4M8QA

Ontogeny of recognition specificity and functionality for the anti-hiv neutralizing antibody 4e10
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
127
structure length
125
Chain Sequence
QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCAREGTTGWGGKPIGAFAYWGQGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords GEP1 Fv heavy chain
publication title Ontogeny of Recognition Specificity and Functionality for the Broadly Neutralizing Anti-HIV Antibody 4E10.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 125
sequence length 127
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m8qA00
4MCZB 2PO6C 1AJ7L 4L9DA 5I1CL 4ELKA 1RURH 3SGEH 5DEGA 3FQRB 3GIVB 5F9JB 3LS4L 3H9SA 1NBVH 4RDQG 3FMGH 1CDUA 1NBYA 1WITA 4XNXL 4EVNB 2EH7L 2EYRB 1OGTA 1MI5D 3MPCA 2NXYB 1S7SB 1CGSL 3CDFA 5F7NC 3QXTA 2R4SL 4HIJA 4W6XB 3CFDA 5IEKB 4AIZB 2L0DA 5FGSA 1J8HB 5CKAA 1AR1D 1CLZL 4KV5E 1F58L 4OGXL 5I8CA 2OX5A 2W91A 1RUAL 1YECL 4WUKH 1ZLSH 5J12B 4N0RA 3WIHA 2H1PL 2UYLA 1IAKB 3L3GB 4Q9BA 3IRZA 3SCMA 2FX8L 4I13B 2R1WA 43C9B 4FHBD 1QBLH 2IAMA 4KJWC 4PD4K 3MLXH 3WFBL 1OF2A 2I60L 3GM8A 2X2YA 2R1XA 3PNWA 4Z77B 4UIKH 1JUFB 4FP8L 5IKCB 1T6WA 4HEME 1L7TL 1N4XL 4NN6B 4FZEL 1U8MA 2FHCA 4RMQA 1A4JB 4XNZC 3VXNB 4ODHH 5HHXH 4UBDC 1MHCA 2ED9A 3OQ3B 2V2WB 1BZQK 3K74B 2XN9E 2XA3A 1MIEH 2AJVL 3N1QC 3V8OA 4AL8H 3CC5A 5ANME 3V6OA 4JFFB 4NYLA 2E8YA 1ZHBB 5I18H 3PWPD 3V7AG 3I9GL 3QI9A 1S78D 2NY4B 4I9WD 1WC7B 4MX7B 4M8QB 3TNNA 5D1ZC 1A4KB 5TE6L 4BKLA 4Z78A 4ACPA 5LGJB 4G6FB 1S7RB 2CMRL 1F3RB 5E7FA 5F1KC 2ADIA 2DQJL 3FQUB 4HKXA 4JFEA 4HUWA 5JHDA 1YC7A 1RMFH 4ZUTA 1F4YL 1NGYB 2P4AB 3DVNB 3CVIH 3BH9A 5D1QC 3X14B 1NLDL 3EDKA 4OBRA 4RSVA 5DK2A 4OM1H 2PO6A 1S9YB 1G9NH 2GHWB 3SDDC 1P53A 2LVEA 4NQCE 5GRVK 4E42A 5DJCA 3O3BA 4CW1B 3I75A 3BP5A 2W1NA 3IFNL 4J4PC 1I9IL 5DURB 4K7PH 3P9LA 4X6DB 5KSBB 2HMID 2YD2A 4YUEL 1D9KA 1WT5A 2HVKB 3D85B 1TQCC 1M71B 4P23C 5C0ND 5T1KB 3O3DB 4AEIH 4D0DA 3U9UB 1NGPH 4JRXA 1Q9KA 4QRUA 4IIQA 2Y1VA 4ERSH 2CGRL 4XH2B 5I8OH 2GT9A 3LKNA 4OIIH 3ARDB 4KZEH 1V7NH 2EXWC 2VYRE 4HS8L 3OKMB 1S9VB 4OCYL 5T5NF 5IROC 2PTUA 1XMWA 3LKOB 4XPHH 1IGCH 2WW8A 1A14H 1U8OB 5D7IA 3V4PL 1OT1A 5GRYA 4OT1H 1G6RH 3MV8D 1A3LH 2DWDA 2F9BT 3BX7C 1ADQL 1A9EB 2KKQA 3NCYS 2GY7B 1RZ7H 1MFBL 1C1EL 3RHWK 2J2ZA 3ILPB 4L3CA 4JFPA 4ZFZA 3ESVF 3KYKH 3RWIB 1KCVL 3K80A 2VLMD 3QXDB 2NZ9D 4DWHA 5EIQA 1UXSB 5FEBA 1IC7H 4PRHD 3DYMA 1UYWL 4PJ9D 4UILH 4NM8H 2FX9H 1U91A 1DVFC 4JQIL 4U31A 1MI5B 1X5HA 3VFUB 2ZZUT 2J6EH 1LNUB 3V6BR 5JW5B 3IFPB 1C7TA 4OD2A 2CH8A 4NKDA 4GS7B 4MJID 3MTRA 2Y72A 1BFOA 2X70A 1XGQA 3HS0B 1R3KB 4LNRB 1UCTA 1EEZA 4KK9D 1X4YA 5K9OA 2H2SC 4FFZH 4NO5B 4NHCH 4XHQA 2ZSWB 3RJDA 1UWGL 4XP9H 3X13B 5C0AE 5E2TH 1NANH 1F6FB 1P6FA 3NPZB 3GUTA 2VLLA 4CN4A 4RIRA 4U0QB 3ZT7A 4NKMA 1A7OH 3HMWL 4NKIL 3SDDA 1F2QA 5JR1L 3PGFL 1A5FL 1CYGA 3FO9A 5HHMB 1MPAL 1P7KB 5TH2B 3T0WA 1P9MA 3SDXA 3ULUD 1D5IL 1AC0A 1MFDL 2GYSA 3C08H 1FRGL 3RZCC 1B6UA 1I1YA 4YHZL 1U93B 4ZD3H 1NC4B 3WSQL 4NQVB 5M94B 3SJVE 4E5XB 1B0RA 1A7PH 4PJAF 4KRNA 1IILE 1GRWA 2XWBB 1U6AH 5D2LB 1QUNA 3O45A 2GQHA 5EUOF 4ODXB 3RY4A 1H3WM 4IMLB 1MCWW 4X80L 2FYYA 2BVYA 2O5ZH 4HS3B 1AGFA 1G7HA 2GK0A 3TVMC 3PDDA 5IFHL 5KSVA 1G0YR 1IAMA 4LRNL 4Z7NF 2Y5TA 5F96L 1SBBA 4JO2H 3T8XB 2J88L 1WCQA 4OM0L 1UA6L 1AE6H 4ZO9A 2B1HL 4O2EB 3OXRA 4P5KB 1T1WB 1U0QA 5D8JH 5JZ7C 4IOSD 5TGBA 3MODH 3RWCB 1HXMA 3V0VB 5IB5A 4JM2C 5L0QB 3EYFA 5IFAL 1K4CB 3BH8B 4PJGA 4O02H 1CD9B 4UB0H 1I85C 1BVKA 1QLFB 5CGYD 3OXSA 3T1FB 5JLZB 4WNQB 3FT4B 2V5RA 1LEIB 1DVFA 5D5MF 5EOTB 4DGVL 4POYA 3RL1B 3K1DA 4NQTA 4S1RL 1KLUB 3O2WH 5E6IA 3HC3L 3D3VA 3VXTA 3O4LE 5HVHC 4O2CA 1CFNA 2OQJB 4TOYL 3QPXL 2ZJSH 2WM0A 