2W65B

Anti citrullinated collagen type 2 antibody acc4 in complex with a citrullinated peptide
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
217
structure length
217
Chain Sequence
b'DVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-CITRULLINATED COLLAGEN TYPE II FAB ACC4
publication title Structure and pathogenicity of antibodies specific for citrullinated collagen type II in experimental arthritis.
pubmed doi rcsb
molecule tags Immune system
total genus 53
structure length 217
sequence length 217
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w65B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w65B01
2X9XA 3FOLA 2VKXA 1Q1JH 1MWAA 5E03A 4M93C 3LVEA 5INCB 3EJJX 4OTXL 3RI5F 3BIKB 3FT4B 3AXLA 3SDAA 4YXHH 5IHLB 4XNUL 1A6WH 1RU9L 1WFUA 3GSUB 4PJ8B 2BSSB 4G43B 5DRZB 3CLEL 4U6XA 1MLBA 5IVZA 4XWOD 2HTLD 2UZXB 3PXHA 4XTRC 4WDIB 4XC3L 5DC4B 1T1XA 5FM8A 4NP4L 4L8BB 4J3UA 3AU1A 3HC3L 3O9WA 5CGYD 1U8IB 3L3OA 4LPYA 3S3JA 1FHGA 2HYMA 5D8JH 1UEYA 3KLSA 5J3HD 3PL6A 1FN4B 2W9DH 4IRJA 1FNGA 15C8L 1HCFX 3IFNL 3FT2A 4S1DC 3W39B 1ORQB 1BWWA 3H9YA 5EZLA 4OLZL 3PABA 1DFBL 1MCKA 2VUYA 5FGCE 2FJGB 1R6VA 1A7OL 1J86A 4NWTL 4QHMB 3TYGH 2D0GA 2P5EA 1BZ7B 1FNHA 1E4JA 4P5MB 2RCSH 4HIJA 1EZVX 2GSIA 1FH5L 3CSBA 2CDGB 5D1XA 2W9LA 3IJHB 3NAAH 3K74B 1I1YA 5JW3H 4ORGB 3STBA 3N1FC 4TTDD 3ZO0A 1IAOA 1HQ4B 3O0RL 4K2UH 3P4LA 3NCCB 1U8OA 4JLRA 4O5LH 2EEBA 4RGOL 2GITA 4LOUC 3TO4A 1I9JL 4RMVA 5JA9A 4JKPL 4S2SA 1FRGL 1EEUA 5DURB 2QSQA 5CIPA 4KK9D 3I02A 1F00I 1SJEA 5HI4D 3CU1A 3TBYA 1YYMH 4ELME 3TBWA 3HZYA 3CMOL 3K0WA 5JNYA 3OQ3B 4JHWL 1KJMB 1P7HL 3MLSH 2JJVA 1KLGA 4IIQA 3P9LA 2OTUA 4WRLA 2DLTA 3QDMB 3BZEA 3R8BB 1MELA 2D4DA 1U8HA 1EJ6A 4NZJA 3J7HA 4Z7VA 4E5XB 4W6WB 2CLRA 5DD0L 2IH3B 3FZUD 4OGYL 5FM4A 1OP3H 2BFVH 5DZNA 4ONGH 1WK0A 3BHBA 4XNMB 3WL9A 5J89A 1RUPL 3WE6A 1QZ1A 3B5TA 2A1WL 5K9QI 1ADQA 3P9WB 5D7IB 5DHVH 4C83A 1NFIA 1VFOA 4JM2A 4YFLF 3GJEA 1UJTA 1L7TH 5D2LF 1TXKA 1XMWA 4WY7H 4POZC 2PCPA 1M05B 2LTQC 5I74C 3D85D 5FK9A 5EUKA 3D3VA 3WHXA 3SO3B 3G5ZA 3OAZH 2CKBL 4U0RB 4EI5B 1D5IL 4Z7WF 4FNLL 3V5KB 3SDDA 2HKFL 3SO5A 4GMTH 4R7DA 1OW0C 3UDWC 2P8MA 3VE0A 1A2YA 3NZ8A 4NDMB 1CXKA 5F9JA 4MA8L 4FTVA 3SE4C 1LE9A 1EDQA 2JB5L 1I3UA 1A4JA 4BA8A 5C0JA 1UT9A 2I9LB 4YHZH 4HF5L 5TH2A 1BFOA 5ISZD 5I8KL 4JO1L 3IDUA 5D70L 4EDXB 3LV3A 4NZDA 1KSRA 1DN0B 5HHPB 4N5UA 5FO8B 1P1ZB 1N4XH 2P48B 4YPGA 3RA7L 1A1OB 3KPSE 1AJ7L 3T0EC 3LKNA 2Y6SC 4U4BA 2Z35B 4I3RL 3HPLA 3IKCB 3UTTD 3GSQA 2ZUQB 3VFMA 2DMKA 4Y4KD 1U95B 2AXFA 4J3XA 5EO0B 3U46A 1XIWA 3RGHA 4D3CH 1JL8A 3P9MB 1MCJA 4QXUH 4N0FA 4S1SL 5KSAB 4LLDA 4PG2A 1Q1JL 5GRYA 3DETD 3T3ME 1DANT 5IG7B 1FORH 1R3HB 3K4DA 3GZKA 4U7MA 2YD3A 4WUKL 5EO1B 5DFVD 5IF0B 1XCTA 2MNUA 2XTJB 4UQ3B 3O3BB 2X4QA 3QXDB 3GSRB 4YXHL 1B4RA 4LF3B 1A6WL 3EYSH 3VJ6B 4KUCD 4WV1A 5E2VL 2P1YA 4GSDL 4HEME 4YDJB 5CZVH 1NCWH 6CGTA 3WCYA 3C60A 1TQCB 2H41A 4E41D 2DKSA 3QZWG 2DYPA 3O3DA 32C2B 5I19L 5F88A 3KYNB 3TO2A 2Z8VC 5D8JL 2VDML 3UP1A 3BD3A 5DMGC 3V6FA 1AI1L 2OYPA 3W11D 5KANI 3QISA 3QP3A 3SJVB 2W9DL 4PUBL 5FF6A 5C0RL 4EZMA 5HYJD 4HDIB 2DQDH 3OPZH 4PGBB 2XG5A 4JHAL 5TFSL 2OXHA 2QBWA 2H2SD 3X11B 3CC5B 2KQNA 3FHQA 3PDOB 3TYGL 3GMNB 3HRPA 4UT6L 4OZ4B 1EJOL 1JN6B 1YEKL 2APXA 1E4WL 3PHOB 2XWBA 3NAAL 1V7ML 1SEBA 2VH5H 1G7HB 4XCFL 3SKOA 5IUSA 2W60B 4P99A 5T1LA 3AREA 5GSRB 1JWMB 5IEKB 1HH9B 3DXAE 1L4IA 2AJ3B 5K9JH 3VGFA 3IDYB 4GAFB 2EEDA 4OZGE 3FQTA 2FGWL 2VZOA 3WHE1 3QIBD 5DJYB 3QFJE 1IQWL 25C8H 3IFOB 3RUGB 4JPKH 3WNPA 1ORSA 1S5HA 5C0IA 1YYML 2YPLA 4M6NH 5H2BA 4WENB 4LCWD 5DYOA 5EPMB 4PRPD 4HUUA 4LCIL 1QLEL 3SGDH 1KCRL 2GTZA 3SBWC 2XG4A 4KK8C 4RX4D 4B0MM 1XEDA 2P8PB 1C7SA 5BZDA 1F42A 4YHPB 1JV5A 2Y07L 2BVTA 2AGJL 5I2IA 1H15A 3QJFB 4UT9H 1JGEB 2EDKA 4LVHC 2EDEA 4UNTA 2V2WB 4M6AA 1F97A 3TC9A 3U9PH 2DI9A 3TH4T 1MIEH 1RZ8A 3D0VB 2DD8H 2Y23A 3WO3B 1T22A 4JRYB 4RQQA 3LN9A 3QEUB 3QJHB 3GB7B 2BNRE 2XPGB 2EO9A 1UFUA 5BO1H 3VWJD 3HCVB 1B2WL 2VSDA 3VH8B 1NUFA 4UUJB 5F9OL 5JO5B 1A3LL 2EE3A 1EGJH 4LMQE 1T2JA 1ZA3A 2ADJB 1L7TL 2AP2A 2NCMA 4MAYD 3RZCC 2A9ML 4MA1B 1IEAA 1TZIA 3THML 2AKRB 5GZOC 1NCDL 3MJ8B 4MMXC 5ADPH 3T0VA 4IMLA 2BRQA 3MCG1 2NLJB 3C6SB 4RZCA 1MCPL 4CMMA 2BNQE 1KLUB 4GMTL 4CVUA 3C5ZB 1N6QL 2BSRB 4OUOA 5IFAH 2ADIA 4GMSH 1A0QH 4PJAA 3MJ9A 3HI5H 1J05A 2EC8A 3NGBB 3MNVA 4GAYB 1VESA 4YHZL 4RMWA 4F2MB 2WBWB 5IW1B 4PJ9A 4OI8A 3CFJA 1BM3H 3UTQB 5F7EL 1JGLL 2H8PA 2YHGA 3RZWA 1WBYB 4KKBD 4P0DA 4AT6A 4N0YL 2BZDA 3GGWB 5HPMB 3MXVH 4PY8J 1NEUA 3NACH 3KPNB 5CWSA 1WVZA 4XNQB 4KQ4L 1ZLSL 1FFNA 2A6DB 3KPSA 4RA3A 4G3YL 2A2QT 5C2UB 2PYEB 3BGMA 2OSLB 1PKQB 2VLME 5I73C 4PJFA 1C5DA 1HHIB 1LK2A 3ULUC 1FORL 3LZFH 1CXIA 4FN0A 4KV5E 1UB5A 2VRAA 4QXGH 2IQAA 4ZQKA 5DD5L 1A1MA 1FLTX 3ETBF 4QRRB 5SWZA 1JF5A 4JY4A 4KHXH 3BP7A 5BXFA 4ZFFB 3N06B 5TQ0L 1FZOB 1OCWH 4NKOA 3VGHA 5CP7A 5C0BA 2F15A 4P46C 4RDQG 1T03L 2GT9B 1HSAB 4KDWA 1ZLVH 1P5VA 2DJUA 4N0UE 4M7JH 3VFGL 2WWMD 3B9KD 4P2OD 1IAIH 4L4VB 4WFFD 3NFPA 1ZVSB 5EOCH 1NMCB 4YAQA 1NAMH 4CRPA 3OKOB 4QO1A 1Q9OA 5I71C 3GHEH 3GMQB 4APQA 3C5SA 1J8HD 1KEML 1NMAH 