4M8QA

Ontogeny of recognition specificity and functionality for the anti-hiv neutralizing antibody 4e10
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
127
structure length
125
Chain Sequence
b'QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCAREGTTGWGGKPIGAFAYWGQGTLVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GEP1 Fv heavy chain
publication title Ontogeny of Recognition Specificity and Functionality for the Broadly Neutralizing Anti-HIV Antibody 4E10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 20
structure length 125
sequence length 127
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m8qA00
1A7QH 5HGAB 1D5IH 1AR1D 2ITCA 2W60A 3S35L 2J88H 3QH3A 1OP5H 2AQ3A 1JVKA 2IQAA 4I18A 1A5FL 1JHTA 3ULVC 1RZJH 4ZXBA 1NBZA 1TZIA 1BAFL 1QKZL 1MEXH 3IJSB 4DOHE 2QHRH 2Q8AL 5T1MA 4NKMA 3QXUA 3B9VA 2XT1B 2JJUA 3CZJA 5CINH 3KYMA 5JUEH 1JZ2A 1UZ8B 4MJIA 3AFLA 1AKJB 3QIUC 2ICCA 2J12B 3IU4L 1J9CT 2GTZA 2NZ9C 2QQKH 4X7EC 1A4JB 4IRJC 4JM4L 2J7LA 3O6KL 1H3XA 1UADC 1XGPB 5EDXA 3T3ME 1UGNA 4U1KB 3GMRB 3QNYB 3VRJA 1ETZB 2CR3A 4MQ7B 1YEKL 3SO3C 1LEIB 2QQNH 5T5NF 2X1XR 5J06A 3NZHH 1FP5A 2QQLL 4PTTA 3OKEB 2ZNXA 3HNTH 2V9TA 4K7FB 5GGTL 1RZFL 2V2WB 4P2OB 4XNYL 1UACH 3B9EA 1CGWA 2HJFB 1ES0B 1OF2B 4OGXL 2X4RA 5TQ2L 2EDXA 5HY9A 1DQMH 3T8XB 2H1PL 2E8YA 2Z31B 5IM7B 3IAPA 5CHNB 3TIDA 5ACZA 3DUUA 3WJJA 3FFCE 4GKNA 3IKCB 4UDUA 4O9HL 2MPAH 3HC4H 2XTJE 1KTDA 4I4WA 4M62H 1R3JB 4HG4J 4XBPA 1A6WH 3D85A 4XP5L 2D9CA 4RNRB 5HHOA 4JVPA 2EYRA 4M4RA 3P40A 3LKRB 3DVIA 4HJJH 5IOPA 2V2TA 3REWB 4Y2OA 3C60C 4X4MA 2FECL 1E6OL 3LQMA 2XG4A 1JGUH 2I9LA 2KZ1B 5AYQA 3MLXL 3VXRA 4YFDB 1H3TA 1H3WM 3HPJB 3QEQA 4XGZB 4KU1A 4IIQC 4OGAC 4FA8A 1PSKL 1BVKA 1Q1JL 2PXYD 2FHFA 2DQTL 3T4YA 5ANMB 3C8KB 1YYLH 4Z7UA 3FRUA 3IXAB 4LKXB 3RX7A 1A3RH 1KB5L 2YA1A 3IFOA 1NCWL 3O6FD 1HKFA 3AY4C 4IMKA 3RVWD 1EHLH 1TMCB 3OKDA 1RZ7L 1OP9A 3QFDA 4R4BB 4AMKL 1RZIB 4EI5C 4XPAH 3NIDF 5T3ZD 4BUHA 4J6RL 3V7MA 4M1GH 4KTEL 3GMNA 3FQRB 3SDCD 2PYED 1J0HA 5E5MA 4OFVA 5GGQL 5KSBF 5DI8A 4QY8B 5I75C 4JY5L 1MRDL 5ACMA 3CDCA 3S4SB 3GMPB 1FRGL 4H88H 1INDH 4OIBA 3QCTH 3QZWG 5J3HC 1DEEA 4N90E 3FQWA 1CICD 2GTWB 1OT1A 5GGVH 2VDLH 1FDLH 1LO4H 1H3PH 4Y4HB 3QIWA 3N1FC 5KVDH 4EQ2A 2WBJA 3VXSD 4PJHA 3RFZC 1QLFA 4XB8A 1I8IA 5T1DL 5E2TH 3JVGC 3V5DA 1PZ5A 1OAXH 2XKNA 2G5RA 4M5YL 3WDIA 2VDQL 3EYOB 1OGTA 5JO5B 1CS6A 1Z0MA 3EFDH 5CBEB 2YD5A 2VDOH 5ILTH 4PB9L 2H9GB 4L3AA 2OYPA 2GSIB 3D39E 1YDPA 5FXCH 4RGOL 3V4PH 3ARGD 3R8BB 1EO5A 2YD7A 4GW1B 4MWFB 3BP4A 4P2RD 4K8RH 2EE3A 1FO0B 3KPOA 2O5YL 2RBLA 2P8PB 4YDIH 2RAMA 2AERT 1IE5A 1J0YA 1YEDA 3PHQA 2A0LD 4F33A 2BOCA 4YHYB 4OLXH 1G7QA 2VR9A 2VITB 2UWEA 3OJDB 1NFDF 2AJZA 5I6XB 4R97B 2MHAA 2HWZL 1ZT7A 4EDWL 1RAMA 3PDOA 5I1KL 3F62A 3MLSL 3GFUA 4TVPH 3E8UL 1XR8B 2NQCA 4LCWE 3I6KB 2Z31C 1M71A 4XWOC 3OR6A 4HKZB 2FH8A 4ORGB 4TUKH 4BH8A 4OLVH 4E0RB 5B3JF 4IJ3B 3LVEA 3C5ZA 3DSNA 2R0KL 3QDMD 3TNNA 4NQSA 3T2PA 2XN9A 3SDAD 3VGGA 1DQJA 5L6YL 1IT9L 3NH7L 4ODSL 5ESVB 5IF0B 1C7TA 1T21B 4YC2B 1T7ZA 4LL9A 3UTZA 1UM5L 3GBMH 1HCVA 2O5ZL 1J1OL 4L3EA 2R1WA 5T3XD 5KZCB 4N9GA 4YHPB 5A2JH 2ESVB 5BMFL 1A7RL 2VXUL 1TQBB 4WFFD 3JWNC 3V0VA 1TLKA 5DD3H 4NN7B 3R0MA 4PJ7E 5E6ID 3BEVA 3VFRB 4LMQE 5DRNB 3P0GB 1MHEB 3MV7A 4HT1H 4X6BB 4PLNC 1ZAGA 3O2VL 3EYQD 1NEZB 3PWVA 4WV1A 1C1EL 1T0NA 1JYWA 1JN6A 5IW1B 2Z35A 3QXTA 2BSRA 5I1JH 2NTFA 4KJYA 2LU3A 2B5IC 1FZOA 2JE8A 3CFCL 5ALCH 3UJTL 1UKSA 2RQ8A 3HZVB 3LKPA 3PJSA 3BZ4B 1JRHL 4KJWD 3RPIB 1OTTC 5I16A 2WSKA 1RUPL 3O3BB 1LILA 1FNHA 5DWUL 3NFPB 1AC6A 3FKUS 3MLVH 3OAUL 1NSNH 4U6XB 4XC1H 4M8QA 4R0LB 1A3LH 2ERJB 1J86A 1QSFE 2GIYA 4L9LB 3KXFE 1I9RL 3GJFA 3IDYC 3FMGH 5FA4A 1WEJH 2BVUA 1VFAA 2X10A 3TH3T 3VJ6A 3QEHB 3ULVE 2WWMD 4Y4HC 5I8EB 4Z76A 3BP6A 3TZVA 4QXGL 5F3HA 4NQUA 5JOEA 4Z7QE 3D1MC 2N4IA 4WU7A 4QHUB 1UT9A 1CLCA 2C9AA 4ZAKA 4GRLA 4ODUA 3C6SB 2ZCLL 3O3DA 3ZDXE 4UIKH 3ZYIA 2ARWA 4UTBH 2BNRD 1KB9J 2BRRH 5D7SH 5F7LB 1YEJL 3FCTA 4PRAA 4LRNH 4WWKA 1XF5B 4KUZH 3MRCB 1H5BB 1OY3B 2YC1B 1OB1A 2UV3A 4X0KA 3VGAB 4EZMA 3F8UB 3W39A 1LO5A 1B3JA 4GQ9H 4ONHA 5DRZB 3LHPL 5JMOC 2R0ZH 4PGZA 3BESR 2A77L 1DSFL 1FORL 4OZHF 1YMME 3ABZA 5FUOH 3BIBX 1FLTX 4YHYC 4HBQA 5J89A 4NM8H 3B3IA 4HK3J 4DK3A 1AXTH 3IU3B 2X70B 4ZMAT 3I9GL 3MUJA 4F8TA 4M43H 1XGYH 1N4XH 4HS6B 4JLRB 3GO1L 4KDTC 1KEGL 4PJ9B 4Z7WE 4P5KA 1U41A 4IEFB 4PV9A 4DTGH 4NQCB 1FVDA 2FO4B 3M45A 2APBA 4IJ3C 2NY2D 2ICWB 3LRHA 4H1LG 5JW4Q 5EIQA 4AG4H 1ZTXL 3SE8H 2HVKA 1WWBX 3MRIB 3RWDA 4I0PD 2BNQB 3UC0L 4XC3H 1ZLWK 4CBPA 4DEPB 4ZUUA 1PZUB 3D87B 5ISZA 4K9EC 5IVZB 3E2HB 1VGEH 1MCIA 4P3CL 4PJAA 5BQ7B 2W65A 3OAZK 2W9EH 3LN5B 1NBVH 2EYSB 3VXTA 3MV9E 3PE9A 4GH7B 4OFYA 5C0RH 4G7YL 3TO4C 4M6OH 2ATKA 4FTVD 5HTSA 3GIZH 4KRNA 4QWWC 1G9NH 4MA1C 1TQBC 2B20A 4JY6B 3CFKB 4DZ8B 5ITFA 4RA0C 3VXPB 4NN7C 1AIFB 4KROB 3R06A 1GCFA 3BEWA 4OF0A 4GAJL 3UTTD 3PWNA 5F88B 6CGTA 1MREH 3TVMD 3X11B 4LFHD 2IPTH 1IBGH 4Z7VB 3ARVA 4ODTH 1BZ7A 4TRPL 4JRXE 4Y19A 1SEQL 5DA4A 1X5AA 5EUOF 3P30H 2X09A 1DTUA 4LKCA 1FGVL 3HPLB 4HFUH 4OM1H 3U0WL 4IDJL 5I1LB 4LSUL 3TJEL 1BF8A 4IOIB 2ILLA 