3G5ZB 4XI5D 3PJSB 3DV4B 4LVEA 1AXSA 2V5MA 3LQZA 5C7XH 2VIRA 3KYNA 2NW3B 1T22A 4G7VL 4EDXB 5JQ6H 2RCSL 1U8IB 3BVNA 1MCOL 4YNYB 5DJ8A 1BD2E 5L6YL 1LO2H 3N9GL 2W0LA 1IGYB 2DWEA 1JNLL 1U3JA 3JWOL 4GUPA 2Q8BH 5D6CB 4YH6A 4YWGH 1EZVY 3DROA 1I3RA 5MEPA 1YNLL 2XWTA 4TYUA 1G7LA 3D25B 2NY1B 3MX0A 5I8EA 3QEHA 4R0LC 4AH2A 1K8DA 1LEKA 5I8KL 2AABL 3PXJA 2AXJA 3B5GA 4I3RH 2IFFH 3ARVA 4AK1A 1YEHL 1IEAB 3OAUL 5EZLA 4PJ9B 5GISL 4Q7DA 4LHUD 5HI3C 2A1WH 2BSTB 4FQQB 5L8KB 3D87B 3QT2A 3MNWA 4X98A 3GSXB 3I85A 3IKKA 4DW2L 2XN9D 4MJIB 3MBEA 1OHQA 1I1RA 5SV3A 2BDNL 2GIYA 2QQNH 2WZPD 2CUHA 3TVMA 3MRRB 1FSKB 3QHFL 1VPOH 5J8OA 3SKJH 2GSGA 2CKBH 5E99H 4DUVA 5IOPB 5IJKA 4Y5VB 4Q97A 1ORSA 4HXAL 5CMAA 4ZO8A 4IRSA 2I5YL 2MQCA 4DEPC 3MLVH 3LN4B 4LLQA 4GAYB 3IYLW 1I4FA 3C5ZD 2UZIH 3OPZL 1IGIL 5FK9A 4J23A 2WQRA 1OCWL 5C6PB 1Q9WB 2DD8H 2XG5A 3PHSA 1I85A 4PRDB 4YGVB 4CMMB 3H7LA 4HX1B 4LEOB 1SEBB 2DQDL 5C0DA 2VC2H 1MUJB 5E4EC 1CFSA 6FABL 3HI6H 1W0VA 4XPFL 5D71L 1YQ2A 1U3YA 4RMTA 1C08A 5GS0C 4NQCD 2R2HA 4M3JA 5MP6H 3UTQB 3S34H 1RIUH 1NH6A 3O6FD 2WP3T 4U1JA 5I1HH 3QUXC 1EJ6A 1QR1B 3EYSH 3ORJA 4N90D 4XWOC 2B7DT 2CJUL 3M45A 1CICC 3BDYH 4KVNH 1F4WL 4N0UB 1KXVC 3OMZA 1ZHKB 4D8PB 1I8KB 5FUOL 4ZFOL 3E6FA 3R06B 1CQYA 4ZMAT 3Q0HA 1KSRA 4YPGB 2X5PA 4NC0B 1MY5A 12E8H 5E5MA 1A2YB 1ZVHA 1NUDA 4XWGH 5IVNA 1NEUA 4UOW0 4K55A 3UJTL 5F7EH 1MFAL 2ZNWA 2K3TA 2N7BA 3U1SL 2X4PA 3MLSH 3FQWA 1XZ0A 2ARWA 1XT5A 5GZND 2OTWA 3H8NA 4JM4L 1NGXA 1QO3B 2ZCLL 1BQHA 3K0WA 3E6HA 2OR9H 1IM9B 3J8F7 2HH0H 1D6EA 5F3BB 4X4MA 4JG1H 3WJLA 2L7JA 5IBTL 1TLKA 5FECA 3PWJB 2NLJB 1RZKC 1BFSA 1UCBH 3PIQA 3V4UH 5F44A 1INQA 2B1AH 1Z6JT 1HXYB 4C54A 5F7YC 4LCYB 5D72L 3GRWA 3GMLB 5I16A 1BVLB 3DUUA 3CXHK 3KYOA 1YEGL 2DB8A 4HIEA 4MVBD 5F7DB 3KPOB 1ZT7B 5T1DH 5DD1L 1CI5A 4K3JH 3WO4C 1NCNA 5ACZA 5EO0A 1S3KL 2V9TA 1XGPB 4L29B 3GK8H 4P46C 2OP4H 5TE4L 5HHVH 4L4VE 4LPCA 1JZ2A 1JGVL 1BFVL 5C0AD 5ILTH 3HAEA 1R5WA 3PV6B 4O4YL 4P2RA 3TIDA 4XVTL 5FA3A 1XGYH 3S5LA 3L6FB 4Y4HD 5FDWB 2WLYA 2FL5B 4Q0XL 1DE4B 1JFQL 2DQUL 3KPNB 4F33A 4A6YL 2CLRB 4LHUB 5CZVH 3LQAH 4IDLA 1JWSB 1FNGB 1UM6L 4OGZA 4XRCA 4X8JA 2EDWA 4OZ4B 3VFGH 1KPVB 2XWJB 2XN9B 2MSPA 1S7XA 2OCFD 2VDPH 2JKXA 4GBXC 5ANMB 1FPTH 4OLWH 2JCCA 3BW9A 5DZNA 5IM7A 3SKNA 4M61B 1FNSL 3MOAL 3FB6B 1CN4A 3LS5H 4POZD 1ZHNA 4CU7A 3VFSA 2ZG1A 4PJFA 2JJVA 3RBGA 4KWUA 2PW1B 3LEXB 4KXZI 3K3QA 5D2NE 3U36B 3X3FH 4M5ZH 4M48L 4YHLL 2ERJB 4GOSA 1BX2B 5DZLA 4OQTH 4TPRL 2JB6A 2MQ3A 2Q76A 3M1BA 1YY8A 4ZNEE 1R0AH 2X4OA 4AYFA 2GJ6A 1DUYA 2R0WL 5DJYA 2AXFA 1J0IA 3QUZC 3WIFA 1S7WA 2W38A 4NM4L 3RGVA 4NQCB 1U2HA 4LGRB 2XTJE 2BC4A 1Z3GL 4I77H 2DQHH 2EDRA 3VFNA 3VFPA 3RHWF 1CXIA 4DGYH 3VXQA 4YXLL 4LP4A 4R3SB 5B4MC 3MRMA 4X9IA 2OR8A 4M9OA 2F8OA 4LASL 4R4FL 1A7QH 4Z7UF 3MRCB 3THMH 1ZA3A 3O4LD 4FA8A 3CVHB 4LDEB 1KPUB 1FDLL 1GPOH 4RFEB 1IQWL 3W11D 2KL6A 1M05B 1X3DA 1RUPH 3LHPH 3MV9E 4ONFH 1I7TB 2IPKA 1GH7A 4Y4FA 4OGYH 4JFQA 2A6IA 2GW5A 1ACYL 2MOVA 1RZFH 2Y7QA 5TQ0H 3ULVH 3HE7C 2VXVL 3H7BA 1VB9A 2PF6A 1M7XA 5MERB 5B3NA 4DGIL 1BD2D 3U48A 1KBGL 4EN3C 2BCKB 3O2VH 4U4BA 1IE5A 1QOKA 4RAVA 2BVQA 1EVUA 4QRSB 4UT6H 3VGAB 1MCJA 3MNZA 4LCCB 4UI2A 3VMPA 3IDXL 5DD3H 3O6KH 4OF5A 3OKKB 5F6HJ 5HHNA 1RIHH 4JKKA 3SQBA 1BWWA 1NCTA 3VWJD 4TTGA 1F6LL 4ZOAA 3NH7L 4JAMB 5C0BA 3EYOB 3TZVB 2VDNL 5I1EL 5B8CA 3BQUB 5KTEL 3MOBL 1D5XA 4YHNA 3S3JA 3VH8G 1S5HA 5CIPH 2NNAA 3CPLB 1GIGH 2H41A 5D7LE 2E5EA 4MCYB 3RP1A 1INDH 5LCVL 2RHEA 4IDJL 2RBLA 3NAAH 1HEZB 5FCUH 1YY9D 5JDSA 2CO6B 3VDBA 2YPKA 2NX5A 4DKFL 1VFOA 4FTVA 3SEPA 2HT2D 5EIVA 1CZ8H 3DGCR 2XQBL 2AJXH 3IDJA 1AXTL 4XPGL 3FZUD 1E0OB 3SGDI 2B0SH 5J57B 4V1DA 2F74A 4OF8A 2A83A 2HLAB 5KG9A 5AUMA 3SGEI 3WXVH 4YFEA 5C0AB 3NCYP 