4XP6H 1LD9A 2VLRD 1JMXA 5HHOA 5JUEL 1UWEH 1CDCA 4HC1A 4Y16C 5BOPA 3SOBH 4NC1C 5GHWL 1UXSB 5KSBA 3EOBA 2QQLH 3MNWA 5J6GA 1OLLA 4GG6B 2D2OA 3MUGA 5HD8D 1YMME 5EBGA 1RHHB 1RPQA 4QY8A 1X5AA 3Q1SH 4ZFOA 3VXME 4MDIB 3VXOB 4B50A 5IVXE 3OXRB 4G9FA 5DMYA 1F4AA 3OKNA 1U91B 2R0WL 4F7TB 1EFXB 2HFEB 2DIAA 3WJLC 1WCBA 4LAQH 4KQ3H 3P40A 2HA1A 4YDKL 5FDYA 1U41A 5CKGA 1CLZL 3T2NL 1DBBH 3E2HB 4PJDF 4CBPA 3H8NA 3V79C 4KTEL 2WAHA 3X3GL 2AV1B 3CPLA 3OZ9H 4OF6A 3QZWA 4G7YH 4W70A 4YBHA 3RWHB 4FMFA 3QCVL 2NY6D 2I9TB 4F33B 1NBYA 1Q9WB 3JV6A 1KIUA 3UBXI 3VGEA 3MLZH 5JW4M 4OFYA 2DTSA 2X40A 1G7LA 4S1DD 1GC1C 1TIUA 2X1WL 4H1LB 5TJWK 1A9EA 1AP2A 3TBSB 1ZANL 2X6MA 4MA3B 1SHMA 5D6DC 4NNPH 3U9PL 2YD5A 3MLPA 2WLZA 5DHVA 2DD8L 3P4OA 4LARH 5I16B 2IPTH 2CDEB 4ZNCD 5TF1L 4OJFL 3HG1E 3VG9C 3TWCH 1LNUA 1KCVH 1N5AB 4Y2DB 3B9AA 5F7UA 4HK3N 5DVKA 2ZCLL 4O58H 1KIQB 3FT3A 4P2YA 1U3YA 4LOUD 5IB5A 4MJID 5E2JA 5ADPL 3L9RB 1FE8H 2AJSL 3MRQB 3SCMD 1HNGA 3CMGA 1QSEA 2H6PA 3ARBB 5FYJD 4P2RB 4TPRH 3PJSA 1OP5H 1HYSC 3GSOB 3OJMB 2A73A 3X13A 5L9DL 3O41A 4JFZL 1OVZA 1ZT7B 5E24E 4X99A 1KELL 5I8CB 3QDGD 1Q38A 5F6HJ 1EBAA 4MA7H 3MBEC 5DUBA 1RZFH 2NY2D 2V5SA 1I1AA 3L7EB 2OR9H 3BPNC 2X1PA 3EJYC 4M7ZC 3WNOA 1YEGH 1NCUA 4PD4J 1RZKL 1T6VN 2VAAA 5KBNC 5JTWA 2E9BA 2XTLA 4RISH 2OJEA 2ZNXA 1RMFH 1WFOA 1CE6A 1TETL 4OCSH 1IEBA 4CJ0A 3OG6B 5HHME 2Z0BA 3W9EB 4BFIB 1A7PH 5AYUL 1NKRA 1YYLL 3OJVC 4J7RA 3G6JF 4ZFGL 3VWKC 2LVCA 3W81A 4LLUA 4FFWD 3O3AB 5LGKA 4OZHF 4I18B 3KYOA 4AEFA 5C71A 3VXSB 2V9RA 5CHNA 5HGDA 1ED3A 5HYFA 1FGVH 4PJCE 3TN0C 3L95A 2DLEA 4NOBA 3MRDA 4PRIA 4QHKI 3KR3L 3O45A 1S7WB 4KZDH 1SYVA 2I25N 4U1NB 3Q3GB 3U4EB 4IMKA 1OD9A 4MJ5B 1CXLA 1N7MH 5F7YC 3ZE2E 3P11H 4N0UA 4L3AA 1FNSL 1UB6A 2VL5A 4OQTH 2CK0L 5EOCL 1KYOJ 2BMKB 1NAML 1XGTA 3ARFB 4JQIL 5KVFL 2CQVA 2YPKA 5DEGB 2EXYC 4H5SA 4HZAA 4U1SA 1CICB 3TBVA 1A47A 3ULSB 3MODL 4MLIA 4S0SD 5E94B 3QUZC 2Y6SD 2VLKA 4O4YL 1NGZB 3DV6B 2MCG1 3MBXL 4TOYH 3MACL 2AK1L 3I84A 3NZHL 5E2TH 5H8DA 3BISA 4LQFL 4Q9RL 4I4WA 3Q1SL 2R29L 1YMMA 4PYHA 4L3EA 3GUTB 5EO9B 2Z92B 3VA6A 1BGXH 2VR9A 3QDJA 3QQ9C 3CDYA 1QA9B 5EC1A 4B5EA 3CH1A 3CUPA 5GS1B 2IF7A 3IU4L 4MQTB 4OIBA 1FL6B 1QD0A 4XVSL 2IADA 4OV5A 5FYLH 1CU4H 5TPWL 5F96H 2P45B 3V6OE 4KQ3L 3FONB 2E7BA 2ORBL 1H5BB 1UH4A 2X42A 1WBZB 1DBBL 4FXKB 2ERJC 1AD0B 1CFNA 1EVUA 1N2RA 4WI5A 1YNTB 1TNMA 3S37X 1PFCA 4M7LL 4LRNL 2X05A 2DQGH 2W92A 4F7PA 5CJBA 3IKKA 1JMZA 1I75A 3U4BH 3I6LE 3T1FA 2A6IB 2DWEB 2WANA 1P2CB 1X5JA 2DQEL 5C6PB 2OL3B 2WLYA 3ES6B 1AE6H 1OTTC 1YJDH 5INCA 3V4PH 3WS3B 1FNFA 1NH6A 4NNPL 4ELKA 4F7EA 4Y5VA 2R69H 3BIKA 1MAJA 1EGJA 1N0XH 2F53E 3U1SH 3OB8A 3S37H 3NA9H 1BBDH 2IPTL 3NN8B 3GSUA 3T4AB 4PJ8A 1QRND 4Q74A 4C59B 2BERA 1EO5A 3PQYD 4HPOH 1WEJH 1X5LA 4YNYB 3IS0X 5KSVB 3HR6A 4GAGL 3DX6B 5AZ2L 2QSCL 4BQBA 1S5IL 1TQBC 1R5IA 1R5WB 3MYJB 4DQOH 1X6NA 1T5XA 3MRIB 1FE8L 3MOQA 1FN4A 4HMDA 5CBEB 1OARH 4RFOH 1F45A 2ADFH 5L2KD 4QRTA 4XCYA 2XI9A 3VRJB 2L4OA 2B7DT 1CLOL 5CS7A 4KK8D 4Z0XB 1XF5B 1J7VR 4P5MA 1C5CH 2CDGA 3IJHA 4M7KH 4QRSB 4MNGE 1BF2A 4G8EB 3VH8G 4NO5A 1RZJH 2Y5TB 4OD3H 4M3JA 3MZTA 2OR9L 2BVUA 1P6FA 5ACZB 3ULVD 1UADC 2OTWB 1HQ4A 1IC7H 4OCXL 3QUKA 1G7QB 1IQDB 4R3SB 4IEFB 5IBUB 2CXGA 3JTTB 4PJ7F 4HWBA 4GW1A 3MROB 1A7PL 3KYKH 4RFEA 5B8CC 5FHBL 2VDPH 1QFWL 3EOAA 5EBMB 4LNRA 5DJ8B 4TSAH 3RZCD 1J1OH 3U79A 3ZKQD 2OP4L 5GZOD 1CLCA 2R15A 4KRMB 1NUDA 3ZE1E 4OUUB 5EU4B 3QDMA 3WN5C 1KNOA 3K2UH 4LHQB 1IARB 4JGUA 3SDYL 4AYFA 5HGBA 3O6KH 5ISZB 4WVRA 3X17A 2HFTA 4G6AC 5FOJA 1KN2L 4XBPA 4N8VA 3WIIH 1T4KB 4OQTL 4XNMA 5IM7A 5KZCD 2FJHA 5MHSE 2ZWLT 5DJZA 1FNAA 1CYGA 3GBMH 1LP9B 2YSSB 3UTTB 2Y06L 1BJ8A 4HJ0C 5D7IA 1KTRL 4Y4KB 1LE5B 1PLGL 5EZOH 3W5NA 2N56A 4I77L 4DW2L 2F54E 4X8XA 3IF1B 3OKEA 4UQ2B 4YWGH 1MREL 4CW1A 4L9LB 4PJXA 3SE8L 4EI5A 1Z5LB 1F58L 4K3EL 4DGIH 3ULUD 4CN1A 4Y19E 4M1CC 4TRPH 2PTTB 5DC9B 3AY4C 5CILH 1DZBA 1X6LA 3V0WH 5KG9B 2CMRH 3ALXA 5H35B 1FVDB 2V5TA 1DEDA 4E41B 3BGFC 5IHZB 3OG4B 1NDMA 1T66C 4XI5C 4NYLB 4EDXA 3EFFB 5F6IB 3D9AL 3H3PL 5FO8A 2UV3A 4N9OB 1HOCA 1A1OA 2CSPA 2DQHH 2F5AL 4NQTA 5EU7E 2JK5B 3RY4A 5L88H 3GMPB 5DQJB 2Y4SA 1FO0H 4K8RL 3VFOA 2Z35A 4R0LB 1S78D 1FFPB 5HYJB 1A64A 3PL6C 5LWYH 1U95A 4UOJA 5EO0A 3U4BL 4MSWB 2C3HA 2ED8A 3OSKA 3UAJC 5TDPB 1IGIH 3FOMB 4YBLB 1FJ1B 3LHPH 4ZXBA 3O3EB 3CJJA 3F58H 5IG7A 1T2XA 2DQFB 3V4PL 1R3HA 4HX1B 3BPLC 5EUOF 5IF0A 4LNVA 5IHBA 1VFAB 3NIFE 4UQ3A 1ZSDA 3O3BA 2HAZA 1N0XL 5KW9H 3QXDA 1CG9A 1BQHA 3GSRA 2NZIA 3U1SL 5K9KA 1EMTH 1AIFB 4WI6A 1NCCH 4LF3A 2JE8A 4GQPH 5KS9F 1PDKA 4YC2C 4XP4H 4YDJA 3WKML 1NDGB 4PJIE 2Y7QB 2E6PA 4MNQD 4PD4K 1WEJL 4L1DA 5C86A 3QIBB 4QT5B 2HG5B 4R97B 3TPKA 2E5EA 4L8SC 1F6FB 5DUML 1CK0H 3QNXA 5DRNA 3EJZD 3W0WE 4LCWB 1KCUL 4OLVH 3ZTJG 4PRPB 1R24A 4H1LG 5I17B 1Q0XL 4LP5A 4HDIA 4U33A 1NBVH 2YD9A 4PGBA 1GGIH 2FECL 4P23C 1FFOB 4P2QD 1DLFH 5JORA 3IVKB 1A7BA 1OGTB 2BXZA 3GMNA 4OZ4A 3AB0B 4M9OA 3ILQC 5BV7B 5DQ9B 2FX7H 3PHOA 2FIRT 4M7KL 1HKFA 1XF4B 4HWEH 1RZJL 2R1XB 4OD3L 3KLAA 1G7HA 5HDQH 3DVGB 5ICXB 2W60A 1OAXH 1W8NA 1KYOK 4JANA 3U7AA 3VWJB 1HH9A 5TE6H 4Z95H 2AJ3A 1T89C 2X41A 3GSNH 