4H8WL

Crystal structure of non-neutralizing and adcc-potent antibody n5-i5 in complex with hiv-1 clade a/e gp120 and scd4.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
212
Chain Sequence
SALTQPASVSGSPGQSITISCTGTSSDVGSYNFVSWYQQHPGKAPKLMIYEVSERPSGISNRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGSTTFRVFGGGTKLTVRGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Definition of an Antibody-Dependent Cellular Cytotoxicity Response Implicated in Reduced Risk for HIV-1 Infection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
molecule keywords HIV-1 CLADE A/E 93TH057 (H375S) GP120
total genus 45
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h8wL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h8wL02
1MQKH 5D7KE 1DFBL 5T1LB 3TBTA 4JFDB 1Q1JH 2XPGA 3WS6A 4F2MB 4XPGL 2BNQE 1MREH 1BQHA 4JM4L 3SJVE 4OZ4A 1NCWH 3RKDD 1K3ZA 1IGCH 1KN4H 4UDTA 4YQXL 1Z0NA 2Y5EA 2RB8A 4JN1L 2PN5A 2XN9A 1YEIL 2DIAA 3NA4A 1IKNA 4OQTA 2UUDK 3PABA 4J3WA 4F58H 1CLZL 3OKEB 5I1CL 2X4OA 43CAA 4PJIE 1AGEA 4JVUA 5DRZB 4K3GA 4JZNA 5EBWB 1D6VH 3IYLW 3PQYD 4DKAA 3SDDB 1QRKA 3F65A 1GGYA 4XVUD 4L29B 4MXWL 5EWIL 3KYNB 1P4LA 1CICD 4I0PD 2D7TH 3VFRA 1FNSH 1AXSA 1K3IA 1CICB 4LQ1A 2ZSVA 1FV1B 4PV9A 3GMNB 1RURL 2PXYD 3MLZH 2HFTA 3RL1B 1KCRH 4G43A 4HAGA 4ZUSA 2RCSL 4KUCF 5DJ6B 4HJJL 5CZXD 1D5XA 2GYSA 2HVJB 4MHHI 3RUGA 2CIKB 3WLWD 4UTAL 5D72H 4HIJB 2ADIB 2MKLC 3FONA 3RGVD 4D9QD 4IMKA 2VN4A 3CXDL 4OGAD 2WV3A 3S4SG 3LQZA 4PY8J 1EAPB 1TPXB 5CZXC 1JWSA 2DIBA 3D25A 4M5YL 4POYA 1OARL 3MGTA 4RNRB 4Z7WF 4FQCH 5IVZB 4AEFA 1UCTA 3KPSB 4WWID 2OTWB 2YRPA 1HDMB 2IALA 4IOIA 1TJHL 5CJXC 5D7SL 3DVFA 2L4OA 1D6VL 4XMLH 3MJ7B 1W72B 1UQSB 3QUKB 2YC1A 1QSFA 3MRLA 2BNQD 1L7TH 4WHYG 4NPYB 3GMRB 1RZGB 4XVUC 4MA3A 4JO1L 3UBXB 5F3HA 3WLBA 3QQ4B 4X6FA 5E8NB 3OR6B 1EPFA 1HIMH 4OM0L 1FLRH 4JG0H 1K8IA 1MHPH 1XF5A 1T0MA 2XFXA 5L2KD 1AKJA 4ONGL 4JVWA 5ANMB 3VD3A 4FZEL 4I4WA 2R69L 3WFEL 1U8OA 2A9MH 2ZNWA 2AEPL 5C08D 3EYOA 3BQUA 5DYOA 1FVEA 1IEAA 3QI9D 4L8DA 5BXFA 4HXAH 4I2XA 1HI6A 4FA8A 4XNUH 4G8GE 3ZT7A 1KUMA 1QUNA 3PV6A 4TN9A 2D3VA 2IQ9L 3BSZH 2AJUH 3BZ4B 5I1EL 4R4ND 3BYTA 3LKOA 1DVFB 1TITA 2MHAA 3LS4L 1MRFH 2NMSA 4WU5A 2XWBA 4Y4KC 3GJFK 1D3CA 5FYKD 1I3GH 5J1AA 1Q72L 1JNJA 4H25B 1SMOA 4NN7C 3RWCA 5MEND 4R0LA 3IU4L 1UENA 5KG9A 4FP8L 2CIIA 3RAJL 3TPUA 1F3JB 3HI5H 2COQA 3L3OB 3C8KA 1U9KA 1M05B 2B1AL 1WVZA 2CK0H 1JGDB 3EGSA 5GGUB 3SCMA 1AD9B 3FRUA 4IOSD 5I19H 1EMTH 1D5MA 3TA3C 1A3QA 1B4JH 4P0DA 4ZOBA 1JUFA 3FQRA 3WFEH 3P4NA 5ICXA 4DOHB 4QHLA 2A77H 1I1RA 1MFCH 3QUMA 2YKLH 2D7MA 4LBEA 3SOBL 5B38G 25C8H 3O4OC 2VQUA 4PGCB 4K23H 4Q2ZB 4NBXB 5IHUH 3MLXH 3MBEB 4XH2B 1MJ8L 3A0OA 4EOWH 2IQ9H 4CVUA 3QNZA 4K3DL 4LSSH 1QG3A 3C09B 4O2EA 4JDTL 2DWDB 1OP5K 1T1WA 4L8SA 3OJDA 5I8EB 1JBJA 3BD5A 2GEEA 4CADB 3MRIA 3VXRD 4L8BA 1Q0YL 3AMLA 4O5LL 1FL6A 1CGVA 1II4E 3GSOA 3CIQA 2ZP0T 2GK0B 1I7ZA 3MCG1 2VMFA 2E6JA 4RFEB 4H0HB 3DVNA 1R24B 1GPOL 4FP8H 5HDOA 5KVFH 3HUJE 5D1XD 1MWAH 2GJZB 4QLRA 2WNGA 1KEML 4M1CC 1JF1B 5JHLL 1CLYL 4M1DL 5L8LB 1T5XB 4LOUC 4M6OL 1IARB 3QDJA 5DQDH 5DYOB 4PJ8C 4M02A 2YWZA 3ESUF 1KT2B 2PKDA 3JV4A 1ZV5A 3OF6A 4LAQL 1JGEA 2GSIA 3WFBH 4RCAA 1DQJB 3AVEA 1AIFB 1O5DT 3DV4A 1CI5A 1X6NA 1CL7H 4PJ8A 1HCVA 3AAZA 4GLRI 3T0EB 5GGVH 4JKKA 3L3HB 3VU2A 4BFBD 2F8VA 2M8XA 5I0DA 3L3GB 4I3SH 4L4TD 1MHEA 1Z9MA 3AC0A 5SWZD 3WHE0 2JJWA 4PJGB 4WUUA 1EERB 4BA8A 1ZVSB 3N9GL 2VISB 4C56A 2P4AB 2NY4B 2V5TA 5DMGC 1AGCB 1G6RH 3LH2L 3JVGC 3MLUL 5DUPH 3UTSB 5GSVB 2AABH 3CH8A 4TULL 4MNQE 5D8JL 5AZ2H 1C08A 2NY6B 5GJSH 5DXWA 4Q9BA 1BIHA 3H6JA 5FGCE 4RMUA 3T0XA 5KSBE 2WK2A 4MJIE 5KG9B 2O5YH 5DD3L 3TP4A 1EAJA 1GZQB 1TNNA 1GJIA 4X7EC 2XWJB 3GJEA 1HHJA 4KDWA 1XCQB 1KJMA 1OT2A 1PX3A 5I74C 2NXZB 4H8WL 1Z5LA 4LPUA 2OJZL 5BVPH 2WLYA 1J7VR 1BX2B 4I1NB 2ENSA 3PABB 2VLME 3PQYE 3S4SB 2DQIH 1KCSH 1TJGL 3NTCL 2CLVA 2I60H 3RY6C 1U3HC 2X1XR 4HUVA 3PE9A 2IPTL 5IW1B 2VXTH 4FQ2L 3EOYG 4L9LC 3MNZA 1VFAA 3OV6A 5E6ID 4OBRA 2R0WL 4BH7A 3BYYA 1SJHB 4YK4C 4Z9KB 1A9BA 1ZA3B 3GK8H 2DWDA 4YAQA 5ANME 4PV9B 3Q2CA 3IFNH 2WBJA 3FO0H 3MRHA 5E00A 4EI5D 1JPTL 2Y5TB 4J6RL 4NRZB 1YMHA 1TZIB 2RCSH 4GW1B 1T1ZB 3FFCB 3JTTA 1E4XI 3RUGB 4AEEA 5DRZA 4K94H 4E41D 3HAEG 3BP5A 3DVNB 3X12A 5KZCD 1KYOK 1KCLA 5TDNB 5EBWA 2LTQC 3DX9B 3IFLH 2A83B 4XMKH 3ZKMC 2D0GA 1J88A 5GS1B 4GUPB 1P9MC 3HPJB 3MFFA 4D8PA 3VFOB 3MREA 4QKXB 1V3LA 4YC2B 4OD2B 4NNXB 1EMTL 4P2OC 3A6BH 1ZTXL 3QHZH 3IDGB 3WUWG 2J1KA 3MGOB 4P2OD 4HHAB 2FYYB 1JNNL 5GRUL 1FGNH 4G8FB 5IOPA 2NX5E 3UP1A 3CLEL 3GMLA 1QR1A 3CD4A 4JPWH 2H45A 1F58L 1D5XB 3BESR 1MHEB 3HS0A 3FONB 4XBPB 5DHVB 3C08H 1GIGH 5BW7A 5L2KE 3KLDA 1FDLH 5HGAA 4P3CL 1QVOA 1PQZB 1E4WH 3IJYA 4OIAA 3TO4A 1U95B 1DJSA 3K8MA 4NKMA 3WD5L 1RJLA 3QUYA 4NUJA 2AK4E 2D0HA 1G9NH 1WBZB 5EIIA 3SDDC 3LRSA 5D6CB 3N1PC 3SJVB 1BFVL 2VL5A 1HHIA 3BQUB 5I8OH 4GG6A 2YC1B 2BVQB 3RVTC 2Q87A 1TVHB 3BW9A 2I9TB 2NY0C 1OQOA 3EBAA 1DEEA 4D0CA 1NLDH 2NQCA 3OGOE 1RAMA 3QHTC 1QNZL 2R29L 2HFFB 4PGBA 2Y36L 5DD5H 1JI1A 2OZ4H 3UBXG 3LQMA 4WU5B 3OF6D 3HG1E 4DGVH 4F8QA 3QR2A 2XXMB 4W6YB 3M1BB 3D6GA 1Q9WA 4ZDHB 