1CGTA 5K59F 3U30B 2PXYB 3HI5H 3DO7B 4LVHC 1EAJA 1C5BH 4DKEH 2WQ8A 4HIIA 4Y4HB 3ARTA 4U0RC 1IAIH 3ULVF 1A6ZA 1F4XH 1N59B 3WHXB 4NQSA 4U6VH 3STLB 1TJIL 3BRFA 5CEZH 1T5WA 4P5TA 1MFEL 4L8SA 4HF5H 3TA3D 3L95B 1HQRB 5GSVB 35C8L 4KKAD 4P4RB 3F6IA 3VW3H 2A2QT 3MRNA 5E56A 3OL2A 2FX7L 2R23A 1HH6A 3C2AL 3ZTJH 3QDAA 4UQ2A 5LBSL 4IRZL 3EOAB 4XCYB 3SJVB 5IW6B 3IAPA 3U7AA 4K9EC 5CCKH 3ILQD 4GO6B 5C0EA 1TMCB 4M93C 1J5OL 1LE9A 3T4AA 1HYSC 4PYGA 4Y1AE 1CG9A 1CDBA 3SDCA 1KIRB 1A1MA 4ONHB 3JV4A 3R8BB 5C0RH 4LCIL 3MBXH 3QUMH 4NN7C 1ETZB 3KR3L 3U0PB 4U6HA 5HPMB 5DZOA 1BLNB 4HWZA 3QHZL 4Z8FL 5SWSA 4ISVA 3RNKA 5EU6E 3MCKA 1U3ZA 3RTQD 3VXPA 4BA8A 1XGRA 4HXBL 2HFGL 4M6OL 2H26B 1JPTH 5I1LA 1FLRL 2R0KH 2V5TA 2LE9A 2DS4A 3QFDA 5DHXB 3SN6N 5EB9A 4JQXA 3G6JF 4EI5C 2ILLA 4PJAE 1RULL 3B9KA 1T0MA 2GUOA 2NPLX 1IZJA 4QCIA 3V6FB 4U1NA 1J0KA 3LKRA 3O4OC 5JPMB 3O4LB 3FO1A 5F1OB 5EUOE 1N0XL 4MJ6A 4NWUL 3FONA 1J88A 3NACH 3VRJB 4X4ZA 1FV1A 1UKTA 3QEUA 4ODSH 2IPUK 3F8UB 3C6LD 2VMFA 3O3EA 3PWLB 1GHFL 4H8WL 5ETUB 4Z7NE 3U7YL 5BXFB 5KVEL 3T0EC 2QSQA 4TNVK 2Z8VC 1TVBA 5FGBC 1B88A 4K7FA 3HG1A 1B4JH 3JTTA 2YN5A 2ESVA 2DI7A 1BD2B 3UROR 4KMTL 4M5YH 1WEJL 2ICEB 1X5JA 3B9AA 1MCQA 4QXTB 1PQZB 2ATKA 2AEQH 3I6LE 2WUCL 1OLLA 3LKPB 4CADA 4NNYA 4HWUA 5T5FL 3WL9B 1QSEE 1VADA 4HT1H 4P3DB 3VWJB 5F3HA 3KPRE 4NWTL 3MRKB 3KLHD 5I71B 3R4DA 5CUSL 4K23H 2X4NA 2OXGA 3DX6B 2DLGA 5IVXA 4RGNC 4LSUL 3ZHKA 1JGLH 5SX4H 1Z5LA 4LL9A 4CJ1A 5I6XB 2HFFA 4X0KB 2OZ4A 5F6IC 5L2KA 4LLYB 3MUZ1 5A3ID 3HC0A 4OI9A 3H3BC 1JPGB 1YEDB 5D70L 4PJ8A 2DAVA 4XP6L 2FX9L 5IK3A 3UAJC 1G7IB 2PTTA 3CFJA 1Q0YL 1ZMYA 1ES0B 4ZS6C 2R0LH 3ZLQC 1L0YA 1LD9B 2YEZA 1E28A 5DHVB 3PGCA 3VXUA 1G1YA 4G6JL 5JHDD 2AI0L 3UYOD 1FE8H 1MAJA 4OLUH 4N68A 5ICZB 2A74A 3K4DA 4FQXB 5DD5H 1JYNA 3L3OB 4HPYL 5DUPL 5FKPA 1LO0L 4LIQL 4PR5B 3T4YB 1W72B 2CIKB 1C7SA 2VSDA 5HYQB 3GGWB 5LQBL 1DLHB 3KPSD 3MRGB 3QDJA 2W9DL 3ARED 1NUGA 5J1TC 1NANI 1N7MH 1EHXA 3GJFB 4N0YH 4NJ9L 4GRMA 4P57A 3P4NB 4IBLT 5LWYH 4QRTA 1RIVH 1OSPL 3RVTD 5E2UH 5GSRA 1VACB 2BX5A 5A2KH 3T0EA 3D69A 5D6DC 3QEGL 1Q9OB 43CAA 4PRPE 4JDTL 4QRRA 2JJTC 5EA0H 1JI2A 2OK0H 4NRZA 3WUWA 1HKFA 1T1XA 4ZPTB 1T1ZA 1DBJH 1R6VA 2AV7A 5AWNH 1PFCA 1J1PH 4MAYD 5GGQH 1YJDH 2EEAA 1RUQH 1KF9B 2XZCL 3HN3A 3RTQB 3CLFL 5INCA 3VDCA 1KTDB 1G7JB 3OB0K 2NY0D 4JO2L 4HKBB 3QRGH 4ZPVB 1AE6L 4JHAL 1J12A 2OTUB 1J86A 1JI1A 1FZKB 3RDTA 1KC5H 4APQD 4LPTA 3QFJE 4YQXL 3DIFA 3T2QA 3D18A 1X5FA 2YPLA 1RK1A 2J5LB 3S6CA 3EAKA 3TBSA 3F58H 4JHWL 4OCNC 4QHLB 4H20L 4PP2A 3RWDA 3AU1B 5D7LD 5IFJB 1KPRA 4JFXB 4G3YL 4GW1A 3QA3A 3FRPG 4HCRH 1YMME 2EH8L 4HPOL 2V2TB 3ARPA 1A6AB 2ZJSL 2B4CC 4I0CC 1DJSA 5KW9H 5IMKB 2XNAA 1RUMH 3A6BL 5EUKB 1GGIL 1SY6A 4M6MH 5DQ9A 4G8IA 3KNBA 4LMQE 3U82B 1INEH 4WI8A 3OR6B 1YYLH 4JPKL 4L4VB 4OZFG 3QXAB 3RWGA 1P7QB 2VDOL 2BNQE 2YMXL 3IRPX 1EJOH 1JMXA 5HGHB 5DDHB 4JRYA 3IDMB 3S88H 4L8BB 4TN9A 5AEAA 5GPRA 3V5HB 5SWZE 2FWOA 5C0JB 3RQ3A 3PDOB 4XC1H 1Y18A 4JCMA 5F1IB 3TO4C 3GO1L 2R8SL 4F8TA 1DEEB 1KIQA 1Q0XL 2JJTA 3D0LA 2ZCKH 5JIIA 5C07A 4Z95L 4PYHA 4XNYH 5CJQH 4XMLH 1P1ZA 3L7EA 2EDFA 2AJZA 1OAQH 3MJ6A 2Y23A 2FBOJ 3FQTA 1D3CA 4EDWH 4EBQL 1TETH 1DUZA 3D39E 1NCAH 4X7FC 4ETQA 4DZBA 5I2IB 3Q1SH 3CDYA 4HWBA 3B3IB 4Y1AD 4F7PA 5D2NB 4O9HH 3WEXB 1B2WL 4UIMB 1WIUA 4Y5YC 1E4WH 1RJLA 1UKQA 1JYXA 2FEEL 4I4WB 1R24A 4JKPH 1JHTB 1QLEL 4QOKA 1CE6B 5DUBB 1I9EA 4LP5A 1FHGA 3TC9A 4WW2C 1DZBA 5EU6D 2BVOB 4CMHC 5BW7C 3AREB 2GAZA 3BDXA 4OD3H 2XTJB 4R90L 3FFDB 1JGDB 4GXUM 3ULSB 3HRZA 1Q94B 3CLEH 4K8RH 4M1CC 3R0NA 1T03L 1ZGLM 4NCC1 4HK3N 1YNTB 4OZHA 3TN0D 2VAAA 4LVOC 1JRHH 2NR6C 3CMOH 1CXHA 4HMDA 5GS3A 5HY9B 4XP5H 2V7HA 3OKLA 4HK0A 5C3TA 2LV4A 3MACH 1YMHB 5ELIA 1DQLL 1SJXA 1MWAL 