3HAEB 3K4ZA 4GW5B 3HMXA 2KZWA 5DQDL 5DJYA 4MAYB 3LRSB 1GAFH 3IFOA 2XQBL 5C0CE 5I30L 2R1WB 3K8KA 5C08D 4BFGA 2RQ8A 5IMMB 4N1EA 1ACYH 2FWOB 4TSAL 5JIKA 1J1OL 2YRLA 3B2VL 4NC2B 2B4CL 5EIIB 4QOKE 5EORH 4JO4L 2IQ9H 5DJCA 5I18H 1YECH 1MY5A 3BKYH 3O4LE 3BDBA 1MJ7H 3QPXL 4YHPA 3HLAB 3DARA 2GJZB 4QRPD 1JGEA 3C5JB 1VB9A 5ENWB 1HILA 4TQEL 3KPQB 1EA9C 3JWOC 3D0VA 3VXPA 1DP0A 4DFHA 4JRYA 3ARDA 3T8XA 3MBED 2WQRA 3C08H 3QEUA 3QJHA 2XPGA 4IOFD 2D0HA 4CN6A 4TSBH 1G7PB 2UZYB 1HHHB 4H20L 4F37K 3VFVA 5TE7L 5H94B 4UUJA 5I0ZA 4MXWH 3WUWB 4DUXA 2VLJD 4C4KO 1KGCD 4J4PA 4EDWL 2VDKH 1CN4A 3G04B 5DVMA 1Z9SA 5E9DE 5DJXA 4OM1H 3MJ8A 2P4AB 3QEQE 5CEYA 5ERWA 2NLJA 4ZUVB 3R0NA 1KLUA 2EO1A 3CZJA 1ZVHA 2J8UF 3R4DA 3C5ZA 2BSRA 2C3GA 1NFDB 3B9DA 3PIQB 5C0FB 3AMLA 3OJDB 3RY6C 4HUMB 3KAAA 4GAYA 2FD6L 5HHQB 4PJBA 2HP4A 3TN0D 4F2MA 4WJ5B 3GIVB 5IW1A 1RIHH 2BC4B 3B9KB 1JWUA 4M62L 4P2OB 5E5MB 1PKOA 4RWHA 3UTQA 3L5XH 4QHNA 4BSJA 1WBYA 3OV6A 1U58B 4P5TC 1YEDB 1G9NL 2DQHL 3GGWA 4DUVA 5HPMA 4NN5C 2Y25A 4WCYH 4DEPC 1J8HB 3KPNA 4XNQA 2VLRB 2HT4C 2N4IA 3KPPA 2A6DA 4MD4B 4U1LB 1VADB 1XGYL 2NX5E 2PYEA 3VXRE 3ZE0F 3EO0B 5B3JE 1F3DJ 2FNBA 6FABL 2M2DA 3LHPL 3OJ2C 3WFCH 2O5ZL 3QUZD 3F58L 3V6BR 5DVLA 3O6LH 3GIZL 3U0PA 4WEUD 1PD6A 4M93B 3NIDF 4HXBL 1UXWB 4QRRA 4Y4FA 1V7NH 3FAWA 3QYCA 5ITBL 1YEJH 4W6XB 1LEKB 3OF6D 4JQXA 4ZFFA 5D4QA 5DJ2B 3HC4H 3BZDA 2CDFB 5D7KD 3QQ9D 1JPSH 5C07A 2EC9U 3DO7B 4C4KT 3OR7B 4NQCD 4KI1A 3L5IA 1EEQA 3CXDH 3S8WA 1XGPA 4ODHH 1OF2B 1CK0L 5JR1L 5GRXG 4JRXD 5SV3A 3JV0A 1BAFL 2IFFH 2BVYA 3OKOA 4R26L 2NY6B 3U30C 5F93C 4PR5A 4XVTL 4JJ5B 1TTUA 3L5WB 4GG6A 2I26N 5EU6E 3T65B 1DLFL 3AAZB 1NGWB 4G42B 3GO1L 3HRZB 2DQIH 3MV7E 2IPUG 5JDSB 5I1CL 1DVFD 1XF1A 3JWDL 2LU4A 5DC0A 2P5WE 3LQZB 3VXOA 2FX7L 3BYYA 2R1YB 1EUTA 3OXRA 4HWEL 1WWCA 2E7MA 5CEZD 4X6CE 3ARUA 1U91A 4JFDD 3EYUL 4F7TA 1FPTL 1EFXA 2HFEA 4Z95L 1RZ7H 3T0XA 1NCBH 3EFDH 2WBJC 3EDDA 4OZFB 3ABZA 4XCCH 1T3FA 4X5WA 2D0FA 5SV4A 5A1AA 1CFSA 3T77B 5FGSA 2JCCE 3MOBH 1T2QH 5CLTA 2Z8SA 1NPUA 2F58H 4G8IB 4MJIB 2AV1A 5T5FL 1Q9LB 1MCSA 2OTPA 4IRZH 3RWHA 3SCMB 5AG9A 2I9TA 1NKOA 2AXGB 5ADOH 2YD7A 3BKJH 4CKVX 2IQ9L 9CGTA 2A9NH 1MJ7L 4QOKA 4JVPA 2EH8L 5J56B 1F4YH 4H1LA 1F90L 4JJHA 5DRWA 2QQQA 1CGSH 1DE4A 3QDGB 3BZFA 3TBSA 4GQ9H 4MA3A 4YFDB 1JF1B 3LKPB 4LLAA 4X9IA 3TH3T 5C2BH 2H2PC 2NY2B 5ALBH 1KOAA 3HUJB 1AQDA 5IBUG 1HIML 1CT8B 2DQTH 3VGGA 5JHDA 2CDEA 1T21A 3CIQA 3DYPA 1QSVA 3TIEA 1SBSH 3K80A 1N5AA 2Q86B 5FHAL 3BPOB 4Y2DA 2DM2A 5FEBA 1NC4A 3LKOB 2H32B 2Z91A 2APFA 4CL7A 5FV2A 5JXAL 1KIQA 4K3JH 4KH2A 4P57B 4Z76A 1CFVH 1KCLA 4JB9H 4OM1L 3U9UB 4NQVB 5A2KH 1Z9OA 2Q8AL 4XVJL 1FZMB 4CUCA 3MRQA 2LTQB 2DBJA 5KAQF 5D2NE 2APBA 3QEQA 4FQQB 3P0YH 4NO0B 5D1QA 3PWPD 3ARBA 1DR9A 1CGYA 1ZT7A 4K7PX 3MGTB 3IDMB 5I8CA 3DVNB 5D5MF 1OP9A 2EDBA 1FO0A 3L5XL 3L7EA 4HS8H 5FYKH 1G7JB 4G6AD 4S10A 1KULA 2X70A 4IRSD 4Y8AA 5IWLC 4LVOB 4WCYL 4M1GH 3BQUD 5A16A 4YPJA 4XAKE 3U4AA 5CSZB 3DURB 4QHKJ 4CDGC 1INQB 2XN9E 2NNAB 2YN3A 3BAEH 3JVGC 1REIA 1BHGA 3W9EA 2VZTA 4BFIA 1D5XA 4HJ0D 1OLZA 3RX5A 2NX5A 3SGJC 1P7QD 3HAEH 1WV7T 4X6DB 3BP6B 4UTBH 2GFBA 1MRFH 1RUKH 3O3AA 2JIXD 4I18A 3TGXA 3VXSA 1YEJL 3KLHC 1SMAA 1UM5H 5I8OH 3WIFA 1G9ML 1A6VH 1YNLL 5E4IA 4C56E 1J18A 4M1CD 3F5WB 3ORJA 1S7WA 1QR4A 2AJZB 4UDTB 1M7IB 4U1NA 3DTXB 3LB6D 3Q3GA 4Z78A 4NQEE 2GK0A 2B5IB 1XZ0A 3UPRA 4NQDE 3JTSB 2BMKA 3ARFA 3TF7C 4XI5D 5DEGA 1MFBH 1CGXA 4RBPH 2EZ0D 4PRNB 1CICA 1K3ZA 3PNWB 3ULSA 3UPAA 3A0OA 5GGSY 5AYQA 4XBEH 3HNSH 5E6YA 5D96C 3O9WD 5E94A 2VDQH 4U1MA 2DIBA 2IALB 4MXVE 1IILE 1NGZA 3BKMH 2PF6A 2VXVH 3G5YA 4CVXA 3PL6D 3PV6A 2DQIL 2VXSL 2R23B 4IRJD 3UAJD 3GUTA 5EO9A 4Q9QL 2ARJB 4AMKL 4KVNL 3GSNA 4KJPC 4M43L 4EN3C 3QWOB 1QA9A 1BJ1H 2AJYH 4MJ4A 5J1TC 1QRNB 3GK8H 5GJSL 3G08A 2P5ED 5D2LE 3PQYB 2VIRB 3HMWH 2BHYA 4GXUN 5IEHB 3FONA 1K4CA 2HFGL 1H5BA 4P3DB 2GY5A 4FXKA 1AD0A 1T2QL 1ZS8B 2R0LL 4FFVC 4OZIF 4Z7WE 1RVFL 5D9SB 3FL7A 1KJ3H 2J8OA 1AQKH 3EO9L 2DJSA 4IRZL 1V3KA 5AD0B 4R8WH 4Z7UF 5HVHC 2NY0D 4J8RB 5L2KB 4AK1A 4AQ1B 3BKJL 2EYTB 3I85A 1A5FH 2RBLA 2A9NL 3BEVA 4BZ2L 4LLVB 4YBQC 4X4ZA 1BLNB 1U8KB 2P7TB 3D0LB 1UCBH 3FB6B 2A6IA 2DWEA 5CJ8A 2IBZY 4P5KB 3WJJC 1JZ6A 4BFBD 1CGSL 1P4IL 4GQ9L 4YHKH 3SKJH 2NY5L 2EYSB 3NBNA 1GGTA 2QQKL 5ALBL 4ONFH 4LVHB 2BVPB 3B8YA 4UIMA 4GG8B 3HAEG 1KUMA 1NJ9B 2DQTL 1UM4L 3E0GA 2IAMC 3TH2T 3DX7B 4RAUB 1B88A 3QXVA 2PXYC 3E6FB 4YNYA 1SBSL 1ZLUH 2IWGA 4MX7B 3MLVH 1J1XH 1MHPL 1R5WA 2B1AL 4JCLA 4K3JL 3VG0H 4N8PA 2E7LA 3V6ZB 3MYJA 2UYLB 3WFZA 5J1AB 3RZCB 3MRKB 3MRIA 3VXQB 5CBEA 3L3KA 2YA1A 3VRJA 5ILTL 5FYKE 2VDRL 4GBXA 1WZKA 3IDGB 4ISVB 2B20A 1OPGL 4Z0XA 3D3VD 5F9DC 1XF5A 1FDLH 5FYJU 4D9QD 3QB7C 1NMBH 1G0XA 1HK6A 1I3VA 4NFCA 2WUBH 4QRSA 5J11C 4G8EA 5KZCB 4HS8L 4LL9A 3WUWG 3BWUC 2OTWA 4R7NB 5HI3C 2DS4A 4M1GL 5DDHB 3GMRA 1G7QA 4YHML 1IQDA 1MSPA 1YDPB 4M02A 4PP1C 1E6OH 4D9LL 1T0NA 3MROA 1QO3B 5I73B 5DJ8A 4KXZH 1HZHL 3S9DB 3MA7A 1HKLL 2H1PH 2V9QA 1OAZH 2B2XL 5J7CC 3UYRL 5JQ6H 5EU4A 4MWFB 5IB1A 1D6VL 1WZLA 4PRHE 2D31B 2HMID 5GGTL 5INDB 3GJFK 5FYJH 2FATH 4H88H 1JUFB 2V2XB 4ELMF 4I5BB 2HRLA 3FRPG 