JANB 4HUXA 3A67L 3V5KB 4HMCA 1Z3GH 2EECA 2F58H 1LP9E 3QNXB 1AI1L 4U6TA 4N0YL 4NO3A 3SGEH 4YDJA 2NXYD 1B88A 2E6PA 3VGDA 4JHBA 2X1XR 1I3GH 4DOHB 3R0NA 1UB6B 2DWDB 1Q38A 4NZRH 5LG1A 3MRQA 4PGJA 1UCBL 2A6IA 2XQBH 5FV2A 3TT1H 1A4JA 3LRGA 1A14L 5E00B 4L8SB 4YLQT 2I27N 2IF7A 1Q9KA 2B8OT 4FP8L 4G8FB 5E2UL 3LKPA 1YMMB 4AEFA 2YN5A 5BV7H 1UJ3B 3ZDZF 2M26A 2BVQA 1GGYA 2AKRA 4LPTA 3ZT6A 5IVOA 1A22B 2VH5L 1UENA 3MNWB 1MCHA 2IBZY 1OQXA 3MBEC 2RQ8A 4WIQA 3RU8L 4CADA 4LSQH 4XCNB 4X9HA 3MGOA 1DBMH 4HWZA 1XGTA 4IMKC 1FL3A 4P2RD 2Q86B 3SDXE 4DCQA 3PQYE 4JDTH 4ZAKD 2F54E 4AYFA 5FYKE 4IMKA 4CVZA 4DGIL 1YN6A 3EDJA 1IGYB 5F9OL 4L3EE 2K3TA 5I1AB 3HNVH 3WHXB 3VE0A 4P4KA 4YZFF 2H1PL 4XAKD 3NABH 4N8PA 2YSSA 1YPZB 1G7LB 3CC5A 5IW6A 4S2SA 1YQVH 4KI5C 4XCEA 1CR9L 3Q5TA 4APQC 4IOIA 2R0KL 4OGXH 2E9JA 5C2UB 4MAYA 3KPNB 1I75A 3TT3H 2KL6A 5ADPL 3ZE0F 4YBLB 2X1OA 4KRNA 3MRNB 1E0OB 4M4PA 1FORH 1AXTL 2V2WB 4XVJH 3QB7C 1TVHB 2BC4A 3QXTA 4ALAL 1TXKA 2F53E 4MD5A 3L3JB 5H35B 3WHE0 3CU1A 1D5XB 5CJOH 2BSTA 3RUGA 3ARQA 3VGAB 3EW3B 3FO2A 1Z0MA 2VDKL 2YZ1A 1IEBB 4GKSB 4LSTH 4JKLA 3W81A 2P5EA 5FM5M 2H9GB 2ESVA 1CIUA 1BBDH 4NQXA 5H2BA 3RWIB 1WBYA 4UT9L 3O3UN 5JORB 5ESAB 1RZ8B 2FYYB 3I50H 4FFYL 3CCHA 4ZOCA 3A0OA 3IU4H 4KKNA 1HKLH 2X42A 3TBWB 1R0AH 1A1MB 1INQA 4EOWL 5DJYB 3OJDB 4L8CB 3PJSA 1R5IB 1I1FB 3MRDB 4M6NH 2DDQH 4OLZL 4JY6B 3B8YA 4YUEL 4EI5B 3CZFB 2NW2A 1S9WA 4YGAB 3V0VB 4HQQH 3NCBB 2NY5C 4POYA 4I77H 4BQCA 1MFEL 2BZDA 2V2XB 1KJ2A 1ERNA 2O26U 4YHZL 1ZT4B 4ZPVA 2OQJB 3O6FC 4PTTB 4JG0H 3JWDC 5E1HB 3T0DA 4OFKA 3L3KA 3BVNB 1JZ8A 2HKHH 4XPBH 1LEIA 1HHJB 1FN4B 1S9YA 3TIDB 4CKVX 5IGXL 2EYSA 4HIJA 4P3WA 3SKJL 4W6YB 4OJFL 5GJTL 4M9OA 3RJQB 4LQ1A 2HKFH 4Z7WF 2HWZH 3MUGA 1EHAA 4JDVB 3WNMA 4Y89A 2HT4D 5ISZB 1JNHB 3QQ4A 4FN0A 5E6IB 1QSFB 4HIEA 4JQVC 1C08A 3GI8H 4MQTB 5IFAH 1E4KC 3NFPB 5C0JA 3PGDA 4JQVA 5DDHA 