4MAYB 2RB8A 3MV9B 1IEBB 1LWRA 2HRPH 3VCLA 4F7MA 3WNMA 5MEQB 4S1DD 2C1OA 3OG6B 1L6ZA 2VABA 4G7YH 5BZDA 3WS6C 3GHBL 1H3GA 1WTGT 3EO9H 3TPKA 1HSAA 4FQHB 3T65A 4XNUL 3MC0A 2NY0B 2JJWA 4W6YB 4DVRL 4LSDA 2ADGA 1KB5L 4L4TD 2CKNA 3VGFA 2YN3A 5HHQB 5D7JC 1FVEB 5FOJA 3I6LD 4UDTB 5BV7L 4APQB 4Z7VE 4XC3H 5DEFB 1MHPH 5BS0E 5ESVA 4UT9L 5IEHB 3TO4A 3JBG7 5HI4C 1VKXB 2RAMA 3KPRD 1S9KC 5KVDL 1CFVL 3VXRA 4Z7UE 1NCDL 2Q6WB 3A6CL 5HD8D 5TF1H 1PKQE 4WWKA 4N8PA 4LNVA 4CVXB 4JPWL 2L7UA 1J87A 4HZLB 5D7LB 3RX5A 3LB6D 2C4FT 4MZ3A 2E7HA 2EE3A 2AEPH 4DUXA 1ORQA 5EOQL 4MYWB 3O8XD 4Z7OF 3SDYH 5A43C 3KLAB 2ZP0T 2HKFH 2QKIA 2R0ZL 4N8VA 4X4XB 1VGEL 4ZUUB 5MHSE 1D5BA 4U1KA 4ZUSB 1XH3B 2X05A 3BGMB 3A6OA 1CIUA 2MKWA 5IMMB 1IT9H 1MCDA 5DRWB 1WF5A 3VFVA 1V3JA 1GAFL 2OSLB 2P5EA 5EZJB 5EORH 4OUUA 4X7SH 5I75B 2CDEA 2EKJA 2VXUL 2WBJC 3KS0J 1V05A 1OPGH 2EYSA 4I8DA 3PP3K 1DQML 3HNTL 2FJHA 3I6KB 4RQQB 5HJ3B 4Y16C 3Q5OA 1PX4A 4KTEH 4YZFE 4FQ2H 1IGFL 1T20B 3SO5A 2IALB 3K1KC 2Z8RA 4LFHG 2BK8A 3H0TA 3B9EA 3GMPB 5TPWH 3FB5B 3SE9L 1UG9A 4QHNB 3L5XL 2Z8SA 2A6JA 1AKJD 3VJ6B 3DTXB 3L1OL 1NEZA 4N8CL 4OLXH 3ZT6A 3MLWH 1UM5H 2PR4H 1DDHA 3EFDL 4PRPD 4P5MA 4XXCC 4Y1AB 5K59E 2YKLL 2WK2A 3LY6A 1J1XH 1U8KA 1HNGA 2ICWB 5BO1L 1UB6A 2OR7A 3ULVE 4TNVF 3MZGB 1CFQB 3G5XA 2YXMA 5FYJE 4M5ZL 2CK0H 1ADQA 2VDKL 3GBMH 1J0YA 4PRAB 2BY1A 5EU6B 4ZAKC 4QYOA 4LRIC 4YHYC 4OQ1A 1H15B 3D48R 1NC2B 2V2XB 4JR9H 1XR9A 5MENA 1JN6A 1RQ5A 1MRCL 2X9YA 3I6GA 4FQJH 1KEGL 3ETBF 5HDLA 3OKNB 1KACB 4KK8D 4ESKA 1Z9LA 4P3WA 4PJAB 3SDAD 2DI8A 1S8DB 1N8ZA 1ZWIA 3BHBB 4UINH 3BEVB 4PB9L 3N06B 3QFJD 1SYSA 5EUOB 2ATPA 3KXFE 2VLJE 2QQQA 5C08A 5HGBA 5ICYB 1L9NA 2YC1B 4EOWL 3MRQA 3BAEH 5DD6A 4OZGA 3QO1B 5TE7L 5DMYA 1Z9SA 1BOYA 5FYLL 1IC5L 4JN2B 2E6PA 1YMMD 3T2OA 1NQBA 1DQQB 4KKLC 3BI9X 4MA3B 5C0CE 2EECA 2HFEA 2BSED 1BZ7A 4JPVL 4ONFL 1RZJL 4MGXA 1GOFA 1EX0A 3WNNA 1X7QB 3F5WA 4KY1H 2AEIT 3IXTB 4PRNA 4KQ3L 1FL3B 1ZEAH 3JWOC 1NGZB 1UFUA 3ARBA 4PRIE 5E03A 3W9EA 1NCBH 2YPVH 4NUJB 2WMPA 3SKMB 2R4RL 3G6JE 3KYAA 3LD8B 4P4KC 4NOBA 1UQSB 1QSEB 3OB8A 2BSSA 3KPRB 3S36L 4KMLB 4QHUA 1H3XA 4MWFB 4JZOA 4JDZB 1DANT 4U7MA 4FOMA 2BNQD 4F8QA 4J1UB 4K71B 3P30H 3OX8B 4JZJC 4RGMB 1GL4B 3BZFB 5HVGB 4LCWA 4TULL 5CD3A 2FBJL 5HYJE 5SWZD 5JPNA 3G6DH 3IB4A 5CAYB 5I76A 3WNOA 1OB1A 1X5ZA 1R3JA 4YFDB 4I2XE 4OI8A 3EBAA 2AKRB 4R7DB 1WWCA 2AXHA 1WGOA 2PYED 3S37H 2Z31A 2LTQB 1QRNE 2OI9B 2ZUSA 1INDL 4UV7H 1FZMB 3H42L 4OF7A 3KWWA 1V3KA 2HLFD 1T5XA 3IU3B 3WFZA 2APVA 4TUOB 3TBYA 4G9FE 2FH6A 4JFDA 4MXVF 2F5BL 1E6OH 1R5IA 2P47B 4LDLB 3TH4T 2D7QA 3ZKNC 1XGTB 3QZWB 3V5DA 4FFVD 3N0PB 5IBUB 3RGVD 1TZIA 4PJDE 3N85L 1NCWL 1OAKL 4YHOH 4DKEL 1MRFH 1IC4H 2HTLD 4KUZH 4HV8A 3ROOB 1KN2H 3IT8D 2X4QA 3FQXA 3GDBA 4JM2F 3CK0L 4FN0A 4KGJA 2FLBT 4HW6A 5J7CC 4XBPB 3NFPA 3LV3A 3ARRA 1CF8H 1IAII 4XAKE 3AXLB 1OAXH 3RVUC 2D9QB 1KCSH 1P4LB 4PRPB 5BMFL 5CZXD 3FRUA 4W4NA 3FB7A 3MNVA 3GMOB 3W9DB 1GSMA 3P0YH 4HG4K 1K2DA 3MGTA 4OKDA 4WEBL 4UTBL 2ADFL 3ARFD 3GRWH 1HHHA 4U1GC 4RFNB 4HC1L 3G6AA 5DO2D 3E3QC 3H9HB 4RRPA 2V7NB 4D3CH 5ACMA 3PV7A 1AFVL 5ISZE 1KELH 1FZJB 4MSWB 4J3VA 1BQLL 2DDQH 3HB3C 2R2BA 3L3KA 4ZYKB 4OGAD 5E5RB 3RWFA 1IZKA 4WUUA 1YNKL 4TSCH 2AK4E 2DTMH 3UTZA 1E4KC 3MROB 4WDIB 2FJFA 4YHKL 1FH5L 3GIZH 4XGZA 5DJXB 5GS0H 5BS0D 3T3MF 4HJGA 4UV4L 3GSQB 3QFJB 5E8NA 4GXVL 1JF5A 2EZ0C 1HHIB 2PKDA 4G5ZL 3S35L 5JOFA 1FFQA 2Z35A 5AAWA 4UTAH 1KG0B 1RK0A 2NX5D 3TBWA 4YIQA 2KBGA 4NBXB 2ARJB 1YMMB 1DBKH 4XMKH 2CKBB 4YHPA 4O51A 4ZXBB 3WDIA 1JZ3A 3O0RL 3TNMB 1VEOA 2VOTA 3F12A 5EU3A 1K8IA 2PETA 2YUXA 1BBJA 5I73C 4LSQL 1WBYB 4M7ZC 4N5ED 2D7OA 5GS2H 3FFCE 2VWEC 1JWUA 4G8GE 1FBIL 4RX4D 1H0DA 4KKBC 1CT8A 3VH8A 5D7KD 1IRAY 1LDPH 2EDNA 3TBTA 