3F8UB 1U36A 3K8MA 4KUZH 2HFFB 2AAVA 2M1KA 3KJ4C 1OSZA 4LPXA 1ONQB 4NQDA 5I8EB 3C60D 4WTZG 4NCDA 5TF0A 3UTTA 3N85H 1LE5A 4Y4KA 2HH0H 2DYPD 2BRRH 3MRNB 1OAKL 4RGNE 5D1ZC 1VEMA 2HT4D 3BKML 5FO7B 4U0QB 1XCQB 5ALCH 1CXHA 3IF1A 4UQ2A 3PWJB 1G7MB 2ZG1A 1BBJA 4P9ML 5GISL 3S36H 3H9HB 4QRUA 4L9LA 4FOMA 1Z5LA 1MIMH 1JZ2A 2BP3A 4NT6B 4NZRH 4YXKH 2PTTA 1MFEL 5JPNB 1JP5A 5KG9A 4MNQB 5H35A 4LSVL 1JNHA 4BUHA 4E41A 1IEHA 1XGQB 2H3NA 5IHZA 2X09A 4ZO6A 1FAKT 3P4NB 1UVQA 2YMXH 1G6RB 5T1LD 4ODVL 3GMPA 5HBBA 3OGCA 4R8WL 4KK5C 3NVQA 3GKWH 4R0LA 1QLFA 3ME0A 3PP3K 1A5FL 3MC0A 1D5BB 3QH3B 3U7YL 1U9KA 2YN5A 4OCMC 4X80H 4JO3H 1MF2L 4P2QB 2UZIL 3FOMA 1PX3A 2YUVA 4Q97A 1FJ1A 5DUPH 2D7NA 2YPLD 3O3EA 3UCRA 3RTQC 1KC5L 2L7UA 2DQFA 1XR8B 2CK2A 4HX1A 3RL1B 3SE9H 4OAWA 3B4NA 2VQ1A 3UZEA 2X4SB 1VFAA 2ZKHL 4LEOB 2OXGA 4OZFG 1AIFA 4M6ML 1RZKC 5FECB 3WNMA 5I1IH 1MEXH 1XH3B 4A6YB 3L3GB 3UYPA 4YHIB 3B3IB 5GGRB 5HVWA 4LVNC 2VITB 4QT5A 4GUPB 1ZHNB 2HG5A 5FFLA 3VG9B 5FUCE 4M00A 1SYSB 2YD4A 1LO2H 2WBJD 5LG1A 1QYGL 1L0QA 5C08B 1ROWA 3BP4B 2RB8A 4KJYA 2F8OA 4LCYB 3ZKND 4LCWA 1WICA 4LBEB 4AJ0A 4GH7B 5I17A 4JKKA 1MOEA 1RFDL 4HS3B 4FQCL 4M48H 1KCSH 3P30H 1DQLH 1TLKA 1EK3A 4PGDB 1FFOA 3SQBA 2J1KA 4QRPB 3IVKA 1OGTA 1VFUA 4OM0H 4ZTOH 4F3FA 4PPTA 5B39B 4UV7L 1NMBL 1UWGH 2P8LB 4D0CA 5DQ9A 2WUBL 3IDJB 1JVKA 3BO8A 1XF4A 2R1XA 5HYSA 2CUIA 4GAJH 2Q3AA 3MBEB 4KROC 2W1NA 2EE2A 4PB9L 5ICXA 2EIDA 1I7TA 3MV8E 5I1AB 3VWJA 2BOCB 4XPHH 2FB4H 2MKWA 4A2MA 3HAEA 4Y5YA 4GW5A 5BMFL 1VGEL 4MAYA 2R1WA 1EHAA 1B6UA 3CX2A 1QFPA 1CL7H 4AL8H 5IMMA 3QRFM 4ZFZB 4WHYH 4F9PC 2FWOA 3KPSD 1EHNA 1CDHA 4Z18A 1CLYL 3IRZA 4X4YB 4HIXH 2VZUA 5EIIA 3JWNC 1YEHH 1U8MB 5JQ6L 4ZG1A 1JTOA 4JVUA 4X7TB 1KB5B 4OZGF 2GJZA 5FA3B 1H3VA 3TN0B 5F3BB 3BEWB 3SKMA 2RJMA 4H88L 5ENWA 2BHZA 2DMBA 2HVKB 4U3HA 3KPQA 5F71A 1A7QL 2ZUWA 1OM3H 2KUTA 5BZWB 2W0PA 2FIKB 5IQ9A 2AJVH 1QKZL 4HKJB 4F57H 5E1AB 1QTYT 4RMTA 3V6OC 1ND0B 1M6OA 1T1YA 1KN4H 5H94A 5FCUH 1W72B 4U2ZA 4DK6A 2JLLA 4XCNB 3WUWA 4X6BB 1T83C 1NSNH 1NLBH 4JG1H 2OJZL 2EH7H 1ODAA 3QDHA 1G6VK 2B1HL 3ALPA 2UWEE 1FZJA 3G04A 3QUZB 1GOGA 4APQD 1TENA 3S36L 3I50L 2EDDA 1Z0NA 4U3CA 4ZUVA 4Z8FL 1I4FB 4YLQT 5KVEL 2FH8A 3TYFA 3ZDYF 5T1MB 1DUYA 4WFGE 1JHKH 3CSPA 4NZRL 4UOW0 8FABB 5C0FA 3PIQA 3OJDA 1FNEA 1W0YT 1ITCA 4KJWC 2HN7A 5HHQA 2PW1B 2KDGA 3OMZA 4NQCB 3CVHB 4PLNC 3GIVA 1EO8H 4I48B 5E5MA 3B9KA 4P2OA 4G9FD 2VO5A 2R2HB 3QEHA 4JRXB 1U58A 1YEDA 3ZKMC 3SJVE 3OL2A 2YD6A 5D6CB 3AC0A 1IC1A 3C2AH 3H0TB 1IGMH 4XPFL 1CZ8L 3FRPA 3GKWL 1DEEB 5GGSA 2XY1A 4MD4A 2BOBB 3DXAD 2QHRL 4JFFE 1DL7H 2LQRA 1YNKL 5BVJB 1I85C 5I1HH 2ATKA 1I7ZB 2NXYC 2PUQT 4NRYB 2B39A 1DVFB 3F7VA 2CLZB 4R90H 4LSDA 3S35H 1U8QB 2VQTA 5DI8B 4HSQA 1RULH 3SDXB 1UXWA 4NQXA 4WHYG 1LEKA 3C09C 4JFDB 4OIIL 5DJ2A 5I1IL 4KJPD 2CDFA 4EN3D 1KIRA 1AY1L 3QUMB 3MTRA 3DO7A 1GHFL 3OR7A 3RP1A 1M71A 2JELH 2VXQH 4JZNB 1PZ5A 1EAPA 1OTUD 1U8PA 2VLLB 2K9UA 2AEQH 3RUGE 3RHWK 2GUOB 1OF2A 4OZHE 3LH2L 2NQCA 2BY2A 4PTUB 1TQBB 1N59A 4MCZA 4KKCD 3NCYP 2BNRD 2LVEA 1PYWA 3V5HB 2YWYA 2QQNL 3ZKXC 2IG2L 3LS5L 3WKNA 5JDJA 1IKFL 4L1HA 3QIUC 3CCHB 4JFEE 4G5ZL 1DQLL 3EDJA 3L5WA 4KMTH 3ZKSD 4YIQB 1FBIH 5B38A 5CCKH 3AAZA 4G42A 1NGWA 4G6JH 1DLHA 3TIDB 1MJ8H 5C0EB 5JDSA 2Z4QB 3DGGB 2VN7A 4W4NA 2MMXA 3WXWL 3QI9C 3P0VL 2YEZB 4QWWC 5C7XH 2BNQD 5C0DB 4NUGL 4NNYB 4FABH 3M17B 3RWEB 2YK1H 1YPZF 1A8JH 2FB4L 4M6OH 3MV8A 4OF7A 3TCLA 2IAMD 5EC2B 3CSGA 3WSQH 3GHBH 3T77A 1G9EA 5FM5O 5CGMA 4Y5XB 4G8IA 3LIZH 4GRWB 5DK2A 1MCOL 2OZ4H 3CFEB 3NA4A 3QWRD 5B8CB 3ROLA 2AXGA 4MCYA 4PJGB 3U83A 3PWPB 1YEHL 4UMGA 5LXGH 2W59A 3KGRA 2CR3A 4HIEB 5L6YH 5IT2H 3FQNB 4PS4H 2VLMD 1KG0B 4TSCH 1EEYB 3WIHL 3WN5B 1KPRB 3QDGA 4FG6C 4JM4H 1JF1A 4PJDA 3RWJB 4BZ1H 3MMEB 4YDIH 1F4XH 3OKLB 4OBRA 1IC5H 2CR6A 4IRSB 4F57L 1VFMA 1GC1H 3BQUB 4K8RC 3ZZ1A 3L6FB 3AS3A 4KAQL 1KN4L 3GMOB 4M8QA 5HI3D 3RNQB 2Q86A 4KDVA 2ICWA 4LQ1A 2XICA 1IC4H 3C8DA 2D03H 5I75C 3MPCA 5GJTL 4ZUTB 1DUZB 1TJGH 3TT3L 4Z5RB 5EU7C 1P7QB 4OCYH 4HJJH 3TJHD 4P57A 1AHWC 1JNLL 2CLVB 3QIWC 5TGBA 3U9UA 3GBNH 4NQVA 3NABL 2R0KL 4H26B 5JIHA 1DN2A 2JIXB 1LDSA 2HT2C 3JUYA 3OHXB 4PJ5A 1A6TB 4HWZA 4ZYKB 4NO0A 1JHKL 4S1QH 3P0GB 5TQ2L 3WLWC 4OLYL 1D9KC 3UDWA 3WFEH 4JE4B 1YMMD 2DLIA 3INUH 5KVDL 3ZTNL 1BF8A 4Y4FC 3WDHA 3IDMA 3SE4A 4P2CG 5DMJB 1TTFA 3LSOA 2C3VB 4KPHL 3SDCC 2HWZH 3U2SA 3VXMD 2ZG3A 3BGFB 2PW2B 4G7VH 5EOTA 1CF8L 2RAMA 1G7JA 4WI9A 4G9DB 4U6XB 5T5NG 1MLBB 1S8DB 5CMAA 5IVZB 5I1KH 3WFDH 3RKDD 1Q72H 4XBGB 4Y0GA 5CSZA 3RDTC 3MLXH 2DQUL 1T1XB 3T0EA 3O9WB 2AQ1A 1AGFA 1JF6A 4X8JB 3PL6B 4HUXB 4IRJB 2A0LD 5D1ZD 1FNGB 2XRAH 1UM6H 3BP6A 2OK0L 2V9TA 3VFTB 3ARYA 4ZO7A 3LQAH 1MPAL 3QXUA 5EZLB 1P4BL 2D7TH 4HMEA 3PABB 1RZJC 2C3XA 1JYXA 3R06B 3STLB 1IAKB 5IBTL 3TLRA 4PJ7E 3I3BA 4UILH 5DZLA 5F1OB 2P5EB 3V52L 1CCZA 3OAUH 1FFQA 2NXZC 2G5RA 4TNWF 2GSIB 4F80A 4QHUB 4YC2B 3GRWH 2AJZA 4UDTA 3A6CL 1M7IA 1I1YB 2X89A 3DTXA 3FCTA 3MFGB 4HAFA 4LSPL 4NN6C 2AEQL 2FO4B 3O2VL 1U6AH 4WHDA 3G6JA 5J12C 2HVJA 3BKCH 1QBMH 5FKPA 4OD1L 4OZHA 2W9EH 2B4CC 4GXUM 2NY0B 4PRNA 3PNWA 2GITB 3Q6GL 4S1RH 3R1GL 1PG7X 3HG1D 