3ARVA 4ELME 4D94A 4FXLA 4LSTL 1NCTA 3VG9B 1ERNA 1QLRB 1NGXB 2HYMA 1FIEA 3O45A 4R0LB 2NXYD 3EYOB 3UTZA 2ZCHH 3QWOA 2FIKB 3TT1L 3B3IA 1T3FA 2E5EA 5D7JA 3U30C 4AT6B 1I7UB 2ED7A 1J8HB 5TE6H 4YUEL 3FFCA 3JTTB 3VFPA 3W11D 2X40A 4GAGL 5KSBF 1R6VA 5DMGD 2P49B 3U7WH 1GXEA 4K94L 4KVNH 1BEYL 3W81A 3TWCH 3VGAC 4F7MB 1F6AB 3VGDA 4HT1H 4JY4B 5IFHL 3VWKA 3BEVA 3WXWH 3LKNA 4QRRE 4ODHH 2VITA 3WS6C 3HE7A 3MREB 1XCTA 5J1AB 1CLZH 4EDXA 3IVKA 1FAIL 3MR9A 4YBLB 2XPGB 3UYPA 1PKOA 4YZFE 4WCYL 3FQWA 3H7LA 4RGNB 4UT9L 4IEFB 1IKNC 3GJFA 4K3DH 3UPCA 1WWCA 1RZKL 1R3HA 5BV7C 1I9IL 1MAML 3X11B 2Y7QB 3ARBD 3SCMB 4MDJB 2HKHH 1MEXL 4S1RL 5D5MA 4I3RL 4QYOB 5D1QA 5ITBL 4JFZL 5DJ8A 4WNQA 4M7KH 3QNYA 3B5HA 1I1AA 3THMH 4M48H 2FRGP 1MCWM 1JPTH 3BFOA 5DJYB 1JHLH 3IS0X 3QI9B 2NY1B 1W72L 1FSKC 2L7JA 4P49A 2YD5A 3PXHA 3WDIA 2JCCA 1I1AC 5KVEH 3BGAA 4EXKA 5CAYB 2DJ4A 3IFOB 4ZPVA 3D3VA 1MI5D 1NAML 1QO3B 4U1IA 4Z7OF 2VL5B 4M6OH 2XA8L 3PWLB 4KVNL 1HQ4A 2DB8A 4MNHA 1FH5H 1IBGH 3OJMB 3BAEL 1LK2B 3WJLA 3DETD 3KPSE 4YQXH 4ZFOL 3WJJA 4QF1B 2EO9A 4PJAE 3ARUA 4WUUB 3VW3L 2DBLL 1CTOA 2CMRL 3RKPA 2WIMA 2PXYB 5FGSA 4PB0L 5KJRH 1JTOA 4KUZL 1OM3H 3TJEH 3RIAK 4P48A 4UV7L 4RNRA 2Q86B 1UJ3C 3F58L 5CS7A 4DKDC 4BZ2L 3ROOA 4X0KA 5EBLB 2NY0B 4PBXA 4FQJL 5B38A 1QA9B 3TBYA 5CP7B 1HNFA 1V5JA 3MBED 5FHBL 1KTKE 3H2WA 3L3GA 4L4VD 1AKJD 2XTJE 3NTCH 4HUXB 4WHTA 3SE3C 5J56B 3K4ZA 4YDLC 4RIRB 3MRNB 5D9SB 1IQDA 1FNGB 1SBSH 2E7BA 3LQAL 1UADC 5C0EB 4R4NC 1JYNA 5KTEH 2A9NH 1DBJL 2NYYD 1DVFD 3T65A 4F7TB 1KNOA 3N06B 2LFGA 2R0WH 2GITB 3FRPA 4F58L 5HI5C 2BVUA 2ZSWA 3QI9C 3HG1A 3IDJA 1A7NL 2V5MA 3BKML 4PRPA 3V6BR 3MRPA 3QA3A 4XP5L 1CE1H 4I13B 1MRDL 2CUIA 1R3KA 3MJ6A 1P5VA 2BNUA 2WINA 2LAGB 3ZT6A 3P3YA 1I7TA 2H2PD 1WV7T 1YA5A 5E8PB 5TPWL 1HOCB 1HH9B 1UM5L 5T3XE 3STZA 4G6MH 2W9LA 2YK1H 1ACYH 1DN0B 1CU4H 4N0YH 5IHZB 3MBXH 4OAWB 2FH6A 1MHCA 3K7UA 1KENL 1NCNA 2ZNXA 4MNGE 3QUMH 2LTQB 3VXOB 4ZS7L 5SWSB 1H3PH 4DN3H 3M8OL 1R3IL 4U6TA 3IDGA 2D4FA 4N9OB 1DQMH 2YD1A 4PRAB 2IPTH 4GAJH 1DEDA 4WW1A 4Z6AT 3DGGB 2NTFB 3NCJL 2W9DL 4PTTB 4GG6F 1T1ZA 3EGSB 5ICZB 5C0AA 4AG4L 4XI5C 3MV9A 4KRPB 3NFNB 4JE4B 2Q8BL 4Y4HC 4FN0A 5TDNA 4RRPA 1RZJH 4LHUG 2APVA 1RJCA 2AK4D 4MQXC 3BN3B 3HLAA 2CMRH 2AGJL 4FQ1H 3WLWC 2J8UF 2BSRA 3QEUB 1QVOB 5ACMA 4R0LC 3SDCC 3VRLF 1SJXA 4HKZA 1T2JA 5TGBA 1CGXA 2Q86A 4F3FA 4KTEL 4BFIA 3RWHB 1E27A 4U0QB 3IJHB 1T5WB 4RGOH 1HWGB 2YSSA 3IU3B 1PD6A 2VXQL 4KI5E 4YPGB 4J3SA 5I8EA 1KTDA 4S2SA 1MRCL 2NLJB 1ZMYA 5GZNC 1IGIL 3VXTA 3DO7A 3ILPB 1F13A 3V7MA 4I0PC 3CPLB 4TSAH 4KXZH 2F9BT 4HUWB 4ZPTB 3T2NL 4RAHA 1G6VK 3ARDC 2Q7NA 4J3UA 4JFHE 4X6DE 5C0EA 4KKBD 3RPIB 3MUJA 4WHCA 1OTTC 1RIVL 3OTTA 3CVHH 3LHPL 2EXYC 1IE5A 4P9MH 3LKRB 1A6TA 2F5AL 2XA3A 1NEUA 1QEWA 4LKXA 4ALAL 3RIAF 1Z3GL 5C0BE 5IT2H 1YNKL 1MJ7L 1NUDA 3RWIB 5I2IA 4XPBL 1LEKA 4TQEH 4MD4A 3PGFL 5FGCB 1CDHA 2XN9B 4MAYD 1JL8A 4IHOA 1IM3A 3P30H 4WY7H 3TJEL 4E41E 1P7KB 3AAZB 4MD5A 5HVWA 3BWAB 3QEQA 3T04D 1QLEL 1GGIL 3ARGC 2VDOL 3C5JA 2E9IA 4GO6B 3ARZA 1JZ7A 4PJGA 1AGFB 4X7SL 4B53A 3D69B 4OSUH 2V9QA 3OJVC 5BVPL 1OPGL 3PL6B 1WT5C 4UNUA 1CD9B 2HA1A 5F88B 5C8JA 1ZE3C 2R2BA 3RDTC 1SYSA 4OLVL 1FAKT 2IAMC 2FECL 2GJ6D 3VXSA 3GZKA 3F6LA 4Q58C 3KPRA 3GMNA 4NFBA 3PP4L 3TPKA 1DQML 4FFVD 1JNNH 5GRUH 4PGEA 3WN5A 4P23C 3P4OA 1J8HA 3UJIL 3VFPB 3LMJL 3KVQA 3VD9A 4OFDA 1NCAH 4XAKE 4Y5XA 4Z7QF 1BFSA 4XGZA 3U36A 2V7NA 4HBQA 1RVFL 3BZDA 1F97A 2FBJH 3VWJD 1EJ6A 4G9FD 4RGNC 4M8QB 4UBDD 2VLJE 3UPRB 3QIWB 3NABH 4YFDB 4JZJA 4L9DA 1BZ7B 3U7AA 1ZXQA 4EUPB 1MREL 5C0GA 1DUZB 3B4NA 5F1IB 3GUTB 4YAQB 1C7SA 1S5IH 5DC4B 5CGMA 5J1SC 1A8JH 3D0LA 4YBHA 5JUEL 4GXVL 4PRBA 3ISWA 2OJZH 2A0LD 5EULV 5FO9B 5HY9B 3FO1B 3A6BL 1ORQA 3QHZL 4P2RA 4APQD 5JIPA 4MJ5A 3P9MA 4DN4L 3LB6D 5DJ8B 3CSBA 3B9KD 4UQ2A 5JDJA 3FB8B 1SHMA 2AJ3B 1A14L 3QP3A 3GBMH 1MIMH 4MD0B 4P2OA 3FAXA 4XBGA 4PJDA 3PDDA 4UT7L 4RMQA 4TRPL 5E5UB 3D3VB 2R0LL 3L5XL 1MJ7H 4PYGA 1FVEB 4MB4A 4AEHH 1RVFH 1S7VB 2KPNA 4HUKB 4X9BA 4KKAD 5L6YL 2FBJL 4YHPB 5IOPB 1KXTB 1FG9C 4PLNC 5F7EL 4U1HA 3QDJD 5EUKB 2X70B 4WW2B 4OCXH 5C3TA 1AE6L 2C3VB 1KIQB 1WQVT 3PWUA 3U6RB 1WZ1L 2J88L 2A9ML 4P5MA 4JO3L 5J6GA 2DICA 2IFGA 4IS6A 5B22A 3O6FC 4N68A 3X14B 1RD6A 3MV9D 4HWEL 1TJGH 4OKDA 1U8KB 4PJEB 4XB8A 2P8PA 4DFHA 4PRPB 2DBJA 1HHIB 3ES6B 5F1KC 1ZSDB 4NJAL 1S7SA 1GGCH 1MFDL 1IC1A 2EE6A 1SY6A 3GO1L 1D6EB 3G6JB 4ELKB 4WU7B 4E41A 3WS3B 4HIXL 4AIXA 3AU1A 1NGWB 1NMAL 3P4NB 4Z7UE 5I73C 5D2LE 4EJ1C 2X4NB 4PJGE 3C08L 1MCRA 5DUPL 2R2CA 4L5FL 2GTZB 4Z7UF 4EVNA 1HKLH 2UY7A 3G08B 4XWGL 5D8JH 3TJHC 2GY5A 4FRWA 3WIIH 3CFDA 2E6QA 1FFQA 4EUPA 2YRZA 4YR6B 2GK2A 4XVJL 3GMPA 3C60B 2P5WA 2YPVH 2CGRL 2AEQL 3S7GA 3AY4C 3E1F1 5E2UL 3QRGH 2V2TB 1NCBH 1IL1B 4JFEA 5A43C 1JGVH 4L9LB 3AY4A 3MRQA 4MAYA 5T1KB 3U9PL 5IMOB 4FQHB 4MXWH 5EWIH 4E5XA 2OCFD 3Q1SL 1S7XB 2ATKB 3RUGF 2RFXA 3RVXD 1XCTB 3G6JE 4Y4FC 3SY0B 5D2NA 2ESVB 3OHXA 2QKIA 4JCLA 5FKAA 4K71C 1X7QB 3T77B 1ORSB 3ZKSD 4TOYH 4HIXH 1XGYH 2W0FB 3CUPA 4U7MA 4YHYC 1K4DA 1U8LB 5JPMB 4EDWL 3K81A 3PL6D 3LDBB 4X9HA 3MUGB 5HYEA 1ZHKB 5D70H 3FOMA 3R8QA 4F9PC 1NC2D 1WEJH 1TCRB 3G5VA 5JHLH 