2W65B

Anti citrullinated collagen type 2 antibody acc4 in complex with a citrullinated peptide
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
217
structure length
217
Chain Sequence
DVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-CITRULLINATED COLLAGEN TYPE II FAB ACC4
publication title Structure and pathogenicity of antibodies specific for citrullinated collagen type II in experimental arthritis.
pubmed doi rcsb
molecule tags Immune system
total genus 53
structure length 217
sequence length 217
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w65B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w65B01
2Z8VC 4WWKD 3ARXA 2V6HA 1EJOL 1GGUA 2P7TB 4MXQC 3EFFA 3O3EB 3O9WC 1MJUH 3O41B 1EO5A 3N50A 3C5ZC 1RUQH 3PHOB 1LO2L 1GHFH 1OY3B 1ZTXH 1QR4A 1YNLL 4ONGL 3ARRA 1P6AB 5KVEL 3CLFL 3CC5B 1JPSH 4ODXA 2UUDH 4PRID 3HR5B 1A6VL 5T1LD 5E56A 4Z18A 5DF0A 1UJTA 4OLYL 2EDLA 1F4XL 4OGZA 4JZOB 5D1XB 1OWRM 3EYSL 5C0RL 1W72L 3T65B 5TE6H 4YHLL 5C08E 4I3RL 2EH8H 2Q8AL 4U1KB 1G7QA 3HNTH 4XCYA 1NEZB 1CLYL 4NQXA 5HYFA 5EORL 5FYLL 4KQ3L 3RNKB 3KLHC 3D69B 4LOUC 3MRDB 3GO1H 4WFFE 3VI4F 3RIFF 4LLUB 4X6EB 1KIQB 5I0DA 3FMGH 1OTTD 4G8GA 3RIAK 1N4XL 3QDMA 1J8HE 4ZXBD 8CGTA 1MFAL 3WE6A 2GSGB 4XB7A 1FRGH 4PP1D 3QWRA 6CGTA 3KYOB 2VMFA 4N0RA 4DVRH 3WHXB 2NQCA 2OL3L 1G7LB 4C57C 4NNYB 3MBEC 3UC0L 3G5XB 4RISH 4UNTA 2APFA 4ZYKA 3QUMA 1CF8H 3FHQA 1ZHKA 1JHKH 4WCYL 3RDTC 5D6DC 4EUPA 3BP6B 5GJSL 4YDJB 4S1SL 2QR0B 4IMLB 4PP2A 1KTLA 3RY6A 1HCFX 4RWYL 4KWUA 1BEYL 3SE3A 2NNAA 2X1QA 1FFPB 1NBYB 1S9WA 5KVDL 1CBVL 3H2WA 32C2A 3FO1A 4CVZA 4KV5E 3T2PA 4PJ5E 1G6RL 1DUZB 3U6RB 3O4LB 5DD3L 1RK0A 4BK4A 5B38A 2UWEE 1LE9B 1JI2A 3OAUH 1BZ9A 1QFWH 1MFEH 2IQ9H 1NANI 4UV7H 3IFPA 5KW9L 1CDGA 4HKBB 4MX7B 3RKPA 3MLRH 4NUGH 5DTFB 4AH2B 1RJZA 4FMKA 1WFOA 1U36A 4QF1A 4W6XB 3SGJC 4HIXL 3CVIH 4HUWA 4OF0A 3O9WA 3VFOB 1FDLL 1A47A 2EKJA 3WIHA 2PN5A 3C5ZA 1Q72H 3U2SB 1FC2D 5ALCL 4GG6F 1TZHB 3EDKA 4HFUH 1ZT7B 4PJGB 3FT2A 1T03L 4Z0XA 1XGTA 4WIQA 2PUQT 3RWFA 3QDJA 3FQRB 5K9OA 3AAZA 4LGSB 2H2PC 3IJYB 1VGKB 4J3OC 2F15A 5C9JA 5DQDL 4LL9A 4OI8A 2A1WH 3MUGA 3IXTB 3PNWB 5KSUA 4H8WC 5JORB 1CTOA 3MV7D 3IAGC 4JFYA 3NACL 4Y1AE 2YPLD 4U2ZA 4QHLA 3DRQA 2MJWA 4OLZL 4GKZB 5FYKE 1PKOA 5FM4A 1U8IB 5F9WB 5K59F 1FBIH 1MWAA 4NRZB 4KY1H 1EFXB 5E4EB 4KFZC 3ZSTA 4AM0B 1OGAE 4R8WL 3DVGA 3R1GH 2WP3T 4JO1H 2XG5A 2EC8A 3MFFA 2RHEA 3DLQR 5KN5B 4OV6F 4EDWL 2NY5L 3RJDA 1IGMH 2BNQD 2XWJB 1GZPB 3MBEA 1ZHKB 3QUZB 4WW2F 3RWHB 4BH7B 3RDTA 3L3GA 4U49A 3HUJA 2C1PA 5D6DA 3IYLW 4XXCC 3N06B 2GT9A 3GSQA 3D5OF 4S11A 4XXDA 2DWEB 1PG7W 2NY3B 3QCVH 3I50L 3D0LB 4DGYH 2EDXA 1CGYA 3JV4B 2R56H 1ERNA 3BIKB 2VH5H 3NOIA 3MV9E 1MAMH 2HLAB 1INEL 1LEIB 2YPVH 4GW1A 1OAYL 1X5YA 1Y18A 1RY7B 3KXFA 5E8EB 5FV2A 1YPZE 4KGLA 1TJHL 4BH8B 3TT1L 4PJDA 1FCGA 3OJDA 7FABL 1MCDA 5FDWA 1NFDE 3FTGA 3GI9L 12E8H 2VQUA 3P9LB 3AREB 3QNZA 2A9NL 1SJHB 4M48L 3SGJA 2OMNA 3L5XL 1J11A 4PJFE 4M9PA 1JNHA 5EU7E 3C5ZB 1JWUB 4U33A 1EERB 4G6KH 1T2QH 2F74A 2X4TA 4PJCA 1WITA 1S9YA 1A9BA 3SKOA 3TZVC 1RD6A 3RTQD 3MRHB 3RVXC 3BVNB 3HE7C 3K2UL 2CUHA 1HHJA 1D5IH 3BMWA 5FYJD 5JHDE 2J6EL 5J1SC 1C5CH 4XH2B 1X5AA 5CILL 3FQNA 4MAUH 1XF2B 3BW9B 3WFBH 1KBGL 1G7JA 4LCWE 1KN2H 3MO1A 4U1SA 5FA3A 1G9MH 1YEFL 4E41D 1Q0YL 4Z77A 1XH3A 4L5FH 3F7YA 2N56A 3GI8L 3HMWH 4NO0D 5CWSA 1RUPH 4MA1C 4KAQL 3G9VA 3ZE2F 4LK4A 3OQ3B 4UIKL 1YEJH 1D5MB 2XN9D 3AU1A 1D9KA 2O26U 2XPGB 5JUEH 4PJEF 4N5EC 1YUHB 5EO9B 4K94C 3C60A 1FG2B 1JPFA 5GRVL 4F7TA 4PGCB 4KKAD 3W2DH 1ROWA 4PREA 1NEUA 3PDDA 2C3XA 3QJFB 2Z31C 5E0QA 3MBXL 1SJEB 1WWCA 1DQLL 4Q9RL 1QUNA 2C3VB 2PR4H 3EDJA 1BFVL 4U1HA 3B6SB 4XXCA 3UTTD 4AEIH 1GAFL 4MJ5A 2NXYC 2IPKB 3CVHB 4Q2ZA 5J3HD 4YNYB 1HINL 3CAFA 5K93A 3BKJL 4YGVA 3FL7A 3LCYA 3JTTA 5EPMA 3IFLH 2VE6A 4FQCH 4GLRI 1OGTA 3HI5H 4NQUA 4XWOC 1JPGB 2NXZC 3S35X 5F71A 3QR2A 4KKNA 4JFFB 5LGHH 3MGOA 4FOMA 1R3IH 1HNFA 1C5BH 1HSBB 1UEYA 5DS8B 3CFCL 3FFDB 3BE1H 4GKNB 3EO9H 4S2SA 3GJEB 4MJIB 2B1HH 4APQD 3EFDL 3H7BA 2KDGA 2H8PA 2XZCH 3JUZA 3UPCA 3VXSB 3DWTA 4U6VH 5EO0B 2BMKB 4NM4L 3VI4E 1A5FH 1S9YB 3UJIL 4NQCD 3D3VE 3QHZH 2X9WA 5CSBA 4EI6B 4YPJA 3TZVA 5IB5A 5D2NB 3H9HA 2AK1L 2A74A 3LB6D 3A67L 2DQDL 5IM7A 5HVHB 4BSVB 2AEPH 4M6OL 5LBSH 4I77H 3MYZA 3MJGX 2H32H 4HWBL 4YDLC 1OSPL 3MROA 4L4TE 3AY4C 1NJ9B 1CFNA 1XH3B 3OHXA 1GC1L 2VSDA 2R2EA 3SKUD 1KC5H 2PTVA 3NAAL 4NYLA 5DEGA 2XTJE 3VH8B 4OJFH 3TBYB 4QTIL 4N8CH 4Q7DA 2OJZH 2O5ZL 3L3JA 3ULVL 5LCVH 1JPST 3BKML 4MD5A 1UYWH 3K1DA 4JY4B 4JY5H 1CD0A 2X4RB 4UBDC 1RPQA 4PB9H 5TE7L 3EBAA 3GMQB 2Z31A 5CJ5A 1IMHC 4JN1H 3SJVB 1ONQA 1UACH 2A2QT 1EUUA 3T8XA 3BO8B 3HPLB 3CH1A 3U0PA 1PQZB 2EZ0D 4GG6E 1CDCA 2BNRD 3D25A 5TJWK 4JQVC 5IMMA 3VW3L 2BXZA 2HMID 1FAIH 5IT2L 5JLZA 3MRPA 1CXLA 5DO2C 4UTBH 5C6PB 5ESQB 1QD0A 1KCUL 2OXHA 5HHOD 1A8JH 3C9NB 1TQBB 1YEGH 3V52H 3THML 4WUUE 4R7NB 4YDIH 1JF1A 3H7BB 1P84J 4UOW1 5L6YH 2DIBA 2FATL 5INDB 4JPIA 2DQFB 1YMHB 1ZK9A 3SGKC 2HG5B 2F19L 3LHPH 1QLFB 4HK3J 4KJWD 5F7LB 3MUJA 5K59E 2WWKT 1PSKH 4UTAL 4GQ9H 4QT5B 5I18H 5T5FH 3HE7B 1CL7I 3GMLA 4M4PA 3MLXH 4P2QD 1IILE 