5DHXB 5EWIH 4JO2L 4KK5D 4KMTL 1LO0H 2IALA 3I02B 4U05A 1GL4B 1IFHL 4OFIA 3TBYB 4HUVB 4J3SA 3HE7C 5GS0L 3ZE2F 4JFHE 2R23A 2ESVA 2BJMH 3WEXB 4NZTH 5HHXL 2E7HA 2ARJA 1G84A 2PETA 2XNAB 1KLGB 1L7IL 4QGYA 3BOVA 3QWOA 5K93A 2E9JA 2I27N 4F8TA 1VERA 3D69A 1QRNA 4LCCC 4FABL 1N6UA 3MLWL 5IOPB 3PQYA 4HKZA 4C55A 3QT2A 4L29B 3HNTH 3BHBB 3RGVC 1ZS8A 1WWAX 2OZ4L 3I2CH 5IVNA 4C83B 2XA8H 3ARVA 3GJEB 1U8JA 1A6ZA 2EYTA 1BIHA 1VPOL 4P2RE 2E7CA 5B39G 4LLVA 2PCPB 1LMKA 1BLNA 3B83A 5CJOL 5HHMD 3SBWA 3BE1H 5FK9B 3D3VB 4PS4L 1I7UB 5F9AC 4MB3A 3CVIL 4TSCL 4XC1L 2KQMA 5KJRH 2Y36H 3V0VB 1CTOA 1QFWM 1I3GH 2EYSA 2P8MB 4LSTH 1A2YB 5E2UL 1WUNT 4GG8A 1G9NC 1N0LA 2DWDA 1NJ9A 1A4JB 4Z7UB 1F4HA 3PG2A 4J12A 1QACA 5ANME 2ICEA 4HJGB 5TH2B 2Y72A 1S7XB 3E6FA 1F13A 4TNWK 3LN4B 5CEZH 4GKZA 3VXUE 4MX7A 1BD2E 4KHTH 3KDMB 4Z6AT 4WW2C 2F19L 5EUOE 5T3XH 3V6ZA 2UYLA 1A22B 5J1AA 3RZCA 3MRKA 3HPLB 3VXQA 1A3QA 5IFHH 3VFMB 3AM8C 1A9BB 3MRLB 5IW6B 3U46B 3MRBA 3HA0A 3MOAL 1VDGA 4KI5F 3UEZA 2H26B 5IBLC 3ET9F 3FB5B 3O2DL 2BSED 1TJHH 4M5YH 1L6XA 4I2XA 3CK0L 3QWQB 1XCTB 3DLQR 4GT7A 5A2IH 4FFYL 2X4QB 3NOIA 4G7VL 3EOTL 4V2BA 1IAII 5DR5L 1TPXB 4R7NA 3IT8D 3C60B 3QCTH 4O02H 4UDUB 5DDHA 4N0CC 2EE6A 2DYPB 3O3DB 4FQPA 4NN5B 2VE6B 4DEPB 4K94H 3TO2B 4MQ7B 1KEGH 2FSEA 3V6FB 4Q7DA 1S9XB 3JWDC 1UM6L 1S7QB 5FF6B 1PBYA 1YEEL 3LQAL 3HI6L 3UX9B 4UINL 1H8NA 4GRWH 1AGCA 1VFBA 4ENEC 3ARXA 4K07A 1RK1B 1J12A 4ZXBD 4MWFA 1AGDA 2Z8RA 3I6LD 4WUUE 2D31A 2FX9H 5BVPL 4J6RL 4LDLB 1JUFA 1XFPA 3FMGH 4KVCH 5EZIH 4KJWD 5F89B 2V2XA 1JHLH 1SEBB 4P46A 3SQOH 1BEYH 4I9WE 2HFFA 5T1LB 3S3PA 1A6UH 3BKCL 2F53D 2ZG2A 4XPGL 5I8EA 5DK0B 1SMOA 3BIAX 3ZKMD 3H3KA 2HKHH 4WWID 1LDPH 3L3IB 3U30B 3MRNA 4X7CC 3DHJA 4NJAH 2OM5A 2G5BB 5FO7A 1ORSB 1XCQA 4MXQC 2YPLB 4Y16A 2WINB 5BJTB 12E8L 4PJEF 4FQXC 5MP6H 3RWCB 1G7MA 3H2WA 1AXTL 1HHJB 3H9HA 3HE6A 4ELMB 3ZL4H 2NXYD 4DKFL 3BUYB 5L0QC 4ZD3H 5IGXH 4X4ME 1RJLA 2F74B 4YDLC 3QR2A 1JYWA 1JV5B 4NT6A 5I2IB 4K9EL 1H15B 2J3SA 4UB0H 5ID0A 4Y2OA 2OL3L 5DK3A 4MNQA 1TITA 1R3IH 1DQMH 1UYWL 1B6DA 3HNTL 1OD7A 4L5FH 3WJLA 1HINH 2WBJB 1FP5A 1WZMA 4OB5H 2BY3A 5SX5K 3WNKA 2J8UE 1Q9KB 1JWSB 2J6EH 1FYHB 3PP4H 1KJVA 5B4MD 5D7JC 3LOWA 2CKBB 1YQVH 1D5BA 4P49A 1NGQH 1IEAB 2CRIA 3FQWB 1A14H 4XHJC 5DFTA 2G60L 1DBMH 4IMLB 4GXVL 1T04B 3LKQA 5D2NC 4CMMB 3UTOA 1K8IA 1U3HC 4O51B 3ARGC 3V4UH 7FABH 2ZJSL 2ADIB 4PJHE 5T3XE 3MNVB 2VNCA 5DMIL 1MCBA 4PGZA 2DTML 5AWNH 3ZE0E 3QI9D 4QWWD 3L3GA 1ZTXL 3B3IA 4YHIA 3O2WH 4RCAA 1SVZA 5ANMA 4CADB 2H8PB 3OKYA 4GUPA 5E6IC 1SYSA 3ARDD 3ILPB 4IDLA 4JN2B 5EU5B 5LCVL 3KPTA 3NIDE 5I1EH 3NIFF 3BP4A 3WXVL 2ZCHH 3G6DH 4FMKA 1BIIA 5MHSD 3W2DH 1FFNB 3KPSB 4LBEA 5MENE 3O6FC 4YE4H 3WO4C 1ZEAH 4BELD 4J4PD 5L8KB 4GS7C 5KS9A 4PJFB 1G9MC 2HLFC 3NTCH 4RWYH 1CDYA 4MHHI 2HLAA 2FL5B 5C0ND 1TJHL 2CPCA 4XCEB 1RZGA 2I5YH 5B39A 5FYLD 3AS0A 4ZQKB 2P8LA 4O9HH 1E6JL 2ZNWA 3MA9L 4GOSA 3BP7B 5BXFB 3V7AE 5F44A 3WDIA 2KBGA 4FG6D 3MBEA 3DX9B 4I1NB 4KY1L 1X5FA 4Y19D 2FRGP 2YXMA 1LP9E 2CIIB 3QCTL 2VDNH 5IQ7H 2BOCA 2RIKA 4F7CB 5I76A 4PIRF 1NLDH 3MGAA 4Z7VF 5KOVC 3NFPB 4K8RD 1R5VA 4YFEA 5I1DA 5DT1L 1RSFA 1E4XH 3QUXA 3NH7H 3E8UH 1K3IA 2AQ2A 4KMQA 1FFRA 4Q0XL 3MFFA 3CFBA 4APQB 1ZVYA 5C09A 1YEFL 1X44A 4X4YA 5F8QC 3UTZB 1OAQL 4JFQA 2PYED 1LEGA 2ZUVA 3MUGB 3VWKA 4X0KA 3GRWA 1U8MA 3EYVB 4X7TA 1KJ2H 1UA6L 4JM2F 4R2GD 3L3JA 2QHLA 5FA3A 4ZFOB 3TN0A 3BEWA 3FN9A 1NC2D 4NPYB 3WLWD 1D9KD 3FQUB 3M1BB 1DQTA 3FMGL 4WUUA 3SKNA 1BEYL 4U6HB 4JZJC 4Y4FD 5BZWA 1G0YR 2FIKA 4HKJA 1I1FA 5C07D 1CWVA 1WCBB 4DGVH 3KG5A 3DXAB 5HDLA 2HKHL 1LDPL 4XCNA 4HXAL 4X6BA 1H3PH 4NJAL 5IMKB 5KVGH 1JZ7A 2OMNA 4Y4HC 2VXTL 3TP4A 4JR9H 1TJIL 3QUZA 4XP1H 1ZLWH 3SY0A 4J2XA 1X7QA 2NY5C 3LDBC 5D7LE 1EHXA 2YA2A 5KTEH 4TUJB 1I4FA 1NFKA 2P44B 4PBVC 3GJFH 3KJ6H 5CEXA 4UIKH 1FVCB 1FLRL 3OF6A 4RAVB 4KTDL 3JBG7 2ZCKL 4ODXA 4EN3B 4NZUL 1AP2B 1F3JA 2PW1A 4NQCA 4ODSL 4U1HA 4OTXH 4I48A 5FA4A 4HLZH 3QHFL 4JEGB 2NXZD 2R2HA 3UC0L 4OSUH 1RU9H 1IE5A 4UNVA 3CLEH 3OX8B 4P4KC 4XNYL 1HWGB 4K23H 2R8SL 2BNRB 4PRPE 5D6CA 3H0TA 3T1WA 5IV2B 1DEEA 2JF1A 4XC3H 4X98B 4NP4H 2BOBA 4Q9BA 3ZT5A 3HC3H 4XPAH 5BVJA 5HVHB 4NBYB 1WTLA 4LFHD 5D5ME 1A14L 3QHZL 1I7ZA 1IGTB 5C0CD 1DBML 5FUZL 3VU2A 15C8H 2XZQL 3IFNH 1KV3A 5DI8A 2H6PB 3HE7D 3SDXA 2BNQB 4CMHC 3X13B 4QOKD 1T20B 2CIKA 3REVA 4KKAC 4DVBA 3NFSL 3ESUF 1UENA 4JFDA 4NWTH 4YQXH 3O4LD 1RJZB 4D0DA 5B3JF 3QUMA 2AS5M 4OKDA 4K55A 3QXWA 2IAMB 5BV7L 2J7LA 3WUZA 5AG8A 4JZNA 1IT9L 2VLLA 4GFTB 2NMSA 2FR4B 2GUOA 1NBZB 2V5MA 5JHDD 4Y5YC 4PTUA 5I1EL 2VAAB 3O0RH 3RGVD 1CE6B 3V5HA 2YR3A 5C0AE 4YE4L 4RGOH 1I9JH 2WIMA 4Y2DD 1P7KA 3CCHA 3BX7C 5MENA 1FRGH 1NC4D 2BXYA 2DQJH 1AO7E 2YD2A 1CFBA 4YIQA 3EO1B 1MI5E 2QADC 2N7AA 1T6WA 4U6VL 2V7NB 4LLUB 2Z4QA 4UNUA 3DGGA 2UY7A 3CMOH 4YR6B 1I8IB 3KYOB 4JHWH 2YPVL 3QEQD 5CHNB 3HZMB 3BXNB 5D1QD 1ED3B 2ATPA 2YEZA 3MRDB 3SPVB 2ENYA 4NNYA 3BYTA 5DD0H 5IQ7L 1N8ZB 1M7DB 4OGYH 1N5YH 5K59F 4UU9A 4DFIA 4N0UB 4X6FB 1F4WL 1RUPH 1XGTB 3IGAA 3VMNA 3O8XC 2DKUA 3BRFA 2A1WH 3CFEA 4HLZG 4XVUD 3TBVB 3F65A 5B8CA 4X6CF 4RGNC 3PWPA 4NN7C 2MQCA 3NCJH 3VA2C 2NX5D 3VXRD 4GRMB 