4UNVA 4YHML 5DVKA 4CMMA 1QBMH 4XBEH 1OGAA 1YJDH 1HKLH 4WDIB 1KF9B 2NY0D 3OKNA 3AUVA 4JDZA 3IKCA 1MCEA 2HVJA 4HMCA 3CPLA 5AZ2H 4L4TE 3FFDB 4PRDA 4OKVB 1AE6H 3BDYL 4ZS7L 2CDEA 2NY6B 5F1OB 4R0LC 2ERJC 3LMJL 2P4AB 4L9LC 1J8KA 3O8XC 2A9MH 2YUVA 1EV2E 5C0ND 5HGBB 5HYJB 1RUAH 1CFQB 4Z77B 3MBEA 3PHOB 3AREA 2YSSA 4HK0B 1XGUB 3SDDD 1QZ1A 3IAQA 4NO0D 4H5SB 3LRSB 1EGJL 3H9SE 3QFJE 1J05A 2APVA 4TYUA 4LSTL 4X6EB 2D0HA 5K9JH 4N1HB 4LPVA 3DV6A 2DQDL 1FFOA 3RVUC 2VLJD 1FBIL 1J8HD 4CADA 4F7EA 3SDXB 1CD9B 5JPNB 5SWQB 4JKMA 2NCMA 4JRYB 3UROR 4F80A 4YDVB 4ZXBD 1VERA 3C6LB 3S36X 4LU5H 3FB6A 3UXFA 2BCKB 4ETQB 3R0NA 4LNRA 1I8LA 1R5IA 2E7CA 2BC4B 4KJPD 1EXUB 3O45B 4NQDD 1F6AB 1K8IA 4XNZB 4WUUD 1UA6L 1T2QH 4DGYL 5FKPA 1NMBL 1XCQB 5F7DA 4MJID 4L29A 4ZDHA 3HUJA 4JHZA 4FQQB 3Q2CA 4AIZB 2WMPA 1DLFL 2R4RL 2DDQL 3U6RB 2JJSC 4P23C 1X5LA 5DR5H 3HNVL 4U31A 3V95A 1SHMA 3WLWD 4KKCC 4MCZB 3RU8H 2GAZB 1CN4A 4N0UB 4ZNEE 3CVHH 3WL9A 3BPCA 4KHXL 1BVLA 4NGHL 3NOIA 2C3GA 4PY7A 2W9LA 4CVXB 1N59A 5C08E 5EBWB 1T7VA 2E5EA 1R24B 5JZ7D 4LK4A 4OLWL 2ICWI 3AAZB 1KEML 5GJSL 1YMHA 1ONQB 4NJAH 4J3SA 4TSBL 4DEPC 4CU8A 4JRWA 3CK0L 1OSPL 4D9RD 5K33A 5LWYL 1QFWH 2NY1C 4JE4B 3DHMA 1JPFA 4G9FE 4L8DB 1BBDL 3ZMRA 4U1HA 2YKLH 5CEXA 3STLB 3SKJL 4HF5H 1OSZA 1N7ML 1BWMA 1BMGA 1J87A 2X1WL 1F4YL 3WS3A 1YEHL 1XMWA 5I73C 2YUXA 3OKMA 5DTFB 3S3JA 3WCYA 1MFBL 3PABB 3D85D 4OCYH 4MAYB 4ZFOB 5KS9A 5A40E 1CDUA 4LVHB 4NP4H 1BX2B 1S9WA 3FQTB 5FO7A 4QRPD 3U9PH 4CVZB 5I1DA 4U1JA 4XTRD 4E42B 2IGFH 5E94A 5LQBH 2GYSA 3HRZB 3RUGF 3VXRD 5JQHC 3FAXA 3W81A 3QEQD 1G0DA 1T80A 3B2UD 3TN0A 1QSEB 2OI9C 5EOTA 4JM2F 1FFNB 2E9BA 4Z7NF 5C2BL 5HYSB 4M1CC 4WFEE 4S1RL 1JGDB 1Y18B 4UQ2B 4Q2ZB 2EH8H 1FH5H 1CE1L 3SY0A 4PPTA 1NDMA 5FO8B 3BKML 5IROC 2UZXB 2P5EA 4KRPC 5FUCC 1DP0A 3EDFA 1DUZB 3NIDE 4Y16B 5TDPB 2E6QA 2A73B 1MRCL 1KJ2B 3GSRA 1BQSA 1ZHKA 4FG6C 5MENB 1IMHC 2D3VA 4FXLA 1X5YA 3RAJL 1CDIA 3QQ3A 3OKYA 4MQXD 3OPZL 2YPLE 5KSBE 3ULSA 3X14B 1AO7A 4YHPA 4U6HB 1ZA6B 3M17B 3IXTA 4JDVA 1V3KA 2DBLL 4YNYA 1S7RA 4LSQH 3TBYA 5I71B 4NQTA 1P4LB 1H3GA 2B0SH 1FIGH 1GC1C 3B9KD 3A6BL 5DD5H 1YNTB 4IRSA 5F7EL 5IMMA 5BZDB 1PY9A 1AFVL 5E4EC 1MHEA 3RZCA 2YXMA 3NFSL 1S7TB 2F58H 3V6OC 2AEWA 3MOBH 4WNQA 4XH2B 3MODL 4UOW1 4J3XA 2GSGA 4U7KA 3VD5A 2F5BH 4G6MH 4KKLD 2VE6B 1KENH 1CIUA 3C6LC 3QIWD 5D71H 4WEBL 3VFMA 2WBJD 5H37H 4NO3B 1C5BH 1XR9A 3BZ4A 1TJHH 4RAVA 1AGBB 4XNZC 2FD6L 4K94L 5H8DA 1FYTB 4D9QD 5KG9A 4Q9BA 2HRPH 4Y5XA 3QDGB 2EXWC 4AH2A 1KLGA 2VDNH 1FAKT 5IESL 4Y5VB 4NYLB 3EO0A 4YQXL 1LEKA 5ESQB 2FEEL 3BX7C 3DX9A 1F3RB 3LDBC 1UCBL 5ICXA 4C56A 2DTSA 4JHWL 1U91B 1F3JB 4LLVB 5EWIH 1ZLVH 1ZXQA 3NFNA 1GGUA 3QQ4A 4QXUH 4YXLH 5ACLA 4OV5A 1KPUB 3BAEH 1YPZB 4KVCH 3HE7B 2DI7A 1F11B 5LJYH 2AV1B 1LD9A 1BM3L 4OSUL 2IH3A 3OX8B 1NFDE 5B8CC 5JIKA 3AU1B 3HR6A 1Y0LB 3UYRL 3SKNB 4MB5A 1MLBA 3GGWB 1R6VA 3I3DA 3MZGB 1NMCB 1K6QL 2EIZB 4KQ4L 5DZLA 2GJ6D 2CKBA 5A2FA 4ZUSB 4NO2A 1I9JH 4FFWD 1GZPB 5B3JE 1R3LB 3BHBB 3NPZB 1KBGH 3P3YA 4HJ0D 5DRZA 4Z7UF 4L4JA 3RI5K 1JNNH 4WCYL 5DUMH 1VACA 1RHHB 4GSDH 2AJ3B 2HLFC 2W59A 4MAYC 4KPHH 3MLRL 2A6IA 3VXMA 3MPCA 1PQZB 2PYEE 4OZIB 3WEXA 4Z95L 3GSWA 2ADJA 4XAKD 4Q9QL 3MV01 4H0GA 1D5MB 4LLQA 5GZNC 5JHLL 4P2QA 3UDWC 4OZFG 3DURA 3L5JA 1UENA 2HG5B 3IDJB 4X4ZA 4JB9L 2XPGB 1CVSC 1NGPH 5I19H 5C0DB 2Z91A 3MV7D 3QEGH 1T89C 3CDGB 3FQNB 1RK0A 3AS3A 4XCNA 1B0RB 1S9YB 2P8MB 1OAKL 2EC9U 5E8DL 1C08A 1EO8H 4Y16C 5C0IB 1P4BH 2YR3A 2P47B 4JM2C 5JPMB 2X4PA 4YZFF 2BVPB 1MFCH 4PJHF 5GIRB 2OXGA 3CNKA 4J23A 4LSPL 2PCPB 3OGCA 1BGXL 1KYOJ 3G9VA 1I85A 4RFOH 2XOTA 5I71C 4HIEB 5C0BA 3TFKC 3TT3H 1AHWB 1TENA 3DRQB 1G7MB 4PGEA 3DARA 5HHPA 2W0FB 2OTUB 3S34H 2R69L 2VZUA 1D6EB 3O11A 4Y88A 1J5OL 2NPLX 3PQYB 3LEVL 4W6XB 4NCDA 3EJYD 4P2RE 5CBAA 3UMTA 2O5XL 4N8VA 4KKBC 4L5FH 4ZTPL 1ZWIB 1KCLA 1MCWM 1X5KA 2AJSL 1B6DA 4XP9L 2ORBH 5C0EA 2F53B 3ILPB 3Q6GL 2UWEF 1O0VA 1LE9B 4WGVB 2XZZA 2GQHA 4XHJC 5I2IA 2A74B 3NABL 2ZSWA 1WBYA 2NY4D 4IOFD 5BOZG 3WSQH 1BOGA 3BVNB 1IM9B 1XGTB 4Y5VC 1L7TL 5DVLA 4R3SB 4WWKD 2LV4A 1NCCL 2CRZA 2Y36H 3QUZB 4QOKB 5D2NE 5FKAB 2HTLC 5GXBB 1N6VA 2FB4H 2D0FA 3MRRA 4GG8B 3P77A 3QPXL 4OZHE 4LQFL 1MJUL 3CFJB 1D5IL 4PJCA 1ZKAA 3HE6A 2XNAA 5D1XA 1SM3H 1IGJA 1U3JA 4PGCB 2X2YA 1YN6A 5T3XE 1RZJL 5EZIH 2CKBL 4LOUD 5DYOB 1HEZB 5EUKA 1EAPA 5E00A 4LEXL 1NMCC 5SX4H 5KJRH 3ROLB 5K9QI 5E8PA 4OCSH 5D7KD 1LO0L 2HA1A 5ICZB 4PJ8A 5IW6B 1DUYA 4PJFB 2B1HL 4V1DA 2JJTA 5FCUL 3KDMB 3OHXB 5JUEL 4EUPG 2V7NB 4CU6A 4OT1L 4YJZL 3FRPG 1AGDA 4FOMA 4YFEA 4LBEB 12E8L 4PD4J 1F6AA 2R2CA 5J12B 3WXWH 5CWSB 3CX5J 1DBBL 1L4IA 2QL1A 3BZDA 4FZEH 2GEEA 4ODXB 4M48L 5TF1H 4LDEB 1GH7A 3KPQB 4R7DA 2EC8A 3U6RA 4JAMB 3D3VB 4OFYD 2QQNL 2Y23A 2EEBA 2HLAA 1A1OB 3WO4C 2O93L 1HHJA 4MNQA 3L7FB 2ZP0T 1N64H 4JFFB 1NBYA 2F19H 2MJWA 4CW1B 5F7MC 4XI5D 4F9PC 3EDJA 4BZYA 2YMXH 5DS8A 5EUOE 4P2OD 4OKDA 1YA5A 1MI5B 1BBJA 4Q97A 3QQ9C 5KVFL 1AY1L 3GDBA 4XRCB 2MPAL 1T1YB 3BIAX 3HA0A 4M62L 3NZ8B 5TE4H 1NLBH 3ZL4H 5E8EB 2A9NH 5GS2D 3TA3A 5KN5B 4RISH 4HJJL 4I77L 2BNRE 1IC7L 3CSYA 1WTGT 5IFHL 1HHHA 5D8JL 3KWWB 4HW6A 3RBGA 1KV3A 1CDCA 