4W68A 1KV3A 4X99A 4LCUA 3QDGA 1CQKA 3QFJA 2MOVA 4R8WL 1WSST 3RX5A 1RIHL 3UC0L 4XP6L 4PJCE 1WZKA 3RVVD 4F37F 4M00A 1QOKA 1N59A 3CVHB 4NZDA 1PJ9A 3MLWL 1JPFB 4MNGA 1DDHA 4LKXB 2UYLB 1UZ8A 2ICCA 1ZTXH 4NC0B 3GJEB 1HHJB 5HI4C 4D9LL 5I2IB 2FD6H 1K4CB 3LV3B 1DANU 3FB6A 1RIUL 4U1MB 1YUHA 4OZFB 4M43L 2YN5A 3X3FL 4NRYA 5HHQB 3GDBA 2W0PA 4F57H 5I75C 3TIEB 3V95A 1WLHA 1P7KA 1UC6A 2G60L 1UM5H 4JHZA 1DUYA 2IJ0C 4YWGH 2ZG1A 3BZ4A 4PJCF 4HUVB 3U0PA 2KH2B 3RPIA 4RMRA 5EZJB 5EZOL 3O6FB 5KVFL 1FFNB 1HIML 1UJ3A 4P99A 3NFSH 1U36A 2JB5L 1U6AH 1SYSB 5T3ZL 3AREA 5F7NC 2EC8A 2VTFA 1U8JA 5C09B 1FJ1A 1ZHLB 3UXFA 3EO1B 4XP1H 4AIZA 1JRHI 4LRNL 1NCWL 4XXCA 2QSTA 3GSVB 4QRUA 2HH0L 2Q76A 3MOBL 4KMTL 3W2DH 3QXDB 4FQ2H 4I2XE 3FKUS 4NBZB 5FM4A 4IJ3C 3FRUB 4ZOAA 3JTSB 3ZKNC 1KLUA 1Z3GH 4XXCC 3PHQB 2EH8L 3U82B 3Q6GL 4NKOA 2JIXB 4LHUB 5DD5L 1K2DB 3R06A 3SE4A 5HHOA 4E5XB 2AXFA 5F88A 4AENB 3MLUH 5JR1H 5KSBB 3QYCA 3QUMB 4HS8L 4K94C 2XY2A 2R4SL 1A7RH 1U8MA 4KTEH 5FYJD 32C2A 3RNQB 3MRBB 2R1YB 1XIWC 4G6ML 5JW4M 2O5YL 2ARJA 7FABL 2ZCHL 3ABZA 4PJXA 4YXLH 1NDGA 3O3EA 4FQXC 5ESVB 1ZA6A 5C9JB 2WIIA 4HGKC 2YPLD 3CXHJ 5I76A 4GRMB 3TBWB 3LOWA 3QDGB 3BN9D 3FQNB 1DQLH 2IH1A 1X4ZA 3O3AA 5C6WH 2XA8H 4JZNB 3D85A 4YXHL 3ULUH 5CHNB 1PKQA 5LAXB 5DEFA 1JV5A 2VUOA 2HT3D 1KPUA 3NCCB 1UB5B 1FRGH 2W38A 2X1WL 4BSJA 5EG6C 4Y4KA 1INEH 1AXSB 1ZGLP 5E7BA 1BOGA 1FV1A 4HLZH 4QHKJ 1KYOJ 4P2CG 2VQ1A 4BH8A 2AK4A 3PGDA 3UROR 5BRZE 1RIUH 3HNTH 1V3JA 2VE6A 3F7PC 2V5SA 4KU1A 4PTTA 5FUZL 5IWLC 4OIIL 5EUKA 2R4SH 4RISL 2E6PA 3S34L 1G9MH 2ADIA 3FOLA 4U0RC 3NN8B 1AGBB 2Z93A 1FFPB 5I8CA 1H3UA 1MRCH 1MCFA 2YEZA 5I8OL 2EDQA 1LE5A 2RHEA 5E24E 4U6VH 5CLWA 3AREB 3OL2A 1QBBA 4ZUVA 5TFSL 1QPXA 3O11A 4LNRA 4QGTA 3I6GB 3AM8A 3IS1X 4Q0XL 4C57C 3W0WB 4G9DA 4JFOA 1KB5A 3MNWB 4XAWH 5E95B 5KOVC 1Z5LB 4QXUL 5JMOC 1W72A 1UQSA 1IGJB 2G5BB 2NW2B 4F7EB 3FT4B 2BY0A 3OKLA 3X17A 2C3GA 3PHOA 4RZCA 2HWZL 4NQCE 4KHTH 5EC1A 4YHKL 3NA9L 3TH2T 1Q0XH 4L3AA 5T33L 2CDGB 4OCWH 1S9YA 3TBVA 5C70A 3T2PA 3X3FH 4EDXB 2DAVA 4JFXA 3QIBA 4MCYB 2JJTC 1GGIH 2FX7H 5FYLH 4WEUD 2ZUQC 1U8KA 5FKPA 3OB0K 2F5BH 4PGDA 5D5MF 3S98A 7FABH 4U6YB 2XY1A 3HFML 1DBML 4QNPF 2VDNH 3LD8B 4HCRH 4V1DB 2ICEA 4HZLB 4DZBB 5D5ME 2WIIB 3S36H 3QQ9C 5TQ0L 5D1QB 3ARED 3K80A 3BWAA 2AKRA 3A6OA 3RQ3A 1OGTA 3O6MH 4H88H 3LKSA 1MY7A 4YBLC 4FQHA 2YBRA 3FQTA 3FN0H 4Z8FH 1EEZB 4JQVC 1KPUB 1VA9A 4NNXA 4J23A 4QRRD 4NQSA 3RTQC 3TFKC 1MELA 4P2RE 3RZCA 5KAQF 1FVDB 1YN6B 2APWA 5FB8B 1JNHA 1E4WL 1IKFL 4ZQKA 1CZ8H 4MA1B 4OCWL 3PDOA 1DBBL 1AO7A 2BSED 4Z76A 3NCYP 4EI6B 4NC1C 3DWTA 1OSPH 4NIKB 4X8JA 4HW6A 1N4XH 2EO1A 4WEBL 4O4YH 3FQUB 1WISA 5IMOA 2IBZX 2IAMA 4AMKL 4OBSA 1X5XA 2Z8WC 2H9GB 1U8PB 2DTSA 1IFHL 1T1XB 2B39A 2F53A 5GPRA 4U6VL 2W1NA 2ZOKA 4QHNA 1S9WB 5DJZA 2CO7B 4PJEE 3VI4F 1G9NC 2Y36H 4NKIL 5F6HJ 1V3KA 4QT5A 1WGOA 3TO4D 1GAFL 3U2SA 4ETYA 3B2UC 5DQDL 3RX7A 2X09A 3DTXB 2JB6A 1GOHA 1OTUD 2BK8A 4HK3J 4XC3H 2EDHA 3HRPA 5I66A 2F5AH 4UV7H 1LO5A 4M7LH 4BKLB 4GBXA 2HFFA 4LSPL 5KSVA 2V9RA 1XGRB 4I3SL 1NUGA 3QIWC 1T66C 4ZNEE 5ELIA 3ZTJH 3FN3A 5DD1L 1OTUC 1OAYH 2XACC 3BE1L 3KPOB 1DTUA 5C0FB 2HTKC 3KJ6L 1N59B 5D70L 3BJ91 1MVUA 3WCYA 2F19H 2GITA 3VMNA 3SO5A 2VLJA 1KGCE 3CH1B 4KZDH 4GAGH 1QLRA 1T22A 2R1XB 2Z35B 4G8EB 4CN1A 4X4ME 3MRPB 1VGKB 5DHVH 1JYXA 4EKXA 3MV7B 1F5WA 4PG9A 1WFUA 2M2DA 1XF4B 1ZGLB 2NPLX 3LQAH 3S9DB 4XX1E 1FO0H 5D7LB 2IAMD 2VDQH 1AIFA 3VFMA 1JPSL 1P69B 2Z8RA 1M6OB 1HH9A 1R5WB 4MA1C 3KNBA 3L5JA 4X80L 3Q6GH 3TCLB 1N64L 3L3IA 3FB7A 3SGKC 4TSCL 5IF0B 2VITB 2UVFA 4LASH 1CTNA 3GSXA 5J6GB 5J6HA 4HF5H 4JB9H 1EEZA 2BOCB 2MSPA 4JJ5A 3ZYIA 3HUJA 4F9LA 4X9IA 1EIBA 5FCSH 3SGKA 2IPUG 1QQDA 3S3JA 5EU6B 1NC2B 5L9DL 2IANE 1YJDL 4I18C 3U46A 2F74A 2ARJB 4EUPH 4WUUD 4ZQKB 1NDGB 4AEHL 1S7SB 2ICWA 3VXSD 4I18A 1XGTB 2XN9E 4OZHE 5KSAA 4HKXB 4E41B 2NNAA 2EC9T 2NXZC 2EXYD 1YEGH 3VFVA 3FB5B 1LEGB 5D7IF 4WIQA 3V52L 1DBKH 5IG7B 3QIWD 3W5NA 1MCNA 3QNYB 2AXFB 3GSQB 1WC7A 1NEZG 4LLQA 1HXMA 3MGTB 5D93C 2IPKA 3S5LB 3BH8B 3IDMA 2W9EL 3G08A 4XCNA 1RFDL 2D9QB 4KAQL 5IJVA 4QY8B 5DJZB 2JCCB 3FMGH 2ORBH 4DK3A 1A02N 4N8VB 3DUSA 1G7MB 5H35B 1B6UA 3V4UL 3RHWK 3MJ7A 3VG0L 4AY0A 3HNVH 1O0VA 3R1GH 4F57L 4NZUL 3IJSA 3BD3A 3DHJA 1H3TA 2YA0A 4XC3L 5KVDL 3BPNB 4MA3B 2OLDA 1LNUA 4GLRH 4KVCH 2FLRT 3WFDL 3L5WA 2Z31D 1YJDH 5HYIA 1FFPA 3MYJB 3IFNL 1WCBB 4WFEE 3L3JB 4LVNB 3SBWA 3VGEA 5DEFB 4D8PB 2RFXB 5HDQH 1C5DB 5JIIA 1NGPH 4OD2A 3WD5H 3ARFB 1K9TA 1OAZL 2FB4L 2G5RA 1OLLA 3UC0H 4OUOA 3X13A 4BZ1L 1DSFL 1XF2B 2QADD 1KB5B 3MNWA 4HHAA 2QHRH 4S1DD 4XPHL 3CJJA 2DQFB 5LKNA 1Y18B 3AGVA 1F42A 1RFDH 3PHOB 3KYAA 1AP2A 2Q6WA 4NCC1 1E4XH 2F54B 3FMGL 3TGXA 2BOBA 4PJIB 1J1OH 3EYUL 3MRCB 4RMSA 5DC0A 1W0VA 2VOTA 2F8XC 1P7QD 1BVLB 2NY7L 1J05B 5DSCB 1Q72H 2NY4C 4HK0B 3RL2B 4ZFOA 5HHMD 1QQDB 1FQ9C 1X6LA 4MHHG 4MCYA 3FT3B 4MNGB 3I6GA 3I2CH 3E0GA 3DJ9A 4F9PA 4G9DB 4JFOB 1N0XL 1V7ML 1GPOH 4XVSL 3NACL 2FX8H 1MHPL 2P24B 3EJJX 2PF6A 3SGEH 4OT1H 3QUML 3H42L 1GC1L 3P77B 3QUZB 2NNAB 1DVFC 5GZOD 1MQKL 4E0RB 3HG1D 3VFTB 3BGFC 4XGZB 2HT4C 2H2SC 1A3RH 1RZIB 1PG7L 4LRNH 2EEDA 3VFSB 3ZDXE 2EDTA 2IH3A 