4WFHD 1MPAL 1S7QB 5IW1A 2XI9A 1OAKH 2IADA 1AD0B 2JK5B 5C70A 4O5LL 3HFML 1SEBB 3MV8D 1S3KL 2AJSL 3MR9B 4ORGB 3GSOB 4GAFB 3N1QC 1IEAB 1RVFH 3T2OA 5DK3A 5EZJA 3VFGL 3TT3H 3RL2B 2PTTB 2YMXL 5HHXL 5GRXG 3V0WL 4XP4L 1G7IA 3AY4A 4JO2L 3U79A 4PJIA 1FO0A 3HMXH 4WI8A 3C8KB 4NZUH 2ENSA 1EFQA 4R4ND 1Z9SA 5F9AC 4Z0BL 5L2KD 5DJ8B 1BOGB 5HY9A 1DLFL 4RA0C 2DQTL 1A7PH 5JPMB 2QTEA 5E5RB 4DEPB 1YEHH 2Z8RA 3MRJA 5L8JB 4P2OB 2VLRE 2BRRH 4IRSD 5EU7C 1QRKA 1IZJA 1EEYB 1NCAH 4RQQA 2J88L 1KB5B 2Z31B 4OQTA 1X5IA 2PXYA 4QRSB 1LO0L 4NN6C 5FYKU 4PRAA 3CK0L 3A6CH 4X9IA 2ESVE 1A6ZB 1QYGH 3ARWA 3ZL4H 3MYJA 3GMNA 4JZJC 1E27A 1UH4A 4G8IA 5C08B 2FDBP 4UQ2B 3SDCC 2ADIA 4J1UB 4JQVA 3MJ7B 5DD5L 3MXWL 2OTUB 4Y4FD 3N85H 5JLZB 3GNMH 2V17L 2X4QA 4HIIA 2NXZB 4Q0XL 1HHKB 3JWOL 2WINB 5EUOF 4NQEA 2JJTC 2EEAA 4HPOH 4Z95H 5D6CA 1R5IB 1FL6A 2OTWB 4YK4B 1KEML 5CIPH 4J6RH 4DQOH 2UY7A 5C6TH 3WXVH 1J8HB 5GHWH 4HUMB 4D3CL 5F9JB 4P5MB 1Z3GL 3AMLA 4YHIA 1MI5D 2VDOL 5FXCH 3SGKA 5SX4H 3OB0H 2BCKA 2EYTA 4JRXE 1I4FB 2E9BA 4KI5C 1X9QA 4QRPE 5HGAB 1MRFL 5DUPH 5JOPE 2ZUVA 3D9AL 2GJJA 4OZGA 3JTSB 4MAYC 4WFGE 2MKLC 1FORH 4L29A 3ZE2E 1VHPA 1AGFA 1RJYB 4KZDH 1WCBB 4KK8D 4QWWD 2CSPA 4NZDA 4PJEE 4KK6C 1NSNH 4HF5L 2JIXD 3KJ6H 4J3WA 5DVOA 2UVEA 4KVNH 5DMKB 4YDKL 1P84K 3U48A 5DVLA 1YMMA 4XPBL 3W0WE 3H9YA 1MJ7L 1U8LB 4PJ5B 4YDLB 2R1YA 4PS4H 1VADB 5E1HB 4BFBD 4PGZA 5GGRA 1F2QA 2UWEB 4WGVB 3W82A 1P4LA 4F8TA 5IQ9B 1XF4A 4P23A 4MA8H 5I76A 5HI4D 4KZEL 1QKZH 4FXGB 3UTQA 1KIPB 3WO3B 5IB1B 5J6GA 4NRXB 1I85C 1TNMA 2WLYA 5AZEL 2CRYA 5GRJL 5F7EL 1F4WH 3IT8D 5E6IB 5I16A 4A6YA 4JFDD 3EJYD 3HZVA 3ZLQC 4ZFGL 4HV8A 4IBLT 1YN7B 4OCXL 5GRYA 2K1MA 3QIBC 4CNIB 1I7TB 2PYEA 1QFUL 5IMLA 4KKLC 5IWLA 1MEXL 1HILA 4LDLB 1T1WB 3IDGB 3U4BH 2X9YA 2FLRT 4HKXB 3C09B 5GS0D 1A6PA 3BX7C 1I1RA 2GFBB 2GK0A 1D5ZB 3SDCA 4XPHH 3F7RA 2GJZA 4XGZA 4Y1AB 1NGQH 4K23H 5DWUH 5EIIA 4YR6A 5HDQL 1TCMA 3J8F7 1U8KA 4MNQA 2B4CH 3BRDA 3ORJA 2Y6SC 1I3RB 4KHTL 1FL6B 2JJTA 3WS6C 2E8ZA 3D18B 5DHVA 1XGYH 1GGBL 4U1LA 2LU4A 43C9B 1F8TL 1OGAB 3MLVL 5GS0H 2X4OB 3NN8A 4HGKC 4QHKI 4UQ3B 2A38A 3QIWA 4NJ9L 3H0TA 4HCRL 3O2VH 5T1KA 3IVKA 3ILQD 5HD8C 4ODBD 3IU4H 4MQTB 1QPXA 1I9RL 2I5YH 4M62L 2QSQA 3ARDC 3LRSB 3BEVA 3C5SB 1VFAB 1MY5A 1OL0A 3SQOL 3IXAB 1P7QA 5I1KL 5FUCC 1BF2A 3MRCB 4OCMC 2EDHA 3L3KB 4OLVL 5FAAA 4IRZL 4QTHB 4XMPH 4MVBD 3TVMC 2I9LB 1RK1A 1MY7A 1I9JH 2B2XH 3MV9B 4LQFL 4LARH 4PRBB 1SY6L 5EO1B 4QGYA 4W4OA 2VXQH 3LEXB 3QEUB 1YPZB 1AGEB 3G5YB 3F7VB 2R0ZH 2X7LB 5C3TA 1N5AA 4OIIL 1NFDB 2E7LA 2VZOA 3W39A 4K8RD 4YLQT 1WC7B 4FQ2H 4L3ED 1C8PA 2QHRL 3VCLB 1L9NA 1CVRA 4A6YB 1R3JA 3ZTJH 4PJFB 3VXUA 4E0RB 3TIDA 4HV8B 2DTMH 3LQAH 4G7YH 1U93A 3VXRE 4J3XA 4QHMA 3W9EB 3WD5L 2DD8L 3PWUB 3QIBA 5IMOB 5KSAD 1T21A 2X9XA 3NCJH 3UROR 3VDCA 4K8RH 4M1CD 3L5IA 4GXUN 5JHDB 4OBSA 4KTDL 2I27N 1OTSC 3ES6B 4KRLB 2A6IA 4JZJB 4RFNB 2A6KB 4W81A 3NVQA 1DQQA 1BIIA 2GJZB 3LKQA 4LCWB 4K7PX 1BQLH 2D7TH 1NGZA 4G6ML 5J8OA 5IGXL 1F6LL 4H5SA 1T89C 1XF5A 1ADQL 1JRHH 4L8DA 4JPWL 5D96B 3UBXI 3H8NA 2CKBA 3RUGE 3QPXH 1MELA 3RPKA 3T3PF 1K5NB 4KMTL 5FUZL 4XPAL 4Z7WA 1QACA 5I2IA 4F7PB 3PWLA 5EU3A 3CX5J 3LEYL 4KJYA 3EW3B 3QXAB 2X2YA 4YBQD 4PLKC 4DZBB 1J05A 3PWJB 1EVUA 5HYSG 3DGGA 4U1MB 2RR3A 2VLMD 3ARDA 4X7SH 4MAYB 1MVUA 2VDNH 3L6FB 4LPTA 4X5WB 5T3XD 1EMTH 5FA4B 3O6LL 4MJ2A 1OHQA 5EDXA 3VU2A 2R9HC 3T0XA 4U6YB 4D8PA 2N4IA 2VZ1A 2HJLA 3ZTNL 1N8ZA 1RZ8B 3V5DA 1H15A 5AUMB 2GCYA 1U6AL 2ZJSH 1M7IB 3D85B 5T3XH 2H45A 4F3FA 4M03A 1C5DA 3GJFH 3BH9A 2HT3C 5BVPH 1DQDH 1N5AB 3DSFL 1OSZA 5MERB 3RBSA 3IFOB 4MLSA 3WV0A 4KKCD 1G1CA 3HB3D 3O2DA 3CSBA 1CYGA 2VN7A 1MCLA 3NZHH 1I7RB 3L1OH 4ZUTB 1T1YA 1LDPL 3S3PA 5JHLH 1U8NB 5EUOE 3ROOB 4HUVA 3RL1A 3FO0H 3ZKND 2A83A 4QCIB 1WCQA 2P24A 3D3VB 2YBRA 1GL4B 5BV7L 4KHXH 4MQXC 4MA3A 4FQJH 3BAEH 2X89A 5C2UB 1DEDA 3CFBA 3H9SA 1HQ4B 4HFWA 4F9LC 3KYKH 1JZ4A 1A2YB 5L9DL 2V2TB 3OR7A 5HGBA 3D39D 4ZAKD 4CADA 1T5XB 3LZFH 2YWYA 4XC3H 4M7LH 3SY0A 3VMPA 4Y89A 43CAB 1FL5B 35C8L 3CDFA 3EOYG 3SOBH 3HC0A 1WF5A 1I1FA 3P4MB 5GSRB 2AK4A 1C1EH 3MNVB 5GS1B 1XF5B 4M7KL 2AEIT 3U7AA 3Q3GA 1EA9C 3MUZ1 1YQ2A 3O2WL 1T89A 4L4TB 2CLVB 2W59A 3ZT5A 4ZTPH 4LBEB 5ESVA 2IGFL 5EWIH 1I9IH 3OTTA 2XTJB 4Q97A 3EOBA 3PWLB 1EGJA 3VFMA 3M8OH 2DS4A 4XMKL 5LXGH 5HVFB 3SDDB 5ITBH 5JW4Q 3ZYZA 1AIFA 2OZ4H 1J05B 4GOSA 3PHQA 1MREL 5KOVC 3T4YA 2XY2A 3P40A 3W9DB 2YA0A 1YEEH 3B9KB 1QSEA 2GJ6A 2J8OA 4EI5C 5IQ7L 4NKIL 2EH7L 5SWZE 4L3EE 4N68A 3ARVA 1G0XA 1MCOL 2YD2A 4TSAH 1A1OB 4Y16C 1LO3L 3TVMB 3W5NA 2MTPA 2UZIH 5CEZE 4GG6B 5E99L 2HJKA 5J13C 3CX5K 2BVTA 1F11A 3ARBD 4TVPD 1KJ3H 1KPVA 2VISB 1KFAH 2NY4D 4NC2B 5H37H 5IFJA 2GTZA 4UT7L 4XP9H 1S7SA 4P3WA 2ARJQ 1KLGB 5FO7A 4O58L 1TJGH 4TNVK 2VIRA 4WUUB 3S36H 5AG9A 1AP2A 4I0PD 5DQJA 3WFEH 2OTPA 4TOYL 3UTPD 1I7UB 5FKAA 4TVPH 1WJ3A 1FNEA 5DSCA 3IAPA 3PL6C 2F54A 3AUVA 2GTWB 2XRAH 4OZFH 2OP4H 3DMMA 4MA3B 3DNKA 1C08A 3K2MC 4MQ7A 4K3EL 4OT1L 4QHNB 1SVZA 4UINL 5FGCE 1HE7A 5CGYC 4F9LA 1EEQA 1F58L 1JL8A 3ARGD 3KPNA 2VLJE 3VFTB 1UZ6F 1OW0C 3C6SB 1HHHB 5K9JL 2Y07L 1NAML 3SY0B 1QR1B 3DXAD 4LSPL 4BQ8A 4WW2B 4N0FB 3GMOA 