4BZ2H 1K85A 2FZ3B 4MQTB 5J6HA 3V6OE 4MXWH 1NLDL 4QRTB 1JI1A 3MBED 5DMJB 3KJ6L 1OM3L 4PJBA 5GISL 5HPOA 1S7SA 3HG1B 4PREB 1DVFB 2E9WA 2CLRB 2IPKB 3TYGL 1A6TB 1FNGA 4MDIA 4K3HA 2E6PA 3H9YA 3IDGB 2A83A 3DYOA 1RZKL 4R4FH 4PJEB 3GSNH 3MGOB 4CMHB 4RZCB 4NN6B 2OLDA 3A6CH 4N1EA 3WNLA 3HZYB 4KK9D 5DJAB 5FO9A 3I2CL 5D96B 5IMLB 1JGLL 1S5HA 5I1AA 3QUZC 4NWTH 5MENA 4C83B 1EFXB 4ZFFB 1D9KB 3R8QA 1BLNA 2HFFB 4HWUA 5DJ2A 2VL5B 1SVCP 1INDL 3HI5L 5DVNA 3H0TB 1BZ9B 3T65B 5F9WC 1RIVL 3E6FB 1FG9C 4HKXB 2OZ4H 2X5PA 4U6HA 4BH7B 4DVBB 5IVXA 1JWSA 2JKXA 2FDBP 3PIQA 2F74B 3KR3L 3GRWH 2X4SA 2VZVA 3OTTA 4NRZB 1N5AA 2Z8VC 4PJAF 5E08L 4EOWH 2YPVL 5HVGB 3O41B 3L1OL 4XNUL 2W9DL 2CR6A 2EEDA 2J8HA 3C5ZC 4NNPL 3V7AE 1S8DA 1E4WL 3LKSB 1G9ML 2DLFH 1VFMA 1L9NA 3UTTE 3WFBH 1VFBB 2XRAL 5ADPL 4J12A 4HMEA 3MO1B 5DJDB 1ZS8A 4YAQB 1ZA3B 2C1OA 2YA2A 3NCFB 2PR4H 4GXUM 4P59H 3PDDA 4GKZA 3RNKB 4PRNA 2CLVA 2H3NA 2VNCA 1I1YB 3TF7C 5TPWL 4ZFZB 4OTXL 3P0YH 3FQUA 3CFDB 3FONB 3HNSL 4YHNA 1LK2B 3DROB 4O51B 4JFOA 2VH5L 3ILQD 4NM4H 2AV7B 4MD0A 3WIFA 3NCEB 2AEPL 1N8ZB 3IDNA 3HN3A 5DD0H 5D93B 4D0BB 1JWMB 1Q72H 4NKDA 4ELMA 4YGVA 3B2VL 4WW2B 1VPOL 1T22A 2A6JB 2ICWJ 3RUGE 1XGRB 4OLVL 5I8KL 4FQXA 4JZNA 5TQ0H 1KUMA 3PWPA 2ZWLT 3PDGA 3WN5B 3KAAA 5EN2B 3VXOA 1SMOA 2F54B 2VB5A 4Z7NE 3TN0D 4H1LA 5F1IB 5FGRA 4WI2A 3JWOC 5HI4D 2N1KA 4X5LA 2VO5A 1UYWH 4XVUD 4JPKH 5DMKA 3CX5K 2P5ED 1UC6A 1QPXA 1V7MH 4G6JL 2IBZY 1Q9OA 5CD5D 4GBXB 4NOFA 5ERWB 3RL1B 4PGBA 2GY5A 5E2UH 1FFQA 3ZKXB 3TZVC 1HH9B 3W2DL 4JCLA 1GAFH 2VWEE 1G7LB 5I8OL 2P42B 3CSBA 4ZAKC 5KZCD 5D70L 1AO7D 4GRLC 3RKDC 3O3EB 1GVIA 2B2XH 1DVFC 3RVTD 4MJIE 5F7UA 3MLWH 2FEDC 3NCCB 2AXGA 3MV8B 3DSFL 3QO1B 5I1JL 3HUJF 4YLQT 3I50L 2H32H 3GSXB 4IRSD 5EZLA 3MUGB 1ZHLB 2LAGB 3RZCD 3BH9A 5T1LA 3WFDL 4KTDH 4CMHC 1CG9A 4HUNB 4NN6C 4LLUA 1RVFH 2RB8A 3EYFB 4PUBL 5D96C 5DHYA 5EG6C 3CFIC 2OXHA 4TUOB 3MRJB 1RSFA 4YR6A 3I84A 3EOBA 3TBSB 2G75A 1X5FA 3O6LH 5GRJL 1J88A 4F2MB 5DVMA 4KJQD 1CU4H 3GI8L 5F6IC 5BZWB 5I1IL 4PTUA 2E8ZA 2Q7YB 4O2CB 1KCSH 1WF5A 3KPNA 4GAGL 5LGJB 4OZGA 5F1KC 1A2YB 1I3GL 4ZFGH 3HB3C 1C16A 4KRLB 1LO3L 3VXUB 4LRIA 1QBLL 2VQUA 2WLZA 3U0TA 1W72A 4U1MB 4YHKH 3IVKA 3MRFA 3QQNA 4I1NB 5IB4B 5IP4A 4RCAA 1U8PB 5FYKL 1BIIA 3U7YH 3QPQD 4ZTOL 1JZ8A 3TYFA 1BEYH 3BKJL 2XYCA 4ODBD 1IC1A 5HHOE 4UIKL 1HOCA 5IMKB 3N50A 1YUHB 3MA9L 1ZGLB 2BRRL 1I1FB 5EU5B 3P2TA 5KS9F 3CC5B 4X4ME 2IBZX 1DBAH 1EK3A 3GMOA 1MUJA 4NWUL 2BHZA 5D7LB 1CCZA 2HKFH 3RKPA 1KPVA 3QEQE 1N5YL 4MJ6A 5C92A 3L6FA 1XGTA 3EW3B 1A4KA 4I2XB 4JFZH 5AG9A 3F7PC 1TCRA 2NXZB 4Z7UE 2HFGL 4IMLB 3JWDH 1IGFL 1TPXC 1UVQB 3JBG7 1CGVA 4NM8L 5HJ3A 4HUXA 1IKNA 1D5XB 1JMXA 1G7PA 2FIKA 2XIDA 4F7TA 2OBGA 2HJLA 5D93C 4G42A 3P73A 3N9GH 5HHQA 3G6AA 3EJZC 3VXMD 4WW2C 3EIFA 2C4FU 3MRHB 5CJQL 3QUXA 3DGGB 3IJHA 1RUQH 4IDLA 1MAJA 4OGYL 1FJ1A 3O9WB 3CVHA 2ATPA 3HFMH 5SWZA 2DD8H 2R9HD 2WM0A 1QSVA 4PJ9D 3RWGA 3BD4A 3GSQA 5GRVL 4O5LL 5ELIA 3PP3H 2G5BB 3D69A 1VGEL 1BQHB 4F57L 1QO3A 4CDHA 3MREB 2I07B 5HGHB 1MH5A 1AD9A 2DLGA 2KQMA 3SGKA 2HN7A 2HT4C 4KVNH 4M6OL 4CVWA 1KG0A 2V2XB 3AREC 5CWSA 4GBXC 3IDUA 2G2RA 4O58L 4NSKA 4YZFE 5J1AB 2GCYA 3H3BC 1CD1B 4PJHE 5HHNB 5C09A 2R4SH 5L9DL 1T66D 2GFBB 1HH6B 1M6OB 4PRHB 3X3FH 1YY8B 4Q0XH 1CT8A 1FNEA 4D9QE 3JTTA 2BVYA 3KPRA 3HHRB 4PS4H 3DIFA 3HR5B 3NA9H 4DJMA 2EZ0D 3K2UH 1MCQA 2Y5TA 5C0BD 3MLUH 3MLTA 4TNWK 4ZPTA 3S3SA 2J2ZA 5FYJL 1V7NH 4Y89A 1DN0B 4JZOB 4N5UA 1KIRB 4KROD 4D0CB 4ELKA 3ULUH 4P5MB 2W1NA 1HSAB 1PJ9A 4O00A 4U6TA 1U92B 3UO1H 1T5WA 2Q76B 4YXKL 1FYHB 5HVHC 1OT2A 4PJDB 2QSVA 3UTSB 1JFQH 2DRUA 3V9FA 4W6WB 5T5NG 1VADA 3R1GH 3CXDL 4GXUN 1ED3B 4LP5A 4GW5A 1AE6L 1KPRA 5TFSL 1HWHB 3AROA 2DWDA 2JB5H 3ORJA 3GSNB 2MFNA 3MGAA 3KPLB 4G43B 5DQ9B 1E4XL 1T20B 4W70A 4P2YA 2NX5B 4XBGA 1RUAL 1KCUH 5MEOB 1W72L 4HKJA 1QR1B 3IYLW 5T33L 2NY6D 5C07B 1QRNA 1MCPH 3QUML 4N0YH 4U7MA 5EH1A 4F7MB 5J11B 3MQIA 5F1NB 2VABB 2XN9E 1SJHA 3HMXH 4Q6IA 3ZKNC 2Q3AA 5L2KA 2MQ3A 5EU3A 2H26A 3HE6D 2R1XA 5TDNB 5D1XD 5SX4I 5IGXL 2FJHB 4L3EE 4GRMB 1A7NH 2VN4A 4H20L 1DE4B 2RIKA 4PJEA 2XZQH 4LVEA 4CUCA 4M1DH 5F9DC 1OD9A 2Q8BL 1HHIA 3V4UH 2VN7A 4LSDA 1J0KA 4PJ8D 4DVRH 4X4XA 4NZUH 4V1DD 4JRYD 4UNTA 2E27L 4PP1D 2IQ9H 3MV7E 1MWAB 4KFZC 4DGVH 5D6DC 3X13B 3IJYB 4NHUB 4O02H 3LS4L 3MSPA 1S9VA 2C3XA 4L8CA 4Z78A 1U8HA 3O3AB 5FDWA 1NGZB 3RWEB 3CVHL 3TC9A 4XAWL 1GZQB 3QJHB 2DYPB 3PGDA 1TVBB 3O9WC 4LHUB 32C2A 4PRPB 4K8RD 1TZHA 3CLFH 3WFHB 5BW7A 1A47A 5I17B 3FT2B 1OAZH 4PRIB 5A3IC 4MNQD 1HYSD 4YBQD 3SO5A 2E7BA 1LO2H 3KYKH 2IANB 4OM0H 4LF3A 4CGTA 3L3OA 8FABB 5D2LF 3PL6A 5HI3D 5F7FA 1WCBA 5L2JB 3HZMB 2BOBB 2X4NA 1NEUA 3ES6B 1U8QB 4HZLB 1CLYL 1YN7B 3S5LG 4TVPD 3OXSB 4X6FB 5HGDA 3MXVH 4PRBB 3ARDB 1HIMH 5DJCB 3UJJL 3EO1B 5KSVB 4WO4A 4MHHG 4ZD3L 3WXVL 1G6RA 1P84J 4ZQKA 1J1PL 3O4LA 2X9YA 5FK9A 4OCYL 1HILB 1TVDA 4KK6C 3WLBB 1I3VA 4HIXL 1SYSA 2Y7QB 3U9PL 4LSRH 5EOQH 5LQBL 2A6KB 4ZUWB 3VGBA 5DD1L 3T0BA 3OJ2C 4ZSOA 4YXHH 4G7VH 4OFPA 1AQDA 1QOKA 3U2SB 4U1NB 4LAQH 4E41A 1L6XA 2QSCH 4FQ2H 1MY5A 5LBSH 3TWCL 2R15A 4UT9L 4K3DH 4MA8H 1U6AH 4GXVH 3BGFB 1IGML 1ZEAH 2BSED 2W91A 5FEBA 