3VH8G 5EPMB 2YPVL 2VIRA 4XCNB 5IJVB 5FM8A 1FC1A 4HIIA 3VXOA 4JVPA 5CJOH 3QNZB 4YHKH 4JRYA 3VFUA 2UZIL 2DQTH 4WFFD 2E9BA 4N5UA 4HH8A 1A7OH 4G8GB 2RAMA 3RWJA 3PWJA 1GCFA 1DBBH 5T1MA 3GHBH 5IQ7H 5EN2A 1S8DB 5HHVH 3GGWB 1NCCH 3B6SA 4F8TA 4PJDF 3VXRE 4YXLL 5K9QG 1T2XA 4QRSA 4X7SH 4P5KB 2IQAA 4Z7UB 4HBCL 2OMNA 1WCBA 2VR9A 2YBRB 3LKNB 4M7KL 2FJGA 3KJ4C 1NMCC 1CLCA 3EOAB 3QO0B 5ALCH 1KSRA 3GJFH 1Q1JL 5M7QA 2YPLA 1R3IH 4GMTL 4LSVH 1NFDE 4XPGH 2X7LA 4NM4H 1JNHB 4BZ1H 4PB9H 1DQJA 2HFEA 2V5YA 4RBPK 1NANH 3SE8L 4P9ML 4N0UB 1J0KA 1CL7L 1FZKA 2FX9H 3CX2A 3SE4C 4A6YL 2WUCL 5FYKU 4EOWL 5EOTA 5DVKA 2CKBB 1MF2L 3SKUD 3QXVA 5DFVC 2MJWA 5EOQL 1LE9B 4PJIA 4XMPL 3GI9L 4WW2F 4HG4K 4UOJA 1XIWA 3F7VB 2ZKHH 3TZVA 5KW9H 2ITCB 3CGTA 1MWAA 1DANT 4O9HH 2VLJB 3CH1A 5IGXL 3P4LA 1JGLH 3QRFM 5EZIH 5IKCB 2P8PB 1F4YL 1U8OB 2HJKB 3F7YB 3HFMH 4EDWH 3L95A 4JO3H 43C9B 1I1FB 2VXVL 1LD9B 4QTIH 4IHOB 1QFOA 4URTB 1W72H 3VFTA 5FFLA 1LO5B 5T3ZH 2WQRA 3MUHL 4HJJH 1Q9LA 1OTSC 4ZO6A 5C07E 3HI6H 3EYFB 4UI2A 4GRWE 1SBSL 2V2XA 4ZTOL 1V3MA 1LVEA 4PJCB 1QBLL 2HJFA 1RUAH 1L0QA 4BH7B 2OXHA 3C60C 4GG6E 1PW3A 2YUVA 2ED9A 4M7LL 3ORJA 5CJOL 2XN9D 3U0WH 3C60A 5SX5K 1JYWA 2FD6L 3W0WA 3PWJB 4W6XB 5IIEB 4M43H 3KYMA 1L9MA 4DEPB 2Z91B 2FX7L 3BKJH 3D3VD 5FYLL 1D5IL 4HKXA 1I3RB 1G9NL 4YEEA 5DF0A 5K9OA 1MI5A 4DUXA 3ARRA 2JJVA 5EU7E 4RA3A 3B5GA 1NCCL 5EC1B 4PRIA 4JQXA 3ZHLA 3FB7B 1UWXH 3DXAA 2EDRA 3HPJA 5C9KA 5JORA 3PP3K 3ULUC 2FX8L 3FJTA 4OLVH 5IB2A 1BD2B 2HRPH 1YEEH 1KNOB 3Q3GA 1HKFA 4OD3L 3OGCB 1N8ZA 3WSQL 4IRZL 1NC2A 3CVIH 1W0WB 1WF5A 4K3EL 2W0FA 3CUPB 4RMWA 4FXKA 4G42A 3DV6B 3HC4L 3LQAC 4OCRH 1JWUB 5GJTH 3CZJA 4KTDH 4YDVA 1MFBH 5SWSE 1WBYB 3RWDA 1FGNL 3CDFA 4KMQA 1I75A 2YD6A 3IDYB 4XNYL 4N0UA 1F2QA 5DO2C 5F9JA 3S8WA 2BHYA 1DBJH 4LSQH 1RU9H 2X5PA 1IQWL 4GQ9L 4YDKL 1MLBB 3C2AL 5DHVA 4PJXE 2ADFL 2H2SD 2W60A 1YEJH 4MB3A 3EOBA 4OKVA 4QHUA 3WFDH 2FO4A 4NN7B 3TT3H 1XIWB 3LS4H 3HN3A 1R3JA 4P2OB 2ZKHL 3BH8A 3IDMB 4WO4C 5C0RH 2DQEH 4PJDB 4QRTB 3VFRB 5EU5B 2VR5A 5CJBA 5D6CA 1AE6H 3PL6C 1WT5A 1JF6A 2FGWL 4O2FA 3N1QC 1H8SA 1WZ1H 5HGDB 3ARBA 5CBAB 4HWZB 1T6VN 1S7VA 3X13B 4N90D 1WITA 4QNPE 2IANA 1ND0A 4MMXC 1I1FA 2PUQT 4QWWC 1ZAGA 1WAAE 1KENH 4JFFE 3DV4B 2W9EH 5INDA 1C5CL 3H9SE 4QRQA 1IGIH 5ISZA 4C4KT 3UDWA 5DMKB 3L3HA 2UY6A 1Y0LA 2K1MA 4PJ5A 1Q9LB 3TESA 4LSVL 1CLYH 4NHCL 5KSAD 5E0QA 3ZKMD 4Y5VB 1NFDF 1OB1A 4WGWB 3V4UH 2V2XB 1EDQA 4NBYB 1JHTB 5JNYA 4YHIA 3RU8H 3NCJH 4KRNA 1MCDA 3F7RA 4UT7H 1QBLH 3IDNB 4G7VL 3V0AC 4HJGB 5ADOL 4LSQL 3FT3A 3B8SA 3U4AA 2EDOA 1KB5L 3C2AH 2OX5A 4PJEA 4LLMA 1H8NA 5H2BA 3IDXH 3BE1H 1A0QL 1CE6B 2J8HA 3BIKA 5IK3B 4FQ1L 5DZLA 1K6QH 1LP9F 5D71L 2VAJA 4P2RD 1FO0A 5E2TH 1URLA 3CNKA 3JBG7 5H94B 3H3PL 3BO8A 1OY3B 4BYHA 4ZPTA 3QUYD 3AU1B 3UBXA 4LP5A 2HG5A 1RJZB 4X7DC 3VWKB 1K2DA 3R06B 2NY3C 3L3DB 1FG2B 1U3HD 5I1KL 2OTUB 2IH3B 5C0BD 2GTZA 1A22B 5BO1L 3Q3GB 1BQSA 4OIBA 2VO5A 4NZJA 4BSWA 2YMXH 3TNNA 2VZTA 3TIDA 4DGIH 5FUCC 4NKQB 1P84K 1XF4A 1ZGLA 4YDLB 4M3KB 3KDMB 5KJRL 5JLZB 1WICA 1TVBA 1TZIA 3VWJC 5IFAH 4E0RA 3KPMA 5C08E 4MJ6A 5E8EB 2KQNA 1CFBA 1UWGH 1A6AA 2PW1B 4RDQG 2CRIA 3CSGA 4JZOA 4ODBD 2NY6C 1UM4L 1EJOL 4Q97A 3WDHA 4QRSB 4LSPH 4RGMB 4H20L 4GUPA 2AJSL 4P23D 5DUML 2BVTA 2Y23A 3UAJD 4QHKI 1G7HA 5E2TL 4KDVA 1OAKH 2FNBA 2DIJA 3DURA 1X5IA 1G0DA 4MCZA 3U48A 3ARBB 3QHFL 2F74B 1IGCL 1U8LA 3ZE2E 5M94B 5C09D 5D1ZB 5CD5C 2X4PB 4LARH 5DRXB 3TNMB 4IRZH 2KL6A 4GG8A 4LCUB 2E3VA 5BV7L 3DYMA 4JRXB 2V7NB 4K7PL 2DM2A 2VSDA 5CKAA 1RZKH 1GAFH 1ZLVH 5J9PA 3UTTE 1PQZA 3ZMRA 3IT8D 5BQ7B 2IMMA 3WL9A 3C6SB 1QLFB 4HF5L 4ZUVB 5HXMA 1FNSL 4HXBL 4M1GH 5DFTA 3D0VB 4YJZL 4BZ2H 4KVCL 2UYLA 1IT9L 5CILL 3BXNB 1YEJL 4MDIA 1P7QB 2FATL 1T4KA 4D0DB 3BX7C 4NFCA 2YK1L 4FQPA 3LSOB 2HTKD 5CFHA 4YFEA 4BQCA 3MRRB 4P3CH 43C9A 1FYTB 1GC1H 4M9PA 1BGXL 1OTTD 4LPXA 5C07D 5DUMH 2P43B 5HY9A 1T66D 5F7DB 3RIFK 5F44A 2CKBA 2DQCL 4P2RB 5MERA 5D9SA 3IETB 1SJEA 5GGSA 3A67L 2AJVH 4X6DB 2XZQL 3TBSA 3BAEH 4XAWL 4MD0A 3RGVB 4I9WD 1Y6KR 2A9NL 4NN6B 2W92A 5CEZD 1JF1A 4YH6A 3GMMA 4Z7NE 5FGBA 1F02I 4PJHF 1EO8H 1J1OL 1ZVYA 2DM7A 3QDJE 1A7OL 3DX7A 1I4FB 4AM0B 3PHSA 4PY8I 5FIEA 4AIZB 3L95B 4JHBA 3KDMA 4HS8H 2Q76B 4KI1A 2E7CA 1KFAL 1PLGH 2ERJC 3T0EA 5TPWH 3RDTD 3ARFD 4RISH 4Y4HD 1JMZA 3QDAA 1UWGL 4HG4J 4F15B 2OQJB 4D0BB 1NAKL 4JY4A 1IC4L 4M7JL 1P5UA 5GSVA 4GSDL 4A6YA 4P46B 1X9QA 4KQ3L 4JN2B 4JKMA 3DI2B 1R5IA 2ESVE 3SDAA 4APQA 2H8PA 3H9SA 4G80B 2XZCL 3HZYA 5F7EH 3GKZA 3TFKD 4WFGD 3MOQA 4DKEH 3KXFB 3MA9L 2YRLA 2AEPH 2QSCL 5CSZB 3HC4H 1O7VA 2PETA 1N3NA 5BOZG 3U7YL 4NN5C 1BHGA 2P46B 1WBYA 1IEBB 4JJHA 4PFEA 4CUCA 4QRRB 2YD4A 1ZHNA 4HMDA 4CMMA 2BC4A 4LPWA 1Y6NR 4XPHH 1I3RA 4F7CB 5C9JA 2QHLA 2NY1D 2UZIH 3LN4B 1KB9K 1UFUA 4HWEH 1YNLL 5IT2L 3BKMH 1IC7H 1BFTA 3PIQB 4NQCB 5EUOF 4WV1B 5FYJL 3ZDZF 4L1HA 3U9PH 4C58B 4L1DA 2NZ9D 1INDH 4JG1H 5E56A 3I9GH 1U3ZA 5GZND 1SJHA 2LU4A 4U6XA 3BGMB 1BWMA 1KJ3H 2FR4B 3GFUA 1CT8B 2ZUTA 5CILH 1UB6A 5DJAA 5FECB 5I75B 3O8XA 1Q9OA 4X4XB 5DVLA 1VB9A 2VQ1B 4BH8B 4JFZH 4AMKH 3BPOB 1OP5H 3VXTB 3KG5A 3MLPA 4TVPE 4QXGL 2A6JA 2X89A 3W0WE 1P7HL 4ODSH 5F3BB 2BSTB 