3LRGA 3LIZL 1LEGA 2FLBT 3MJ6A 1S78C 4F15B 5LAXB 3ARTA 2AKRB 2W92A 3IDYB 3MODL 5H94A 4CVWA 4P2RA 5C0GB 1XMWA 1FLRL 5C0DB 2OL3H 2FECL 2QQKH 4Z7QF 5JIKA 1P2CA 4XPFH 4XVTH 2GSIA 3GMRA 1ND0B 3WJJA 3T0ED 1NCDL 4MJ6A 5K9KA 4ZSOE 2BOBA 2HFFB 1I1AC 2AQ1A 4UIMA 4MMZC 4WCYH 2VDPL 3SDXF 5J1AA 1FPTL 2IPTH 2VLRB 4LLYB 2I07A 3EYQC 1B4RA 1FFQA 4XTRC 4PPTA 4KRPB 1KXVC 5FO8B 3Q6FB 4JB9H 2EDKA 5IW3A 1ETZB 4LVHB 4OLEA 4HDIB 5E7FA 4MXWH 1FNFA 3MTRA 1DLHA 1WSST 3E0GA 2D4DA 2W9DL 2ESVB 4YDVB 5EOCL 4EUPG 4JR9L 3GSNL 3HHRB 2CIKB 4QRRD 5ID1A 3OKLB 4Y16A 2Z35B 3S35L 4MDIB 4JEGB 5D1QB 4DGVL 5I1JH 3RU8H 3I75B 3KR3L 1S8DA 5IFJB 4J3TA 4AT6A 3UTSE 4KVCH 3ZE0E 2NYYD 3ECBB 1EJ6A 5BZWA 3HG1A 5DZLA 4ALAL 1BVKB 1HSAB 5E2UH 5BRZA 1JZ5A 4PTTB 1KUMA 1MCWW 2NTFB 3MRQB 1IAOA 2QQQA 2IANA 3VXOB 3NIGF 4LGPB 3QIUB 1MFCL 3PL6A 3LPWA 4X80H 4JRXB 5EBLB 3WFCH 4XVSL 5DJDA 1MHCB 4QRPB 3KPQB 3TF7C 3OB8A 3QWQB 4OZHA 4YO0A 3SGEI 9CGTA 2W0FB 3T3PE 4N90D 3GM8A 2Z8SA 3MA7A 3V4UL 3NFPA 5E6YA 1NCUA 3DHMA 3PG2A 3HAEB 2VR9A 1LO5B 5FOJA 5C0CA 4PJEB 3EGSB 5E2TH 5J56B 5I1LA 5HI5C 4PJBF 2NY6C 3RWGB 5ITFA 5T1DL 3I2CL 5D71H 3MJ8A 1AGCA 4DKFH 3DIFA 4DWHA 3W0WB 1NGPH 4ELMA 1B3JA 1O0VA 4RWHA 5HHMD 4KROB 2Z92A 2H26B 3CCHA 3CFEA 3HZMB 1RJCA 4H1LH 3AC0A 4RFOL 5I8OH 3QI9C 3HZYB 1CXHA 4YHNB 4BQ9A 4U1NB 5I1AB 1GH7A 5AWNL 3ARFC 3MZTA 5HYEA 1T66D 2JJSC 5AYUL 4C56A 5IBTL 3S3SA 1FCCA 4G5ZH 4Z5RB 4KPHH 2IAMC 4LHUB 3QO1B 2RCSH 4FFYH 2X4UA 4R7DA 2P8LA 3MXVL 1A6AA 4U7SA 4JLRA 4JJ5B 4M02A 4NFBA 3KYNB 3C87A 4WEBL 4F9PC 1DDHB 1N7ML 3QXTA 5D7JB 4JRYA 5CCKH 4GXVL 4EI5B 2F53D 5I1DB 4MA7H 2OM5A 2HKHH 1OAYH 2FIKB 2ZNWA 2AJXL 4TQEH 1QSZA 1HKLL 3B43A 5DMYA 5FYLE 3V5KA 5FB8A 1YYLL 3HS0B 5JOEA 4K2UH 1ZLWK 1UM6H 2Q3ZA 1PYWB 1KNOA 2V2WA 3S4SA 3MOQA 2CDEA 5CBEB 1NMCB 2X4NB 3D2UD 2NZIA 4OFYD 5EN2A 3DV4A 4HIEA 1KGCD 4ZOEA 1OM3H 1IAKB 4R4BA 3MV01 1U92B 1IEBB 2FX7L 5EC1A 3OPZH 3RGVA 4D0DB 3FFCE 1HDMA 1OB1A 4RGMC 2J6EH 4G42B 1CXEA 1N0XL 4PGEA 3DX6A 3FB7B 4M8QB 5IVZA 2DM3A 2C26A 4RAUB 1MCPH 4QY8B 3UZVB 4NPYB 1S7UA 1HXYA 1P9MC 2VWEC 1WBZA 2BRQA 5ERWB 3IB4A 2IH1A 1E6JH 1D3CA 4LKXA 4Y19E 4P5TD 4YHKL 3G08A 3ZT6A 1Q8MA 5D7LA 3GK8H 3NTCL 3ZYIA 2APWA 2BY0A 3G6JF 5C0AE 2GY7B 3CFEB 1I8KA 2B8OT 2EKSA 5JW4R 1A7OL 4OCYH 4H25A 4PJ9D 1QBMH 3QI9A 3VRJA 4L3AA 4WFED 2APVA 3WNOA 4V1DE 1PLGL 4P46C 4ORZC 5J57B 3LSOB 3ULUL 2G75A 3ARFA 1CDBA 1I1AB 4JRWA 2BOCA 5A2FA 3QAZB 1AR1C 3QUML 1SM3H 2EIBA 5ADPH 1S5IL 1MJJA 3QA3B 1HQRA 3JV6B 3VXRB 4EN3C 2NY1C 1QSFE 2AABL 5D2LF 4ZFFB 4Y5YB 2YD5A 1NC4D 4M7LT 3UYPA 3BWAA 3RVUC 4XHJD 4HIJB 5F3HB 2D9QB 2CGRH 2BVUA 1A0QL 1XIWA 4CN1A 1KELL 3FQUB 3MCG1 1IC5L 3AXLA 4QRTA 5HHPB 3HZKA 3D87B 5F7YC 1M05A 5J6HA 3CFKB 2C1OA 3EUUA 4HGMA 4L9LA 1H3WM 3BDYH 2P8MB 3PP4L 4LCIH 4EQ2A 1UZ6E 3HE6C 4DN4H 1IBGL 3RUGB 3VXTA 3MNWA 4AIZB 1Q94B 2AI0H 4M6NL 3WIHL 5DRXA 1T0MB 4OCSH 3HRPA 1FL3A 3QWOB 3U46B 1V3KA 4PJHA 1F3DJ 1G7MB 1FYTE 1IQWL 5E5MB 5BCAA 2ED7A 3GIVB 3PQYE 4XRCA 4Z7QE 4HK0B 5D93C 5IHZB 1VGEL 1BFSA 5L88H 1I8IA 1RU9L 3VWJD 1CICD 4OLXH 5I1EH 3KPRD 1LDSA 1FC1A 2X1WL 4PJ8D 1BWWA 2J8HA 5TDNA 3G08B 1HH9B 2ZCLH 3DURA 4HH8A 2UY6A 3B3IA 3SDXE 2NY6B 4ZS7H 4G6FD 3DECA 4G9FA 3BP7B 1PG7L 3PP3K 1IAIL 2FR4B 3VFNB 5F8RC 1MWAL 1AC6A 3G5VB 5SX4I 3T2NL 5CZVL 3TH3T 2AJUL 1MFBL 2ORBL 2ZG2A 5E08H 4PGBB 1HNGA 1R3LB 4KTEH 5F1IA 1XF3A 3VWKD 1TJIH 5HHQB 5SWQB 1LWRA 2BVQB 4P46A 1UCBH 4HC1L 3T09A 5MHSE 3ARFB 2HFTA 1RULH 3L3DA 3PABB 4JHAL 5DJ6A 4JM4H 3RWJB 4DAGH 1T1XA 3VI3F 2IAMB 5EUOB 1G7PA 2HJFB 5E9DE 1Q9KB 1OD7A 3REVA 2ZSVB 2EDJA 2RFXB 4QHKJ 4D0BB 4GJTB 3HI1A 2DMCA 2XZQL 4X7TB 5TQ0L 2H6PB 3VW3H 1AGDB 4R97C 4ZOAA 3NIGE 3TC9A 3QCTL 4UB0H 3AXLB 1NMBL 3I6LD 5I6XB 3QZWG 4HGWA 1RIHL 2EDNA 1DP0A 1T3FB 3QJHB 3D0VA 2DJSA 5C07E 4NOFA 3GSRB 3T3MF 2NY2D 1MQ8A 5F88A 4H88L 4YE4H 3PGFH 1U41A 1R3HB 4N0UA 4XX1G 1QO3B 2WBJC 5KAQG 2FBJH 2X1OA 2C4XA 4FZEH 2V5SA 4UOW0 1OAUL 4PJBE 3U7YL 2AV7B 2JTDA 1MIEL 3B9DA 4LVNC 1JZ7A 4LMQI 5B22A 1F90H 3E6HA 1FL3B 3MRLA 2QADD 1N59A 3PDOA 5KANG 2HKFH 2QQLL 1RZIA 1U8JB 3MLYL 3VFVB 2DDQL 4XP6L 4PRPD 2OI9B 4G6JL 2HWZL 2VAAB 3P73B 4WW1A 3BDBA 4H8WL 1H3VA 4YHML 4M1GH 3QXWA 1PDKA 4GW4B 1MRCH 5CJBA 3S34L 5I30H 1MNUL 3WLBA 2WUBH 3KPSA 5SWZB 3VFSB 3FB5A 2OJEB 4MGXA 1IRAY 5ANME 3EHBD 5DT1L 3BKYL 3VMNA 1AKJB 4FQQA 1IAIM 3LEVH 3V4PL 3QRFM 1QA9A 5HGDB 2VN4A 3MRIA 3E3QC 1DBAL 2H3NB 3QXDB 4M61B 3MRGA 1HYSC 1S7TA 5I71B 5HYJA 3MJ9A 4N1CA 5ETUA 3NFNB 5F7FA 2HYMA 2EDWA 3UYRH 4JG0L 1A1NA 2GUOA 5EU6D 3U7WL 5EU4B 3DYOA 1LO4L 4NHUA 5BVJB 1BVLA 4P99A 2MCPL 4EN3B 4U1IB 2NLJB 3IGAB 2VDLH 4Y4HD 2NY1B 2OR8A 1Z0NA 4M7ZC 1QFPA 3WEXA 1VFBA 4Y2DC 5FGCB 3OKEA 1E28B 2Q1EA 7CGTA 3X12B 1FFOB 1XGRB 4NWTH 4J4PA 1B0RA 5CP7A 1ZANL 3OSKA 2VLJB 2DQEH 2JCCF 4K7PL 3E8UL 3TM6A 4HPYH 3PGCA 4HGWB 4FZ8L 1FVCB 1RUAH 3I85A 3HC4L 4JDTL 5B39B 4QXTB 4FQ1L 4OF6A 1WAAA 2EYSA 2VB5A 4HWUA 1IAMA 4ONHA 4JQIH 4PRHD 2YEZA 4UILH 1HHGA 4XP1L 3GFUA 5C0BE 3OJMB 5IVOA 3F5WA 2HN7A 4Y8AA 3TV3L 3HE6B 2WBJA 1UWGH 3ULVE 2VDOH 4NFDA 1UXSB 1C12B 2V5YA 3MUY1 2V9TA 5KVFL 1JF6A 1KB9J 4M8VA 5KJRH 3TJEL 1JWSB 2E27H 2QKIA 4ZSOB 