3JTSA 3EDDA 3GJEB 3BJLA 4Y2DD 2BNQB 4MQSB 2N7AA 1YN6A 5JW4Q 1JK8B 1GZPA 1WFUA 2Y6SD 4KHXH 4ALAL 1U8HA 5I19H 3TH3T 4PGDA 4YO0A 4K7PX 3S7GA 2XQYG 2HG5B 4D0BA 5SWZB 3HR6A 5EO1B 2NY2B 4DQOL 5J6GB 2NTFB 2X44D 1KTLB 4GSDH 4AMKL 2MCPL 4QRQA 3VWKC 4MNGA 3HTLX 5CD5D 1BBDH 2VSCA 4HWEL 4NQDA 3BN9C 3T0AA 3VA2C 5FO9A 2HN7B 2B5IC 3FT3B 4BFGA 5FM5M 4ZFOA 3H9SE 4PLKC 5IQ9B 5CJOH 4KTYA 2VE6B 4H5SB 2DKUA 3U46B 5I74C 3FT2A 4Z7WA 5KVGL 3D39B 3MLYL 1FG9C 4QXUH 5HPOA 1E27A 2D7PA 1HKLL 1FNAA 3RNQB 4HKJB 3WLBB 5L88H 3IDGA 4N5UA 4NT6A 1UM4H 5SX4I 5FO8A 2R2EA 1R5VB 3IDNB 4B7LA 4HFWA 2IG2L 3UBXG 1B0GA 4YHIB 4YX2L 3T09A 4ZFFB 4Q9QH 1RFDL 2O5XH 5FYJD 5EC2A 1E4KA 4OLUL 4F9LC 1YPZA 3U9PH 1KIPB 3PP3H 5E8EB 5E8OA 3KPQB 5A16A 4P59H 2ENYA 4WI5A 5C2BH 1SEQL 5GJTH 4HUXA 3CGTA 5ESAA 5A2FA 4CAGA 1I1FA 2BNRD 1VSCA 4HMCA 1AGDA 1I1AD 1LEGB 1FO0L 2F54A 3UJJL 2A9NH 5E8DH 5AG8A 5C6TL 3PF2A 4HIXH 4H26A 4I48B 4Z0BH 4AG4H 3DMMD 4JDVB 3KJ6H 1IC1A 4LBEA 1QNZH 5TF0A 2LU7A 5IR1A 1F3JB 2ZUXA 1EXUA 2GSIA 2NY6D 4YFLF 5D93C 5FO7B 3KXFD 5E8PB 5MEOB 4M7JH 4QF1B 3ARFB 4N9GA 2DJSA 2H3NA 3JXAA 2BOBB 1WBXB 2AV1B 4Q6IC 5GQBA 1FFRA 4JPIA 1DBAL 3RWJA 1EO5A 4YDJB 1NMBL 3DETD 4BH8A 3GI9H 1TQBB 5HDQL 3ZL4L 3HR5A 4YGAB 1UADC 4B0MM 4AJ0A 4E0RB 2EDTA 4G8FA 2CLZB 4Y8AA 1MIML 2NW2A 4A6YA 4YHML 5K9QI 4URTB 1QBML 2GEEA 2DBLL 5LGHH 4JFEE 1R3LB 4LHJB 4ODUB 4PRID 1TVHB 3INUH 2IBBA 3DVIA 5CJ8A 4CVZA 4Z7VB 1VEPA 3WIHL 5BS0B 4FQ1H 3SKOA 3PGDA 4YK4C 3VWKA 1RZIA 1MNUL 2DMBA 4JY4B 2A6KB 4HUKB 4NP4H 1XIWD 4Z7UB 2DYPB 3TJHC 3ARWA 3R0MA 1HINH 1OP3K 2QADC 4YDIL 5SWQA 3F7YB 1PKQB 4RMSA 3OKOB 5FKAB 1OOAA 3VFOB 1NFIB 4OLZL 1Z9OA 4WTXA 5HYJD 5IVZB 1BWMA 4X4YA 4QHMB 3QIBD 4BM7A 3ZYJA 4PIRF 1ZTXL 5EBGA 2EKSA 4GRWH 2JIXD 5J4MA 2YUWA 2EDLA 3GMRB 2Z91B 5GGTL 3ZDZE 5I1AB 4XHJC 3L3IA 4UUJA 2YK1H 2ZUTA 3QULB 4QTHB 1A7BA 3H9ZA 3ZTJG 3QIUB 4MZ2A 4MD0B 4F9LA 4JJ5B 3V0WL 1CTOA 4TNWK 1WAAA 3BWAA 3MLTB 4XZUA 1Q9LB 4G9FD 3ARUA 4Y2DB 2R15A 2E3VA 2OMNA 4PGCA 2QSCL 1Z0NA 3B5TA 1AO7E 1UXWA 4U6XB 5J1AA 3L7FA 5FDYA 3P4OA 3QO0A 5CZKA 5IB2A 3EGSB 1OAYL 4U6YA 3GMQA 1MJUH 3RA7L 2GTZB 4R4BA 3VXME 2MQ0A 1ZVSA 2AJUH 4KI5C 5CKGA 5GS1B 4EUPG 1BM3H 1FVDB 4AENA 2BRRH 1NGQL 2D7NA 4Z7OE 2E9IA 1MCHA 3ZSTA 3P77A 3PDGA 5ALCL 1M6OA 4S2SB 4UU9A 1ZA6B 3BT2L 3IDYB 2GCYA 3MCG1 1WZMA 1BGXL 3LIZL 3SE8L 4YPJA 3CFEA 1QFWM 4XAKD 4OCMC 2VLKD 4JFHE 1QQDB 3MOQA 1F02I 3OSKA 4XP1H 5GRJL 3ISWA 3FQRA 5F9JA 5E2WH 5FM5O 1NCAL 4GRWF 3MXVL 3WKMH 5AZEL 4EVNA 3L5HA 3T08A 3WD5H 3NBNA 2EYRA 3DHJA 1IARB 5H94A 2X1WL 5IEKA 3ZDXF 1HI6B 3DYPA 4AIZA 4Y4KC 5ISZD 2P5WE 1L0XA 1J8HA 2YR3A 2QHRH 3HC4L 1U8NB 4MLIA 4Y88A 3JV5A 1EO8L 1IAOB 1I1AB 3MJ9A 3RWEB 5EO9B 1IAKA 4EKXA 1IQDB 4BFEA 1P69B 2AK4D 1G9NC 43C9A 3SGKC 1CGYA 2HT4C 3DMMB 4NN5B 5F9WB 2VR4A 5F9OL 5CIPB 4XVUD 4GG8B 1CLYH 2HT3C 4PG9B 1A6TA 3QUYD 4CVUA 1MCWM 3WS3A 5I66B 1QSFE 2NY6B 1JUFA 2VLJB 5IKCA 1OTSC 5FYKL 2BY0A 2OZ4H 5C0GA 4N9OB 4S1QH 1A4JA 1OM3H 4H8WC 3MRJB 5ICXB 3RKPA 4PJCF 4V2CB 5DUML 4HKZB 1T4KB 2ZNXA 3HPJA 2V2WA 2VDLL 2Y25A 3WN5C 3RI5F 4P9MH 3ET9F 1AH1A 3O41B 3GI8L 3RVXC 5C0CB 4JFFA 1ZHBA 2DQFB 5GGRB 1CE1H 1JRHI 3T77B 3OKDB 4PJEA 4HFUH 4PRIB 4G8GD 2C3HA 1WC7A 4M8QA 2DJ4A 2FJGA 3G6JB 5F97E 1KCRH 1DCLA 1A4KA 3P73B 5BVJB 3DVFA 2CIIB 5T3XH 4GAJL 5LGJA 1KYOJ 1S7RA 2X4UB 4TUJB 1AR1C 3U0WH 3NCJH 4K3DH 3FCTA 3FQUA 3W5NA 1DP0A 4RMRA 4KK6D 3MRFB 5KSAD 3S97C 5HYJB 3TPUB 5DSCB 3DVNA 3HMXL 1LK2A 3X14A 3MLUH 4LSTL 4RNRB 3HLAB 5CJBA 5H37G 4I2XB 5E2VL 1S9YA 2JIXB 5CHNB 3EHBD 3QWRD 2NCMA 1OARL 1QRNB 2L4OA 5DQDH 3ELAT 5IVXF 3LN5B 3MJ7B 4KGLA 5IV2B 5KSBA 1JNJA 4PJ7F 5GRWA 2DIBA 4PGJA 1AGCA 2HVKA 3D85A 1M71A 3O3DA 4G9FB 4Y4KA 3K7UA 1N3NB 4XH2A 1IKFH 1KNOB 5K9QG 1LMKA 1S78C 