4KGJA 4X6DF 5FF6B 1T7WA 5C92A 3TBVA 2PYEB 1NMBL 4ACPA 1TVDA 5F1NB 4BH8B 1PG7H 1E4WH 1XGPB 3OKEB 2CUIA 4JG1L 4NQVA 4NSKB 4DOHE 1BZQK 5C08A 1ZHNA 4LCIL 3K0WA 4NZTH 4WVRA 1CE6B 1HHKA 1I7UB 3EYQD 2JK5B 5IBUG 1C7TA 1YEKH 3IFPA 1AGBA 4FRWA 4M7ZB 4PJ7B 5D7LD 1CFVH 5F1OB 3AAZA 1WF5A 5I66B 3QXUA 2MNUA 4K7PY 5FM8A 1MVUA 1MNUL 1T1YB 3HC3L 1XF4A 3IAQA 3PL6A 3FRUB 4R97C 1R5VA 4HH9A 3V8OA 3VXOB 2Y07H 4OZHB 4P23A 1IKNC 2HT3D 2OMNA 5DJ8A 3BUYA 2X9YA 3TYFB 1NGWB 1GSMA 1S9VB 3OGCB 4XNUH 5BRZA 1S8DA 3WNOA 3IDYC 4F9PC 2O61B 1W72H 2YK1H 2ZJSL 4Y5XC 1MRFL 3EYUL 3UX9B 5JZ7C 1KB5H 3BPLB 1CICC 1GIGH 4OKVB 3ARBB 2ADIA 3GSRB 5C0AB 4Y5XA 1N4XL 1JWMA 4QGYA 1IE5A 1UG9A 3MBXH 4YDIH 2HLAB 5AG8A 5FA4A 3VI3E 2HTKC 2HYMA 1G1YA 4LLWB 5IJKC 5D6CA 3P9MB 5D1XA 4XHQA 2HRPL 1ZLWH 3L7EB 3L3OB 3VD5A 4MNHA 3LRSA 2VXTL 1NGZA 4PG9B 2NNAB 4FFVD 2J4WL 1F4WH 3VXPB 3DUUA 4V2CB 4XCYB 3RVXD 5BZWA 3VG0H 4HDIA 3NCJL 5HI5D 2BNQD 4JFYA 2HTLC 1IBGL 2NCMA 5DUMH 2AV1A 1NKOA 1ND0B 2DB8A 4PJ5D 1HWHB 3RTQC 3X17A 4DEPC 4Z7NF 2E27L 4F7CB 3MV8E 1HH6B 4GUPA 2CIKA 3C2AH 3ZKQD 3WIFA 4XB7A 1JI1A 1ZLSH 4NO0D 2XXCB 1C8PA 3RTQA 4UT6H 1RU9H 5EO9B 1VGKB 3AS2A 3HE6B 5L2KB 5FYLL 2FBJL 3TYGH 4FFWD 2W0FA 4ZUUB 4QHNB 4X8XA 2VABA 1SBSH 4FTVB 4X5XA 3VWJD 4Y16D 5T3ZL 4KRLB 1QRNB 3QUZC 4NQCA 1KELH 4RFEA 1EMTL 1NC4D 2BHUA 2XWJB 3V6OC 1BVLB 5A3ID 4UIMA 4G80B 5FCUH 4RSVA 5FGSA 3SBWC 2X10A 4C83B 1ORSA 3CH1A 3VFUA 4XPHH 3JTTB 1X5KA 3QAZB 3UJIH 3V6OA 2AJVH 5CJBA 1XFPA 5AYUL 3SBWA 4POZC 4KROD 3GSXB 4NUJA 3QULA 1AO7D 2WZPD 2IC2A 2DQFB 4P46D 4PPTA 3OKKB 1D9KA 4PP1D 1T20A 4LLQA 2CKBB 1G7JA 1XR8B 5MEOA 4I48A 1S7XA 3QPXL 1FZJA 3WL9A 2JIXD 1HSBA 4LDEB 4LMQE 5EPMA 1DBBL 2IQ9H 5IWLA 1I3UA 1FO0L 1C5CL 5B4MD 5DD0L 3GMLB 4AL8L 4NN5B 3SDDD 1S3KH 4XC3H 1QSFE 4R3SA 4KH2A 5FYJE 3WKMH 4R6UA 4GAGL 5HGDA 3D85D 1RIVL 2UZIL 3QFJB 1N3NB 5CBAB 2FGWH 1KJMA 3L6FB 3OJ2C 