3AS3A 3LKPA 3G6JE 3GMPB 2XFXB 3QXVA 2RB8A 5I19H 1NGWB 3VG9B 2VXUH 2AGJH 2P8PA 3B4NA 1RIUH 4U2YA 1DL7L 1J0JA 2V2XB 3N1FC 4YWGH 4ZPVB 1FZKB 4WWKC 3DX7B 1OLZA 1T22B 1WIUA 4J8RA 4WU7A 4YDKH 2VC2H 2VABA 3WCYA 1HN1A 4FQLH 4YBLB 3U36B 4FXKA 4QOKE 3QULA 4WJ5B 3V8OA 5AD0A 5I75C 1EHLH 2ZZUT 2CRZA 4TSCL 1QTYT 5D2LE 1WZKA 4BSJA 1Q0XH 2ICWI 4HJGA 2VDKL 1U3HD 2HT4D 1I1YB 2PXYD 4OGXH 5DDHB 3UTSB 4L4VA 4ZUUB 5IR1A 2EIDA 3GSUA 2C7UA 2RGSA 2G5BB 3K7UA 2DAVA 5JA8B 3U4EA 1ACYL 4KJPD 3JWDH 4WUKH 2DWDB 1JF5A 4NHUB 1INDH 4LASL 1QPPA 1SYSA 2ADGA 2IPUK 2VKXA 1OTTC 1H5BC 2Y5TA 1XR8A 2BVOB 4ZXBC 5IW6A 1JNJA 2FH8A 4NQDE 4IOIA 1KCVL 2DICA 4URTB 5CP7B 4KJQD 2DLFH 4ETQB 4YUEH 3X14A 2R2HA 2O5XL 1NGYA 3NABL 2ICEA 1UB5A 2DQGH 1P5UA 1MCFA 3U9UB 2YKLL 1CVSC 3RBGA 3TH2T 3EJJX 4MNGE 4XCCL 3QNXA 4ZFZB 4PRPE 5IJVB 3SKNB 5JNYB 2G5RA 1K6QL 4UU9A 3RP1A 3TBWB 1U3JA 1CFVH 1IEHA 4MSWB 4I5BA 2WBJB 2UUDK 1LE5B 4K3JH 1RZKL 5IOPB 1HK6A 1T6WA 1BM3L 2CO6B 5DRNA 1YC7A 5TF1H 4L8BB 3BT2H 1IM9B 4LCYA 4RFEA 1CE6A 2EYRA 1F4YH 5FDYA 3LKPB 5HYIA 3BP5A 3DVFA 1LEKB 2AV1B 5K9QG 5GZND 3SGDI 2CJUL 1A6WH 4YFLF 5IROC 2BVPB 5LWYL 2CDFB 3IDJA 2YR3A 1UWEH 3AM8C 4OD1H 1G1YA 3FAWA 2ID5A 4AY0A 3Q5OA 1GGYA 3UBXA 1IM3B 1RZ7H 2OSLB 4WWKA 5I8EA 4XBPA 5JPNA 4OZFB 4XCFL 1W72B 5CP3H 4XBEH 4X6CF 2FECI 5KS9F 5IHUH 3VI3E 1VFOA 2BXYA 4X6DF 4YQXH 1KB9K 4AIOA 4G7VL 4Y7MA 4JG1H 2ZSWA 1DQTA 1MLCB 4PRIA 4HKJB 4I48A 1FO0L 3QH3A 5T1LA 3RI5K 1CLZL 4NSKB 4L8SC 2P5WE 4G3YL 3L3HA 4WHTB 3FO2B 4NZRL 3VXNA 1A3RH 2Z93A 4NIKB 2QHRH 2M26A 1NMAL 4OI7A 1FJ1B 5GGQL 3MCLL 5DHYA 4PV9A 5GGSB 2OL3B 5IFAL 1URLA 1EK3A 1S9KC 4U7MA 4NGHH 1CWVA 2QQNL 3FQXA 2XXCB 3T3ME 3LMJH 3T1FA 1EIBA 2XNAA 1G6VK 3NCYS 4GT7A 1FVDB 4B0MM 4OQTL 5D7IF 4OGYH 3ILPA 1A3LL 4PRHE 2YK1H 2DM2A 1H3PL 1H5BA 3FFCB 2P43B 5IW6B 4UUJB 4JE4B 5FCSH 1QSVA 3ARPA 3RFZC 3P11L 4Y2DB 3QUXD 4JPKH 2FJHA 1MRDH 2ERJB 1ZA6A 3R8QA 4Y5VC 3LH2L 3CXDL 3QIWD 2CMRL 2W0PA 4GRLB 4G9DA 2BX5A 4XPTH 3HI6L 4Y19B 2WUCL 3M17B 4G43B 1G6RB 4IHOA 4JM2D 1L7IH 1ADQH 2PCPA 4XP5H 1FV1B 4UDTA 8FABB 2Q6WB 3H42L 5HJ3A 3TPKA 5ISZE 2V5RA 3WNKA 4PLOB 3WXWH 1KPUA 2FGWH 3NIDF 2ADFH 5ENWB 4H26B 3PV6B 3B2VL 1WICA 4V1DB 1F2XK 1VPOL 4DCQB 1T7ZA 2L7JA 1KXQE 3S98A 5IBUG 4HWZA 5CJQH 1CFBA 4QNPF 4F7CB 3RWIA 3KAAA 5E2VH 3O6ML 3QFJD 4TSBL 5IROA 1J1OH 5TH2A 3AM8A 1EAPA 1AI1L 1JFQH 5CD3A 4WWKB 1FNHA 1KCSH 3WJLA 3UZQA 5E7BA 1QSFB 5GIRB 3DI2B 5F44A 1J1PL 4PGJA 3OKYA 4XNMA 1T2JA 3ZDYF 4JO4H 3RWDA 1EHNA 3VXME 2C3GA 1ORQB 5JMRA 5I75B 4V2CB 3L7FA 1X7QB 5TFSH 2CDGB 3RTQC 3UPRB 4FG6D 5T5NF 5GRVK 3IDMB 2ZKHH 5EBWB 4CVUA 2VLKE 4KMQA 5DJCA 4GUPA 2DQJH 4AIXA 3SE8L 3DX9B 4ENEC 1MQKL 4JKPL 4P4RB 3NCEB 2JCCE 4OLWL 4M4RA 1J12A 2JB6B 3MV7A 3ULVC 2B5IC 5EIQA 4BSWB 4HT1L 4CBPA 5DUML 1YQVL 5F1NB 1FGVL 1IE5A 1K85A 1JHTB 1LD9A 5DMIH 1N6QL 1S9VB 4FHBD 1DBBH 1JNNH 1RZJH 2O5YH 3IJSA 4OB5L 1FYTB 4ZXBB 4IM8A 2P49B 4K9EL 3OKDA 3PQYB 4X8XA 4JFZL 5TPWH 3TA3A 4UT9L 1MVFA 2R69H 2PW1B 1RFDH 4S0SD 4CW1A 6FABH 1UXWB 3HC3L 1KENL 1L7TH 4Y5VA 3CLEL 3VFPA 5J12B 2Q8BH 3RHWF 1U58B 2ZCHL 1KJ2H 4QXUH 3MOBL 2R0WH 2BNQA 1J0IA 4HBCH 5HJ3B 4MWFA 3RY5A 4FFVC 1G84A 2HTKD 4KC3B 4JFED 4LLQB 1DEEA 3T4AB 1CGTA 5I17A 5KTEL 5B8CB 4XMKH 2IJ0C 5J3HC 3FRUA 4EOWH 3PJSB 4O2CA 3VMOA 1MOEA 3BHBA 5T33H 5C09E 1A1MB 1LK2A 4OF3A 4CGTA 5TH2B 5FO9B 3FCTA 2DBLL 3TN0C 4N1HB 4FNLL 3RNQA 3U0TB 2Y36L 1AHWC 3CMGA 4M6AA 5E9DB 1DE4A 3B2UC 3RWDB 4APQC 4LPUA 1TTFA 2JB5L 5IKCA 3BZFA 5BQ7B 5JR1H 4LSTH 3VD9A 1ITCA 4IRJA 1YDPB 2BNUB 4WTZG 3W11C 3VXPA 1JPTH 2FSEA 5D7SL 3RTQA 1R5VA 4HWBA 1EZVY 5C07B 3MACH 1IQDB 1Y0LB 1AFVH 4O2FA 2H41A 4L8SB 4NM8L 4PRNB 3S5LB 4POZD 3QDGD 1T6VN 4OCRH 1AE6H 3MMEB 4NNXA 4JN2A 4PJBB 1IL1B 5AEAA 4F58H 2NX5E 4FN0A 2AS5M 2PO6D 2YPLB 3BD4A 3FOLB 5FHBH 5GGUA 4Z7NF 2X1XR 1ZVSA 5EZOL 1GSMA 4ONFL 4E41A 1U8QA 4AG4L 2R2BA 4LKCB 3MRFB 2NMSA 1YNKL 4NO0A 5IB3B 4GS7C 1D5XA 1NLBH 4P4KD 1VEPA 5IB2A 1FNSL 2FIRT 4Z7UA 3E6FB 2XN9A 4XVJL 2P5ED 3T1WA 3OR6B 2UYLB 3TLRA 1A14H 2Q7YA 4PLJD 2BNQB 1UA6H 4X0KB 1ZSDA 3FO9A 4K3DL 4QRQB 4TYUA 4JQXC 1WZ1L 4Q9QH 5ANMB 3MNZA 4RDQG 4MCZB 1NGXA 4ODUA 3X11A 3JWOC 1IFHH 5I15H 1BGXH 2CKBL 1NEZG 3UTTA 3QG6B 4X6CE 3MRKB 5KS9E 3FT3A 2I60L 2EZ0C 2CKNA 3U9PH 4NO5B 1NCBL 1KLUB 4X6DE 4GSDL 3WKMH 4BFEA 2DIAA 3MLZL 2FWOB 2HMIC 1CXKA 5CINH 1BAFH 1A22B 4H20L 4HUKB 4X4XA 4JFOA 2DYPD 1CFSA 3CZJA 2H1PL 1IAII 4WO4D 5CEXA 3L5WA 3P4NA 4WHCA 3EYOA 4KMLB 1CCZA 4LCCA 1CGVA 4LLDA 4APQA 3UYOD 5MENE 5FM8A 4XBGA 2LQRA 4XCEB 5IB4A 2BSRB 4HQQL 2FJGA 4KJWC 4DZ8A 1YECL 3CSYA 4R2GD 4ZFOA 3C6LB 5D7IE 4NQCA 3K8LA 3QUYC 3RTQB 5KOMC 5IK3A 2Q86A 2R4RH 5L8LB 2H32A 4O2FB 1MF2L 2GITA 4PJGF 5DVKA 2OQJB 5A1AA 3WNNA 3ARQA 5C0FB 1HEZB 2Y7QA 2OXGA 2JF1A 1MCQA 5HYQA 5C0BB 5D1XD 4I4WA 1S9XB 4Z8FH 4KQ4L 5AZ2H 3O2DL 4M93C 4R90L 1SBSH 3QNYB 4LSSH 4CDGC 2B5IB 4JAMB 3TESA 5EFIB 3I9GH 4OD2B 3P77A 4XVSH 4YPGA 5HHNA 1MCCA 4GW5A 3TNMA 4AEFA 1MJ8H 5L2JB 5B21A 3TCLA 4D0CA 1JYVA 3NIDE 1Q1JH 4MCYB 4NO0B 5ADOH 2A73A 4R4NC 4MD0B 1TDQA 5MEPA 2XT1B 3EOAA 5FF6A 5DRWB 4U05A 3BSZH 1VKXA 1HWHB 3MV11 3UAJD 4AEEA 4QNPE 1WTGT 4GO6B 1II4E 3O6FB 