3L3GA 1OAQH 3IGAB 2NLJB 4Y5XC 4PJCF 3QO0A 1EJOL 5ADOH 4WW1B 4X83A 2VDPH 4GAFB 5TH2A 4FXGA 2VIRA 2BHUA 1C5DB 4HDIA 4PJ5B 5IBTL 3ARFB 3KHOA 3MC0A 4UAOB 4DGIH 3H9HA 1EBAA 5D1QB 3KGRA 5F7YC 4FS0A 4P5TC 3CIQA 1EHNA 1CF8H 4LSQL 1CQYA 3QZWB 5AEAA 5MEND 2VDKH 4S10A 4X5XA 4PJIA 2EO9A 5C0CA 3QRGL 5J11C 3EAKA 4RGNB 3WFZA 2OR7A 2X9XA 1GSMA 3S96A 1GYAA 5BJTB 5ISZE 4RMSA 4HEME 1KIPA 3LKNA 2CH8A 2F58L 3U4EA 4X5WA 1L6ZA 4PJAE 1NCUA 3B5TA 4NT6A 5DT1H 5FM4A 5T1KB 1FNLA 3QHFH 3ROOB 1Q0YH 3G04B 3OGOE 3DMMB 4KMQA 5ENWB 2OP4L 1AJ7L 4MAUL 2X4QB 4G8GB 3MOAH 4KI5D 2H2PC 3C5JB 4AENB 5IJKA 1LDPL 1C5BL 4S1SH 2HT2D 2E9IA 4NJ9H 3RNQB 5I30L 1TJHL 3VFTB 4NIKB 4NKIL 1EERB 4OJFH 3MRGB 3O2DA 2ICEA 4DAGL 4YWGH 5FYKD 2PKDA 3SKOB 7FABL 3TT1H 2WNGA 2WBKA 2JCCA 1T03H 5B39A 4QCIA 5FB8A 5DJ0B 4OIIH 4TN9A 4Y19E 1R3KB 1NAMA 3QHTC 3V79C 1MAKA 4U2ZA 5JOFB 1VKXA 1FYTD 3RX8A 4HJGB 1QEWB 3JSSA 1DQQA 2ADFH 4IRZL 4P9ML 4KVCL 1INQA 1OGAE 2WP3T 4KH2A 3TPKA 5KBNC 1KELL 4UINH 3BQUB 1C8PA 1M7DB 3PP4L 4M6MH 4MX7B 1FGNL 2OM5A 3FO1A 1S7WA 3P4MB 3HE7D 2XWTB 1TVHA 4CU7A 1QLEL 4AQ1B 2IADB 3U1SH 4ZUTA 4NUJB 3H3PL 1LE5A 4NFBA 3MBXL 5GZOD 5BS0A 4GJTB 2P7TA 4XP4H 1G6RL 4QNPF 3PWPD 1GGBL 4LLYB 4PJBF 4MA7L 1N3NB 3T4AA 3QCVL 4HWEL 3W9DB 4UT7H 3WS6A 4QXTA 3FRPA 1LHZA 2C26A 4KPHL 1I9IH 1P69B 2DM4A 1I7TB 1RURH 5DZOA 1PBYA 5F89B 4I9WD 3MV8E 2X4TB 4JFQA 4MCYB 3WE6B 2J8UA 5E9DB 4P49A 1D3CA 1M7IB 1E4JA 1S3KH 1MHCA 1IQDB 2DMCA 5BXFB 5IEHB 3D2UB 3DX8A 1NGPL 4WGWB 5JDSB 4S1QL 5F70A 1F4XH 5DJXB 4GQPH 3QEGL 3ARBB 3VXQB 5E2VL 4Y7MA 5IVXF 3ZKSD 5DRXA 5BV7H 3HUJE 4MS8C 2CQVA 1BD2A 5GS0L 4YDKH 1FZKB 4ENED 2CDGB 4Y2DA 5GJTL 2OJZH 3OXRB 4D8PB 1QVOA 3ARFC 5ALBL 3UTOA 4N5ED 3DTXA 4U1IA 4KI5F 5FYJD 5T1LD 2FSEA 1IEAB 1U3ZA 5L0QB 1J0IA 3RX5A 4Z0XB 2BVEA 4L3CB 2ZZUT 5JQ6L 5J1AA 4HBCH 1PFCA 4HKBB 1P7HL 3SKMB 5D1XC 5DLMH 1UKTA 2VAAB 2VXQL 3VFGH 2XFXA 1E28B 5C2UB 4APQB 4WI6A 4HK3N 4HIIB 3L5WB 1FG2B 2NY5C 4FNLH 2MCG1 3DMMC 5IB5A 2ORBL 3GMMA 1KIRA 2DAVA 2JJTC 5HHXL 1OW0A 3P9MA 4ZNCD 4ZS6C 4HAFA 5EO0A 2H8PA 3O2DL 1CDGA 4UT6L 4WU5A 3X3GH 3VFOA 5DFVC 3P0VH 4P9HH 3KYOB 4KK5C 2EDRA 5F9OH 3LH2H 1B0GB 4LQ1A 1JF5A 3I75A 2DMBA 5EU6A 4Y5YA 5KS9E 4HH8A 1EEZB 1NAML 1JP5A 4MNHB 5B38A 4ELMF 2YS4A 2Y25A 4A6YH 3L9RB 1X3DA 2BVQA 3F7VB 5D6CB 5MEOA 1MCCA 43CAA 4KMTL 1IM9D 3GJEB 1XF3B 4QOKD 5IEKA 4X4YB 4RWHA 1Y6KR 5C9JB 3BQUC 4H26A 4MNGB 1RD6A 3QWOA 4OCWH 2P5EE 4ZYKB 3LKQB 5EZIL 3TBTB 2Y06H 4X7SL 9CGTA 3FB7A 3BRGC 4F8QA 4QRUB 1IFHH 1KT2A 4TPRL 5TDNA 5DJ6B 1CLZH 1MY7A 4HIHB 2P5WB 1CL7H 3ARZA 1REIA 1ZLWH 5C7XH 3EOTL 3QUXD 1KCVL 1AO7E 2YD3A 1XT5A 3S37L 1TXKA 3D25B 1YEEH 4X6CA 3G9AB 3TA3C 2QBWA 3OR7B 5SWZD 3MA7B 1GL4B 1MF2H 2GUOA 3LQAL 5HPMA 1P7QB 1HSBA 1KJVA 3C08H 3MGTB 4XCCH 1KTLA 1SJEA 4NUGH 3OMZA 2B7DT 1I3UA 2GJJA 3B6SA 4AIXA 3QI9B 5C0GB 1SBSH 3HMWL 2WWKT 4FZEL 2AXJA 2H2SC 3QG7L 5TF1L 1IL1B 3RWCB 5F7KC 1F4HA 3C9NA 2WIIA 1S78C 3ZE0F 1MPAH 3GSUA 4JFHD 5FHAH 4QTHB 4FFZH 2KUTA 4L1DA 2GITB 2BNUB 2H6PB 2IEPA 1QFOA 2ZUYA 3LN4B 1NCBH 1JPGA 4HUUB 4JGJA 4ZUVA 3U4BH 4CJ1A 4OZFH 4JFXA 5MERB 5BRZB 3FO9A 5IQ9A 4AY0A 3C09C 4F3FA 4ODVL 1TVBA 1PX4A 3VG9B 4S1DC 4XCYA 3SEPA 2VLLB 4G5ZL 5I17A 5JORB 1YNKL 3KPRD 3H9ZA 5CEYB 3UPAA 1AGFA 1H0DB 3RY5A 1JHLL 3MCKA 4OZGF 3DOSA 4XXCC 4LIQE 3N0PB 4JFFD 4C56E 3QYCA 2CLZB 2VMFA 4ZODA 4P3DA 4EI6B 3CU7A 3V7AG 3ZDYF 3ZL4L 1BFSA 3L3IB 4UIMA 2OTPA 3WD5L 3ZYOA 5L0QC 3VG0H 4U7SA 1JNLH 3T0WA 1JUFB 4LPCA 2HTKD 1MCOH 3M07A 4LFHG 5F3BB 5JW5A 2BDNL 1HQ4A 1U8JB 5F9JA 4J3WA 3NIFF 3VFNB 1Z3GH 3N1GC 1HXYA 3OF6A 2RCSL 3T77B 3CUPB 3P4OB 2NY3D 4APQC 1GIGH 3GMQB 1Q8MA 1YEGL 1W0VB 4Z5RB 4I5BA 3ARYA 4AM0B 5I1EL 1C5CL 5C6PB 1RI8A 1G1YA 1NAKL 4K7PL 5DMGD 2IBBA 3HI6L 3PGFH 3BYTA 5BVPL 1FVEA 1ND0A 5CCKH 5I0DA 3F65A 3BMWA 1U8KA 3V5HB 1MIEH 4JG1H 5LGHH 5CIPH 4L8SB 2HYMA 4KHTL 4H8WH 4MD5A 3RDTB 4YDJB 2HAZA 3C2SA 1K8DA 1MNUH 1P4IH 5L2KD 1AR2A 3A6CL 2H32A 2NLJA 3VXME 3GKWL 1DDHA 5CGMA 1KNOB 3C2AH 2I60H 4U1SB 5F9AC 4JO3H 4UDTB 1IGIL 3RJQB 1HHKA 3FZUD 5D1QA 4DCQB 1PDKA 1I1AB 4P2QE 5GGUB 4EBQH 3P4NB 5EBLA 15C8H 2J6EA 4MGXA 3CMOH 1A7PH 5IG7B 1P2CA 4FQHA 4K3EH 1SMAA 1EFXD 1D9KD 5FYLL 4OD1H 3TEUA 4FFYL 1FSKB 2IANE 2MCPH 2VUYA 3ET9F 4GMSH 4FQXC 4GKOA 4JO2H 1PG7H 1IGTB 2D9QB 3U36A 4Y4FB 2ZUVA 5L8KB 4J4PA 2DLFL 1TZGH 1HCFX 1WBXB 2UYLB 3VU2A 4ZOBA 3T1FA 4X7TA 4N8CL 2J5LB 4L4VB 3HTLX 4YH6A 4EUPH 1B6UA 4GFTB 4ZO6A 2VXSL 5C0BE 1R5VB 3KJ4C 1JGEB 2L0DA 4AEHL 5KVEL 5D5MA 1LK3L 3CLEL 5D2LE 5IFAH 3AS2A 4JFYB 5FHBL 3N85L 1HN1A 4M4PA 1A9BA 5FECB 3PL6D 5HSFA 3MRKB 5JHDB 1MJ7H 5TGBB 5HYQB 5D7IB 5GHWH 4XCFL 4BFIA 2CGRL 4IHOA 1ZMYA 4WO4D 3U83A 2K9UA 3KLAB 3SPVA 2FGWL 3O4LD 1FN4A 5A16A 1NCNA 5E0QA 5DD0L 2DS4A 4U6YB 4LEOA 4PBXA 1Q72L 2AXFB 5D1ZB 2FX8H 3BZFA 3OKLA 1NFKA 4MLIA 4NKOA 1ZVSA 4R90H 5EPMB 1WSST 3ARWA 3D9AL 2Z8RA 3QUYA 5TQ0L 1T1WA 3TBVA 2WIMA 3T2NL 4X9GA 2AEQH 4G3YH 3AVEA 2D7TL 1DFBH 1J7VR 2C3WA 3IFNL 4E41D 1NCDH 4G6AD 2DI9A 5BV7B 2HMIC 3L3DB 5IV2A 4PJCE 5MP6H 3BOVA 2BJMH 2BSSB 5FGCB 1LVEA 1ZT4A 1N3NA 2BSTB 1PYWA 4PJXA 3WDHA 5EC1B 3LQZB 2FWOA 2LFGA 2DQCL 1Q9LB 4XMKL 3MRLA 2FR4A 2DQJH 