1I3UA 5BVPL 1DN0B 4XPAL 1KT2B 2H2PC 1G7QA 2JJSC 5FYJU 1HHGB 1I7ZB 2CRIA 4FNLL 3LKOA 4NRYB 3E8UH 4NZUL 2B2XL 1JNHB 4LEXL 1BIHA 4IRJD 3QNZB 5JW3L 5DGQA 5D7SL 5I0ZA 1HK6A 1I9JL 2P7TB 3VI4F 1OTUD 3FQNB 1GGUA 3E2HB 1R3HA 1XF3B 8FABB 4YXKH 3RIFK 1A9EA 4X7CC 3CH8A 4U7SA 4ODTH 1DFBH 1MCKA 1UZ6F 1ZLVH 3RWIA 1XF1A 5TPWL 1CDCA 3QXDA 1UXSA 5K33A 1BZ9A 1Q72H 4HWNA 4MA7H 1CGWA 1GGYA 2QSTA 3B2VL 3R1GL 1X6LA 1FFNA 4NHUB 1J05A 3DRQA 4MQXD 2HMIC 4XBEH 1MI5A 3F7VB 4X7DC 1NGWB 5C6WH 4P2OD 3OKEB 1OAUH 2YUZA 1LNUA 3IFPA 5DXWA 5IGXH 1XF5B 5ISZB 2D0FA 4NO2B 3PG2A 4OIBA 3M07A 5D1XD 1HILB 1R3KA 3DI2B 4LNRA 4HGWA 2JE8A 4NO5A 3UP1A 5HHOD 2ZSWA 2EIBA 4J3SA 1O0VA 2AK4B 4ZO7A 2CPCA 3IGAB 3UPCA 1D5ZA 1BEYH 3EOTH 3TYFB 1U8PB 1RU9L 2O5YL 5F9DC 2Y36L 4X6FB 5I9QB 1FP5A 1L6XA 1PG7H 2H8PB 2C3VA 1RZ8A 1P7KA 1H3TA 4YDKH 1MHHB 1OAZL 5TH2A 2Z93A 3UZEA 4UINL 2P1YA 4HBCH 3UXFA 5DT1H 4LCUB 3IS0X 4PLJD 1UACL 4XPBL 2MJWA 5T1LB 5BRZE 1JGEB 1R3IH 5GGVH 5J9PA 3BIBX 4WTZA 1S9WB 1GZQB 1GGBH 3QQNA 1EHNA 4NUGL 1AR2A 3D6GA 4OV5A 1U93A 3PWPA 4JLRB 4E5XA 1G9EA 3FFCB 4MNQD 1D6VH 1YEKH 4G8GB 1FLTX 2XWBA 1MCPL 4HWBH 4JZNA 4TVSa 5D2LA 2C26A 3KJ4C 2HJFB 2XA8H 4J8RB 3T3ME 4IMLA 3DGGA 1A6UL 4XBGB 3NFNA 4LPVA 4HS3A 3EW3B 3CFBA 3PXHA 4KK9C 5DI8A 2IQ9L 1AO7D 4TQEH 1P2CB 1Q8MA 2PW2B 5JA8B 3I3EA 5KSAB 2R29L 5ECJE 3R8QA 4XCFH 4MXQC 5EOCJ 3T8XA 2XFXB 4X6BB 2DLHA 5IMLB 3VXMD 1AJ7H 5I1CH 1WK0A 3ARXA 3P0GB 4P5KA 1T1WA 4UBDD 3LS4H 1PDKA 2MFNA 5JNYB 3NIFF 4HMEA 1K4CA 1PEZA 4ELKB 2X4TB 4XNXH 4IOFC 2EH7H 2J4WL 3H9SB 4X7TA 5JLZA 3QDGE 4WNQA 4JREB 2EIZA 1CGSH 3VG9B 2R4SH 5EOTA 3RL1A 1GGCL 1NBYB 4QHKI 2VKXA 1KLUA 2DQIL 4JFHD 1CLZH 5AD0B 4OGXH 4R97C 5D1ZD 3TT1L 1AGEB 1RUAH 1G7PB 1YECH 4F15C 1C16B 1LP9F 2DM7A 5HDOA 2H1PH 5JTWA 4ODVL 3G5ZA 2EYTB 3PJSA 5I8CB 4OF3A 4ZFGL 2Y5EA 5ID1A 3K81A 3SCMB 5DS8A 2X9WA 5C0FA 2MCG1 4EDXA 3WFBH 3GSNB 4LK4A 2R1WB 2I60H 1T04B 3DUSB 1U8IA 3B6SB 5F6HI 1XR8B 4YNYA 5D1QD 1TCRB 2P5WD 3NTCL 4P2RE 4IRJB 4FP8H 3P9MA 4BK5A 3HCVA 1IGYA 3MV8A 1L7TH 1N4XH 1OF2B 4FZEH 1MCIA 4LKCA 1IVLA 2R1XB 5AZ2L 3BYTA 4KDWA 5D6CA 5IHUH 4NJAL 5DYOB 1KJVA 4J4PD 4C55A 2AJVH 4ODBD 1FC2D 1JL8A 1JV5A 1MHCB 4UNUA 3MUJA 1U3HC 4H1LB 4ONGL 3QDME 4P23D 3I9GH 3PP4L 1QSFD 4PRHA 1IEAA 1IEHA 4H88L 1HOCB 1JYWA 3CXDL 5CGYC 2HVJB 4NYLB 4PJ9A 3UJIL 1PLGL 3T2NL 4FQQA 2IBZX 5TE6H 4P2OB 3MRIB 4OZHF 5IMOA 3GSXA 4PTTB 1N6UA 2VZSA 2UY6A 4MJIA 2CMRH 5D1XB 2NY5L 2DQJH 5DF0A 4RISL 4X5WB 5F9AC 1N26A 3MRRA 4TNWF 5C09D 5EIIA 1F4YH 1FYTD 1S7TB 5IOPA 2ADIB 5TDPB 2VL5B 3GSVB 4JFEB 2FNBA 1NLDH 4HUWB 3O9WD 3U79A 5DFTA 2G2RA 3BP6B 5BV7C 4OJFL 4K94L 3GBNL 4ZUTB 4NQEE 5CJXC 3LN4A 4KRPC 5KJRL 4ZUWB 4F57L 2HKHL 3IFNH 3DVGA 1I9IH 3VG0L 3UTOA 1I8IA 2ADJB 1Q9WA 3O3BB 4PRDA 4YGVA 5E1HB 4HX1A 1SEBA 4YUEH 2FATL 1MUJA 4KDVA 3CUPB 1KJMB 4RBPH 3VXOA 3QSKB 1BMGA 3SE3A 2CGRH 5ENWB 3ZYZA 1MJ7L 3VD9A 1T7YA 2A9ML 3UTQA 2VZ3A 4G6ML 1DBKL 4MXWL 4HS8H 1I8MB 4M03A 4OCYH 3LKNB 2V5SA 2H2SD 3VD5A 4I0PD 1QR1A 1UKSA 3T0DA 4LQFL 3V4PH 4PGEB 4PS4L 3AY4C 4N0UA 1HH9B 3GSUA 4MJ2A 4HUMB 4D8PA 1I8KA 2AK1L 2OBGA 4WCYL 1AO7B 2FD6L 1ADQH 3DWTA 1UH3A 4UMGA 4YPGA 1MFBH 1C1EH 3DO3A 1ZE3C 3VXMB 3K4ZA 4XNZB 1DN2A 4EXPX 1KCVH 3C5ZC 3LRSB 2X6MA 3BKJL 2DLIA 4XVJL 3OGCA 3LQAC 1UYWH 4ZFZB 4KK5C 1F13A 4JY6B 4JQIH 2XYCA 1QO3A 1I7UA 1MWAA 5C92A 3TIEB 2LU3A 5GRVL 4KHTL 1U91B 3I02A 5F3BA 4FQIL 3BGAA 5D1ZB 2W0KA 3PWJA 2NLJA 4NKDB 1UWGH 2UUDK 2V6HA 3O6FC 1HXYA 4QWWC 5K9OB 2KZWA 4LCYA 1NMCC 1UM4L 4QGTA 4ZQKA 3GMLA 3K8KA 3HMWH 4NKIH 4ZUVA 1E4XL 1BVLA 1HYRC 1L9MA 1GC1L 3FHQA 5JR1H 3PGFH 1A5FH 5D1QB 2P5WB 2VLLB 4RIRB 4NKMB 4R4ND 3KPOA 1MPAH 5F7DA 5JZ7D 1S7VB 3SDDB 4Q9CA 2BJML 4L29A 1XGPA 4JM2D 3C09C 25C8L 3DRTA 4BQ6A 4DVBB 