4F7EA 3ULUF 5E70A 4QOKB 1RMFH 2VITB 1IGYA 5JOFB 1B4JL 1UH2A 3IU3A 5D2LB 1ZVHA 1OARL 4YAQB 4NC0B 3RIAF 4PJAA 3ZDYE 4LEXL 4X7FC 4EXKA 1U8OB 5CUSL 1EGJL 1A7NH 1FE8L 4ZDHA 2EIZB 4FTVE 1OAQL 2HVJA 5IBTH 1WBXA 2BNRA 2WIIA 3BGMB 1MFDH 3X3FH 4Y4FC 3WSQH 3O4LD 4MQSB 3KPTA 3P9WB 1N3NB 3TN0B 1UG9A 1SVCP 3LN4A 2D31B 5EBMB 5CEXB 5HHOA 4PG9B 1J1XL 4JFPB 1AHWB 2XWTB 4GBXB 4ISVA 3R8BB 5F3BA 1I8MB 25C8H 3N1GC 4JY6B 5EU5A 1CDUA 1U2HA 2DI7A 4NQDB 2EDYA 5F6IC 2O61A 4JFXA 1CFTA 4L1HA 4EBQH 1HZHH 1TETL 2BHUA 4F33A 1OVZA 2GHWB 3EYVA 1BJ1H 1MFNA 4OGAC 2D0FA 1VFUA 4MNGB 4X5XA 3TNNA 4EIGB 5CSZB 4P2QA 1JUFA 1MUJB 5DJ2A 5F89A 5IG7A 5DJZA 1V7ML 4KK8C 4G80A 5CGTA 5IP4A 1R5WB 1SHMA 1AO7E 4H0IA 4AENB 1CD8A 3MV8A 1BD2E 1TCRA 1FVEA 3H3BC 3N1MC 5MEQB 3IETA 5T1MB 1IC7L 4WTXA 4C55A 3TYFA 3FB6A 5BS0E 2YWZA 4RMWA 2X40A 5DD6A 1EFXD 4K7FA 4RZCB 3DVNB 4HWEL 4WDIB 3P9MB 4XCNA 5HI4C 3BKCH 5DQ9B 5L2KA 1WLHA 2WLZA 1K8IB 1KCLA 1IARB 2VRAA 1P4IH 3OKKA 3DX8B 4RGOL 3KPMB 3LAFA 2MHAB 3EYFA 3EJYC 5J9PB 4RA3A 4IRSA 4C56D 3QEQE 3QUZD 5DFVD 3DTXA 4QXGH 4ZUSB 3S96A 3KLAB 4ZODA 1X4YA 2J3SA 3EDDA 3NFSL 3OKOA 2EEDA 2NY3D 4ERSH 3PWPE 4ZDHB 2P5WB 1PKQB 2I25N 2D7NA 5I1HL 5CIPA 4I18C 5GS0C 2J4WL 4NKMB 3GBLA 4ODTL 4P9HL 5F7HA 2B39A 5FCUH 3ABZA 4Y4FA 1UZ8B 2GY5A 4C4KO 4AMKL 4NKDA 2ZOLB 3REWB 1BBDH 5DYOB 4GAJL 2G9HA 4X99A 4IDJL 5J11C 4PJDF 1TVDA 3HPJB 4G8EB 5SWSE 2EE9A 1KELH 5KSBA 1FH5L 4Z7NE 2BY3A 1FZMA 3ARED 3CFJB 4OM1H 1HH6B 1DQJB 1W0VA 1MI5A 3ILQC 4Y4KC 1ZS8B 1U8MB 1YEKH 1T4KB 5LGJA 3QUYB 4NN5C 2D7OA 2D03H 2BVEA 2IALA 3HNSH 4PJCF 5TDPA 2Q87A 5F21B 5D72H 3L3IB 4GH7B 4X83A 3IF1A 5ISZB 4LSVH 3HLAB 3GSVA 3X13A 3KPOB 4HJJH 3L3OB 1TTUA 4DFIA 3MLSH 3T0DA 2JIXA 4U6HB 5FGRA 4MVBC 5DMGD 5HHVH 3SBWC 2QEJA 2YSSB 1HIML 1A64A 4HKZA 4ZNCD 4QYOA 3DUSA 3BJ91 4OKVB 4FQXD 1QQDB 1D6VH 4U3HA 4CVXB 2ICWJ 1DBJH 1RIVH 3O45A 2VQ1B 4X6FA 1L6XA 3VFUA 5JIPA 4DUXA 2YRZA 5BV7C 4XT1C 3OAZK 4NDMB 2BVYA 2PW2B 2YXMA 2DRUA 4IOFD 4XNUH 1PVHA 2AJZA 2G2RA 4K8RC 4WWID 3DSNA 5KANI 2MPAL 3LS4H 2ICES 3MA9L 4LSUH 4JZNA 4O9HH 5DXWA 3SKJH 1CR9L 4KKBD 4X98B 1FN4B 4JFDA 5DFWH 1X5ZA 3S96B 4EVNA 3K4ZA 5KSAC 1LNUB 4LVEA 2D4FA 4HS6A 4M1CC 5DR5L 1PX3A 1ZWIB 3FOMB 2ARWA 2FHCA 5BMFL 3P0YL 5FHAL 3F62A 2QLVB 2VDRH 3VD3A 2JCCB 4NO2A 3BYTA 5J06A 2EDEA 3O3AB 1KPRB 3G04B 3M1BA 3VH8G 1XIWD 3L9RB 4IIQC 2CLZA 3BQUB 4XNYL 4PJGE 2QSVA 3BH8A 3BZ4A 3ARZA 4M5YH 4JFFD 1B2WL 1WEJH 2Z0BA 2B1AH 2BSSA 1MCWM 4OLUH 3CVHH 3DUUA 4LU5H 5DJ0B 4HG4J 4MJID 2KZWA 2AEQH 5DFTA 4UAOC 5DK0A 2FO4A 3OGCB 4IS6B 3VXSD 1JZ6A 4YBQC 1HXMB 2YN5A 3STLB 5TGBB 5C7XL 4TTGA 3TBVA 3I02A 3O81A 4ZPTB 3S3JA 3WS3A 1NBZA 4G8GE 1KJMB 1A9EB 2ZPKL 1CZ8H 1QBLL 4LPYA 1F6FB 3EYUH 1AQKL 3GSVB 2H2PD 1CXIA 3OKMA 3EO0B 2FYYB 4Z78B 2A6DA 3VRIA 1Q9OA 1QNZH 4EZMA 4RBPH 3G6AA 2A9MH 5IESH 3ULUE 3TO2B 2DMKA 4LLMA 2HH0L 3W81A 2PETA 1S7WA 1ZT4A 3KJ4C 4XZUB 1C7TA 1AXSB 1MHEA 2VR4A 2XG4A 2BDNH 4HX1B 4P59H 5ID0B 4LNRA 1U95A 3V6FB 2IWGA 5C09B 2Y9RT 2JELL 3BD3A 4JDZA 2XOTA 4PUBL 5A43C 5FOBB 5BJTA 2MQCA 4R4FL 2CIIA 1MNUH 1YY8B 4KKCC 3HB3C 1A7RL 2VXSH 4L3EA 2QSCH 3VFWA 2XA8L 5DD0H 5ICZA 1AY1H 5EOCJ 3SPVA 4JFDB 3ZKNC 1F6AA 1DBML 5GRUH 4EVNB 4X9BA 4A2MA 3OG4B 1PY9A 3K80A 4HMDA 2P48B 2R2CA 3SCMB 3ZHKA 3FHAA 1PJ9A 1OD9A 5ACLA 2F58L 1CLOH 2HP4A 3UMTA 3SJVD 3C2AL 4JHZA 2VUOA 4ZAKC 2VXTH 3GHBL 3OBAA 4I18B 4YHPB 3ZKQD 4TULL 2EECA 1JWMB 5HGGS 5CJOL 1QRND 5GSVB 1KT2B 2DJ4A 2NX5B 4U1GC 4BFIA 2OYPA 1KV3A 4IIQA 3VD4A 1I3GH 1JHLH 2ICWA 3LN5A 3QDJE 4PGDA 3QG7L 1ZT1B 5JQHC 3ULSA 5DEFA 5DJXA 1FYHB 2F5BL 1A7QL 3RX8A 4PJXA 1EXUA 4NWUL 4NJAL 5TDOA 3TWCL 1R24B 3HRZB 4AL8L 5I1IL 4U4BA 1LK3L 2E5EA 1OAZL 3HC4H 5E8PA 4FQ1H 1NUNB 3QQ4A 2FEEI 4Y4KB 3Q6GH 3I02B 5IMKA 3VJ6A 2DI9A 1H3UA 1B6UA 3TV3H 5ACZA 2R23B 5KZCB 3NCCB 5HVGB 1A6TB 2F8OA 5I66A 4R26H 3GJFA 4PJ7A 3TJEH 1KCRH 4X6CB 5EOTA 4HG4K 3VGAC 1FGNL 4G8FA 4ODWB 4X6DB 1O7SA 4OSUL 4ZNEA 4KUZH 1UENA 1CGSH 3LQZB 1ZA3A 5ICXA 3ARBC 3RWCA 1AJ7L 4NRYB 2YD7A 5DJYA 2DLGA 3HUJE 3S88H 5DUBB 1J86A 2NY4C 1WQVT 1DANT 3O3DA 5A16B 5BV7B 4PJIF 4TPRL 1H0DB 1I3VA 3PIQA 1OCWL 5K9QI 4M5ZL 1TNNA 2CIIB 4PV8B 1J10A 4MDJA 4YC2B 4GRWF 4U0RB 1T20A 5ICZB 5B3JF 5MENB 3NA4A 4JCLA 2HFGH 2AJYH 5E5UB 1UT9A 3KYMA 4ELKA 1MHPH 2NZ9C 4P2OD 4NO3A 1IKFL 3KXFE 1KN4L 2XKSA 3IFNL 3TYGH 2OR9H 5D7IB 3U0WL 5D1ZC 3S37L 1O7VA 5CEYA 5KSAB 1KJ2B 1B88A 4WENB 3BPOC 4PJDE 3GBNL 3OZ9H 4QHUB 1RURH 1OPGL 3ARGC 3GMMA 1MHHA 2QHLA 4K94H 3H7LA 1DVFC 1EO8L 3D39A 4ZAKA 3TPUA 3VE0A 5HYSA 3MGTB 5C08D 2IBBA 3O3BB 4KRNA 3RJQB 1KEGH 3RZCB 4PJCE 1KB5H 2XQYG 3RPIB 3DUHA 4XWOD 5EUKB 5GGVH 2LU3A 1IGIH 2NXZD 3LKNA 1IC4H 2Q20A 3GB7B 2OZ4A 1UVQA 5JIHA 3CX2A 5D70H 4AQOA 3K4AA 1J0ZA 1YEDB 1XCQA 1DBKH 2YC1A 3DRTB 4PR5B 5LQBH 3ET9F 1B0GB 1J8HD 3T0EC 2X70A 3BD5A 4UAOB 5ESAA 1KJVA 4KK9D 1DUYB 4DK3A 4TUOA 5EZIL 3MRMA 2V9QA 3GSNA 2X4SA 3X3GL 5C86A 3LV3A 4C59B 1UQSA 4HAGA 3VGDA 5CSGA 5FFLA 5CZXC 1RUML 4LF3B 4N9GB 3MLWL 2P47B 5E8DL 2YD8A 4NT6B 3LPGA 3TO4B 3UJJL 3OXSB 4Y5XB 5C0IA 4RIRA 1IKNA 3LKSB 4M3JA 2N7AA 4FTVB 3V6BR 1YY9D 2NY7H 4LLWA 1XCTA 5F96H 3V79C 4PJ5D 2WMPA 2VZUA 4OUUA 