4I4WB 5HGAB 1YMMB 1KG0A 4B7LA 4NCC2 2CKBH 4FZ8L 3WN5A 3T04D 1KPRA 5JZ7C 1D5IH 4FNLH 2V7HA 3D48R 2DLHA 3MMEA 3VXMB 3OKLA 4LSUH 3VXSD 5EC1B 1IAMA 2W38A 3CH1B 5IVXB 1BZ9B 2PTVA 2JB5H 1A6PA 5EZJB 1J8HE 3F7PC 1BREA 3KJ4B 4HF5H 4PJAF 3B2UD 4AIZB 4JO1H 5D70H 3HZVB 3GMOA 4BZYA 2K3TA 3RNQA 5DEZA 5IESL 5KVGL 2EICA 1BJMA 1UGNA 4N0CD 1DUZA 3RA7H 4Z5RA 5D1ZB 2CLVA 5D93C 4I3RH 4H26A 2JIXA 1VA9A 3FO9A 1RAMA 2VB5A 4XNXL 2PYFB 1A6TA 2ZP0T 2O26U 4ZYKA 3T4YA 5D7LA 5HJ3B 4D2NA 4S1SH 1HQRB 3T1FB 1UZ6F 5ICYA 1A21A 3MRCB 1C5BL 3NIGF 1MVFA 2C4XA 4BK4A 5EU6D 5IJKC 4ZUWB 3ZHLA 4YZFE 4MS8C 4WUKH 2GI7A 3AY4A 2IANE 4F7EB 4ELKB 4Y5VB 3MV7D 3OWEA 1R0AL 2C3VA 4KDTC 4XP5L 1RIVH 2P5WD 2PW2A 4OSUL 4P4RB 5GS3A 1YY9C 5E2VH 4GSDH 4G9DA 4K23L 4V2CB 1S8DA 4XBGA 3AGVA 2HT3C 5I19H 1V3MA 3H9SE 3HG1B 1R5IB 5FUCC 4FP8L 1JPTH 1OSPL 2VERN 4XPAL 2CO6B 2VDMH 3F7RA 1AI1H 1MAKA 3JV4B 4X8JA 4HUXA 1T5XB 1YUHB 4RIRB 5CSGA 1UQSA 3QBTB 1YC7A 4BH7B 4DN3L 3BGAA 5C0RH 1B0WA 3VFTA 4QRTB 4XCYB 5ELIA 4MXQD 1J10A 3S5LB 5FOBB 1C12A 4FQIL 3R06A 4ZS7L 3STLA 4JHAH 5TFSH 4YHYB 1IAKA 1MRCL 4YQXL 1WIOA 3LN5A 5KSBF 1IGYB 1JZ8A 3DRQA 4HK0B 4UT6H 1JGVH 1EJOH 1YEKH 3KPLA 4QHUA 2VN4A 1E4WH 3HPJA 3F6IA 2W07A 4NO5B 2F8VA 1V7MH 1NCAH 3LEVH 2FO4A 4XCFH 3MXWL 3OXSB 4LVNB 4MJIE 1R3JB 3Q5OA 5BRZA 4EI6B 2UY6A 3QUKB 4L8SA 2XZAL 1S7UB 5E8DH 4X83A 2VXUL 2FGWH 4GW1B 1EXUB 1IQWH 4RFEB 2DQJL 1EHLL 5HHMB 2O61B 3EOAB 4L4TE 1FIEA 3MREA 5E4EC 4LNRB 2C1PA 3HB3C 4HUVA 1AD9A 3RQ3A 2NY7L 5B21A 2FLRT 4P23A 4LCIH 1QLEH 1FL5A 1LO4L 1QLRA 3WEXA 1KCRH 2X5PA 4XHJD 4YUEH 2XNAA 1QSFE 1QSZA 4LGSB 4GBXD 4NOFA 1KNOB 2Y07H 1U3HD 2AGJH 4PJCB 3ARGD 1NAMB 2NY1C 3MV11 5HGBB 2NR6C 5IOPA 3H7BB 4MXVF 1N5YL 4XBPB 4N8VB 4L29A 5FM5M 1T89A 5IM7B 5EB9A 2FJHB 5MEQA 2FEDC 1I8KB 1WAAA 3HFML 4PV9A 1CFQB 5DJZB 1INEL 5E6ID 4R4BB 5DRXB 1KJ2A 1B2WH 2ZUQC 3JV5A 4HHAB 5F9OH 1X5GA 1A3LH 4JKMA 5HY9B 3G5XB 4XAKD 4NGHL 1J1PL 2XN9D 4HLJA 1R3LB 3RU8L 5KSAC 2GSGB 2A9MH 5LGJB 3MRGB 3NCJL 3O6FD 3THMH 2WQ8A 3OKEB 2QR0B 1NCDH 3T0DA 1I7UA 3OB0H 3UXFA 4CW1B 2DL9A 4ERSL 4PJXB 2KZ1B 3V0VA 2HLFD 1MCPH 4NKIL 4ZSOE 3DIFA 4OZIA 3T2QA 2FHCA 4LSUL 1N6QH 1HHKA 2E6QA 2YS4A 1RUQH 4Z7UA 2EXWC 4GO6B 1TQCC 4NRXB 4NKDB 3EIFA 4PLJC 4HJGA 1NDMB 3ZDZE 2EDLA 1S7XA 5F7EH 1JGLH 3RVUC 3LN4A 4C56D 3KDMA 4BYHA 1HOCB 3E1F1 4N0YH 4KTYA 3FRUB 1W2KT 4HV8A 4X6DE 4NQDD 4KQ4H 3VFOB 4DN4L 1ZLSH 1L9MA 4G3YH 1A9BA 2AQ3A 3MRLA 5IW6A 2VL4A 3FN0H 1QEWB 4U6TA 5CGTA 2H26A 2PNDA 4ZXBB 3D5OF 3K2MC 3K3QA 3FB5A 1A7NL 4LEXL 2KH2B 3UZVB 3V95A 4DKEL 3RY6A 5DD5H 4EUPH 1ZSDB 1RIVL 4NWUL 1CG9B 1BQHB 4M4RA 5K9KB 1YMHB 3V4VL 5TQ0H 1JPST 3VDBA 2F53B 3ZYIA 1L0XA 3QG7H 3IDYC 4UDUA 1OP3K 1T03H 4TN9A 4WHCA 4P5TA 3S7GA 3QCUL 3VFGH 2VE6A 1JPTL 3TZVC 1YQ2A 1LK3H 1A4KA 4MVBC 4MQ7A 5HHVH 3H9SA 2JB6A 3QNXB 5DRNB 2CD0A 3T0WA 1S9XA 2XZCH 4HGKC 5FKAA 1R24B 1KEMH 1S7QA 5AZEL 2NXYB 5JUEH 4I3SL 2BVEA 3OKMA 5GHWH 4PREB 1JK8A 2O5XL 3QPQD 5EA0L 5JORB 1XF2B 3OBAA 1RK1A 1JGVL 2V2TB 4WGVB 4ODBD 3C09B 3CAFA 2EDQA 3NCMA 4I3GA 3QNZA 2V5RA 4UI2A 5F89A 4OF5A 3KLAB 4DAGL 1NCAL 3LEVL 3MRRB 4KRLB 2MCPL 5C8JA 2VKWA 3TA3C 3FO1B 2R0WH 4JANB 2EC9T 3IU3B 1DQDL 3U6RB 4LKCB 5E8DL 5DK0A 5BQ7B 5L2KE 3N1QC 4YDKH 1RJYA 1H3GA 5CJXC 4P4KD 1CR9H 1ZOXA 5DA0B 1CLZH 3L3IA 5CINL 3T2NH 1KACB 3ZKXB 4KTEH 2G5BA 3X3GH 2FX8L 4EIGB 3EOYG 3KPRE 1AKJD 5BJTA 1UWXK 2WINA 3RWCA 3QCVH 3BJLA 2D4FA 1HHJA 4ELMA 4RDQF 4YUEL 3BZ4A 3BUYA 5DJCB 4LLMA 1J9CT 4YX2H 4PGJA 2QSVA 2ED9A 2F74A 3NGBC 3WHE0 1Z2KA 3ULVE 5I6XC 4IM8A 3KYMB 1UCTA 3QI9B 5FYKD 3ZYZA 4JFYB 4QTHB 2I60L 1HE7A 2X7LA 1ZANH 3WV0A 1HILB 5BS0E 4KKAD 4XT1C 1MFAH 3VXPB 4FRWA 2CUHA 4RMUA 3ARDB 3T8XB 2WBJA 3D6GA 3WS6C 3BT2L 1KT2B 3ULVL 1E0OB 3ZDYE 5I0DA 4DZ8A 3WNNA 1Q9KA 4HGWB 1JWSA 3K4AA 5TF1H 3WYRA 4OJFH 3VFVB 3TT1L 1IVLA 3MUHL 3RPIA 2CKBA 3KWWB 1J0KA 2NW3A 3ARWA 2ZCLH 4WFHD 3UTSE 3TNNB 4AENB 3FQWA 5DJXB 1EO7A 4LHUD 5CEYB 2AJSH 3VD9A 4KJQC 1WT5C 1T04A 5ERWB 1H9VA 3A67H 2CJUL 2QADD 4O51A 2YC1A 4ACPA 4GRLC 1PG7W 4X5XA 1U93A 5L9DH 4ZPTA 4JFZH 4GKSA 4Y19B 1RUQL 5HTSA 3MGOA 1MCHA 1KELH 4PJBB 3VW3L 2YUXA 1JWUB 2XFXA 4JN1L 4PRHD 4CADA 4QHNB 1NMCC 2EDRA 5F97E 4LGPB 3RJDA 3ILPA 5EU5A 4JN2A 3F12B 1RZKH 5I75B 3MV9E 4WI4A 2EKJA 5IMOB 3TFKC 3KPPB 1K2DB 5J8OA 1U0QA 1TETH 1AHWB 2APTA 3FN0L 5AYUH 4Y1AE 1YYLH 2GQHA 5EIQA 5BCAA 3ZSSA 4L3CB 4R2GB 4RGND 5C3TA 4QTIL 2FL5A 4KKLC 4LPTA 2IFGA 3QDAA 4ZFGH 3U0PB 4XCEA 1NC2B 2DDQL 3LPFA 1D9KB 4Q58C 3ULUL 4XMPL 4Y4FB 4D0BB 4JZOB 3AUVA 3EZ8A 5JZ7D 5FB8A 2FBJH 3DX9A 5GZNC 3SDCB 5E6ZA 2WUCH 5C07B 5F1SA 2WM0A 3QG7L 2CIIA 3KR3H 5ESVB 4F7CA 5IWLA 4PJIB 1XGPB 2P42B 1MFCL 2CRYA 5F72S 4QNPF 1LK3L 4D9RE 4OI9A 1FNSH 5HHVL 2CK0H 1C1EL 5KVFH 4JQIH 3JVGA 5GS0C 1GIGL 5KSUA 5JIPA 4LIQH 1WBXB 1PVHA 3L5JA 2XZCL 3MRMA 3W0WB 4PR5B 2CO7B 3MODH 3SGJA 3S3SA 1ZT4A 1DJSA 4QLRA 3UTZA 1O5DT 2WNGA 1YPZE 1XR9B 4O4YH 1DBJH 4Z7QF 4KC3B 5ESQA 3EYVA 5D7IF 3MBXH 3HE6C 3MACH 3FFCE 3D2UD 1E4KC 2AK1H 4Q9RH 3NZHH 4LQFH 3EDKA 4XAWL 2R29H 4I13B 4QEGA 4XNZC 4MD5A 2ICCA 2OX5A 4NPYA 3FQUA 3M1BA 2QJDA 2NXZB 5DO2C 4MS8D 4U6HA 4Q6IC 3IU4H 4NN6B 4LSSL 1YY8A 