3MYZA 1D5IH 3FO9B 4XT1C 4D9RE 1MFDH 3OZ9L 3PV6A 1FRGH 4P99A 4L8CB 3ARGC 1JNNL 4X99B 4YHZH 1FCCA 3L6FA 5FDWA 1TQCB 3WSQH 4P23B 2FL5A 5KBNC 4MA8L 1YEJL 3KPNA 5GZNC 4YJZL 5CJ5A 2CLRA 4LHUA 4GRWE 3N1FC 3BZEB 2AJSL 1JWSA 2FR4B 4EIGB 2R1YA 3H6JA 1KPVA 2XWJA 3AMKA 4PTUB 2XN9A 5BRZD 4X80H 2XPGA 1M1SA 2IJ0C 4HSQA 3ZDXE 5IFHH 3AY4A 5DVOA 5ANMA 1WCBB 4LRNH 3QCVL 5DRXB 4Y5XC 1RZJC 2NY3C 2FYYB 4U6TA 5F96H 4X9HA 4EI6B 5DJ2A 2J88H 5KSVB 3FB6A 4OM0H 5DMKA 1UA6H 1QACA 2B1HH 2Y5TB 4XXDB 1BJMA 3L3HB 5FM8A 2IWGA 5DK0A 3KDMB 4FZ8L 1L7IL 2AGJL 3LEXA 3C5ZA 3U36A 4TRPL 1SBSL 5IFAH 3PHOA 3BKML 4XMPL 1TVDA 4PY8J 4F7CB 3BIKB 1YDPB 3MA9L 4DGVH 4MMZC 4NKOA 4NQDD 4S1RH 2GTWA 4LPWA 2IGFL 1BVKB 3OXSB 1NAMB 1QR4A 3FOMB 1H8SA 3HC3H 4PJCE 5GHWL 5HI3D 1DVFB 1CDHA 4R2GC 4TOYH 1URLA 3QPXH 4NQCA 5IB3B 1WFOA 3LRHA 1KCUL 1FGVL 2H45A 4R3SA 1NUNB 3QDGD 4MHHI 4G7VH 1BQHG 2R2CA 5I1DB 4I0PB 3QIWD 2RCSH 5HDBF 3RBSA 3LQZB 1U2CA 1MCOH 2VIRB 5L6YH 1ONQB 3MRCA 4NC1C 3N9GH 3SY0B 5GIRB 3CVHA 3HG1E 4C4KO 3S3PA 1JNLH 3JWOH 3U4EA 3JWDL 4NFBA 4RFEA 2CRYA 1M05A 1NBZB 1ND0B 2DWEB 1MCFA 4HGMA 4POZC 1T1YB 1YNLH 5DA0B 1I7TA 2G5BB 3P0VL 3DROB 3PL6C 5I8KH 2AABH 5MERA 3E1F1 1YEHH 3OAUH 1WZ1L 4MD5B 3QEHB 5GISH 5B21A 4E41E 1K8DB 5GS0D 2K9UA 2FSEB 3RZCB 1BOGB 4QRSA 5FYJL 2E27L 4LVNC 4LCCA 2ITCB 5IVXE 2ZKHL 5B38A 4DW2H 3OKKA 3DXAD 4PJ7E 3HAEG 4YAQB 2BDNH 3QUXD 4JAMA 3EYOA 3MNWB 4XWOD 3QHFH 3S5LG 3WE6B 3QDMD 1CICD 3CX5K 2G75A 4HXAH 3U7WL 1AQDB 3CPLA 3TVMB 2MPAL 2I5YH 2CUIA 2HYMA 4A2LA 1ORSB 2X89D 1HEZA 2XY2A 4DN3L 4B5EA 3GFUA 1IGIH 5J0BA 1OCWH 4X6EA 4Q9RL 1FYHB 1RUKL 2YZ8A 4FFYL 5T3XE 2DQDH 4JM2B 1QD0A 4GW5B 2HLAA 6FABH 4Y19E 5C0AA 1NJ9B 2N56A 2XV6B 4XPFH 2VDML 5D71H 1PZUB 4JKLA 4J6RL 1NPUA 5C0DB 4P2CG 3V7AE 4NQED 3DO7A 2OL3L 5IJVA 1U8QB 1RJZA 4Y4HA 3MCLH 2EDXA 5DTFB 4RZCB 5HVHB 1N59A 3QDJE 1ZLWK 3BUYB 4LLVA 4Y7MA 2WWKO 5ERWB 5MI0C 3L95A 4MJ5B 1HQRA 5GSVA 4V2BA 4NPYA 2ZG2A 2CJUH 3SE4A 3TFKD 4JCLA 3VWJC 4P4RA 1OSZB 4U1JB 3T0EE 3LKQB 5BRZB 2YS4A 5KANI 1IBGH 5FUOH 1MH5B 4YR6A 5CSGA 2Q20A 5D9SB 3BZ4B 2P8LB 5IW6A 2NMSA 1CVSC 1X5XA 3BKCH 3ZT5A 1G6VK 3E6FB 2AQ3A 3MA7B 1CL7L 4P46D 3UJTH 3RL2B 5DEZA 2HWZL 1MFAH 3EOYG 5E5MB 4MD4A 1KIRA 3U1SH 3LPWA 4ONHA 2KDGA 5JW4R 3GMMB 3IKCA 2X10A 2HT2C 4JM4H 1QEWA 5E1AA 4R0LB 4C56D 3U0PA 2ZCLH 3AM8A 5HPMA 4FQLL 3FQWB 1BLNA 5DVNA 3N50A 3EO1A 4UNVA 4WI6A 4RGNE 2H32A 3NIGF 3BEWB 2VZ1A 5IBTH 3E6HB 1MJ8H 3LH2L 1AHWC 3X3GL 2H26A 5TDNB 3WFDH 1OWWA 3O3UN 5HGGS 5GGSB 4GBXD 4M43L 5FECB 5D72H 3TA3C 3QDGB 1M7IB 4WIQA 3UTTE 2AS5M 7FABL 3V6FA 1BF8A 1QHOA 1YEGH 5E4IA 4X9FA 5JPMA 3VRIA 3O4LA 3BPCB 5DD1H 2F58L 4L9LC 1F00I 4DEPB 2NXYD 1EBAA 1S3KH 4I18C 3HE6C 3PWLA 4TUKL 5TE4H 3UDWC 5ETUA 1JGVH 1BFVH 3ILQC 5ACZB 5EO0B 4TTDD 4BJLA 1Y0LA 5F8RC 4XCNB 3QYCA 4O4YH 4Z7WF 2XZQL 4XVTH 1M7DA 1H8NA 2X1QA 5E4EB 4Q0XH 1JFQH 2DQUH 1FZOA 1BD2A 3QUZD 1R5WB 5HTSA 4P2RB 4A6YH 1CDYA 2F53E 4HUUB 3S5LB 3ZE2E 4F80A 2ICEA 3QAZC 4JRYE 2XOTA 4TSBL 1UM6H 4F37F 2EDOA 3LEYL 4KMQA 2DM4A 3MLRL 1QA9A 1YPZF 5JMRA 4GKZA 3WL9A 4P3DA 2XT1B 3VWJA 1F11B 1VFBB 3MRDA 3MV01 1A1OA 3MRKA 3QUXB 4X8JB 4JANB 1FNSH 1A7RH 1CICB 3MOAH 2EDBA 3DX6A 1LP9E 4MHHG 4JFFD 5IM7B 3SKNB 4DUWA 2UUDH 4F2MA 4X0KA 4XPTL 3TGXA 2O61B 2HJKB 4LLYA 5L8JB 4M48H 4YHLH 1AI1L 2G60L 4G43B 4TPRH 1JPGA 1YEDA 4JO4L 2R69H 3VFSB 3STBA 5LG1A 3HE7D 2MKLC 3C6LC 1ES0A 2I27N 2R0WH 4DFHA 4EN3D 4G6FD 1G1CA 1YY8B 2N4IA 5DHVA 1SY6L 2X4OB 3IU4L 1ZS8A 4C57C 4DTGL 5DJYB 4NM4H 2I9LB 1TZHB 2AXFB 4NQEB 2XKNB 1CR9L 1Z3GH 1KJ2L 5CSZB 1EV2E 4JG0L 5ICZA 2UVEA 2MHAA 1CQKA 3L3OA 2IAMC 3DLQR 4CDHA 1KB9J 2P49B 2FHBA 4PR5A 4YXLH 1W72A 1VA9A 2BC4B 5HGAB 2CIKA 5IIEA 3S9DB 4LASH 4R4FH 4U1SB 3GGWA 5DURD 3AB0C 3AROA 1I9RL 