5E2WH 1PEWA 4YX2L 3ARBA 4X8JB 3QFDB 4DVBB 1UM4H 5GGTL 5TE4L 5JDSA 3UO1H 4YIQA 3V4VH 2LTQC 1NCWL 4R0LA 3KS0H 1EHXA 2R1WB 4NCC2 4OAWB 4I0PA 2EICA 2J8UA 3QUKA 1JGLH 4E42A 1NAMB 4OCWL 5E6ID 3DO7A 3L7EB 4P3CH 4DKEH 1FO0H 2H9GB 1GPOL 2VQTA 3P30L 5CD5D 4NCC1 1BX2A 4OUOA 4O51A 1QLRA 1JGDB 5C92A 1OF2B 4GXUM 4J2XA 1QLEH 5IVNA 1JMXA 4C83B 1NL0H 4MHHI 3ARGA 4WV1B 2DQCH 3VE0B 3EO1B 4HS3A 3MJ9L 1FFRA 1YN6B 1AO7B 4M43H 1BD2B 3DXAA 1M71A 3FB8A 5J1TC 3QEGL 1T1ZA 5E94A 4Y1AD 3PHSA 5JQ6H 4HH9B 2AXFB 4O4YH 5L0QC 4O2EA 5BS0B 5FYKD 3WFDL 2IFFL 3DBXB 4HXAL 2Y06H 4HLZH 3V0VB 4HS8L 1HI6B 1BLNA 1JGEB 4RRPG 3SE3C 1OGAD 4M6MH 1ZLSL 1FZJA 1JV5B 2G60L 4I3SL 2CMRH 1BFOA 2FB4L 3T0EA 4P3DA 2Q3AA 5DI8A 4PRDB 4X7DC 5DLML 5E8OA 3FQTA 2FJFB 1TVBA 3WN5C 3TGXA 3P4LA 2VDQH 1JP5A 1U8PB 1K4DB 4LHQB 3QEQB 1VFMA 5C0AA 2VDML 4KI5F 1FIGH 1YNTB 2ITCA 2CUMA 4NP4H 1K2DB 3L5HA 4FA8A 1OAXL 3IAQA 5CJXC 2ZOKB 4NZTL 4E5XB 1P7KA 1AD9A 3DO3A 5BXFA 3D6GA 1KIRA 3PWPB 5CZKA 1QVOA 3VG0L 3GUTA 4ZUVB 4F7MA 5EOQL 3O6MH 4QRRA 2PYFB 1PZ5B 4OV5A 1X3DA 1DQMH 3MV9D 4FABH 1MLBB 1QEWA 5CHNA 2FD6H 5JW4N 1NDMA 2CK0H 2OLDA 1AXTL 2BJML 3P4OB 2VL5B 3F7PC 2HLFC 3UEZA 3CZFA 4JHWH 3ROLA 5BO1H 1XR9B 4BZ1L 5FECA 5SWSB 1JGVH 4XX1E 1CG9B 3A6BL 4YHYC 1DFBH 3DO7B 5GISL 1UM5H 2YD1A 3VRLF 3B9VA 5D1ZB 1IZKA 2QV2A 3ZYOA 1OP3H 4AEHL 1QLRB 5C0EB 5GXBB 2UZXB 1N64L 1E6OH 1QFOA 1IGJA 5JHDD 3H9ZA 1T0NA 4KDTA 2DLEA 5F9OL 3GKWH 1DVFB 2BY1A 4GAYB 2WP3O 4LEOB 4A6YH 4Z76A 5L8KB 4P5TC 4JFQB 1YQVH 3Q0HA 3LS5H 4MYWB 2R29H 3GHEH 1NCTA 4LCWD 4G6AC 1TZGH 3F8UB 1P1ZA 1R3KA 5F8QC 1AH1A 3H3PL 4MNHB 1OLLA 2WM0A 4FQHB 5HTSA 4PJ9C 2FRGP 1VACA 4N9OB 1ZGLB 4B7LA 4GMSH 3MPCA 5HBBA 4OQ1A 4WNQA 4HJ0D 4TRPL 4I9WE 1BQHB 1EPFA 4XVUD 4Z7WF 3SDXA 2WANA 4I2XA 3MX0A 5D8JL 4J23A 4ZTOL 1KCKA 3UTZB 4KI5D 4UT6L 5FYKL 3WN5A 4U6XA 4HZLA 1VA9A 2ITCB 4PJIE 5JW3H 3GGWA 5H35A 2XACC 4MAYD 3SKMA 4LSDA 1AD9B 4GRWE 1J5OL 5CJXA 5B3JE 4NQTA 3LPFA 1LP9A 1F3JA 4KK6D 2F53A 3P0VH 1HOCA 4LP5A 3DHJA 3EFFB 1GGIH 1T7VA 2EE2A 4U3XA 2RIKA 5D5MA 2XY1A 5A3ID 1MJUL 1I7ZA 2DBLH 2DQIH 4UDUA 1RUQL 1GHFL 1ZTXL 3D85D 3RWEA 4ODXB 2BFVH 1JPSL 1PFCA 4CUCA 2FZ3A 4WI4A 2EIEA 2LTQB 3D2UA 4BZ2H 4OFYA 1X4XA 5TE6L 1L0YA 4YXLH 1G7QB 1TZIA 4XCYB 2EH8L 3HNTL 5H2BA 4NQXB 4LAJH 3NH7H 3UX9B 4NQEE 3D3VD 3NIFF 3GO1L 4OBRA 2YXFA 1BWMA 4G8GB 4KKLD 3FMGL 3QCUH 3QDMB 3VWJC 3DYPA 3WE6B 3TA3D 4PJ8C 4M00A 1H8SA 1FRGL 1D9KC 4JANA 4P5TA 3OJ2C 4DVRL 4HC1A 3C60C 5HPMA 1A4JA 1I75A 1CLCA 3IDIA 1CGXA 3FQWA 3MCKA 4ZYKB 2Z4QA 1PEZA 3QUMB 1U8HA 5HHMB 4RISL 3FONA 2DQHH 3CFIC 5F1SA 1CF8L 4EUPB 4HUNB 1JHKL 5I1GH 4L4TD 3C08H 3VWKC 2XWBA 1WFTA 4PJ9A 1KTLB 4PP2B 1U9KA 1S7RA 2NNAB 1RZFH 1V7NH 2XTJD 2ITDA 3SE4A 4UV4H 1S9WB 3RAJH 32C2B 3O8XA 3FO1B 3CXHJ 4Z7VA 1YMME 4CVZB 3M45A 4YFEA 4CN6A 3SDDD 1GGCH 3QQ3A 4WHDA 4YXHH 1RK0B 4AQ1B 5B38B 4MB4A 1NCCH 1BZ9B 2ZP0T 5AYQA 4YHZH 3OAUL 1QFWL 5GQBA 1DSFH 3IFPB 2A77L 4XI5D 1NC4A 1MFEL 2IQ9L 3B9KD 4LGRB 4UV7L 5F7MC 5CBAA 1NUFA 2VXVH 1K4CA 3WFHA 3MLUH 1RJZB 3MLRL 4NUGL 1FZOA 1S7VA 2AW2A 4QF1B 4LLAA 4HUWB 1NFKA 3AMKA 3O9WB 5JO5A 3TVMD 3CVIL 2A0LC 4IRJD 4M7JH 4DKDC 1Q72L 1BHGA 3FT2B 2AAVA 2PYEE 4HFUL 4Z0XB 5IV2A 1XGTB 2LE9A 1LQSR 3RWFB 3QDJB 2CD0A 5K9OB 3AAZB 4O00A 4LQ1A 3L95A 4HUXA 2HFEA 2DMBA 5C9JB 1YJDC 3MUGB 3SN6N 5KSUB 4WUUD 2A1WL 2W65A 4D9LH 1GOGA 3WUWA 4YHYB 4JFYB 2QADC 4MS8C 2YPKA 4QHLB 2W1NA 3DRQB 1NBVH 3ARYA 3WHE1 1G7HA 3V6ZA 1MWAB 3K1KC 1FBIL 1HWGB 3DVGB 4JGMA 3KNBA 3VWJA 1CICA 3R1GL 1RUKH 4JO1L 4TNVF 3KPRA 3MFFB 3I6KA 4PJ8A 3NZ8A 1X5LA 5SV3A 3EHBC 1VESA 4NQVA 4KI5E 3MCKB 1N5YH 3MBEB 5E1AA 3ALWA 1IGML 3PGDA 3E2HC 5KVGH 3RDTB 3L3GB 3HUJB 2C1PB 3NA9H 1SYVA 2IF7A 3I3DA 3VWKA 1TITA 2GT9B 1CU4H 3GSQB 4XXDB 2ZUSA 3MOAH 3BZEA 3QCVL 4HIHA 4NQSA 4DGYL 2R56L 5T3ZD 3VD7A 2IFGA 4FFWD 2VH5L 3U82B 2R8SH 2YUXA 1MAML 4GW1B 2VLRD 1Y18B 3QO0A 3HAEG 3KXFB 2DL2A 1V3LA 5CLTA 4Y4HC 4KRPD 4PFEA 5I8KH 4S1RH 1FNLA 4PJDB 3OJDB 3KDMA 5FDWB 5DMJB 5D9SA 4L3CA 1OAQH 3FTGB 1QFWM 4IJ3C 1K8DA 4JVUA 1RZKC 5T3ZH 2ESVD 3QNZB 3NGBC 12E8L 3VRLE 1FHGA 1NLDH 1OP5H 1JNHB 3VXUE 3CXHK 4L4JA 5JTWA 2F74B 2X4TB 4PJCB 4G6KL 4ONOA 5D1QD 1A9BB 1KYOJ 1T2QL 3SKOB 3LKOA 5EH1A 4FP8H 2WWKO 3LKRA 1HHJB 5MEOA 2FX9H 2OS7A 2HT3D 1H9VA 1D5IL 4JO3H 4PTUA 1VB9A 3GSWA 1C5CL 4LHUG 3OXRA 2R4SH 1EBAA 2GAZA 3FQNB 4K3HA 3N9GH 4MAUL 1G7JB 4HXBH 1CE1H 3MO1B 3WFBL 1RHHA 3KPPA 1U91A 5CMAA 4F37K 1KN2L 4P57A 4U1SB 4DOHB 3QIUD 5FA3B 5GJTH 4YBHA 1P69B 4JRXD 2IG2H 2YA1A 1G9ML 4FQIH 4PRPA 4QRPD 1JVKA 3LN9A 4MQXD 4XNQA 5FYJL 4Z77B 1BZ7A 5JOPD 3Q2CA 3F7YB 1XGQA 4OZHF 2M8XA 4XNXH 5CWSB 4L5FL 4WFGD 3HMWL 1RUPL 4Z7WE 2DLTA 1BBJA 4HUUA 3AGVA 3AU1B 1D9KB 1IT9L 3PXJA 1NAKH 1YEJL 4G6FB 5ECJE 3C60B 1JPFB 4DW2H 1EDQA 5JUEL 4F7TB 1NANH 4P9MH 4RAHA 3W0WD 3FN9A 3RRQA 1NH6A 4PREB 3W2DL 4YGAB 4KROD 1G9NH 2Z91A 4DGIH 1U3HC 2HT4C 3WIFA 2PXYC 3VWKB 1H3GA 3HAEH 3QZWA 4U1HB 1KOAA 5FUCE 2PR4L 4MJ5B 1YEIL 1I8LC 1NFIA 3WLWD 4AEIL 4N0YH 4Q2ZB 1T04A 4J3SA 4YGVB 2V7HA 4NHCH 3JTTB 2NY0D 1V5JA 5EPMB 1IGTA 2VE6B 3ETBF 5BZDA 1OGTB 5EU6A 4F8QA 3TIEA 3IFLL 4FQCL 3HI5L 4LHUD 3PWNA 5L7XH 2NW3A 