2R1YB 2VQ1A 4M61A 1AQKL 5E2UL 2HKHL 4WFGD 3QHZH 3L3JB 3MROA 4YPGB 4JHAH 1IC4H 4RFEB 3IDXH 2WUCL 1S7VA 5E8OB 4AIOA 1FZMB 5GSRB 4V1DE 4JHBA 4TSAH 3FT4B 1PKQB 5DEFB 3IFPA 1MAML 4S2SB 2MKLC 1KC5L 5JXAL 3GSVB 4U3HA 1CFTB 4MJ5A 1A14L 4JQIH 4F7PB 4L8SC 3RDTC 4OV6F 3MJ6A 3W11D 4XZUA 4NQEB 1CE6A 4A2MA 1UXWB 1N6QH 1V3MA 2AJUH 4JN1L 3MACH 1PLGL 3RWFB 1DQLL 4QRRB 2J6EL 5DZNA 1IEAA 1I1AC 2ED8A 5L7XH 3BE1H 4UMGA 4MNQE 1G7JA 1CU4L 1BF2A 4JR9L 3DBXB 5K9OA 1P6AB 1KCSL 5EBMA 1U8NB 5M95B 4X98A 3RIAK 1JPSH 1UWGH 5ETUB 3OAYH 3VWKB 2W0LA 4ZFGL 1RUML 1FNSH 3VWJA 2OMBA 4ALAH 3VDAA 5CUSL 2ZUXA 1INEL 3RGVB 1FSKC 3QR2A 3UTPD 3W0WB 4AEIL 3KPSA 5E8NB 4WI7A 5DQJA 2VC2L 4JFEA 1Q0XL 2WK2A 5SWSA 3S88H 5E24E 3BUYB 4OF6A 4Y4FC 3CGTA 1NGYB 1PEZA 3CZFA 4JQXC 4HWBA 4JZJA 4M9OA 3UBXA 3VXUD 1DBKH 4R8WH 4LLDA 2UZYB 3KPMB 4OLYL 2J5LC 2X40A 4F37K 4IS6A 4PYHA 1PX3A 3UJIH 2DQHL 2IALA 4HXBL 4MSWA 3FB8A 1YECH 1R3IL 3LB6D 5E4IA 2HKFL 4QTIH 1NKRA 1P1ZA 5JXEA 3PHSA 3BT2H 4G9DA 4ZO9A 2YD2A 1JWUB 1KLUA 4XCEA 4JFZL 5J6GA 1S9KC 3MUZ1 4QNPE 4X99B 1RQ5A 4PJBE 3S98A 5D7LD 1V05A 2AEIT 2Z8WC 1T0MA 2IMNA 3ARSA 2J4WL 2VXVH 4XP6H 1AI1H 4AZ8A 1MJJB 1XF3A 2NNAB 2VLRB 2NXZD 3DGCR 5C0AA 3N9GL 4ODWA 2QR0B 2DB8A 3HI1B 3AXLB 1X7QA 3ULVH 4OZFB 4P4KB 1T0PB 2HTKC 4TUJB 1MCLA 3F6LA 1Z9SA 3ME0A 5FM5O 2OJEA 1T5XB 4XNMA 5A2IH 4PJIF 1IAOA 1GGIL 1J1XL 5ID0A 5JNYB 3MR9B 5MEQA 2B1AH 1MSPA 3DXAB 3OB0K 5IVXE 3T1WA 3L3HA 1BFVH 2OK0L 5ESAB 1F6FB 4OD2B 4RAUB 5BOPA 5GRYA 3PXHA 4JN2B 1ORQB 4DOHB 1BD2D 4H0IA 3F12A 1FV1A 5J7CC 4L8BA 3VRIA 4KI5E 1WBZB 4Y2DD 4BELD 4D0DB 4QHNA 2AGJH 4KKAD 2V9QA 1D5BB 4WY7L 2VISB 5FYKE 4Q6IC 5I76A 3EHBD 4NZTH 4ERSL 1NCTA 2AABL 3DX6B 3BKYL 5HYFA 2JCCF 5FOBA 1ZSDA 4CNIA 2WAHA 4PRHD 2HJKB 3WIHH 3NN8A 3BI9X 1NC2B 4LLWA 4JFPA 5DD6B 5AYUL 1EHXA 3T0EC 5EORL 1VGKA 4NZRH 4UUJA 1DLHB 5CIPB 4G8IB 4X9IA 1OARL 1ZHBA 2JB5L 5KVGL 5F96H 1J0JA 1X9QA 5GSVB 3E6HA 1E6JH 4NQXA 4YHZH 5EU6D 2DQEH 1G7IA 3S3PA 1NPUA 2V7HB 3OZ9H 3EFFA 3DO3A 5CD3B 5I1GH 2XQYG 4ELME 1EVUA 5CEZL 3FFCB 1HQRB 3IF1B 2XTJB 4ONFH 3RGVC 2PXYA 4XHQA 4P4RB 2PO6B 5BW7C 3PWPE 1SYVA 3GNML 4HWBL 3SE3A 3WKML 3VI3E 2P5WE 1RJZA 1RK1A 2ARJQ 4HIJA 4HX1A 2Z4QA 3I85A 1RJLA 3MZTA 2SEBB 1Q9KB 2AK4A 1NL0L 2OTWA 2UZIL 2F5AL 1XZ0B 1CFBA 1XF2A 5H94B 3FTGA 3ZO0A 3SCMB 4I9WE 2LVCA 4WTZG 2BVOB 1Y6MR 3V5HA 1QLRB 4MXQD 3QXVA 1VSCA 5C71A 5DO2C 4WHTB 5FYLD 1CL7I 4XPGL 1R5WA 2J8UF 5I8CB 3QIBA 2ZOKB 1QFUH 3RVVD 4EUPB 4OI7A 1MFAL 4EVNB 1CDJA 1FPTH 3VFVB 5TDOB 4G8EB 4OCXH 4QHMB 1FE8L 4RMTA 4O02L 5EOCL 4KI1A 2A2QT 3P4NA 5LKNA 1J10A 1U3HB 5EZJB 2VL4A 4I48B 3SJVA 3QXAB 3V2AR 2R8SH 5E99L 3WUZA 2E7MA 3ZE0E 5FYJE 1LP9A 3VXSA 3EGSA 2Z93A 3FOLB 3Q3GB 3VGFA 2MOVA 4EDXB 1F4WL 3QA3A 2ZCHL 1YEFL 4P4KC 1UJ3A 1TFHA 2RGSA 5T5FL 5DJ8B 1HHGB 2D03H 5IT2H 1I1RA 3VXNA 1ACYL 1Q94B 3ZTJG 4LHUD 4PRPD 4U6VH 4Z8FL 5HYEA 4C55A 4LPWA 4QHLA 4K2UL 3V6ZB 5GS0C 4OZGE 5E56A 4WHDA 3MYJA 1IAKA 3C8DA 3DX7B 4XWGH 2IFFL 1ZANH 4GMTL 1LNUA 1K4CA 3TIEA 3ZDYE 1NKOA 4M9PA 1A64A 3HLAA 1SBBA 1A9EB 2C3VA 5EC2B 1QQDA 5FA3B 1N0XL 2YN3A 4NNYB 4M00A 3ARDD 1NGQH 3NACH 1TCMA 3D39B 3NIFE 1ADQH 1FL6A 1OTUD 4OFDA 3OF6D 4U3XA 5IFJA 4KC3B 3MRMA 2AK1H 3RGHA 3K3QA 3V4VH 5EPMA 2R2BA 3ZHLA 3TO2A 2C7UB 4FQ2L 5LBSL 5FUZL 2R0WL 2AJVL 1NGWA 3QDMA 3WHXB 4NN5B 2F8VA 1U58A 1KJ3L 3U9UB 3IDMA 1FZJA 3CFBA 4NRYA 4Z7OF 3U7WH 4QO1A 1XF4A 1FL5A 5IB3A 1AGEB 1WAAA 4LCWB 5KSAB 3L95A 4O4YH 4XB7A 4OAWA 3M1BA 1GPOL 4Q9RL 1H8SA 3FT3A 4LCYA 4QRQA 5AWNL 2I26N 5GGRB 5ICYB 2CK0H 2PO6C 5SWZE 2BMKB 4I3GA 1IC5L 4G80B 4X6CF 4HCRH 5D1QD 5HXMA 5DK2A 1HDMB 5JR1H 1UXSA 4UB0H 4AL8L 5T3ZL 1U8MA 4JPVH 3M8OH 1Z9LA 1T1XA 4KZEH 2EDBA 3P11H 3C5SA 3G6DL 3C87A 3QHFL 3SCMC 3VE0A 1MCHA 2ZKHH 4RGND 4YEEA 4JFHE 4EKXA 2Y6SD 3BWAB 1MFEH 4X6DA 4PJ7B 1QNZL 5IJVA 5C6TH 4Y1AA 1NDGB 3RWIB 1UXWA 5C09E 4KAQH 4J4PD 4OJFL 4LNVA 3G08A 4WJ5A 3WS6C 4XMPL 5C1MB 5GQBA 3LQAC 4B50A 2FH6A 3KPRE 4F7CA 1P7KB 1JZ6A 3DUSB 3OKOB 3G5XB 1FVCB 3O4OB 1OAUL 3GM8A 4QKXB 3KYAA 4TULL 3SDYL 2ZPKL 1CGSH 2XZCH 1D6VH 3SOBL 1GGCH 4A6YA 2NXYC 2ZUSA 5DEGA 5EOCJ 4WEMB 1UM6H 2JK5A 5CZXC 3S9DB 2FGZA 2QADD 1IVLA 1T6VN 2PTTB 4JVUA 5CMAB 2VLKA 3AMLA 3ARRA 1NQBA 3U0PA 4LARH 1XGQB 2KL6A 1QSFB 3KXFB 5IB1B 2DKSA 3RBSA 1L7IL 3FQXA 4MA3B 3QB7C 3G5YA 2WP3O 5E1AB 3PF2A 5C0FA 2AJXL 5D72H 3IETA 4YO0B 2B4CL 3NTCL 2FJFB 3H42L 1J18A 4M7JL 3QUYD 4ODHH 1A0QL 1ZLSH 3DRTB 1QRNE 1CXEA 4NC2B 3MNVA 3MJ9H 1AGCA 1JHKH 3VDBA 5CLWA 1EMTH 2IH1B 1KFAH 4DN3H 3Q1SH 5GRXG 4YX2L 1T1ZB 5L2KE 1UM4H 1U8OB 2DWEA 1YQVL 4J8RB 3GHBL 4JY4A 4LPXA 4BQ8A 4ISVA 5DQDL 1JMZA 1MJJA 6FABH 3JV6B 3WHE1 3EYUH 1W0WB 2X7LB 4CN4A 3VH8A 1S3KL 5IB2B 3BJLA 5AUMB 1A6ZB 1OW0C 1YMMB 3SO3B 3T0EE 4J7RA 1RIHH 3MMEA 1N6UA 43C9A 4JKPL 1CBVH 1MFDH 4RSVA 3MNZA 4TUJA 5E9DD 1UB5B 4I3RL 2NR6C 1QHOA 3GHEH 2Y5EA 2CIKA 1JZ7A 2O61B 4X8JB 5LXGL 4JJ5B 3HS0A 1Q9WB 4K9EH 3FB5A 2YK1H 1U8IA 4Z7WB 4R2GB 5ESAA 4FTVA 3PP3K 2JLLA 5I74C 3ULUD 4TOYH 5C3LD 4UV4L 3SBWA 1JF6A 4FHBD 5DRWB 2DQGH 4QF1B 1KXQE 3EO9L 4D0DA 3VCLB 5DLML 5D4QA 3TVMA 3L3KB 2KBGA 2IAMB 5DMYA 4K23L 4EJ1C 3BIKB 3G5ZA 4LP4A 2R2EB 1WT5A 