3O8XC 4TSAL 3V0VA 3H42H 1Y0LB 1J0IA 3AB0B 4I5BB 3G6AA 2FB4H 1SJEB 4PJBF 5GGSB 1MAKA 2UV3A 3FOLB 4OKVB 5CLTA 5I8CB 4OV6F 1UACH 3RGVA 5T3ZD 1VACA 3VFOA 1NC4D 1F3DJ 1A6TB 3LKRA 1CFSA 5GRYA 5GS0L 4A6YH 3DRQA 4YO0B 3T3PF 5CMAB 1MVFA 4PR5B 1DZBA 4HEME 2Q8BH 3DRTA 1Q0XL 1OT1A 2VXUH 3HB3C 1YNLH 3BWUC 5MP6L 3DUUA 1L7IL 3PGFH 3N1GC 1MJJB 1MCJA 4I2XB 3ZT5A 5DQJB 1T1YA 1IAOB 3P30L 3PV6B 4C4KO 2DTML 3EFDH 3EYVA 2R23A 1LO4H 4J1UB 1MEXH 3KNBB 2XKUA 4RZCB 4UB0H 2B0SL 3MRNA 5EO1A 4FZ8L 1NH6A 8FABA 5F9OL 5DR5H 3SGDI 2I24N 4HCRL 4JDZA 3SDYH 4A6YB 1LGVA 4LCWB 4LVHC 4EXPX 4ZO7A 4APQB 3F5WA 2ATPB 2H2PC 3RP1A 2D4DA 1MIEL 4TUKL 3T2NH 1DDHB 4K3EH 3KPRB 4WTZA 2ZSWB 5FKPB 3SKOA 4XNXL 5F6IB 5H37G 1GC1C 3RKDC 1N6UA 1RZ7L 5F1OB 3S5LG 4OZ4B 1JWMB 5ID1A 5JXAL 3SHSA 2MKWA 1JZ2A 1MCPH 5HI5D 3D85D 3F6IA 1JHKL 4Y5XB 1AR2A 3CC5A 3MRMA 3H8NA 4P4KB 1IGTB 5E94B 1CXKA 1FCCA 5JO5B 3LIZL 1S9VB 3V2AR 5B4MC 1UM4H 3TT3L 4PJ5E 5IWLA 3P11H 3VW3H 1FFNA 5JXEA 1JFQH 1Z0MA 4LP4A 5DQ9A 1R5VA 3C6LB 4OFVA 4NP4L 1FZOA 5IV2B 4JZJB 3T0ED 3MV7E 4W70A 3S97C 3WUWA 2CDEA 4JM2B 1JVKA 4MAUL 5K9JL 5DD3H 2VZVA 3C6LD 4O4YL 2CRZA 3O8XB 4NC2B 3B3IB 5F9DC 1BFOB 4WRLA 4WW1B 1U8NB 5J13C 3GSVA 4QRUB 4G43B 5IB3B 5TH2B 4HLZG 4N9GB 2C7UA 1BWWA 3DO3A 4X8JB 1CDIA 5IMKA 1H5BB 4JFQA 1G7QB 1DLFL 4H26A 5DEGB 4JRXA 1F6AA 4LHUA 4RAVB 4LLUB 3HLAB 5E8DH 4MB5A 1IC5L 4MJID 5JXAH 5GGTH 4CW1A 4DGVL 5BQ7A 4HIEA 4LASL 4N0FB 2BY3A 3O3UN 4YO0A 3SE8H 1CD0A 1IGFH 4P2QB 4G3YL 5DTFB 2NY3B 3ARFA 4HPOL 1S9WA 3JWDC 4M1GL 4OCYH 3DRTB 1T5WA 3NCMA 4XXDB 5SV4A 4EI5B 2X1PA 5ERWB 4JEGB 2H3NB 2Z0BA 3LSOA 1FVCB 3DVIA 5E1HB 2DQEL 4RA0C 3HNTL 5DRXA 2WBKA 5F9JB 5BZDB 3CPLA 3VXUA 1LO4L 2C3VA 2Q6WB 1WBXA 3QBTB 4TUJA 5BRZB 1NBVH 4NQVB 5ITFB 3GMQA 3QHFH 4OLXL 3FRPG 3V5HB 4NQDD 1MCHA 3QPXH 2XICA 4HT1L 3KPQA 3KPOA 5I73B 4HK0A 2BDNL 2AW2A 3ARBC 4G6JH 1CL7I 4GBXD 5ANMA 3GSNB 1TETL 4POUB 4ZPVB 3QSKB 3L5HA 3GMOB 5F7HA 3C5ZD 3TN0D 3CFCL 3CLFH 1PSKL 2BY2A 3RU8L 1VEPA 3MRFB 1P4BH 3P77A 1I3UA 3VXMD 3BIBX 3CXHK 1PLGL 2G9HA 1IT9H 3IXTB 1NGZA 4NRXB 3VFSA 3PV7A 3TCLA 1UXWB 2ADFH 2FATH 2C3WA 5EPMA 2L7UA 4DUVA 3MNZB 4M48L 4EVNB 4M62H 5C8JB 3JUZA 5SWZB 1C1EH 3ALXA 4R7DB 1HHKB 5H8DA 1QACA 1NFDA 3E6HB 2DM4A 2VDRH 4FMFA 1HH6B 2XRAL 2BNQB 2NZIA 3EHBD 2Z31B 4FXGA 5DD6B 1M05A 5EA0L 4X7TA 3C87A 5E2VL 1QSEA 2FJHB 1JN6B 1XGTA 1FO0B 4P2QD 4G8IB 5I16A 5GSRB 4PUBH 4TUKH 1EBAA 3BO8B 5TDPA 4OFPA 1H5BA 4JFQB 3ME0A 1TETH 4FNLL 2E7LA 4KKLC 4N0CC 4IRJD 5AG9A 5CINH 2Q8AH 2DDQH 4KKNA 5K59F 2NX5B 3QIWA 3CU7A 4R4FL 4LSTH 1P9MA 2EYTB 1CXEA 2BXZA 1XFPA 4KHTL 1FFOB 4P46D 2CR3A 3U0WL 3OXRA 5L2KB 5KVGL 4U6HA 2E9JA 5E6IC 3W9DA 2QEJA 4LLWA 5I1JL 3CDCA 5FV1L 3PWPB 2ICEB 3BUTA 1BGXH 2C9AA 4ZTPH 4WI7A 2EKJA 1B9ZA 1A6AB 2PW1A 4UTAH 2CRYA 3MRJB 4I9WE 4XVJH 3QXWA 3L5WB 4LMQI 3MJ9L 4ZUTA 3SN6N 2AEQH 3MYJA 3BUYB 5EA0H 1PZ5B 1TQBC 5EIIB 1OSZB 2VLRB 4C83B 5JUEH 3VXNA 2MCPH 1T5XA 3HTLX 4PR5A 4FQIL 2FR4A 1Z9LA 3BHBB 1ZLWK 2WLZA 5ESQA 4NHUB 4DCQA 3VWJA 3TVMD 4MXQD 4W81A 3O6FD 5C0AE 5FB8A 4PP1D 1PSKH 1TVHA 1L7IH 2QQNL 1WIPA 2C4FT 3OZ9L 3W82A 1MIML 5MEOB 3NH7H 1G9MC 5DHYB 5D7IA 5T5NF 2X4PA 4OV5A 2R23B 3DROB 1NGZB 1KULA 5KAQG 5A1AA 1CDCA 4Y19A 1HNGA 1ZVSA 2ICWI 3T0BA 2J5LB 3SE9L 3DBXB 1YEDB 4OQTL 1SYVA 1L0YA 4HS3A 1YEKL 1OAQL 4UMGA 4I48B 3OAUL 2O93L 1NFDB 1YPZF 4J12A 2B1HH 3NABL 5MHSD 3BRDA 2JF1A 1REIA 3KPNA 4EBQH 3CAFA 3ZO0A 2ZCKH 2EDXA 3ARPA 3P4MA 3F8UB 5IIEA 2UWEF 1IAOA 3MRRA 3BPCB 3I6KB 3EYVB 3DYOA 2FX9L 1KLUB 3B9KC 4MVBD 4XNUL 3WS3A 5IEHB 1RZGA 2NX5D 5E08L 1NGWA 1LP9B 1CGTA 1E0OB 5DEZA 3FQXB 4X6DA 4L3EA 2GJ6E 1S3KH 3QPQD 3O6KL 4GAYA 5EC2A 3I50L 5IB2B 1INDL 4OGZA 1QZ1A 3VWKC 5IW6B 1HHHB 1A7PH 1QEWB 3V7AG 3HE7C 3MV01 5MI0B 3VH8A 4TRPH 1Z9SA 2X9WA 4IDJH 4IRSB 4JO1H 5C0BA 3DV6A 2GJJA 1TZGL 3GBLA 4B7IA 1OHQA 3IF1B 4OLZL 1MUJB 1NAMA 3X11A 5ESVA 1UEYA 3RWJB 3KLSA 4OQ1A 2V2WB 3I75B 5D5MB 5BCAA 4LQFH 5IB3A 5C3LD 5JQHC 1RUPH 2Z9TA 4DKEL 1ONQA 3LDBC 5JO5A 1BAFL 5GISH 2QSCH 5A2JH 5IMKB 3AS1A 4Z0BL 1BLNA 1CGYA 1FNEB 3D85B 3RJDA 3D69A 3L3IB 1PKQB 4GAJL 4E9LA 2XZQH 1J5OH 3D18B 3RWGB 2AJYH 3RY5A 1BVZA 1FO0L 4HKJB 5A16A 1AJ7H 4HIEB 2OR9H 1JHKH 2E7MA 4NZTH 4EZMA 4P2QA 3WUWB 2Y06H 1BOGB 3V79C 1YQVH 5FKAB 3BI9X 2YPLB 1NL0L 1A6VH 3VXSE 5DGRA 2ADJA 3QDMA 2VXUL 3RHWF 5JOFB 2XZAL 5CBAA 3TPUB 4LGSB 3T0EC 4L3CB 2AK4B 3PGDB 4U49A 3C8KB 2JCCE 3KLAA 2OK0L 5AEAA 1JZ5A 4HZAA 2C7UB 4M1CD 4CMMB 2BC4B 4HAFA 1HXYA 3G5VB 4HXBH 4B50A 3KHOA 1FN4A 2AJXH 2ZG3A 4O51B 5FUOH 5GRZA 5JZ7D 4Y16D 4ORGA 3G5ZA 5CCKH 3V5HA 1PGRB 3GSWA 3HI1A 3MX0A 4RRPG 3KPQB 2OP4L 4OUUB 3LEYL 3UPRA 2IPKB 3S5LA 2A2QT 3BPLC 4QCIA 4U2ZA 1WBZA 3PNWB 2B1HL 5HPOA 1GHFH 4XPTL 5DUBA 2OI9B 2V17L 4LSRL 1UB6B 2X1OA 5DJAB 5DMIH 2P8LB 1OP3H 4NCDA 5FUCE 2QSVA 2G5BA 4Y1AD 3P40A 4QXUH 4RWHA 2PYFA 1BIIB 1QPPA 4KKBC 5DLMH 2DQUL 2JELL 3G5XB 4G7VH 3NAAH 3D39B 3ARDD 4CU6A 3B9DA 5DRWB 1NCBL 4NO2B 1NCAL 1PDKA 4JO2H 4XVTH 2FGZA 3TF7C 4OTXH 4ZUUB 1BF8A 1NANI 4KC3B 1UXWA 4KY1H 3ZDYF 4HULB 3EUUA 1F45A 4ZOCA 4EUPG 4U3CA 3T09A 2HTLD 4M8VA 4YE4H 3QFDA 4OIIH 1YQ2A 1HHKA 1KFAH 1P1ZA 3WKMH 3HB3D 2OBGA 1RK0B 3SPVA 3TNNB 