4Y4HA 3DI3B 3DETD 3GRWA 3MGOB 2E3VA 4XPGH 4FFZH 5LGHL 4R3SA 5D9SB 1R3IL 5D7JD 4S2SB 4F2MA 1K8DB 4HBQA 3BE1L 3EO9L 4BKLA 1OP9A 2B1HL 1M6OA 2H8PB 4K55A 5I1CH 1ZHBA 5TQ2H 4I13B 5IIEA 3NIFE 2BC4A 4U6VL 1A5FL 3SE9H 3TZVB 3QHZL 5IB5B 4PRHA 3H9HB 3H9SE 1JMZA 3T0VA 5ILTH 2A74B 1FH5H 5IM7B 3V7MA 3O0RH 3PDGA 4P48A 2AEPL 4LSQH 2X09A 15C8H 1IGCH 5ALBH 3CUPA 1FNGA 5LBSL 3G5ZA 1XGUA 3RUGF 3OKNA 4DTGH 2AJ3A 4ZFOL 5GZNC 2QADB 2P44B 4I77L 2AK4E 5E8NA 2EXWC 3MROB 2FO1A 1BJMA 2I9TA 1WFNA 1CFNB 3OHXB 1KYOK 2R2EB 3CFDA 2I24N 5DEGB 4P23C 4NYLB 2D3VA 1KC5L 4X6BA 1FFNA 4OJFL 4MA1B 1FLTX 4HHAA 3L3JB 4N8CL 3JXAA 3EOTH 1JZ2A 2OJZL 4MD5B 1KTDA 5T3ZE 1UYWL 4JY5L 5JW5A 4WRLA 5BW7A 3FZUD 2Z8WC 3BOVA 3F6LA 4B7IA 3CDGA 3E2HB 4PB9L 3QYCA 2YRLA 4LRNH 1U3HA 1J7VR 5IWLC 1HHIA 1QSEE 4K9EC 1ONQB 2VLLA 2ATPA 3T8XB 4JN1L 1UACL 4X4YA 1I8LA 3CH1B 3VXMA 3U0PB 2NXYB 1I1AD 3D25B 3VGHA 5IMMB 4YEEA 3BEWA 3QHFH 3V95A 4Q9CA 1EZVX 3MRPB 1FAIL 3EYQD 5EZLA 3VXRD 2VLKA 4UTBL 4ZD3H 1BIHA 5DD1H 4R3SB 1Q9LA 3MRBA 2FGZA 1YEGL 3INUH 2KQMA 3V52L 3QEHA 2W9EH 1ZAGA 4IJ3B 1L9MA 1JF1B 2EDDA 3PE9A 4YDIL 4XAKD 2E6PA 3EDFA 3NGBB 4PB0H 3OAYH 3QIWC 4GAGH 4JPIB 1KIUA 5L6YL 4YH6A 4LSRH 5IIEB 5JMOC 4JM2C 2F54E 3KWWA 3SDYH 1ZEAH 2VAJA 3LHPL 5MP6L 2X4PA 1PSKL 2ZWLT 3TBSA 3WIIL 1XAUA 3GMLB 4GQ9L 5I18L 1EBPA 5T5FL 3O11A 5KG9A 3MLXL 1A6UH 1U3ZA 2WWMD 4JGUA 3OF6D 5GGVY 5IW1B 1CFQA 2IADB 5ICYA 4JDVA 1OAKL 2AP2A 4YJZL 2D9CA 3ZT7A 1DN0A 2DM7A 4B5EA 4ODSH 5EZJB 3V5HA 5FKPA 3U83A 2R1XA 1RVFL 1ZLUK 4XAWH 1FSKC 3TT3L 3JVGC 4PJHF 4W4OC 4P2RE 2W0KA 1G7IB 1PG7X 4PJIB 1FO0B 1NC2D 4JGJA 3HMXL 4NZUL 1ODAA 2HVKA 1CK0H 4GRWB 3HNVH 5C2BL 4HZAA 4GLRH 5HY9B 3UJTH 2E7LC 2ZUUA 1ORSA 2CRMA 2O93L 3GBMH 1A7PL 3V6OC 2NY6D 3MRJB 4HULB 1YEHL 4PY7A 2FX8H 2GEEA 1XZ0A 4FG6C 1AQDA 1KF9B 2BRRL 5INCA 2VERN 3WUZA 4RQQB 3Q1SH 1NCAL 2IMNA 5IEHA 5F7DA 2PXYB 4PRAB 2ICCA 3VGBA 1P4BH 2ARJA 3MYJB 2J12B 2J1KA 3A6CL 3GMNB 3BP4A 3MUHL 1E27B 3ZL4L 1QYGL 3ZTJG 1UCTA 1MIMH 4G8IB 3WDHA 2B20A 2F5AH 1E4WH 2P46B 3RVWD 1F97A 2ADIB 4OM0H 4ODHH 2X4QB 2AQ3A 4HIIB 1ACZA 2IAMD 3N85L 3GNML 2X10A 4O02H 4NQEB 2VYRE 4CJ1A 5D6CB 3HG1E 4WHYH 4HPOL 3H3KA 4Z95L 3HCVA 5JXED 1CD1A 2OBGA 4OD3H 3QUXA 1EO7A 4TULH 4J6RL 4DQOL 5C6TL 3WXVL 2DQUL 5GHWL 3U1SH 2ADJA 4XHQA 3FT4A 4NC1C 2R0LH 4YHIB 1NDGA 4LCUA 2BCKB 2EYTB 4JM2A 5DZNA 1E4XH 5KSVA 1EEZA 1UJ3C 2C4FT 1CD9B 3P3YA 4OZHE 5CKAA 1W2KT 4OZGB 2AEWA 5DUPL 4RGNE 4L29B 1ZHLA 4EQ3A 1AGFB 1JN6A 1FORL 3QDAA 4PYHA 3BUYA 4EKXA 5C0CE 4WY7H 3BN9D 4NUJA 2BSTA 4GRMA 1NSNL 2CUIA 1AGBA 1WZMA 5FEBA 3KJ6L 4TTDC 4KVNL 1HCVA 1YMMB 1T7WA 4JFHE 4Q6IA 3V5HB 3QFJA 3STZA 3QRGH 4ELME 5IEKA 4ODVH 1W0WA 2YZ1A 2R1YB 5GGRB 3JVGA 1X44A 4JPVH 4PS4L 1P4LB 4IDLA 1XF4B 4P23B 2VL4A 2HVKB 5JIIA 5I76B 5B39G 4MA8L 5D7KE 2FEDD 3CDCA 3UTQB 5KS9A 1QKZL 5J6GB 1BVZA 4GG8A 1R0AH 1GIGH 5EA0H 5SWZD 3V6OA 5I16B 1F4WL 3HZVB 4RMQA 5CEZD 4L8CA 3O6KH 1AKJD 3KPLA 1Z9MA 2P4AB 2B0SH 4YHOH 1RJLA 5F6HI 1OCWH 2PYEB 5IMLB 3MRRA 4POZC 1HILB 3CPLA 3Q5TA 4NN6B 1WBYA 1D6EA 4YEFA 1KG0A 5F72S 5FK9A 4XAKE 2X6MA 3ZE0F 3U4BL 2XA3A 1FNAA 5I74C 5CEZH 1CL7H 2GK0B 3SDCB 1Y6NR 3K8KA 1JNLH 4XPHL 4XGZB 1W8OA 3AROA 5EIIB 1D5BA 4RNRA 4YR6B 1NGQL 4K23L 5DWUL 1U8KB 4MNQB 4EN3D 1H3TA 5DJAA 2NY1D 2B4CL 4MXVF 5DHVB 4U1LB 2R0KH 3EZ8A 2AXGA 5AAMA 3PP3H 3NN8B 5GS0L 3C5JA 2Q7NA 2VLJD 3QIWB 3H0TB 4PLJC 3R06A 4LDEB 5T1KB 3IVKB 5GRWA 3O2VL 1M7DA 4ZUWA 1ZHNA 1IGFH 3IU4L 3PWVA 5JZ7D 3WL9A 1WAAF 1UJ3A 2I5YL 5DHXB 2CLRA 3BEVB 4AK1A 1JN6B 4JFEA 3V7AE 3HE6D 4GMTH 3IKCA 2IQAA 1P7QB 3MREA 1J0HA 2XKNA 5D7LE 5EC2A 1TVHA 4JKKA 4XMPL 1RK1B 5IEKB 2HRPH 4MZ3A 1I9JL 2IMMA 2B2XL 5C8JA 1FSKB 3T04D 2GK2A 3GIZH 4WO4C 4LAQH 4LARL 3BPCA 2VXQL 4BM7A 5A2LH 4XWGH 3IDNA 2R0ZL 2MSPA 1R6VA 2A6JA 4LNVA 3W39B 2YD6A 1S5HA 4ZO8A 3NPSC 4R2GC 4YX2H 4FQ2L 1R3JB 5IVXA 3MGAA 3F12A 3ZKSD 3VXUB 1T2XA 5HGHA 3T08A 4L8CB 3TIDB 3G6DH 1U93B 5I8CA 4QHMB 5H37G 2DTML 3F58H 3LQAL 3DMMC 1MCIA 4G7YL 3I6GA 3QIBB 1T21B 5E00A 1XGPA 2ZG1A 5D1XC 2Q76A 2OK0H 2BHZA 3QDGA 3NCJL 1F00I 3UTSD 1MCBA 3HKFA 1QFWI 2J5LC 4K8RL 5IUSA 2A6IB 4OTXH 4XB8A 4C54A 1DQQB 1INQA 1BIIB 2HT2D 1UB6A 2PO6A 3CMOH 3OG6B 3T77A 3SDAA 4CRPA 3IJHA 3LKQB 4OZFG 1NGZB 4RAVA 1BJ1J 1BQLL 2D7TL 1BOYA 4H5SB 4B41A 1WV7T 5LVEA 5IBUB 4L8DB 4S1QH 2WK2A 1JRHL 2XZAL 4P4KA 3K8MA 2CKBB 4TUJA 5IF0A 2E6JA 2W60A 3C5JB 4S0TD 4NOBA 3QPXL 2P5EA 4Z7WB 5I2IB 3WJJC 5EU3B 2BHYA 4P9HC 4KJYB 4EDXA 1F3DH 2AJVH 1T5WA 4PJHE 3S97C 1GZQA 4HXAH 4X7EC 4DN3H 3DGGB 4ZQKA 3ARDB 1MVUB 3IDXH 2VDNL 4WTZA 2VWEE 3FN0H 3VFRA 2WSKA 1EMTL 3BGAA 3IS0X 3MRNA 1AXIB 1IM9D 2GIYA 4G9FE 1ED3A 4YXKH 4D8PB 4KGJA 2HJLB 1N8ZB 1YYMH 3V5DB 1H15B 4F57H 2BZDA 2GCYB 3T0BA 2DYPA 3VA2C 2FL5A 1RQ5A 4XMLH 5DK2A 2ZJSL 4OZIA 4WO4A 3S8WA 4F3FB 1CN4A 5T3XL 2SEBA 3LVEA 3O3UN 1C5DB 3BH9B 1EJOH 2YD9A 4IMKA 5BVPL 1OSZB 1DQDL 2PTUA 5DA0B 2P7TA 4E9LA 1G9EA 3O3EA 4QXWA 1MCHA 3O41A 1LO2H 1YNLH 3PHOA 4ONGH 5KVEH 1T1YB 3CLFH 4HUVB 3RL1B 3NZHL 3L1OL 2A83B 5JHLL 3CC5A 1A6VH 3FO0L 5FYLD 2P24B 2YBRB 3HR5A 3QQ9C 4OLYH 4NBZB 1F4XH 4KHXL 2OMBA 3EYSH 3CFBB 4FQJL 1W72H 3H9SB 4HFWB 3BAEL 4JZOA 