4W68A 3DO7B 3BP7B 2EYTB 3BO8A 4M5ZH 3MV9B 5D5MF 2OSLA 5C6WH 3CH1A 4FQIH 4PGDB 4AT6A 1YNLL 5JIHA 5FAAA 1A6AB 3Q48A 2M1KA 4NHCL 4BSVA 3H7LA 4QRSA 3QISA 5CEZD 4G8FA 3KPSD 4XP1H 5IK3A 1JF1B 2VOTA 2VKWA 4EXPX 3EYVB 3EJJX 5F9OL 4HLJA 3LH2L 3O4LE 1RMFH 1Z5LA 2ADIA 4PJGB 4JRXB 2OR9L 4JO4H 1JGVL 1KULA 3DV4A 2FL5A 1NC4B 3O4OC 4QT5B 5ID1A 2VTFA 2LAAA 2QSTA 4A6YL 4U1LA 5DDHB 2XWJB 4FQJL 1JJUA 3K4AA 1AP2B 5EU7E 3SDDA 1E27A 4ZSOE 2VDML 1MQKL 5JXED 3OSKA 1HQRA 3PWLA 1U8LB 4I13B 5FCSH 3TH4T 2DQUH 2Q6WA 4L4TB 1S5IH 3ZE1F 4QYOA 1NMAL 4JGMA 3UZEA 1NJ9A 4JDTL 2YZ1A 5L88L 4O2EB 4PLOB 1DR9A 4YHOL 4FABL 1J8HA 4MMXC 2X44D 4XVTH 4ZPVB 2RJMA 4B53A 3TV3H 1CZ8H 1OPGL 4GRWF 5EU4A 1A02N 1IKFH 4PJXF 5IQ7H 4PLJC 4UOW0 3DXAE 5GRUL 3FJTA 2YPKB 3INUH 1I75A 4WFGE 5I9QB 5C0AD 1I4FA 1KCRL 3TJHD 3WFCH 1UWEH 4HUWB 5B4MC 1ZT1A 3H9SB 3QFJB 1MVUB 4RGMC 4NQDA 35C8H 1RIUL 4OD3L 3DVNB 5EO1A 5BVJB 1S7QB 4WUUA 3QEUB 4ZOCA 1WZ1L 4XCCL 4EN3A 4PJIE 1F58L 4GLRH 4NUGL 5C0CE 1UB6B 3EDKA 3PNWA 1PAMA 3VFVA 2YBRA 3OKKB 1S7UA 1G7HB 1ORSA 3GIVA 3MRBA 3MJ7B 5C8JA 1A6UH 2ADGA 4GAYB 2Y07L 5JOPD 2V17H 5DFWH 3QI9D 5HVFB 4UQ3B 3RVXD 2WWKO 2PW2A 5KVMC 2O26U 2GK0A 4OB5H 4MQSB 4LLAA 3SGEH 3BKCL 1JBJA 3FO2B 1DBML 2ZJSL 4LCIL 3PGCA 3LEXB 3RL2A 2JCCE 5INDB 4Q74A 3QCUH 4WFHD 5IMOA 4DKEL 2DQIH 5FGSA 3GSOB 1KGCD 3WO3B 3I02B 4PG2C 2WZPD 3UTPE 4HV8B 3I6GA 4FQ1L 4LCUB 1N0LA 4R2GC 2EKJA 4OUUB 4FFVC 3F7YB 4KGLA 5C08B 4YGAB 3VG0L 4RDQF 4NO5A 1JNLL 5GPRA 3MNWB 2QJDA 5D9SB 4YE4L 1MCOL 4GG6A 1T7XA 5J9PA 1JZ3A 1M05A 2ZG3A 1RFDL 1WFOA 1Z3GL 2R23B 2ZUUA 3GMLA 2IAMC 1OAYL 4QRPA 4G9FB 1IM3A 1B90A 5I18L 2X4OB 3VA2C 4HH9B 5D7JA 1IEHA 3E3QC 1UQSB 3K2MC 4UU9A 1A3QA 2C1PB 5DHVH 2XA8H 1XIWA 3NVQA 4N8VG 2CKNA 1KXVC 3WV0A 2ZSVA 3CCHB 4FXKA 4FQLL 3PGFL 5BS0E 2PW1B 1B88A 1LEGB 1VEPA 4XNQA 3U30C 1RZ8B 5CCKL 1MCFA 2FBOJ 1IAIH 4KGJA 2CK2A 3V5KB 3VMNA 4RIRB 4OI9A 5LAXA 5DSCB 1CFNB 2F8OA 4H8WL 5CP3H 2AK4D 3ZKMC 4FQPA 3BGMA 5DK3A 4EXKA 2JB6B 4Y4KB 1ZHNA 2XZAH 4JFDE 2B5IB 2CUMA 4MLSA 1A1MA 5E2JA 5IR1A 3C2AL 1DBJL 4Z18A 4LCCA 2QADC 2J8UE 3S7GA 5DUPL 2Y4SA 5JLZA 1TJGL 1HINL 4JANA 1KN4H 3QIBD 3JV4A 2G9HA 5CP7A 4PG9B 1I7UB 5LGKA 3UPRA 1E0OB 1E4KC 3B9KA 3QNXA 5EA0H 4K3EL 2P46B 5HHVH 3MV11 4JEGB 1YY9C 4W4OA 3G5VB 2CDFA 5HI5D 4UBDC 1GC1H 1BFOA 2BFVH 3IDYB 5B3NA 4HLZH 4JVWA 1BD2E 4DW2H 4MVBD 1T04A 3S35H 3MRPB 4JO2L 2YPLB 5KSBB 5I9QC 3SJVD 1WTLA 3I6LE 1A5FH 1H9VA 5JDJA 1TZGL 1QKZH 5AAWA 2Q8AH 2J1KA 1AXSB 3MFFA 3BN9D 4YHIB 4P46A 3QULA 4WTXA 1VENA 4YBLB 4NNXB 1PKOA 4P57A 1I8KB 3IU4H 3S5LB 4M7ZB 1A1NA 3WUWA 1K2DB 3VMPA 1T4KB 2P24B 4RQQB 2VDRL 4M6AA 3WYRA 3W9EB 4POZD 3O6KH 4PY8I 3UP1A 2X1PA 1EEYA 5H2BA 3VFSA 2R2HB 5DJYB 2HFEA 1N26A 2NW3A 1YEKH 3BP5A 2D31A 2EKSB 3VA6A 3S6CA 1P9MA 3H7BA 3NCYS 1CXHA 4WUKL 2QQLH 4H25B 3QG6A 2FX8L 1BPVA 5EU6E 5GGTH 2VLME 4FMFA 1RZFH 4XNYH 1I7ZB 2J8OA 1YC7A 3N1MC 4M03A 5TE6L 4OGXH 4N0FB 2GJ6A 5TQ2H 3LEYL 2WINA 3DVGB 5ITBL 2E7HA 5HYIA 2QLVB 4PR5B 2H1PH 5D1ZD 3RWHA 4JPWL 1KN2L 4PFEA 1B2WL 1GHFL 1PG7X 1KJMB 2R0LL 1NFDB 5C0JA 4N0CC 3D18A 4D9LL 4CVUA 3D0VB 4O9HH 4HUVA 5MP6L 3MRNA 4Z7OE 4XP5H 1Z9OA 3Q6FB 3UAJD 3EOAA 3VWJC 2YHGA 4HD9A 5DUBB 3QIUA 2DQFA 4K7PY 5DJZB 4HWZA 5FYLE 4KQ3H 1E6OH 1XCTA 3HZKA 3TO4B 5CGYD 3MLXH 5IBLD 5CJ8A 4IRJA 1NGXA 2EXYD 1JYXA 4GKSA 1I7RB 1CDYA 1S7XA 3O6FB 4JZJC 2W0KA 4MA1B 5BO1L 4X6CE 1PSKH 1Q1JH 3GEWB 1HI6B 4MYWB 4KWUA 3BH8B 2EH7L 4TSCL 2PTVA 5K9KA 3F5WB 4JQIL 5GGRY 1NCWH 2PYEB 2R29L 3SDCB 3GB7A 5GGSB 3HAEA 2FYYA 1RZ7H 4Y4KC 3RTQA 4ORZC 1RZGB 4AMKH 4R4NC 5I15L 4R96A 1LP9F 1A6VL 4J6RH 3VFUA 3G6JA 1KJ2H 1HZHL 1RJYB 3L5XL 4NKQB 4NQED 1EZVY 2ITDA 1D5ZB 1WIPA 4Y1AD 5GGQH 1CICB 1CLOL 4MD4A 4YDLB 3P9LB 2VYRE 1AR1C 4JY5H 1MRDH 1TQCB 1UWGL 1FRGH 2I5YH 4NFDA 3TP4A 4HC1H 3FO0L 2QKIA 2YEZB 3KYNB 3ZT6A 3L3KA 5KSUB 2EDWA 3O8XB 5DFTA 4FP8L 3LZFL 3C60A 1R3HB 1OP3H 3QUKA 2L7UA 1A8JH 2JIXB 1VESA 5I66B 3BZEA 1FL3B 3KPTA 4OLUL 4HS3B 1CXKA 4R9HA 3S88L 3SQOL 3VWKD 3MLYH 3BW9B 2EIDA 1BQLL 4IIQA 3W0WD 4ONOA 3LV3A 1KIUA 3NIGF 2VLKD 3VD7A 4LLMB 3VFPA 1KIQA 4HPOL 3ARGB 3TBWA 1WVZA 2VDQH 4BFBD 3JXAA 4P2RB 4WTZA 4YBLC 3U46A 4F58L 4JQVA 3K4DA 4PB9H 2EDNA 3QDJA 2OL3B 4EI5A 4M7ZC 3D0LA 4BKLB 4R7NB 3GK8L 1MHHA 1CFSB 3O6ML 1AP2A 1K5NA 1AD0B 4K3JH 4HFWA 2A6DA 3TESA 1ITCA 1I3RB 2O5YH 4X9FA 4XP6L 1AI1L 5EO9A 3KPPA 5CS7A 3TNMA 4J1UB 2FJGB 1WAAF 4OZ4A 2DLTA 2I9TA 4HXAL 1JPTL 4P23B 1QA9B 1XH3A 1U42A 2GI7A 5D2NB 1RU9L 4NFCA 2Y1VA 5HGAA 4YIQB 4EDWH 5GS1B 2G60L 2LU7A 5I1KH 5AD0B 4KY1L 5K9QG 4OZHB 4JPIB 3RY6C 4YFLF 3IJSA 4LASL 1K3ZA 2VXTL 3DVNA 5INCB 1I1CA 3UTQB 1UZ8A 5L6YH 2NY1B 1IT9H 3NH7H 1S9XB 1ZVHA 4ODSH 1AKJA 1BVZA 2PXYC 3HCVB 3MXWL 3OKKA 5EZOL 1UM5H 2OMNA 5E6IB 3E3QE 1J1OH 1A4JA 4XX1G 4X6DF 2Q86B 1QR4A 1XGPA 3O6FC 5I73B 4U1KA 3RVWC 1MIML 3GMRA 1A7RH 3QNYA 1ETZA 2VXUH 4MQ7A 1BIHA 1NFIB 1JV5B 3QT2A 1LEIA 4GUPB 2BHYA 2Z92B 2AJYL 3OKEA 1O5DT 4M3JA 4K7FA 3CFEB 4HS8L 4PJGE 2V2WA 1OLZA 4P2OA 3SDCC 2PETA 5DHVB 3O2VH 4HHAB 4PP2B 2HJFA 3S36L 1ES0A 1OF2A 1C1EH 5HVWA 2CO7B 2DLIA 3RA7L 5JIPA 3ARQA 2DTMH 2B39A 1G84A 3BXNB 3T8XA 4RBPH 2OI9B 5EFIB 2Z31A 5IM7A 