1D7FA 2FJHB 1UQSB 5E95B 3UYRH 4ODVH 1OAKH 1UXWA 5EC2A 1I7ZB 4LPWA 2PYEE 1WVZA 4HS6B 2HFEB 2G60L 1AXSA 4F37K 3NIGF 4FQIL 5L6YL 4S0SD 3WFDL 3HRZA 3GSQB 4EKXA 3VWKB 2DQUH 4P2YA 4F7TA 3WIHH 1TZGL 1ZT1A 3K1DA 3INUH 4QHUA 1KCRL 5J3HC 4WW2B 1J12A 4KFZC 5EN2B 4PJ7E 2UWEB 1N59B 3S34L 3W9EB 4P5TD 5DSCA 5HYJA 2VR9A 3WE6B 2AXJA 1RK1B 5CGTA 1U2HA 4X99B 1G7MA 1GGIL 1FPTH 4C59B 5IBLD 1S5HB 1X3DA 3DURB 4LVOB 4OGAD 3DV6B 4XCFH 3F5WB 1DLHA 1UM4H 4WTWA 1JPSL 3VGBA 5HGGS 1DQML 3OKOA 5GZOC 3KPOA 5CZVL 2IQAA 3QEGL 2IG2L 3HN3A 3NA9H 3VXRD 3EYVB 5FUZH 2B4CC 1AIFB 4PRIB 2PW2A 1YEHH 2R29H 5I17B 4Q9RH 4M5ZH 5C0AE 1JPGB 5J12B 3T65A 2DQHL 5HVHB 1FL5B 4TUKL 4ZYKB 1ZTXL 3O4LB 3UTQA 4QRRD 2X9WA 3VGHA 1J5OH 1H0DA 4TNWF 5J13B 4AMKL 4F7EA 4OCRH 1JV5B 3U0TA 1V7ML 3MA9L 4I18A 3GSNB 1NDMB 1U8KB 3T2NH 2VC2H 4V1DE 5IHZB 1IEAA 2NXYC 4RGND 2IALB 5DHYA 5F9JA 4PJ9C 3HR5B 1T7VA 5IFHL 1MRCL 3GMQB 2BERA 4K94H 3PWLB 4MD4A 1OWRM 1U3HC 3S96A 2FSEB 1NFIB 2X44D 4MZ2A 1GHFL 2I24N 3HUJB 3KPSB 5KJRH 1TCRB 5DJCA 2AK1H 4QRUA 1Q0XL 4OUUB 3HLAA 2J8UF 4GG6F 4JFFE 4HC1A 1URLA 3ULUE 4Z0XB 5CEYB 3RWGA 1U3HA 3GZKA 3SE4C 4J2XA 3WYRA 5IV2B 4PJXA 1XIWC 3WNNA 2H2PD 3W82A 5A16A 3PHQA 4GRLC 1IMHC 2EDWA 4X7TA 3LY6A 2EH8H 5L2KE 4S1DC 4M8QB 3MPCA 5IMMB 2EIEA 2V5TA 3LSOB 1CCZA 2FBOJ 2OR9H 5AD0B 5EIIB 5TDPA 2X40A 5DJ2A 1W0VB 2RR3A 3RWDA 4H1LB 3S3PA 5GGSB 3F58L 2YKLH 1YY8B 4U7MA 4F57H 5HVFB 1TITA 3BZEB 1ADQA 4GXUN 5HVWA 5CMAA 3AY4C 4WY7L 4YHYC 3JUZA 4NM8H 5IIEB 3VXQA 3LS5L 4XNYH 4LASL 1T2XA 4ZAKA 1NEZG 3AY4A 5JDSA 4U7KA 2IH1B 4GS7C 5EU6B 2ZNXA 5GS2H 2BCKB 1AGFA 2H6PA 4J3SA 3QNZA 4PRHD 3DGCR 3BW9B 3PE9A 3K7UA 4X4YB 4U6VH 3IXAB 2DLGA 1MI5E 5GGTL 3O2VL 2JKXA 3AXLB 5DF0A 1CFTB 4FXGB 3DRQB 5DJAB 2BJML 1N5YH 1DFBH 5IW3A 4M62H 1T04A 1AHWA 3QQNA 4G9FB 4UU9B 1DL7H 3N06B 5DI8A 3LDBC 5HD8C 2WINB 4U3XA 1UWGL 5I6XB 1U6AH 1F3JA 2C26A 5I30H <