4RGNC 5D1XA 5C0RH 4YHLH 1HYSD 3T65A 4I3RH 3KYKL 4XC1L 2GKIA 3NMEA 4BFGA 3OR7B 2Q8AH 5GISH 5HGBB 1UB6B 3T77B 4D9RE 4CADB 4U1KA 1ZOXA 1CLYH 3D1MC 1NEZA 5EORH 2N1KA 5FYLH 3LZFL 4KQ3H 3TJHD 3HC0B 4M7LL 1I1FB 3RNKA 3WYRA 5F9WC 3D69A 2AK4B 3MRDA 3SOBL 1P6FA 3RKDC 5C0NC 3Q3GB 3NBNA 4LLUA 4X6EA 1C1EL 4I0KA 1KIQA 1N4XH 5E4EC 3FFCD 4N0UE 2VZ3A 1M7XA 3RI5F 3DJ9A 4BUGA 1MFAH 5ESVB 4Y2DD 4ZTPL 2GSGA 4CDHA 3B5GA 5EWIL 3EOBB 4LIQL 4LPCA 4H0HB 1G7LA 3BRFA 2XV6B 3VFMB 3UC0H 4GRLD 4NNYA 3M8OL 4Y19D 5DFVC 4BZYA 3G5XA 2CXKA 5LXGL 1AIFB 3PHQB 5ITBL 5GJSH 4H1LG 2OZ4L 3RVVD 4JJHA 4S1SH 1NCNA 3BP6A 3T4YB 1MCSA 4YDJA 5C0AD 2QR0A 4RWYH 4IMLA 1BEYH 2NY3C 5KVDH 1YEEL 1GOHA 1FFPA 1NBYA 1QSEB 1EAJA 3GSXA 2GJ6B 1CBVH 5CJ8A 3G9AB 4V1DD 3KPSE 1G6RH 3BWUC 4UT6H 4X7CC 1DUZA 5DD3H 3U6RA 4TSAL 3O4LA 2HJKB 3O4OC 2UZIL 1M4KA 1F11B 1LE9A 5SV4A 1KPVB 4MD4A 4WO4B 5KVMC 2SEBB 5KW9H 1KJ3L 2DN7A 4HKBA 2GTZB 1S7SB 1KFAL 1QSFD 4MX7A 5FO7B 5DTFA 4XP9L 3ALPA 4AH2A 4HIXH 4RMSA 3AREC 5HYJE 2VIRB 3CNKA 1TJGL 1FDLH 1AP2B 5DQJB 3S36L 3VFOA 3NPSB 4R2GB 1CQKA 5ALCH 5FKAB 3WFEL 3U2SA 1FNEB 5DSCB 1TZHA 1T03H 4TVPL 2F54B 1ZT7A 4PJGA 3RGVC 1OT2A 2E7CA 4MXVE 1A02N 3DMMB 2XRAL 3FQRA 1C08B 2OP4L 4MQ7B 5DQDH 3IJYA 1VGKA 3K4DA 3PNWA 3IXTA 2J5LB 3KPNB 5DMGC 5JORA 3NACH 1UWXH 2EE3A 4FQXC 4OLZH 2AERT 2YOCA 3GMOB 1LEGB 1WAAE 4GKZA 1U8IA 4HK3N 5I0ZA 1K9TA 3AFLA 4NRZA 4R8WH 4V2BA 3BZDA 1EFXA 5H94B 1FYTD 4AM0A 4P2RB 1OQXA 3PQYD 4IOFC 1E0OB 5I73C 1P2CB 2GSIB 3GMRB 2QQKL 4XPFL 4XVTL 4MJ6B 4KKBC 5K9KB 2BOBB 4EDWH 1OQOA 5KN5A 1X6NA 2NY5H 3ESUF 4UIMB 3S5LG 2Y25A 3QUZA 2XWJA 1GZPA 1BREA 4ZO9A 1WWWX 3RWHA 5J1AB 4BH7A 2I07B 2IPTL 2VR5A 1KSRA 4JB9L 2CO7B 3GSXB 2DWEA 3I50H 1MSPA 1DLHB 1PX4A 4PY8I 4MXWL 2LABA 3D0LA 3JV4A 1XIWC 3BIKA 5MHSD 1INEH 5ID1B 2HLAA 4Y16B 1LEIA 1RZGA 5J13B 4MD4B 5E8EA 1TJHH 3TT1H 2A77H 5I1JL 3RU8L 4N8VG 4L9LC 4BH8A 2DL9A 1S8DB 7FABH 4AT6B 3E3QE 3GI9H 5BZWB 3HG1B 5E9DD 4L4VE 4KVCL 4JKLA 2A9NH 4M48H 5BRZB 3P9LA 3AREA 1N6UA 3L5XH 5E2UL 1SJHA 2P45B 4H0GA 1JWUA 1WTLA 1IAOB 2IANB 1NQBA 3PL6B 3K2UH 3MRHA 4ZO7A 5BOZG 5D2NC 5DJDB 3BVNA 5C07D 4X80L 3WFCL 2LVCA 4OZHB 2YUZA 4YO0B 4RGNB 5CILH 5HVHC 4XH2A 3MA7B 5HVWA 3NFPB 3WDIA 1JJUA 3UP1A 4W70A 1ZXQA 2LAGB 1KBGH 1XF2A 5C0CB 3BW9A 5I1LB 3SO3C 5ITFB 5E2TL 1Z5LA 2BERA 2MOVA 3ULVF 3IDUA 4FQXA 3MJ8B 1YEFH 1AGCB 5J7CC 3DIFB 5D71L 1EH9A 1Q0YH 3WHE0 4DKFL 4D9QE 4ELMB 1NGPL 2AVGA 2Z92B 3GI8H 4FRWA 3CCHB 4S1DD 5ACMA 3WUWG 3I3EA 4GFTB 4KAQH 2VO5A 5I8OL 4UIKH 5SX5K 4Z7UF 1D5MA 3QISA 2XPGA 5EO9A 1YUHA 3O8XD 1FG2A 3VGEA 4C56B 5B4MD 3K46A 3ZHDA 3N1PC 4PGCA 3MBXH 3QJFA 4G5ZL 4KPHL 2X4UB 4R7DB 2P8LB 1DQLH 4Q9RH 2RCSL 1A6AB 4FFYL 4JLRB 1BFVH 1SJEA 1GAFH 2C3VA 3QHTC 4KI1A 3B6SA 4JRYB 5IJKC 1HINH 2IPKA 5CCKL 3BKJH 1SJVA 3CVHA 4YNYA 4MA7L 4RBPK 1RZGB 2HKHL 3WNLA 3FRPA 3O4OB 3U4AA 3V5KB 1JPGA 4PRIE 4TQEL 5FB8B 3S9DB 4JFFA 1KNOB 5DVNA 1TQBC 4K2UL 1UM6L 2V2WB 3CFCH 3S4SB 1HSBA 2CDEB 4HSQA 5DS8A 3TP4A 5B3NA 3FFDA 4GKNA 1TFHA 2K9UA 3EFDH 3GJEA 4MJIA 3T0WA 2NR6C 1TPXC 5EN2B 3DV4B 4HIEB 5E4IA 4NCDA 4RX4D 1ITBB 4NM4H 4R4BB 3UJIH 1OM3L 4R9HA 3VXSA 5EO0A 2BMKA 3C6LD 5C71A 5EC1B 5HI3D 1JTOA 3RGVB 4EI6A 1ZLVH 1HDMB 4TNWK 1OB1B 2AK1H 3OPZL 5D2NA 3A67H 2DQDH 4PGEB 3DX6B 4JCMA 4LPVA 1BPVA 5IVZB 1B6DA 4ENED 1S7UB 5C0BD 1HXYB 4M6OH 1MCPL 1WBZB 4BSVA 1ZKAA 2IH1B 3ULVD 4LKXB 2FHFA 1Z5LB 1F13A 4HWBH 1E6JL 4FQXB 3DROA 5D7LB 1OSPH 3GK8L 5FYJH 4ZMAT 1GC1H 1NJ9A 1I8KB 3NAAH 2EKSB 4QTIH 3GEWB 3VH8A 5DA4A 3TBYA 4H25B 4OCYL 2DKMA 2O5ZH 3QI9B 3VRJB 3ULVH 1IT9H 1QBML 5I73B 3BKMH 3K3QA 2XYCA 4DEPC 2G75B 4JY4A 4WI2A 4P2OC 3O6FD 2BOCB 2X4RA 3QQNA 4QOKD 5TE7H 4X4MA 1SM3L 1MJJB 3GMQA 5ADPL 1HQRB 4FFVD 1YEIH 4PJAF 3SJVA 1TIUA 3BWAB 3BO8A 3HPLA 4J4PC 5IJKA 3KS0J 1PQZA 2CGRL 1XIWB 1QRNA 2P42B 3P0GB 5IT2H 4QRTB 3HZKB 3SGEH 1M05B 1OTUC 3TN0D 1KCUH 5J6HB 5ESQA 2C1OB 4L9LB 4TUKL 4YK4C 3C9NA 3THMH 3BDYL 3LY6A 3BFOA 1DTUA 4GBXD 4LCIL 3B2UD 4R7NA 2FATH 3VXTB 3MNWB 4NQDD 3MV7E 4DN4L 4KK9C 5INDA 2F19H 2DQFA 1YMHA 2WV3A 2YPLE 2HG5A 3OX8A 5DRXB 2AI0L 1QLFA 1X5JA 3DV6A 4UTAH 3W11D 4OCSL 1MCKA 4PJHB 4CN4A 2EDOA 1DJSA 4QT5A 3HE7A 2ZNXA 3GDBA 4TVSa 1MPAH 4RGMB 4XRCB 1S7QA 2Y5EA 5GGTA 1I8IB 4O5LH 3HFMH 1AD0A 2JK5A 2EDTA 5L88L 1S3KH 2AJSH 1N26A 1SEBA 4OLXL 1F5WA 4DUWA 1I1CA 5I1EL 5TDNB 1YY9C 3DURB 3MR9A 3DROB 4ORGA 3SO3B 3B3IB 2DLIA 2BNQE 3GSOA 2ZCLL 3VFGH 4G9FB 1IEAA 4ZS7L 5F6HJ 2YMXH 3V0WH 4ZOBA 5HHXH 4OF8A 4XP4H 2PTTA 3RL2A 1H8OA 4JO2H 1C7SA 3C8KA 1KACB 1E4XI 4IEFB 1LILA 5F1IB 5E08L 4Z0BH 1XF3B 1DLFH 2LFGA 4KTEL 3C8HA 2DQTH 1XT5A 1BOGA 5DJ8A 1TJIL 1TENA 4P46B 5JPMA 1UGNA 1UCBL 2W91A 3L3DB 5LKNA 5E6IC 1RULL 5DJ6B 4P2OA 5DC4B 2J88H 1T1XB 5CD5C 1EEYA 4JM4L 4QLRA 4DAGL 1KB5A 1LO0H 1G7PB 4QRSA 4Y8DC 3CK0H 3REVB 1A6ZA 1ULVA 4ZG1A 3HI1B 2P5WD 3C09C 3NCBB 5C08A 1QRNB 4UQ2A 5DD5H 3MXWH 2V17H 4J1UA 3MJ7A 4Z6AT 2OTUA 2EDBA 4UB0L 4Q0XH 5F7UA 3JWOH 1V3MA 3EKCA 3D0VB 2APTA 2VJXA 1HHKA 2WINA 5FYJE 1KEMH 5F88B 1R5IA 2OTWA 1MAJA 4N0UB 4YE4L 3PGFL 4D3CH 1J8HA 4NFCA 1Z3GH 5F9JA 1TPXB 2FBJL 4P5MA 4FZEL 5KSBF 3OX8B 2VTFA 2DI8A 5MP6H 3E6HB 3DV6B