3ARTA 4MS8D 3UTPE 1FJ1B 2BNUB 5IUSA 3IFPB 2W59A 1WTGT 3LKPA 3SDCD 1OPGH 1YECL 1N5AA 1RURH 1ADQA 4P59H 5DQJA 4P57B 4KQ3H 4PJIF 1KELL 2FCBA 3O3BB 2B2XH 3RGVC 1CIDA 5GS0D 3WBDA 1OP3K 1OOAA 3EFFB 5IHZA 5EOCH 1KB9J 2RGSA 3T2QA 2A73B 3D18A 3H0TA 3GI8H 4LCWA 3SDXB 2QHRL 1HSAA 2VXTL 1Z6JT 2FO1A 1J05A 3F5WB 5DSCA 1CQYA 2BERA 4M5YH 5DWUH 4G6FD 5D1QD 2R15A 4AH2B 1HHGA 3NIGE 1KJ2B 4ACPA 1N7ML 4LCYB 3ZLQC 3SKJH 3KLAB 1A0QH 4MNQB 2LU7A 1IJ9A 1KC5L 3PWPA 4DVBA 2P24A 4I8DA 1Q94A 1TTUA 4QYOA 2VN7A 2FGWH 5D6DC 1U92B 3K0WA 5CWSB 4ZAKA 2NY1C 1U41A 1IZJA 2NCMA 2MCG1 3LQZB 1T0NB 1NC4A 2BSSB 3ET9F 3ROLB 2FO4B 5HVFB 3FO9A 3IAPA 2W0LA 5DVMA 2CSPA 5FA3B 3BP7A 1OGAA 3S36L 1EFXA 3GKWH 3V6OA 3VXNB 1QHPA 1C12B 4YHNA 1T04B 5CEZL 4F33B 4K8RD 1QBML 2APBA 4Z0BH 3O2VL 2J6EH 5CZVH 4AQOA 1N64H 1TCMA 2JCCF 5C71A 3INUL 5E00B 1A14H 2XG4A 4PB9L 3OB0H 3DO7B 2AVGA 3WFHA 2AEWA 2IG2H 1VEOA 1BVKB 4PD4J 3BRFA 5T3XH 4OV5B 5D7IB 2EEAA 4OLEA 4NO2A 4LEXL 4OD1L 3QCVL 1A6VL 3C9NA 3I02B 5LJYH 5GS0C 4TTDC 1MJUL 1MCEA 3MBEC 5GS2D 4XT1C 1FZMA 1EEYB 3WEXA 2HVKB 5T3XD 4WI4A 2FLBT 4OQTH 5SWZE 5IMLB 5J4MA 4KH2A 4Q9RL 2YXMA 1AKJB 4X6DF 2YD8A 3QFDB 4KMLB 5KW9L 1CWVA 2H32B 7CGTA 2VYRE 1IRAY 4KK9C 1ORSA 3LAFA 4PG9B 3OXSB 5EOCJ 3V52H 4ONHA 4D3CH 3MJ9H 2CJUH 2J88H 5GHWH 1NCUA 1T89C 4GH7B 2HTLC 3V8OA 1CU4L 2ZUSA 4N0YL 1C5CH 5DHYA 4JFFA 4ODUA 1WAAA 3O3BA 5LCVH 5H37H 1T89A 4ELMA 2HT2C 2YMXL 1U8QA 2EDJA 4X99B 1VFBB 5FHAH 1MFAL 3ARWA 1LP9A 2NR6C 5D7JD 4BJLA 1OCWH 3L3DA 3FQXA 3EO9L 1TQCC 5JA8B 3SDXA 4I48A 1MCPL 4PLJC 2OR7A 3HUJB 5CBEA 5FYKL 5LVEA 4NUJB 4G6AD 3QEHA 4XPAL 3KLHC 1L4IA 3LRSB 5FYLE 4G3YH 1XZ0B 4JAMA 4H1LA 4YLQT 5IHBA 4OTXL 4ZMAT 1QD0A 4MXVF 3QJHB 3K4DA 1K6QL 5EU3A 2P48B 1I7TB 2F53E 4L4TB 1UJTA 4CVZB 1S7WA 5T1DH 3EFDL 5GRVK 3WN5C 4UINL 5JZ7C 1MPAL 1BQUA 5EZIL 1Y6MR 4ODVL 3JWNC 1YY8A 1QFWL 4RGOL 2AJVL 3LKSB 3U9UB 2P5WD 4UIMA 2CKNA 4X4ZA 1OGAB 1W0YT 8CGTA 4KAQH 1NBYA 1CXFA 1JCKA 3NCYS 4N8VA 1JGVL 2SEBB 3MACL 4HUUB 1Q9OB 3CMOL 2P5EE 3VXPB 3UTOA 4D9RD 2IADA 5E8DL 2VXSL 3KS0H 2YPKA 3ALWA 4IIQB 2E7LC 4Z76B 5A3IC 2PTTA 1T2QH 3QCTL 5K59E 3QCVH 1YEFH 5KVGH 2IC2A 1LDSA 2RJMA 3W11C 1WWWX 5CCKL 4R4BA 2BVEA 3GEWB 3GSWB 1V7MH 1OAQH 4PJBB 3S37X 1U8PA 4L5FH 3P9LB 5LGHH 2OL3H 1F8TL 3O9WA 1IKFH 3OKKB 1OAUH 2VZSA 4M62L 3WIHH 4NJ9H 3BKJL 4YDJA 3EDKA 4BFIB 2NXYC 4M5ZL 3RDTB 4KJYB 4M6AA 5ILTL 4JY6A 4QXTB 2R0ZH 3W9EA 9CGTA 1QLEH 1JGEB 2GSIB 2B4CH 4R26L 3G9VA 2VLRE 1PG7X 5I1GH 3DTXA 3VWKD 2J4WH 3VA2C 5I15H 3O3EB 4ODWB 1FL5B 2DYPA 5TE7L 1QHOA 4O58L 1FYTA 4IRSC 3QPQC 1YEIH 3QZWG 4P9HH 4UIKH 1KIQA 1MNUH 1VFBA 3QUXD 3SGDH 2AEIT 3NBNA 3QUYC 1LDPL 1XGRA 4MVBC 1VADB 2ENYA 1FLTX 2LV4A 3EYUH 4JDZB 2NY0D 3CCHA 3VXQB 4WFGE 1BVLA 4BM7A 5C0FA 4KRLB 4WTWA 2OXGA 2VXSH 3QEHB 5T3XL 2VLRA 1I8LC 1IGFL 4C83A 3QWRA 5EZLB 4OF5A 1C5BL 1EK3A 2AJXL 4L4VB 3ZE0E 5ITBH 4DCQB 1FYTD 4XCCH 4Q6IC 2EKSA 3UBXI 3CFBB 5IR1A 1CK0L 2N1KA 4L4TA 5I1JH 3VDBA 4QXGH 3Q48A 5INDB 5MEOA 3MV8E 3T0AA 5B8CB 1S9VA 3JV6A 2DOCA 1I8KB 1AGFA 2VSCA 5GGQL 1DQLL 3NPZB 4XPFH 3BH9A 1FORH 4UT6L 3QWRD 5I18L 1NMBH 2J4WL 5I15L 4YHIB 2XXCB 3QEQD 4PP1C 4JLRB 1P1ZB 4X83A 1K85A 4HJGA 3NAAL 3WFZA 1EO8L 3DARA 3FHAA 2DQGH 1NEZA 1IC7L 1F3JA 3VXPA 4MQSB 1YPZA 1OVZA 5L7XH 2JJUA 3HR5A 3BGFB 4MNQA 4YHZL 2OMBA 5I71C 2XYCA 1G7JB 2O26U 3FT4A 2DTMH 1QSVA 4JM2D 2KKQA 4ZFZB 4IDJL 4X4MA 1F58H 2UWEA 2A83A 4NQEB 1VEMA 1EXUA 3IDIB 5FOBA 1FGVH 4GAFB 1WC7B 4CMHB 2IAND 2AS5M 5FYJU 5DO2D 1HXMB 4EI5C 4JFXB 4PJHA 5LGHL 2ESVA 2MQ3A 1JZ8A 3BP7B 4PJ5D 4OM1H 4XH2A 5F7WC 3E2HB 4I0KA 4CJ1A 4EI5A 2Q1EA 4F33A 1JPST 1X5FA 4LCYA 3P0VH 3TIDB 2VWEE 1DLFH 4YEFA 4FQQB 5CIPB 4LU5L 3B9KA 2O5XH 1ZLUH 3LZFL 3R0MA 5BJTA 4LEOB 4UUJA 2I5YL 3OAYH 5HGHA 5K9QI 4HZLA 4JFDE 4DZBA 1R0AH 4Y7MA 1GSMA 4L8BB 1UCBH 4PRBB 1WJ3A 2VDQL 4IRJC 1CFQB 3TEUA 2F8OA 3WNNA 1YQVL 5E4IA 1XF1A 5SWSD 4LARL 1ONQB 4KKLD 3QISA 5J06A 4NQVA 4QOKE 3U1SL 1WAAF 2EIEA 5INCB 4KY1L 5MP6H 3TO4B 3UPAA 3VGFA 3DX6B 2AGJH 3TN0A 3STBA 1NPUA 3H7BA 3KYOB 3H3KA 4Z77A 4HIHA 4KKCD 3DRQB 4RGMC 3BZEA 1G7HB 3HAEH 1GOFA 3LPGA 3K1KC 5IHLB 4PRDB 3QDJB 2DLTA 3FB6B 1MCSA 5I1IH 3RWEB 3V0WL 3CZFB 1T7XA 1KPRB 1MWAL 5ALCL 4JFFB 4PJ9D 2VDML 1NFIB 1RK1A 4U31A 2X70A 4WW2A 4WI9A 2YA1A 4ZS7H 3ULSB 3I6LD 2FJFA 4EQ2A 3K2UH 2J6EL 5CZVL 5JW3H 3M1BA 4N1HB 4EIGB 2EH7L 5GS0H 2UUDH 3K1DA 4PRID 1U8IA 5TDOA 3KPTA 5E2UH 3X14A 3EYSL 4NOFA 4QRPB 2ZOKB 4PJ8D 4QHNB 4F3FB 4K23L 1U8JB 2EDNA 4YC2C 4S11A 3QWOB 4P2QE 4F80A 1N7MH 1A5FL 3I3EA 4ONHB 2A38A 1YPZB 3VG0H 4Q9RH 1PG7W 2NLJA 4YE4L 4HS6A 4Z78A 4LPYA 1C1EL 1WCQA 2XWTA 3OR7A 4MAUH 5K9JH 5LQBL 4OZHF 5DFVD 5DA0B 4GT7A 3DXAB 3C8DA 3TLRA 1DBAL 1SEQL 5GRXG 1JP5A 3STLB 2VXVH 3NIGF 3MCLL 3QG6B 4FABL 2IBGA 4KDTC 3D1MC 1I9RH 4LQFL 3T0DA 1JIBA 4M1DH 4DZ8A 3QULA 3OXRB 4U7KA 5A2KH 5L2KA 4IRJB 3RWIA 3O2DL 1XR8A 5FO8B 4L4VE 2AXGA 3I3DA 1YY9D 3E3QE 4R96B 1CFTA 3MO1A 4KK5D 2YPKB 4IIQA 4DVRH 3WO3B 5IVNA 2G75A 4JY5H 1W8OA 1S8DA 3SEPA 2Y1VA 3QEQB 2W60B 2H1PH 3TA3D 3B6SB 2EIBA 3PWNB 1E4XL 3Q0HA 1JFQL 1YDPB 2O5ZH 5DD1H 1UXSB 2KZWA 3H0TB 4AQ1B 3RUGE 4F15C 3SDAB 4L8CB 4KUZH 2WANA 2AV1B 2EECA 2LAAA 