3CFCH 1ZV5A 3UJTH 2NW2B 5CHNA 4KK8D 1JRHH 1NC2D 4GS7C 3STZB 5EBGA 1CICC 4NCC1 4YDLC 2CUHA 2PYFB 1R3JA 4UILH 4KRPB 1TQCC 2DQEL 5EUOB 2GJZB 2CIIB 5DWUH 4B7IA 4RNRA 5EB9A 4Q7DA 5F1SA 3OAUH 2KH2B 3KVQA 4BFGA 3LKRA 3QXDB 1MHPL 4G6KL 1CK0H 1WZMA 3DYPA 3REWA 1X5HA 1I9RH 1IGYB 3FOMB 1UJ3C 3D48R 4GW4B 4C54A 1U0QA 3HPJA 4HUKB 1OTSD 3FFCD 4XGZA 2KPNA 4M6NL 4HCRA 1LGVA 2BNRB 3TCLB 4QXGH 4D3CL 1JYNA 5ANMA 3DETD 3C8KA 3IXAA 1BJMA 5E4EB 1YEIL 4GRWE 4LKXA 2ARJB 4PJXE 3QNZB 3F7QA 2ZCLH 4J2XA 3ARGC 5DSCA 4YBHA 1JK8B 5C3TA 3KNBB 2B4CC 3HRPA 4R4BA 1RZIA 1JNHB 1H15B 3OL2A 1T3FB 2A0LC 5CILL 5H35B 4ONGL 3FQRA 2ZOLB 1DL7L 3QRFM 1TJIH 2VQTA 4GLRI 4AYFA 3LHPH 2YD8A 3RWJB 1EO7A 5CSZB 1C12B 4QY8A 4XVJL 3TPUB 4EN3D 3LKOB 2A77H 3PV6B 1FORH 3S4SA 3GMPA 1UJTA 5JMRA 1RJCA 1T83C 5A1AA 1CTOA 2RFXB 3LDBB 4XPBH 3SE9L 3NCJH 1CXFA 5D2NC 1N2RB 2GTWA 3EZ8A 3I9GH 5GS1C 2YXFA 2YD1A 4I0PB 1HXMB 3PWJB 1U3HD 3GO1H 1KEGH 4Y4HA 3SDAC 1F00I 2XWBB 3BSZL 4M8VA 3A67L 2XQBL 1FFPB 3L7EB 5B8CB 5FGBA 2FBJL 4NPYB 4W4NA 1ZTXH 1SEBB 1U93B 4L1HA 5CGYC 4N90D 3EYOA 5CBEA 5JO5A 1X5JA 1I8MB 4DZBB 2H9GA 4P3CH 5CEZE 2GSIA 3KPSE 2GT9B 1JIBA 4JFEE 5EIIB 5E6IC 3IDIB 5SWSE 3MRDB 3UTTB 4E5XB 3P9WB 4G7YH 1RPQA 4GW1A 4MWFA 4I3SL 1FO0A 3EYQC 2YD9A 3E1F1 5MEPB 2P8PA 1NBQA 5IIEB 1IQWL 5FF6B 2VITA 2X4UB 3OJDA 3WNPA 1F8TL 1KOAA 4C58B 1MRFL 4KJWC 3V4VL 4TRPH 1SEQH 5D7JD 2NY0B 2DI8A 2HT3D 1FGVH 1XR8A 2AKRB 3CVIL 3I6KA 3U0WH 4IDJH 4KDTA 1XIWD 4OF8A 5KTEL 1AH1A 3TJEH 1IAII 4HKZA 4ORGA 3QJFB 4YHMH 1KB5B 4E0RA 4RFNC 4Z9KB 5IWLA 1EDQA 3N06B 4PV8B 3JWOH 1EVTC 2Y72A 2NYYD 3VGDA 2IPUG 4UTAL 3MUHL 2XY2A 4KKNA 5C0AE 3RUGB 3JTSB 1MLCB 2WWMC 3BDYH 3RIFK 4ZS7H 3GJFH 2M8XA 5ESVA 2VSCA 5IF0A 4QEGA 4NO0B 1T21A 3LMJH 4DFHA 4JM2B 4E9LA 3THML 4TTDD 5KSAD 4LSVL 3RZWA 4OCMC 3K8KA 3X12B 4HCRL 1UEMA 3F58H 2ESVA 2VLJB 5IHZB 3O81A 2ITCB 1IRAY 2W60B 1EGJH 3QH3B 1CTNA 2XXCB 5AZEL 2IQAB 4I18B 5IVOA 4LSTH 1JHTB 3VFRA 3CU1A 5DRNA 1NBZB 1TZIB 4X6BA 2DQDH 1FBIH 1F45A 5EULV 1NEZA 4XPHL 5T1MB 5IW1A 4NKMB 1RUKL 4R26L 4M7KH 3GI9L 4KAQL 2EIBA 2P8LB 5H37G 3WFEL 3KYMB 2IG2L 3HZVA 4MJIB 3DECA 4DQOL 4KZDL 1FHGA 1W8NA 3RPIA 2GTZB 4KRMB 1IEBB 2CMRL 5IHUL 3O3BA 2IJ0C 1UA6H 1KGCE 4P46D 1FIEA 3NFPA 1NMBH 1GGCL 4U6XA 3VRJB 4R0LA 2CJUL 4L9LA 2R4RH 2QQQA 2JTDA 2NY2C 3OAYK 2MTPA 3V0WL 4PTTB 2VZ3A 3HC3H 4I0PC 3QEHA 4JG0H 4KHXH 4NGHH 5I8EA 4GG6F 2IFGA 1OWWA 2X4RB 1OCWL 3WMSA 4RWYL 5HY9B 4OLWH 4HQQL 4QHUA 1ACZA 5GJSH 1MOEA 3C6SA 4TSBH 3TIDB 5ACZB 3DUUB 3CK0H 1OSPH 1QSFD 2MQCA 4GKNB 3SBWC 5LWYH 4I4WB 1XF5A 4XBPB 3SN6N 3MRCA 1H5BA 1BOYA 1BBDH 2YC1A 1FO0L 4BKLA 1FAIL 1JHKL 5HHOB 2EYRB 1X6NA 2D0GA 3TVMC 1HNGA 3SKJH 5LCVL 1N7MH 5IOPB 2V2TB 2AK4E 1F4YH 1YEHH 1WT5C 2I9LB 1QYGL 4WI5A 1B4RA 2K7PA 3VXRB 2DIJA 4OIAA 2MKWA 4PY8J 5T3ZE 4P48A 4XXDB 2WQ8A 3QEQB 2FECI 1L0QA 3QIUD 1BVKB 5J13B 25C8L 2VZSA 4HPYL 4YK4C 3T4YB 2JJSA 3IU3A 1R0AL 2X70A 2NY0C 4Z7UB 3FRUB 4OGZA 2NZ9D 1XEDA 4IRJD 4HS6A 3WO4B 4JLRA 3IFOB 1ZGLP 4PJ9A 2C3HA 4JO1L 3OKDB 4BZ1H 4NQCA 2FO4A 5C2BH 2ED7A 4WWID 5JW3L 2ICWA 4S1RH 5C0NC 5E03A 4FQCL 1CE1H 3MRIA 4XNXL 3BKMH 3GMNB 2BNQA 2H41A 5E5MB 3SJVE 3SDDC 3ZT7A 4TOYL 5IVZA 1LWRA 1LP9E 3VXSE 3GBNL 5DI8B 3RTQD 4YUEL 5FYKU 5BQ7A 5HBBA 3ZTNH 2CRMA 3LN5A 2EYSA 3RAJH 3OPZH 4WTWA 2Q3ZA 5GGSY 3CDYA 1BJ1H 5F7HA 1DEEB 1A22B 5AG8A 3FQWB 5K59F 1EAJA 4HMDA 2DBLH 4OCRL 4J3UA 1SJXA 4JY6A 3CFKA 4DZ8A 5CJOL 3VXPA 3EYSL 1IGCL 2FATL 1AIFA 4FQIL 5KANI 4I18C 3A6BH 5F88A 3VGEA 1X44A 4ZXBC 4XPFL 3QIWB 5HHMD 3X11A 4Z7VA 2WBJB 3C60D 4PJHB 1QLFB 3STBA 1I8IB 3NFSH 4KJPC 1RULL 5TE7L 1K9TA 2VWEC 3MODH 3V5DB 3HPLA 1PZ5B 2XKNB 4EN3C 2OR8A 2ID5A 5I1LA 1P5UA 4IOIA 2AI0L 1OGTB 3CD4A 4OGAD 3NIGE 2JELL 4C59B 3O0RH 4WDIA 5CP3A 1YDPB 5B39G 2R56L 2EDLA 3MCLL 4LIQL 3WLWC 3FFDA 3LY6A 2FD6H 4JREC 4WIQA 4OKVA 3BP4B 4M7LL 2P48B 3A0OA 3KPOB 5IESH 3QDJD 4EI5D 3QXDA 5JZ7C 1NC4D 1UCBH 1YEDB 1O7SA 5HGBA 5HYJA 3PHQB 4F33B 3QDME 2BOCB 1CFQA 1G7QB 1EIBA 4Z77A 2UWEB 3PHOA 5F9WB 2NY7L 4HK0A 2AJZB 1XGUA 1DQDH 5MI0C 2C4XA 1A7QL 2MHAB 2X9WA 3TV3L 1ZT7B 4H5SA 3LRSA 2J88L 3PDOB 1BM3H 1V3LA 1WAAE 4X6EA 4HGWB 1UWXH 1M71B 3U4AA 5J3HD 3OR6B 3UYRH 4BH8B 3WJJC 1MEXL 2QHRL 1NANH 3C5ZB 4ZOAA 3SDXA 35C8L 4WFFE 4KQ4H 5JPNA 5SWQA 3TNNB 3OB0H 4NQSB 4JRYA 2XN9B 1DQJB 5CINL 4YDVA 3C6LA 1GGTA 2BCKA 5E7FA 4ETQA 3H9SD 2BC4A 1EXUA 3O45A 5FYJU 3UTZB 4XTRC 2QQKL 4RMUA 4L3EB 4N9GB 3RHWK 1CQKA 3MLRH 1XCQA 2V17L 3B2UC 1AKJD 3I3EA 4FQQA 4AIZA 3J7HA 5J13C 3V0VB 4X6DE 1Y6NR 3G6JF 4Z95H 2FIRT 3NZHL 3BEVB 4Y1AE 3NGBB 3HNTL 4MCZA 2GAZA 4N0UA 3MV7B 4Q9QH 5JHLH 1UACL 3K80A 4IMKC 3CAFA 3PWVB 4CVXA 5EBWA 4OUOA 1JN6B 4JB9H 2Z35B 1R24A 2BSRB 2DQIL 5HGGS 2NTFB 4KJYB 5B8CA 1DQML 3AAZA 4CL7A 1FZOB 1ONQA 4MQXC 3DI2B 3LKPB 3PJSB 4BSWB 1M4KA 1CI5A 1OAKH 5E8DH 3HC4L 3LD8C 5I16B 2BXYA 1A6WL 4L8DA 1JRHI 2H45A 2Z31D 3B9KC 4XWOD 1TIUA 2VLKE 3STLA 5M94B 5C08D 2KDGA 4M8QB 5CKGA 1BFTA 1QPPA 1BGXH 3GJFB 2P43B 1JGUL 2MWCA 2E6JA 5DTFA 5FA4B 2V9RA 4DUVA 3I3BA 1VFAB 3PABA 1F42A 3VJ6B 1U2HA 4MAYA 4ZFOA 5IBUG 4KKLC 3BP6B 1BX2A 1F02I 2R69H 3QIWC 1JZ4A 3TZVB 2WBJC 1J5OH 3FQTA 5F3HB 