4XVSH 4POYA 4XX1E 4MMZC 4JQVC 5TPWH 4MNHA 2ORBH 1T3FB 1YY9D 3MRHA 3AS1A 3DXAA 1MH5A 4X5WB 1CR9L 1CFSB 4G6KH 4OZGA 5IMKA 4P2QE 3RVTC 4XTRD 3GKZA 1G6RL 3S5LG 1KPVA 3QFJA 5C0CB 3EYFA 1H3UA 2AERT 1B0GB 2GK2A 1BOGB 4M7LH 4LRNH 4Z0BL 3RPKA 3HE7B 3P3YA 4TUJA 4YX2L 3ARSA 1CDGA 2ZZUT 4PLOB 4QOKB 3CFDA 1FVCA 4JG0L 1FIGL 4RAVA 5JOPE 4JY5L 5DRWB 3O4LB 1JE6A 2DQEH 4EN3A 3GNML 4ZDHB 3QEGL 1DE4B 3BZFB 2IGFL 1CDJA 1OB1B 1MFAL 2UWEF 2G2RA 4TVPH 3B8SA 1AQDB 4V1DE 5C08E 5JHDB 2AJXL 5C6TH 1AXSA 1PZUB 3OX8A 3RGVB 1T21B 4ETQB 3QFDB 4A6YL 2BNRA 2FBOJ 3BSZL 1FVEB 3TIEB 3MV8D 4B41A 5IV2A 2QEJA 4GAGH 5AZ2H 4NSKA 2QSCH 4X98A 2G75A 1HDMB 1S5IH 1PJ9A 35C8L 1NC4B 2LE9A 3P77A 2W65B 2Z91B 2DBLH 3LEYL 1XGRA 2BDNH 4I0CC 4Z76B 1UG9A 4X7SL 5I1LA 4GW4A 1IGTA 2GTWA 3FB8A 3MJ7B 3QEQB 3A67L 5MI0C 2MSPA 4X5LA 3HB3D 5D1QB 3WJJA 4YJZL 1OQOA 1NL0L 4NBZB 3IAQA 4LASL 1CLOH 2BNQA 4M3KB 1JYVA 4QKXB 4PRDB 4N8VG 1B9ZA 1T20A 4LLYB 1RJZA 4L8CB 1HH6B 2IAMA 1MCWW 1FO0B 2VLJE 4OF3A 2NY1D 1JZ3A 2NR6D 3VDAA 4FZEL 2PXYA 4ZO9A 2FR4A 2X70B 3PV7A 3RWDA 1NBZA 5A16B 1JI1A 1ZA6B 4OCXH 3CGTA 3LQAC 3QWRA 4WW2B 2FEDD 3QUXC 2IMMA 1I9IL 2DM7A 4XMLL 1QBLH 1D5XB 1FCCA 4EUPA 4F9LC 2NX5B 1DQJA 3IXAB 5FHBH 1XGUB 1KTDB 3VXRB 4WI3A 1QFWH 1I7RA 3LMJL 5EBLB 3EO1A 3GDBA 1QFUL 2GFBB 2OCFD 4POZD 2LABA 1QBAA 2V7NA 4WO4C 3E3QC 4P48A 3RUGF 1N26A 2OP4H 1IM3B 4YR6A 1I8IA 3PDGA 4PJ5D 4UAOC 3HZMA 4NO0D 3BXNA 2ZOLB 5GS1C 1I9EA 4WU5A 2ENSA 1KB5L 3WIFB 2FBJL 3GFUA 3PWUB 4LIQE 3SPVA 2WUCL 1WLHA 4XWOC 3SDYH 2D7QA 2Y9RT 1D6EA 1N8ZA 1T1WB 3MRJA 1M7DA 3VMOA 5CGYC 2W0KA 4DVRL 1KN2H 4Z78B 2EXWD 4RMSA 2GK0B 2J88L 3DWTA 4ODUB 1UACL 4X7DC 3S34L 5J3HC 4X6FA 1XZ0B 4PLJD 3UPRB 1J88A 1PQZB 1SY6H 5F3HA 4Z7OF 3RVUD 4LIQL 1MFDL 3TPUB 4N1CA 3PHSA 2X4OB 2Y06H 2JJSC 3VGDA 2PR4L 4HCRH 1W72L 1PLGH 3T0ED 3IB4A 4U1MB 2ICWI 3P2TA 1DBJL 2GYSA 2GKIA 4I77H 4DW2H 4JFFD 3G5YB 4K71C 4CVXB 1GCFA 5GPRA 3PV6B 1BQHG 3L3DA 4GRMA 1Q8MA 5EU6B 5HGAA 3D39E 1MREH 3I75B 3MV7B 3SE8H 5SWSE 4G6ML 1X9QA 4XP9L 3GSNB 1F58H 4K3EH 1PG7L 2P5WB 5ITFA 1OP5K 3VXMA 3LRGA 2VR4A 5IVXA 4J23A 5IHUL 3L3HA 4FQ2H 5SX4H 1BZ9A 3G08B 4MGXA 5EZJA 5CJQL 3IFLH 5SWQB 4AIZA 3CVHL 1CE1L 1K4CB 1X5XA 1JJUA 3GMMA 2X89D 3HZVA 1WISA 4G6KL 1A3RL 3D9AH 3H3PH 4M8VA 4QRQA 3VMPA 2JCCB 2F5AH 3TZVD 5D1ZA 4EOWL 4MVBD 1VCAA 3VFRB 4K8RH 5DMGD 3GEWB 3BEVB 3PHQB 4TVPE 2DB8A 2PYFA 4Z77B 1FYTE 4NRZA 5HJ3A 3B6SB 5L0QB 1HQRA 4JFED 4LSRL 3MRCA 3FZUC 4POUB 1INDH 3HS0B 2XT1B 4FQJH 1F2QA 4ZUWA 3O81A 2ESVD 3IXTA 2R39A 4UIMB 4TVPL 4ZOAA 2EDYA 3GSWA 1X3DA 4P4RA 3WD5L 5C6TL 3WKMH 5L8LB 4KI5E 1L0YA 4MHHG 4Z9KB 3IJYA 4KKNA 3TA3D 2X1QA 1I8MB 3HG1A 2FH6A 4Y88A 4YHLL 3UJIL 1QNZH 5D7JB 3UPCA 5DUMH 3H6JA 2DBLL 5IMLA 2BDNL 5JW4Q 4JVWA 4HUKB 1SM3H 3JV4A 5L7XH 1CXFA 3KLDA 1YUHA 1KCUH 4RIRA 3L3KB 4BH7A 1E28B 1MUJB 1BQSA 1Q0XH 3BRGC 4EIZC 5DSCB 3M8OH 3RTQA 3S5LA 5FOBA 8CGTA 2XWJA 4GBXB 5LAXB 5CIPH 4F15B 2MPAH 1U3HB 4X4XB 4K3DL 3X3FL 3EYOA 3ARGB 1MQKL 2H9GA 4KFZC 3A6BH 3QUYC 4P59H 3QQNA 1IGYA 4GG6F 4HK0A 4MDJB 2LV4A 1NGPL 4K94C 4K7FB 1OQXA 2XXCB 4IJ3B 1CFTB 3DSFL 2WZPD 4M1DH 3OXSA 4W4OC 1R3JA 5E6IB 2ARJQ 5E00B 5DD1L 1WSST 3KHOA 4XH2A 3GMRB 4EI6A 5ICZA 1FGNL 1S7UA 1BFVL 1II4E 1T0NB 3BPCA 5DQDH 2XN9B 1QBLL 1EXUA 3T2PA 2XQBH 3O6FB 5I30H 3WO4B 2O61A 5DJAB 4EQ3A 4AY0A 1DQQB 1S9WB 4GS7B 5DFVC 1T7VA 2L7JA 5FGBC 3MA7B 3B2VH 2EDXA 2B4CH 2LAGB 4JO4H 2Q8BL 4WEBL 1TZGL 4KJQD 3O11B 5D7SL 5E2WH 3RX8A 3QPXH 3KNBB 5DJ0A 5IB1B 1TVBB 4C54A 4PJCA 3QG6A 4GKNB 4GRLD 1JNNL 1NAMA 1QFHA 3OGOE 3UTPD 3H7BA 3C6LC 4TQEH 4C56B 4PJEE 1J0YA 2C26A 1RUMH 3W11C 1CVSC 4ONHA 1SY6L 1OSZB 2RGSA 1I8KA 4FQ1L 4BJLA 1CFQA 4NQDB 4R4BA 5DRXA 1WC7B 4H20H 5TE7H 3KS0J 4HCRL 4HHAA 3UZQA 5HY9A 3G5XA 5EFIB 1S7SB 4F9PA 1BOYA 2NW2B 4XXDB 2FEEI 2H2SC 4EDWH 1R3LA 3E6HB 3R0MA 5DJDA 3TFKD 1WFTA 3O6ML 2GSGA 5LGJA 3MRGA 1OY3B 1BBJB 2QR0A 5IJVB 4QRUB 5E7BA 4YXLL 3D1MC 2AVGA 3HI1B 3D39A 4KKLD 3DJ9A 2D3VA 4X6EA 5IFJA 5CD5C 1VGKB 4FQ2L 3QNYB 5GRUH 2PKDA 4OLXL 1MWAL 5CUSL 2R2EA 2FD6H 4NRXA 3MLTB 3IFLL 1JNHB 5DD3H 4NKDA 2H3NB 3QIBC 3DI3B 3QRGH 5GZND 5D2LB 3LS4L 4M62H 4IS6B 3V6OA 5GGQL 4P3CL 4P46D 1JRHI 1UVQB 3U0TB 1EFQA 3K81A 3FRUA 1G9NH 2DLFH 3SGEH 1T83A 1MHHB 4Z7WB 3OGCB 1MCIA 1QLFB 1T5WA 5GS0D 1XGYH 2EIBA 1HXMB 1QEWA 6FABH 4Y16D 2O5ZH 3C9NA 4YO0B 1INDL 1S7RB 3CDCA 3ISWA 3RFZC 4FQJL 4OCLC 2Q6WA 5BV7C 3GIZH 4AM0B 3HE6D 3QULB 4OAWB 1MLCB 2VQ1B 4I0PC 4H25A 4JFHD 4HXBH 4QCIB 1O7VA 4CU6A 5ITBH 1YMHA 1J5OL 1MVUA 3GSXA 2E27L 3IYLW 3MRPA 1RIUL 2F53A 1CDBA 4F37F 1RZIA 4LFHG 2JKXA 3PGCA 1KENH 4UZGA 4P4KB 4NM4L 4LLQA 1QNZL 5HVFB 3T2OA 2MQ3A 5JR1H 1AKJB 4QHLA 4EBQL 1BAFH 1SM3L 4KJYB 4MLSA 4N0RA 5L7XL 5GRVK 3H7LA 2F5BH 4NUJA 4R26H 1JGDB 1S9YB 1I85A 2APWA 3RVTD 1NUGA 1ULVA 3CDGB 5FCSH 4XVTH 1KIPB 1DDHA 3M8OL 1GYAA 1CGTA 4X9HA 2BY0A 3KPMA 5J9PB 5T3ZH 3BWAB 4PREA 2MPAL 1XF2A 2ED7A 3GO1H 2NZ9C 4Z7VE 5IB4A 2BX5A 3A6BL 5I1CH 4F3FB 4P59L 3JWDH 1B0RB 4O2EA 4D0CB 2V2TA 1LO3L 2UVFA 3BO8B 5HYSB 3PGFH 1IZKA 1TCMA 3MRRA 1L9NA 4M1DL 5HYQA 4MNGA 3GI8L 1I7TB 1VKXB 3EYUH 3FO1A 4HD9A 1RQ5A 1FPTH 1NBQA 4HFUH 3IU3A 4JREB 3U6RA 