3FFCD 5CUSL 1N4XL 4DK6A 2APTA 4ZAKD 4OLUL 3VDCA 2J7LA 4OB5H 4X6CF 1ROWA 1TJIL 4O58H 3FOMB 4Q6IB 1T03H 1HILB 5GXBB 4HGMA 3V4PL 3FO2A 3QUZD 5L0QB 4PG2C 3U30B 3CX5J 4OCLC 2B2XL 3MACH 4HGWB 4PV8A 4RX4D 3DBXA 3PIQA 3ROLA 4GFTB 4M6ML 3V6OC 4LSDA 5LWYL 2X4RA 2HN7B 3M17B 3UO1L 1CDGA 1UACL 3D87B 3JXAA 3SGJA 3NH7L 3UZEA 4NQDE 4M7ZB 3W9EB 1X5ZA 1T04A 1F3RB 5IBUB 4JGUA 3FFDA 5F7FA 1JK8A 5IK3A 2NY4D 3LV3A 3Q6FB 4HX1B 5DDHB 5MENE 1CK0H 2H6PA 1S78D 1VENA 4R6UA 1FFRA 1B0RB 1CDJA 4G9FE 2VDRL 1JPGA 3EZJB 3ULUE 4G6KH 4JHWL 2HG5B 3IXTA 4UV4H 1LNUB 4FTVD 4LLDB 3EYFA 4YK4B 1X4XA 1GGTA 5F9OH 4R3SB 1PEZA 4H8WC 5CJXA 3IKKA 5T1LA 3TBTB 2NY2C 1X44A 4PJCA 2BZDA 1WTLA 5JW5B 2P1YA 1PZUB 1NGXA 1VERA 1BBJB 4YIQB 4U6YA 1ZHLA 5BV7H 1PYWA 5HHOD 5HVHB 1RZ7H 4XNZB 3EKCA 2JIXD 1YYLH 4X7TB 3T4YB 4JB9L 5E8EA 4OGAC 4R4FH 1WWBX 4U1GB 1EGJL 1OGTB 3GM0A 4NKOB 2UWEB 1JTPA 5EO1B 5EOQH 1YDPA 2IBBA 3O8XD 5I30H 3KYNA 1MCKA 3EDDA 3L1OH 1I8MB 2VR4A 4NJ9L 4JPVL 5EU7C 2EXWC 3L7FB 5TE6L 1PAMA 3T4AA 1T83A 4FQXB 4H1LB 1CF8H 2ERJB 1FFOA 3VCLB 5I1KH 1MFEH 1IGYA 3A6CH 4LFHD 5I1GL 3OKOB 2E27L 2NZ9C 2I5YH 2Y6SD 5E99L 4EI6A 1HILA 1FIGL 4HIJA 4UOW0 3RBGA 2BNRD 4DTGH 1YMME 2XQYK 5E08H 2DI8A 4AZ8A 2IAMB 4UNVA 2B5IC 5J9PB 3QXUA 4TSCH 1T1XA 3OKNB 3JSSA 5DJYA 1VKXA 3DX6A 3VFGL 1NCDH 4GS7B 5L8KB 1MAMH 1HN1A 1LO2L 5EU5A 3BZEB 4GKSB 3V8CA 5B3JF 1RV6X 1HDMA 1KJVA 4JRYB 4TVPD 5HGDA 5CEXA 1EEUA 1JF5A 1OQXA 5DDHA 1QRND 2IADB 3HE6C 3ILPA 1KCUL 4MQ7B 3GMRA 5HHXL 4AK1A 4QRQB 4N9GA 4TVPH 3NCFB 3HMXH 5CJ8A 1AGDA 2X10A 4L9LA 3GGWA 4GOSA 2YUWA 3MA9H 2EC9U 3QQNA 3VRIB 5MEQA 3MJ8A 3QEQE 2V17H 4LSRH 4OLXH 1KLGA 4OLUH 3UZQA 2H26B 4ZUWB 1NMBL 2XTJB 5I1HH 1H5BC 3BKCL 3H7BB 3KYOA 3DUHA 4Y19D 1WK0A 3QXTA 3GKWL 4DGYL 4JPIB 4BELD 2YZ1A 5BXFB 1S3KL 1E4JA 1CE6A 3AB0C 4PJ7A 1ZHKA 4X7FC 5ALBL 2NY7H 3MRKB 3S35X 4JRXE 2DBLH 1CLOL 3C5JB 1LK3L 1H8OA 3UTQA 3LMJH 1X5HA 3OKDB 3DSNA 1NAKH 3MUY1 5IB4A 1WWAX 5HYJA 4LHQB 4P46A 3NACH 3TZVB 4GRLD 3QIBB 1NLBL 1UH3A 3RWCB 1U6AL 3B2UD 1HHGB 4LAJH 2A1WL 1KXQE 3UX9B 1VGEL 3P4OB 4XP4H 3PWPE 1R3KB 5DMIL 3H9HA 1YUHB 1OP9A 2OJEA 5BW7C 2P44B 1CFTB 3MO1B 5DJXA 4KPHL 3OKEA 4PJGF 4MJ6B 4Z7QE 2G9HB 4H1LG 3T2OA 1C7TA 2PTUA 2DM3A 4FQCL 4K2UL 3STZB 2BRRH 5C0NC 4GRWH 3SDDA 4D9LH 5DK3A 2EEBA 1UT9A 5C6PB 3HRZB 3SO3C 1L6XA 5EUOB 3HE6D 1FPTH 1A7PL 4J8RA 1ZKAA 5I9QC 2G60H 2OSLB 2UZXB 3DUSB 3RTQD 1UZ6E 4NZRL 1J8HD 3HMWH 4F37K 2DYPD 2AXGB 3PG2A 4WTXA 4CADA 2VLKB 2Z92B 3RL1A 5I30L 3AS0A 1YYMH 3HR5B 1YECH 5D1ZA 4FABH 4OT1L 2I25N 1JN6A 4P9HC 3V0VB 5ICZA 3TNMA 4ZXBC 4XC1L 1MHHB 5J13B 1WFOA 2MTPA 5J0BA 4FZEH 5MEQB 5J11C 1LO0L 1KN2L 3WFCH 2Q3ZA 3LPFA 3HI1B 4GJTB 4AL8L 5E2JA 2GT9B 3TVMB 3LY6A 5TGBB 4LKCA 5DLML 1KCKA 1U8MB 1Q9KA 1JJUA 4KPHH 5IVZA 1M7IB 3E3QC 4JANB 3B9EA 2OTWA 4JFFD 4JKWA 3BPOC 3S35H 5SV3A 1AQKH 5JDSA 3RBSA 3OG6B 5D1ZD 3DUUB 3U2SB 35C8L 2GCYB 3SKNB 1MJJA 4PY7A 2WM0A 4X9GA 1OGAE 1VPOL 1QSFB 2QQNH 5F96H 1KF9B 2DL2A 2WP3O 1T21A 3LVEA 3FQNA 2WAHA 2P5EB 3ZDXF 8FABB 3O3AB 3EOBB 3ETBF 4QHUB 4Z7VA 5IEKB 4YDIH 3WNKA 2I26N 4QGYA 2OP4H 4KI5F 2VDMH 4R3SA 3CSYB 4HV8A 4KFZC 3O4LD 5C0AD 1NGYB 1MIEH 1TTFA 4Y4KB 1FSKB 5DJ0B 1CFNB 1ZSDA 1IEAB 3MV7A 3O2VH 4ONFL 4M6MH 4QRPE 2PYEA 3B43A 5C6TL 2WWMC 2NY2D 3VD5A 5ICYA 4OI9A 2DQUH 2JELH 1IGTA 5E94A 1FNAA 3MRGA 1MFNA 1FRGL 2P45B 4AG4H 1BREA 5CEZE 1OF2B 2VQTA 2FJFB 3LEXA 1DVFA 1UYWL 1ZEAH 2QQLL 5AUMB 3LN9A 4HK3N 4LL9A 4CN4A 1S7TB 5SWQA 5HGGS 1VSCA 4KRMB 2VL4A 1R5VB 4U0RB 3GSXB 4UIMB 4NNYB 2J8UB 4QWWD 4RSVA 4EN3A 3DLQR 1AHWB 4HIIB 1JTTA 5IV2A 3I50H 2PW2A 5KZCB 3VXSB 2OSLA 1SJVA 3DVGB 4R2GB 4LCCA 3J7HA 4FFZL 3QIUD 2MMXA 2VZUA 3KPNB 1KGCD 2PR4H 3S96B 2QTEA 4JR9H 4Y4HB 5T5FH 1T03L 2DKUA 1A1NA 1EFXD 4JFEB 1Q94B 2HLAA 4OD3H 3REWA 2AP2A 2R8SL 2CLZA 4MZ2A 1J0JA 4KK6C 5E7FA 4K7FB 4Z7UA 1CD8A 3KHQA 2CRMA 3EO9H 1K8DA 3VRJB 2AV7B 4LBEB 3EW3B 4PRHD 2IG2L 1PEWA 1Q9KB 4NZTL 4HPOH 1FBIH 3I84A 4KJYA 4M3JA 5D7LD 4FQXA 3ULVD 5C0GB 4K2UH 1A9EB 4TSBL 4IIQC 5H35A 4TNWK 1AC6A 2QV2A 3HZMB 5JXED 2X6MA 5HD8D 4OZIE 3ULUD 4HUMB 2A6JB 3IKCA 3HHRB 1CXLA 4JPVH 3RVWC 1A4KB 4KV5E 3QFJB 3FT2A 3QZWA 3VXMA 4UQ2B 3ZKND 1TZGH 4X5XB 3T8XB 2HVKA 1KLGB 1TTGA 4HDIB 1GVIA 1RJLB 4KROD 1QFUH 5TE7H 4S0SD 4X5WA 5C0IB 1A6UL 2QLVB 1RUPL 4I77H 4PUBL 3QJFA 5DVOA 1G1YA 4JPIA 4NQSB 3C2SA 4U1SB 5DJ0A 4GXVH 4BZYA 2EKSB 1KCVH 4ENEC 4FFYH 5C0CB 3ZSSA 5JW3L 4TPRL 3FN0L 4KRPD 2F58H 4R7NB 3GHEL 1DUYB 3KWWA 1DCLA 1OTSD 1RZ8B 1I8KA 3LEXB 1U8QB 4ERSH 3G5YA 5C09E 3MXWL 3BH9B 3UZVB 3SCMC 1U42A 3VDAA 5FM5O 2PO6C 4Y8AA 5FCUH 4V2CB 5KOMC 2VKWA 4J3XA 1RUKH 5F96L 3EDJA 5D71H 1DLHA 1C08B 4OZFH 3KS0J 3PNWA 1JZ6A 1HEZA 1J18A 3WJJC 2R0ZL 1P7QA 2CJUL 5KS9F 4XNMB 3ES6A 4NNPL 1OW0A 4PG2A 4XAKD 4AT6A 4Y4HA 5BS0D 4KHXL 3ZE1E 1INQA 3D48R 3ULVE 1BX2A 1A1NB 1QFUL 1RMFH 1B0RA 4PRPE 5F9AC 1JPSH 5TDPB 4IBLT 15C8L 4CDHA 3D39A 1JPGB 4LIQE 4PRNB 4FQIH 3ZSTA 2ARJQ 3IETA 1DN2A 4NN6C 4Z7WE 2X4NA 4ZSOA 3PGCB 2JJTA 3VFNA 4JQXC 4PJHB 2FBOJ 3HRZA 1QFWM 4OF8A 1F11B 2HFGH 3MLVL 4MJ4A 1W0WA 1DQTA 1T22B 2R1XA 1C5BH 2Z35A 4G8EA 1XF3B 4GRLB 1MF2H 1F00I 4UUJB 4YGAB 3IFPA 4U1GC 4KKCC 2Y7QA 4C59B 