1EUUA 1KLFA 4CVZA 4G9FD 1EA9C 4E42A 4WU7B 1YYLL 2O5XH 4ZAKB 4GRLB 3HRZA 1A3RL 1WC7B 4JCMA 4ZTPH 1ODAA 4ODUB 5I1CH 3O3DB 4OCLC 4XP9H 1Z6JT 3WNOA 1EHLL 3UDWA 1QSEA 2NY4B 4FMKA 1FFNA 3OG4B 3Q6GH 5HYSA 4AEEA 3FCTB 4PRAB 4WWKB 4XPAL 1JGDA 1Y18A 4UQ2A 4Q2ZA 2XZAL 2PTUA 4M1GL 1OB1B 4X0KB 5FO8A 5B38G 3W39B 1LO5B 4ONHB 4I8DA 3NABH 3U79A 5K93A 1DUZA 4Y16A 1KN4L 5TDPA 1L7TH 3VFWB 2A73A 1KJ2A 5DXWA 2UUDK 4H88L 3QCTL 1P9MC 1AXIB 4F9LA 3B3IB 3X14A 3QPXH 5F6IB 1ZA6A 3M17A 4WFED 4LQFH 1GC1L 1OTTD 2BFVL 1MJUH 2KKQA 4HC1A 5GGVL 2VDLL 1FDLL 4DW2L 2W38A 1LO4L 1P4LA 3MLZH 5F44A 1H3PL 4FFWC 1YNTA 4P5KB 5KVDL 5BZDA 4PV9B 4FTVE 1FVDB 2CKBH 4HJ0C 4LEXH 1S7TA 5E2TL 2HVKB 4XH2A 1QFHA 2GHWB 2W92A 2MQ0A 1LO0H 4WI3A 3RWDB 1OAXL 2YPLD 4Y4HD 4ZUUB 2VE6A 2B1HH 5ISZB 3EFDL 5FCUH 2P8LA 2VDOL 4NO3A 5ILTL 1Z0NA 4OT1H 4PJAB 2W65B 12E8H 1QFWI 3VXTB 3DUHA 1AGBA 1MWAH 4LGSB 1NH6A 1JZ5A 1IEBA 1FYTA 3V4PL 2DM2A 4W81A 2ATKB 3QDGA 4K8RL 1DBBH 4Y5VA 4NYLA 2AS5M 3AS0A 4M48H 5ESQA 4YDIL 4QXWA 5ITFB 1TNNA 1F13A 3R06B 3BEWB 4LLVA 1U91A 1F3JA 3NAAH 4OLXL 3NGBC 3PWNB 1TPXB 4LHUG 3IKKA 1QSZA 1BZ7B 1KPUA 4Y19B 3RP1A 4WV1C 1YPZA 5CGTA 3HE7A 1F11A 2AV1A 3OX8A 4LKCB 4TVPL 2XICA 3RTQC 3AU1A 1Y0LA 3SKNA 2DN7A 3GGWA 4TUKL 2DBJA 4CMMB 3S35X 1OGAB 5J57B 2EIZA 3OKNB 4JDZB 1D7FA 5KVFH 1AY1H 1CDBA 2HVJB 4ZUSA 3CPLB 4PRDB 3FHAA 1MCBA 1GZPA 3BRDA 2CDEB 1R3LA 3BHBA 1PEWA 2VLJE 1J8HE 2A38A 4I77H 3EJYC 4ZFOL 3GBML 4KQ3L 5IVNA 4CN6A 1MCSA 1IC7H 3AC0A 1RHHA 5IFHH 3MBEB 5D8JH 2AJ3A 3AREB 2YSSB 4IOSD 3LAFA 4HUMB 4XXDA 2ED9A 1PQZA 4OZIA 4NQDE 5DD3L 1J05B 3B43A 2VUOA 1NLDH 4WUUE 4HT1L 3TO4D 3KJ6H 1D5MA 3DV6B 1FFOB 5A2LH 1OM3H 2ESVD 2EDHA 5GISH 3ZYJA 4CADB 5E5RB 2NY4C 4IOFC 5KAQG 4QWWD 2YD4A 4F7EB 2HG5A 3IDJA 4AQOA 3CSPA 2XPGA 3TYGH 4WWKC 4JQVC 1UG9A 5C0DA 4F9PA 1WUNT 1RZKH 5ALCL 3FQNA 3CDGA 3FB6B 1HYRC 3K4ZA 1B0RA 1KJ2L 4LNRB 5HVHB 1S9YA 2P8MA 1R5IB 5C0IA 3I2CH 3WNKA 1JGLH 1K8IB 5JPMA 1MCRA 3MLVL 5FKPB 2BVPA 5F7DB 1NSNL 2I5YL 5GIRA 4L29B 4HC1L 3HUJB 3HI5H 4XC1L 4ZDHB 1T2JA 5FV1L 1A3LL 2PCPA 4LOUC 4D9RE 1RIVH 3FMGL 5ECJE 5IUSA 1WEJL 4HIEA 2BK8A 1AHWA 2EDFA 3DRQA 1EJ6A 3BISA 1G7MA 3KR3H 3WL9B 3BPCB 1BVLB 2W0FA 2OTUA 4PY7B 4BQCA 1D6EA 2NY5H 3MLYL 5E08H 1N59B 3PQYA 2YPVH 3ZSTA 3O8XD 3BDXA 3L1OH 4XNUH 2W9DH 4GG6E 2JIXD 4NNPH 1YMHB 1E4WH 1ZWIA 4NC0B 1G9MH 2F53A 4UTBL 3ILPA 5D7SL 1L0XA 4LPUA 2XRAH 5ADPH 4K3GA 4QRPE 4LRNL 1Q38A 1JPFB 4KUZL 1LE9A 4U1HB 3VXRE 5CEXB 1KCKA 2AVGA 4GQ9L 3RVUD 4GT7A 1OSZB 2A74A 5DURB 5TPWH 2R0ZL 3BVNA 1IM9A 3WS3B 4OTXH 4K3JL 3OKMB 4R3SA 3LPFA 3QUZA 3HNSH 4QOKA 5FKAA 5FUOL 4KTYA 5KS9B 4XI5C 5CZVH 5MHSD 2LTQB 2VH5H 4GG8A 1AXTL 1S9WB 3P4LA 5FO7B 4P2OC 4TNVF 5I1DB 4U1JB 3CFJA 2AEPH 5E94B 5DC9B 2Z8SA 4M43L 1XGYL 1N4XL 3BPLB 1Z2KA 4PGCA 4WHYG 3TN0B 4HGWA 5EOTB 4DTGL 5IHBA 3B2VH 1VPOH 5DYOA 1HEZA 4P23D 3IRZA 1EHAA 5I8KH 4AG4L 2QHLA 3SE8L 3ROLA 1FLRH 3SY0B 4KKCD 1NDMB 3IRPX 4M02A 5ICZA 4XC3L 3R4DA 2P5EB 5IW6A 4PJFA 4M7LT 3KDMA 4FZ8H 2FLRT 4NQCD 3OHXA 2V7NA 2ZNWA 1RV6X 2F9BT 3GSRB 1ZHKB 2W9EL 1NBVL 4LBEA 1X5XA 1JI2A 4MB4A 3QQ3B 4LPTA 5C0RL 2BNQD 3MBEC 3ULSB 1AO7B 3GIZL 4JDVB 3IXTB 4G6JH 4YNYB 1S7RB 4ODXA 1G9NL 2NY1D 1W8OA 3TBYB 3KPQA 2DJSA 4HGKC 4WEUD 3W2DH 4JAMA 3D3VA 1MREL 5IMMB 4IRSB 5I8OH 5K59E 2D7OA 1A1OA 2IPTL 1IBGL 1FQ9C 5D70H 3RZCB 3UZVB 3O2WH 4ODTL 2GKIA 4GOSA 1XAUA 3L7FA 4KK9C 3P30L 4WNQB 4JFFA 2GSGB 5DC0A 4HFUL 4OM1L 3DSFH 2DTML 1KTRL 4CW1A 3UPCA 1OL0A 3I50H 3VFMB 3WFDH 1QBML 4XBEL 1CWVA 1I8LC 1YJDL 1HKLL 1XR9B 4BSWA 1MI5A 5JIIA 4PUBH 4RAVB 4XRCA 1T1YA 4HG4K 3WNMA 3FAWA 5AZ2L 3NZ8A 4UILL 1CD8A 5KG9B 4Y5XB 2ENSA 2UWEE 4AH2B 1KLGB 3RY4A 5E8EA 4K94C 3SGJA 4WVRA 4M1CD 3EO0B 5KN5A 5GRJH 1LEKB 2A9ML 3DX9B 4C56B 1CK0L 5ICXB 3GI8H 1NUGA 5I1IH 2EDDA 2GJ6E 5KOMC 4GAGH 2DIBA 3KWWA 3NFNB 2FEEI 4KRPD 3QQ4B 4P0DA 4P5TB 1I3GH 4RDQG 1LO3H 4OV5B 2FZ3A 1QBLH 2JJVA 4FG6D 1LD9B 4Q9CA 2IH3B 3UBXG 5HYJD 5FGBC 4QRTA 5K9JL 3QP3A 5FYKH 4ZTOH 1MLBB 1EGJA 1WC7A 3Q5TA 3BKJH 3HG1A 4PREA 1DVFA 2CLRA 3MA9H 2IPKA 2CKBB 1A6TA 4NO2B 1NANI 3IDGA 4XAKE 4LU5L 4NWUH 1WWCA 3MGOA 1B0WA 3ILQC 4RZCA 4PIRF 1TJIL 3HZYA 3T0DA 1N5YH 5DJAA 5F93C 4M93B 3T2OA 5IMLA 3VFWA 1VACB 4TNWF 1T2QL 4C83A 1EFXA 4ZFFA 1D9KA 4U4BA 3C6LD 2HFFA 2HFGH 2VL5A 2A6IB 1IGFH 2LTQC 3H0TA 1BZ9A 3VXMB 3T65A 3E6FA 4HKXA 4XPBL 3WEXB 3NCJL 4BH7A 4DVBA 5DR5L 5I6XC 3GSWB 1DANT 3DNKA 4R97C 2OQJB 2ADJB 3RU8L 2F74A 4Z0BH 3BPLC 3UZQA 2EXWD 4LLQB 3K74B 4NRZA 2X89A 4P2QB 3TN0C 3DURB 3V0AC 3G6JE 5SX5H 5HI4C 5CJQH 3O41A 4OGYH 4NDMB 5IWLC 4H1LH 2Z91B 4XVUC 4NJAL 3LKSA 5CJBA 1RK0B 3TLRA 2BY3A 2VKXA 5JTWA 4XCNB 1C08B 1VFBA 4O5LH 1QFWL 5CD5C 1BREA 5HHME 2V5TA 3MO1A 5DJDA 4YAQA 1ZA3A 2EDEA 3QWRD 4F57H 1OD7A 4YC2C 2X4PB 2X1OA 4MXVF 4Z7VF 2YKLL 3RNKA 4HF5L 1I1YA 3OGCB 4ZFZA 2YUZA 4O58H 3RVTC 4UNUA 5SV4A 5C0BB 3CFDA 3MYZA 3FONA 4HZAA 1LK2A 4PGEB 3DROA 5HHPB 5L9DH 4O51A 5D2LB 4NP4L 4IRSC 3O11B 2AV7A 3RZCC 1O7VA 2IGFL 1UH3A 5CBAB 1N8ZA 4XVSH 4N8VB 3QDJE 2HLFD 4MAYD 5FYJH 1SJVA 4D0BA 3GZKA 1JWMA 5C0EB 4WW2A 4PYGA 2A6JA 1XGRA 1P53A 4KJQC 4YXKH 2EH8L 1MFNA 1FH5L 1G0YR 2Q87A 3JWOL 3WN5A 3LIZH<