2R4RH 3UYOD 4LKCA 4Y5YB 5BQ7A 3ROOB 1JZ4A 3S97C 4FQLL 3V9FA 4OCRH 2AK4E 3VXUD 1BD2D 5T5FH 5HPOA 3QIUA 3D3VE 2YUZA 3VRLF 4LHUB 2AI0L 5LBSH 2I24N 1ADQL 1CBVH 4PV8A 1NANH 2R2BB 2QADB 1GGUA 4YEEA 2R0ZL 4JGJA 4NHUA 5E2WL 4FTVE 2UVEA 2EH8H 2FHFA 1Y6MR 4OQTA 1F90H 3KYMA 1X5ZA 3QI9A 5DZOA 4JFYA 1HYSD 4QTHA 3SKMB 4PRHB 4BH8A 1RUML 2DAVA 3MJ9H 4J1UB 1HIMH 3HHRB 2MQ0A 4PJEA 5E7FA 5IQ9B 1KT2A 1CI5A 3WFHA 1WIUA 1M6OB 1NEZB 1T1YB 4HGWA 4P3WA 5CD3B 1FZKB 5L2JB 5A2LH 3HZKA 3EJYD 3O8XB 4ZS6C 5FHAH 3B9VA 1YEIL 3KWWA 4JFOB 3U0WH 3QUXD 4P9HL 5JXAH 4RGNB 4WI8A 1FZJB 4CN4A 3TNNA 4AENA 1MHCB 3LKRA 4YDVA 2Q8AH 5C09D 1FCGA 4NN7B 2F54A 2GW5A 4XVJH 5F7FA 1ES0A 2W0FA 2GAZB 3TYFB 1GGBL 1DUYB 3MR9B 1AR1C 4E0RA 3CSYA 3JSSA 3VWKD 4WO4D 3C2SA 1GGCL 5GRUL 1FNEB 2LU3A 4Y19A 1BVKB 2Z93A 2HN7B 5BW7C 3T3PF 3NPSC 5DD3L 1K4DB 3QRGL 2A74B 4YGVB 5J1SC 1J0IA 2FHBA 4WUUD 1TZHB 3IAGC 4G8GE 3QEHB 1EZVY 2YZ8A 2KPNA 4RMRA 4EEEA 2DLFL 1U8LB 2NY6C 5F1IA 3F12A 4I9WD 4RAHA 5T1KD 5IMOA 1OAUL 2P47B 5GGSB 4CVZB 4JKLA 4PJHF 1WTGT 1K2DA 2DQCL 3FTGA 2EXYD 1AHWA 3QIWA 1CD1A 1VSCA 5D93B 1ZKAA 2E8ZA 4HQQL 3VI4F 4BSVA 5E8NB 1U3ZA 2ATKB 3D2UB 4LPWA 4L3CA 3F7VB 1DSFL 4UBDC 1H8OA 1NC2A 4WFED 4HC1H 1D9KA 2DOCA 4AG4L 2CGRL 4NQXB 1YN7B 4D0BA 4JZOA 2EIEA 5GQBA 1IM9D 4ZUUB 1EH9A 5GS2D 1G9MH 3SDCA 1YNLH 1KIRB 5E99L 2BSTA 1KENL 1M71B 5ESVA 1BJ1J 4EJ1C 1PZ5B 2C1OB 1EAPB 2WWKT 4PJIA 5JPMA 1I8LC 1U8PB 1WWWX 5T3ZE 4U2YA 4L8DB 5HGHA 3RDTA 3FQRB 5TDNA 3SE3C 2YPLE 2F5BL 1N59B 3SCMC 4MCZB 1WBXA 1MFNA 2Q20A 1PYWB 1PEZA 3W0WA 2IPUK 3MQIA 5T3ZL 2EDJA 4DCQA 1LP9F 1XR9A 4XWGL 3O3UN 1OGAE 5B38B 2PO6C 5K59E 1DLHB 4XXCA 2VXSH 3DVFA 4PRBB 3EHBC 3AMKA 5J6HB 3MRFB 5GGVL 1CVRA 4Q9QH 2NY2C 4ETYA 4AMKH 4KVNH 1Y6NR 4JDTL 4M43H 5I1GL 3PGFL 1OTTD 3RI5K 1G7IB 4MD0B 2JJTC 1MAML 5GJSH 4NO3B 5IP4A 1AC0A 4HFUL 5T3XD 2R4RL 3MV8B 4ZOEA 5C70A 3TCLB 4XMKL 3BPOC 2EDTA 1S9VB 2HFGH 4KUCF 2Z8WC 4RA0C 3QO0A 2R0LH 4TYUA 4OCRL 1L6ZA 1RVFH 2DJ4A 5DK2B 5F7HA 1S7TB 3EO9H 5C0CA 5LBSL 4M5ZL 1B0GA 2AK4A 4FFWC 4S11A 1BOGA 3ROLB 4CVWA 1CBVL 1JPFA 2EDOA 4JPWL 5GRJL 5E4EB 4MCYB 2IMNA 3DBXB 3U36A 3UJJL 3HE7A 4BZ2H 4PJAE 5ECJE 5MEND 2X10A 3WLBB 5F1NB 3O4LA 3JZ7A 3HC0B 3KXFE 4ZDHA 1X5YA 2FJFB 1P4IH 2XKUA 2NY5H 4PJDB 4LCCA 4X7FC 5DD6B 1OB1A 2NY1B 2QQKH 3QUYD 3TVMC 5FYKU 2ITDA 3MJ9L 2AEWA 3G9VA 3PE9A 1UM4H 4R4NC 5CJ5A 4LVOC 1GJIA 4H8WL 4CAGA 2GJ6E 4U1GC 7CGTA 3DI2B 3RGVA 4E42B 5K33A 4ETQA 3UO1L 3QFDA 1UZ6E 1HN1A 3MJGX 1UWXH 1FVEA 4M8QB 5JOEA 1W0WB 3KYAA 1ZE3C 3NIGE 2ICWB 5AAWA 3VFSB 1HDMA 1MHPH 1UJ3C 4PJFE 3U0WL 2B1AH 2W65A 1FL3A 3ZDXF 1FG2B 5TGBB 1KB9K 1D5ZB 2UWEB 3MJ7A 5I74B 4U31A 5E9DA 4PJ5B 3FO2B 4HWZB 2X9WA 4URTB 3RBSA 5SWZE 3J8F7 1BVLA 2WK2A 5ILTH 2VDRH 2QV2A 2MKLC 4PRDA 3BI9X 5C0BE 4LLYA 1OPGH 3HN3A 4KZEH 3PWVB 4LDOB 4L8CA 3LSOB 4YK4C 1UH2A 4ZMAT 1HH6A 2M26A 3U2SB 1PX4A 1KF9B 2B5IC 2M8XA 5EOTB 1P9MA 3C6LD 5GXBB 3UMTA 2C3WA 4G8GA 3LD8C 5CMAB 4KGLA 2C7UA 1ZA6A 4WW2A 5HHOE 1TTGA 4YHMH 1IGCH 3T0EB 2FDBP 5KSBE 4D9LH 4QF1A 1MCLA 1AGFB 4JFFB 3AM8A 2ZUYA 3IXAA 1XGUA 1KTDA 4R9HA 3VXRA 1FV1A 5EBLA 3ZT6A 5JW4R 1HHGB 3V5DA 2IPKA 1A02N 1HZHH 2JJWA 1HKLH 4HC1L 1IM3A 4G9FE 2RCSL 2B2XH 4S0TD 3RVVC 1T7XA 2ZOLA 1XAUA 2ZUUA 5D7LD 3UYRH 1GPOH 2E3VA 2ICWJ 3PWUA 5JW3L 3PXJA 4HKXB 1D6VH 4ZFOL 3G5VB 5GGTH 5CD5D 5E8EB 1T1WA 4K2UL 3CNKA 3FCTB 2B8OT 1Y0LB 4WU7B 4O5LL 4ODUA 4DGYH 3DUSA 1T7YA 4I8DA 3W9DA 3G6JB 1PQZA 2FZ3B 1A1NB 1T66D 3MJ6A 2HVJB 3TZVB 5FKPB 5EBWB 3TPUA 4OZHB 2X4OA 1UZ8B 2MWCA 4K3GA 2SEBA 2ICES 1SJHA 1OAKH 4WW1B 1HEZB 1RHFA 1S7VA 3MLSL 4JFXB 4JFEB 3DHMA 4Q2ZA 3OKKA 5EU6A 4P9MH 1OGAA 5GISH 2ESVB 3I75A 2XQYK 2XWTB 3MV7A 1H3WM 2Q3ZA 3NCFB 2P5WA 3DPBA 2BFVL 4AQOA 4ONGL 2VISA 3ULVC 4BK5A 3D69B 4I0PD 1BX2A 1MFEH 2XQYG 2HJLB 4HKZB 4X6CA 5IR1B 2VWEE 4LSVH 3TA3B 5SWQA 1NFDF 3RL2B 4WI7A 3LCYA 1C16A 3DX8A 4OD2B 3WNLA 1HNFA 1OAYH 4WY7L 2JCCA 5BRZD 4ODVH 2BVQB 4N68A 3VFRA 5HDBE 1QSEE 1U8JB 1A6ZB 3BW9B 3U7YH 4FQXA 1IJ9A 3PHQA 5F7MC 4H0GA 1KXQE 5C0AD 4Z77A 1MF2H 2UZIH 4ZNEE 3B6SA 3IDNB 5HYSG 1K5NA 1AO7D 1G1YA 1KC5H 3HS0A 4P23D 2FO1A 1GGYA 5I6XB 1HXYA 1MI5D 4MJ6B 2R2CA 2NZ9D 2NTSP 3KXFA 2ZKHH 3Q0HA 4JDVA 1MJJB 2DWDB 3ILQD 4M6MH 5F7KC 1N4XL 2F8XC 2ICEB 1J0ZA 1QFOA 4DUWA 2GJ6A 4LHUG 2QKIB 4GKZB 2J2ZA 4ZPVA 5GIRB 2X1OA 1I8MA 1AGEA 3JXAA 2VYRE 4YZFF 5D7JA 1QYGH 1RURH 4D3CL 2IBZX 4HZLB 4QXUL 4RGMC 2ZOKB 4I0KA 4RBPK 1J0HA 1BFSA 2AV7B 4LGRB 4M61B 5EDXA 1E28A 1MUJA 5JLZB 1RFDH 3MRBB 2RFXA 4FQCH 4HWBH 2Q76B 5DSCA 1ZHBB 5D2NA 5LAXA 1JIBA 3VGBA 1KFAH 1U3HA 2OLDA 4PRIE 4X4XA 5DEFA 4YH6A 5FGRA 3ARGA 4GRLB 3EYSL 4I2XB 4KZEL 2GCYA 3LKSB 5CZVL 1RK0B 4UV7H 1NCWL 3MCLH 1LEIB 4MDJA 1NEZG 1F5WA 3N1PC 5IK3A 4K7FA 3QAZC 1CFTA 2HJKB 4LRIC 2A6JA 2IJ0C 4PB9H 5E6IA 5E00A 1S78C 1E4XI 3LEXA 1QBBA 4QXTA 2P24A 3BH8A 4J3WA 1IGCL 2VLKE 5BMFH 2B0SH 1VGEH 2XN9A 1W0VB 2FSEB 1MRDH 2Z31C 4BQCA 2DQDL 3O6FA 3OPZL 4G8FA 1I1RA 4ZS6D 5DJAA 4L3EE 5F7NC 1DQQA 1S9WA 4NJ9H 4JKWA 1Z9MA 4HG4J 1CLYH 2CRZA 2VSCA 2EKSB 3QDJE 2G9HA 1XF3A 1AGCB 1VFBB 3O11A 1GPOL 4AH2B 3KNBA 2VH5L 1TVBA 3F7YB 3K1KC 1AGDB 1AR1D 4GKNA 4WNQA 4PJ7B 4HW6A 1K85A