1CBVL 4R90H 2N7BA 4Y4FD 2XIDA 5FCUL 5DJXB 1N5AB 3BQUC 4KROC 2VDLH 1KACB 2DKSA 5KVMC 5L8JB 2HJLA 5E70A 2C1PA 3WKML 2XRAH 2KBGA 3QZWB 3MZTA 4ORZC 1LQSR 3SDXF 4KROB 4ZUTB 4X5XA 2X4TB 3P0VL 5I9QB 3ZE2F 2PR4L 4AJ0A 3TN0B 3OPZH 5C08A 3E2HC 4U1LB 1ZK9A 3MCLH 4JJ5B 1R5IB 2HLFC 4Q7DA 3EO0A 3U83A 3JVGA 1J10A 2X2YA 2BCKA 5DRNA 4JPKL 3PQYB 2AI0L 3RWEA 2H3NA 1K5NA 4OF6A 5AWNH 1N3NB 5BMFH 3ARGA 4PLKD 4N5EC 4YHZH 3Q1SH 2X9XA 1YC7A 3GMLB 4RFOL 1QR1B 3K8LA 3UTTA 1GGBH 1T21B 2DJSA 3G6JF 1Q38A 1AY1L 4X98A 5A40E 1G0YR 1I9IH 4ZAKB 3O0RL 4OCYL 4RDQF 5GZOC 4NQCA 4JM2C 3VD4A 1AFVL 1JNLL 5L0QC 1LE5B 3IJYB 3FZUC 3MQIA 1VKXB 5HHXH 2AAVA 1RUKL 5FA3A 4JRYD 4PJ9A 1TPXC 4NOBA 1EFXB 4JFED 4ZS6D 5F97E 3HE6A 5H2BB 2ZUXA 3QG7H 3QNXA 4XPFL 4WUKL 1HYSD 5I17A 4GG6B 3LZFH 4PP2A 1DSFH 1XGPA 4QXWA 2NW2A 1INQB 4MZ3A 3WFHB 2VDNL 5F3BA 4UILH 1OD7A 2BVPB 4JCMA 3KPSD 4U3HA 1RJZA 2CDGA 1CDUA 1FZMB 4FFYL 4JZJC 3WEXB 6FABH 4GAYB 3OKYA 2R56L 5SWQB 3CSYA 4S1DC 5IMLA 1IC5H 4XZUB 1MFBL 2JE8A 5BVJA 1TJHH 1G6RA 5E9DA 1GGBL 3HG1B 3IDJB 4PGDB 5KVDH 4OJFL 1EGJH 1N26A 3QA3B 4XMLL 2EIZA 3RWFB 5B39B 1MJUH 4XHQA 5K33A 4Z5RA 2Z31A 4FXGB 1MOEA 3ARDA 4OCSH 1RHHA 3THML 1T1YB 5GGRA 5LGJA 1UEMA 2Z91A 3DECA 1UVQA 1SVZA 2Z31C 2HLAB 1OF2A 4LIQL 3VRLE 4LPVA 2BMKA 3QUXC 2BOBB 5AUMA 2WBWB 5DFWH 2A0LC 3RWGA 4ZYKA 1KTRL 1H15A 4Y5VC 3PJSA 3IVKB 5C0DB 5SWSA 1KIPA 2AV1A 4XP1L 4LCCB 3MUZ1 2X41A 4Y89A 2ADJB 3QDMB 4FOMA 3WKNA 1NL0H 5JOFA 4MSWA 2F53D 3SKOB 4DGYH 3O4LA 1FVDA 1YN6A 5EUOE 3RVUC 3ZYZA 1OCWL 3S96A 1ZLUK 3CFCH 5DHXB 5BZWB 5C0AB 1P4BL 3QWQB 3CC5B 2OM5A 4NO5A 4U7SA 3Q5OA 4ZD3L 1U91A 1EFQA 4JFDD 3M45A 3GB7B 4LCIL 1G1CA 2AV7A 2YN3A 3U9UA 4WI8A 5KN5B 3RY6A 1KPVB 4XBEL 5F71A 3SDYL 3MMEB 1PZ5A 3HNSH 5FA4A 3RAJH 3KJ6H 4CU8A 4J4PA 4BUGA 2YSSB 1EV2E 1QO3A 1ZT1B 2K7QA 4YPGA 3E6FA 1KTDB 4S2SB 3HA0A 3KR3L 1U8NA 2OTPA 1B0WA 1ZWIB 2ICES 2PYFB 1VFUA 1UH2A 1H3PL 1E28A 3UO1H 3IGAB 2DLIA 2EYSB 4YGVA 5EU4A 4CN6A 4MXVE 4PBWD 1M7XA 4DTGL 4Z0XA 2LE9A 1A5FH 1C16B 2AJUL 4FS0A 3G5YB 1AXTH 3GI9H 2P8MB 4R4BB 1VPOH 4OZIA 4ETQA 4C56D 1INEL 4IDLA 4Z7NF 1G6RB 1N2RA 5DMJB 1M7IA 2EDWA 4ZNCD 4YHML 1NMCB 4UB0L 4XXDA 4JQIH 4QXTA 3VI3F 4AM0A 3O4OB 2VH5L 4IJ3B 5LGKA 4NQCD 1H3XA 1N6QH 2HFEB 4PY7B 3VFMB 1IGJA 5GGRB 3ELAT 4JHAL 4PLJD 5LGJB 4N1EA 1I9RL 2FL5A 3HNSL 3O9WD 3OAUH 4CMHC 2XQBH 5FEBA 3HI5L 1WBXB 1EUUA 4YXKH 2MHAB 4Y2DA 2OQJA 3EFFA 3FAWA 2QBWA 4Y5YB 5IF0A 5C6TH 1FG2A 1E4KC 3B2VH 1DBKL 2R2BB 3PJSB 4PJAF 5GGSY 3RJQB 3AUVA 1PKQE 1MWAB 1SEBA 5D2LA 3TO4C 3DMMD 3GSNA 5EZLA 4XRCA 4KQ4H 1MNUL 3MOAH 5IQ9B 4QEGA 4KK9D 1XF3A 4GRLA 2YPLE 4HFUH 5ACLA 3CFBA 5IR1B 5E6YA 2V2WA 2GJ6B 3DNKA 3O6KH 2DF3A 4NP4H 1J11A 2DLFL 1Q0YH 2EE9A 1AO7D 5L2JB 3LN4A 5C2BH 2AKRB 1U91B 1S7RB 2P5WE 4IMLA 4MJ2A 2ED8A 4QHLB 1RHFA 4EN3C 3PWNA 5LXGH 3PXJA 3D2UD 1KLFA 4XI5D 3UJJL 3HUJF 4LDLB 1J0HA 5JHDD 2ZJSL 4LCCC 1UXSA 5GS2H 1G7IB 2IGFL 4AEIL 5IMMA 5J3HC 3RPKA 3DURB 1U58A 1ODAA 1G7MA 2MFNA 1NEZB 4L8SB 3HI6L 5CD3A 4KV5F 3KPRD 2AJZA 3S3SA 4ZTOH 2GUOB 5FO9A 4B0MM 1J12A 1AR1C 4OZHA 5DJ6A 2C1PB 3MLVH 3HC3H 2DMBA 4RFEA 5I6XB 2H1PL 3C9NB 4X6CA 1X5KA 3UCRA 2DQGL 4K55A 3AREC 4LF3A 3LRHA 5I1LA 3QQ9D 1UA6H 3ZDYE 3U4EA 1U2HA 4XBGB 1C5DA 1YZZA 3KGRA 3KPPA 1RQ5A 2X4RB 1D5BA 3NPSB 3BMVA 3GBNL 5C7XH 4YHMH 1MPAH 1LILA 5HJ3A 5D1XB 1XF2A 4TULH 1PX4A 2NXYB 4YHPA 2L0DA 1DBMH 4KK8C 4GW5A 4PP2B 3V5DA 1YYML 4X4YB 3IAQA 3MRKA 3UTTB 4JR9L 4ONOA 3NMEA 3G5XA 4K7PY 4XTRC 5F7DA 1WIUA 3T0VA 4Y4FA 4BKLA 3F62A 4NUGH 5DRWA 5CJQH 5MERB 4AENA 2JK5B 4P5MB 3MV9E 1KCVL 3K8KA 2KUTA 5GQBA 1A3RL 5HYJB 5IB4B 3BP4A 1CDYA 3T1FA 2V7HA 3BUYA 4WI2A 4U1KB 4HWBA 2Z4QA 3ARXA 1MVUB 2AJYL 3ARQA 1VHPA 4FTVE 4NT6B 4QRTA 4WV1C 5DK2B 5D93B 1GZQA 3MOAL 3QNXB 3EJYD 3EDEA 3DX7B 3DXAD 4A2LA 1E6OL 3OB8A 5DS8A 5DVNA 5FYLD 3IDXL 3LKPB 3MJGX 3OAZK 3QUZA 1IM3B 2HMID 1IAMA 5EORH 2I9LA 2AERT 4MD5B 5HVHC 1M6OA 4TVPL 3KWWB 3WJLC 5C0JB 1OAYL 3MTRA 1BM3L 4GS7C 1XGQB 2EICA 1OB1B 4JDVA 3VJ6B 1M71B 4PYHA 3MLSH 2IFFH 5D2NE 3C6LA 5J6HB 3K4AA 2R69H 5T1KD 2DQDL 5E2VH 1KOAA 4MA8L 2IGFH 4AEIH 3DXAE 3WHE1 1ZA3A 3ZE1F 1HEZB 4M6NL 2R8SH 4GMSH 4LLMB 4NHCH 2CDFA 1Z9OA 3SKMB 4G8GA 1BFOA 5D96C 3BDBA 5CSZA 2XTJD 4HSQA 4DGIL 1NUNB 3WN5B 1FL3B 2DN7A 2R56H 2BHZA 2V2TA 2C4XA 2BXYA 3QCUH 1F3DH 4R2GD 5IBTH 3TH4T 3L9RB 4L3EE 4RFNB 3X12B 2YA2A 3BN9C 3O0RH 1GGCL 1MFDH 2R0LH 5T1KA 3SO3B 1XGUA 1SM3L 5C0CD 3MSPA 4G7YL 3VFNB 4YPJA 2A6IB 1YEKH 1CCZA 4YDJB 5DTFA 1NLBH 2X89D 2D31A 3MLRL 4U6XB 3G04B 5TE4H 4BSWB 3VH8B 1A6PA 4ODVH 1XIWD 3MRDB 5CUSH 2B4CL 4OFKA 4R26H 3E6FB 3O3DA 5F72S 1FL5A 2ZJSH 4Z7OE 5BZWA 4R96A 5HPMA 4PTUB 5E8OB 3K3QA 2HKFH 2YD7A 4U1NB 2Y4SA 3IAGC 3N1MC 5GIRB 1X5YA 3VXUB 1IMHC 5T1LD 3TWCL 2O61B 4GXUM 1KELH 2HJLB 3P9MB 2JK5A 4NQTA 4C56E 4YFLI 3QIBC 4WO4A 5ETUA 1R24A 4NQEE 2X4QB 1U95A 1QBMH 2J2ZA 3MV7D 4UDUB 2OZ4L 3EYQD 2A74B 4U1LA 5BOPA 4XHJC 1CLOH 4PRHA 3T3PE 5IBTL 3CDYA 4TVSa 4LVHB 4UDTB 5HYSG 5L9DH 4TSBH 2C3HA 3HE7D 1QSEE 2VZ3A 4CGTA 4RAUB 5AAMA 3ZTNH 3RTQB 3V5KA 4WWKB 1JMXA 1F8TH 1D9KB 2DQFA 4S1QL 1FYTE 2I9LB 2OYPA 3MLTA 5EORL 3OKMA 5C0JA 3Q5YA 2XG5A 4XWGH 4ELMB 4P23A 2KDGA 1OLZA