1DLHA 3MRGA 3KLHC 1FDLH 1IGJA 4L9LA 2AJYL 5CFHA 1IQWH 5E08L 1ITCA 3GJFA 2P8MB 4I18A 5T1KD 2LVCA 3P4NA 3V6OC 3WO4B 5E6YA 1NFDE 5K9JL 2Q7YA 1MCCA 1ACYH 1VACA 3QI9C 2VXVH 4P46B 5HSFA 2IPKB 4DGIH 5C71A 1KBGH 3ARDD 5EG6C 1YEKL 5FUCC 2FEDC 4ETYA 5HI5D 1MCSA 3H7BB 5EU5B 3QWQB 1PZ5A 1TNMA 3IDXH 2CSPA 2ZCHL 5CP3H 4RAVB 3L3DB 1PX3A 2AEWA 2BVQB 3QQ4A 4MDIB 2C3WA 2W9EL 1WAAF 3NH7H 5FV1L 3ZKXC 3LZFL 2VDNH 4D0CB 1KEML 5I1EH 3RTQA 4WEMB 5KZCD 5HHNB 5KTEH 1BQSA 3MOBH 1KTDA 1T7ZA 3MJ9H 3DPBA 4HKBA 4E41D 1P6AB 4GBXB 1OQXA 3NGBC 5LCVH 4YHNB 3MRBB 4GLRH 4IDJH 1N5YL 1ZK9A 1S5HB 4JVUA 4WY7H 1P7HL 1FZKA 3EOBA 5KANG 3GSNL 5IB4B 4DKFH 3OR7B 4E9LA 1MHEA 1HYSD 4XPGH 2XQBH 1AXTH 1D9KC 1WT5C 5EOCH 4AIXA 3C6LA 4R6UA 4UT7L 4IIQC 3AU1A 4NSKB 3RVTC 1JZ6A 4JFXA 1IL1A 4JRWA 3GM0A 1BECA 1F6AB 3NZHL 2F74B 2V2TA 2YOCA 5KG9B 1XF4A 5AUMB 1JPFB 5EN2B 2DTSA 3QUZB 5DVMA 1TJIH 2GY5A 1UWXH 3EDJA 4M1DL 1TTFA 1EMTL 1MFEH 3TBVB 35C8H 3OR6A 2EICA 3RPIB 1T5WB 4Y19D 5HHMD 1KJ3H 1Q38A 3QXAA 4EI5D 3W39A 3O3AB 2FX7H 3H2WA 3C2AH 4L3EE 4AIOA 3OBAA 5IHUL 3S37X 4K8RC 5HGHA 4IRZH 5DDHA 2NY0C 5LBSH 5LXGH 5GGTA 3O11B 3MYJA 4L8BA 5EBLB 3P9WB 2R23B 4LF3A 3V5HA 4GRWB 5EC1B 3BMWA 3O81A 4HGKC 1J5OH 4J7RA 1MREL 3FJTA 3WXWL 5C0JA 1QP1A 1NC4D 3PDOA 2AJ3B 4OZFH 4NKQB 4WU5B 1LE9B 3T4AB 4WFFD 2W0FA 4LCIH 3GSWA 3KR3H 3EIFA 5T33L 3HE7B 4FQPA 1W8OA 4MNHA 3TH2T 2HTKC 4EN3B 3QHZH 3ALPA 4Z8FH 3EZJB 1FIGL 4U6HB 4PGBA 3QUKB 4BUGA 5CEYB 3KHOA 5DWUL 5I2IA 4HXBH 2C4XA 2HFGH 3B3IA 4M6OH 5B39B 3WEXA 4ISVB 4YBHA 1FLRH 4U1MA 3WUWG 1XGRB 5MENE 2R56L 4PJEF 1JHTA 1RULH 1ZLWH 2BXZA 1UJTA 3OWEA 1CE6A 3QQ9C 4GFTB 5DUBA 3QFDB 2D0HA 5A2LH 5ADPL 4RGND 4ZODA 4PJCB 5F21B 3O6LL 4KI5F 1N0XH 2DOCA 4NWUH 3KPSA 2APXA 3IFOB 3F7PC 1P9MC 1QFWL 2BVOA 1UGNA 3BPOC 4P3CL 3AREA 3OAZH 5CBAB 3LKRB 3DJ9A 5JDJA 3FO1B 1GHFH 1JGDA 2EO9A 3FFDA 4H8WH 3U7YH 4MJ6B 3S4SA 3FONB 5KVEH 1U36A 3UAJD 2IH3B 4TVPE 4OCRL 4MMXC 3UYRL 1DBBL 1DSFL 4ZS6D 1UT9A 4GKSB 3UTTD 2CDFB 4KKCD 4KMTH 4K7FB 3HG1B 1WEJH 5EU4B 3JTTB 4LVHB 3SO3C 3BP4B 5JORB 1MF2L 1YYML 2WUCH 4U0RB 5HYSB 1EO7A 4MAYA 5T5FH 1IEBA 3UPRA 5MEQA 4NWTH 1JVKA 1K5NB 1RVFL 4X5XB 5KZCB 5CUSH 1RD6A 4GQ9L 1QFOA 3HZYB 4G80A 5F3HB 4FQHA 3MMEB 8CGTA 1C5CL 4KAQL 4Z0XB 4LSUH 4E41B 2F53D 2NY1D 1D7FA 5HHQA 1FVEA 1F3DJ 4UDTA 2ITDB 4LCWE 3QHTC 5IVXB 4APQA 3NPSC 4CBPA 1MJJB 1MVUB 5IEHA 5D70H 4PJ7B 5HDBE 1MOEA 4XP6H 1Q0YH 1P4BL 3SQOL 2Q6WA 2Y07L 2IADB 2DQCL 4O5LL 1FN4B 1OGAE 5E6IC 3TYGL 5IK3B 3QCUL 5D7LA 1UEMA 4NN7B 3I3DA 1WBZB 4G6JH 3TN0C 2DIJA 2FECL 2AI0H 1TITA 3IFLL 3IAQA 3ZE0F 2YEZB 4HPYH 5DUPH 1LO0H 4LIQH 1MRDL 3G9VA 3NCBB 1SYVB 3ZMRA 4ZUUA 5F89A 4ZUSA 2XQYK 1MVFA 5FKPB 1WFNA 4GMSL 4OFYD 4PRBB 2ZPKL 5DC4B 2ZSVB 5J3HC 5JXED 3RPKA 5IMMA 1AIFB 4RFOL 4Y19B 4S1DC 1X5LA 5T3ZD 5LQBH 5DRWA 1MFCL 1VFMA 1DR9A 3HMXA 4EI5B 1RHFA 2W9DH 2OSLA 5EZJA 1VFAB 3OF6D 3QP3A 3LDBC 3O4OB 1SM3L 4NJ9H 5C9JB 4YDLC 3QDJB 9CGTA 4KDTC 2NXZC 1OSPH 4AT6B 3WLWC 3QEGH 3I6KA 1EGJL 4GRMB 4RQQA 5HJ3A 4JDTH 4M7KL 3UTPE 4JGMA 3W2DL 32C2B 3T0EB 3D69B 3NCCB 2IALA 1JPSL 1FIEA 3X11B 4NRZB 1VESA 4C59B 3GMPA 3MBEC 1ZT4A 2IANE 3FB5A 1T1XB 3ES6A 1A02N 3LB6C 1P4IL 2X1XR 1NAML 3VJ6A 2XZCH 3QNXB 1PSKL 3NABL 4PBWD 4DJMA 4N0CC 1YA5A 1LE5B 3CLFH 3O8XC 5F88B 4GG6E 5IJKC 4Y1AA 1F42A 3A67H 2E9JA 5BJTA 3LEVL 4IRSC 4XNQA 4D9LL 2ICWA 1FFPB 4JHAH 5INCB 5IESL 1AD9B 3WFEL 3KVQA 3B8SA 4UQ3A 5JO5B 3BGFC 1C8PA 1MY7A 4WUUE 4RGNB 4YQXH 5L8LB 5D2LF 1PY9A 4PRAA 5EU6A 4M6NL 2V2XA 2ZUVA 1IM9D 2BSRB 4OZIF 4JHWH 1MFNA 3DIFB 4H20H 1BJ1J 3D18B 2YPLB 1RK1B 1PAMA 4G3YH 1A6WL 5FUZL 4LLMB 2EH8H 3TBSB 4HPOH 3RJQB 3TN0A 1JTOA 4PP2B 3UTTB 2IH1A 3BHBA 4KKNA 2XIDA 1RSFA 3QXWA 1F90L 4FXLA 3A6BH 1XCQB 4ZNCD 4OLVL 1GGIH 2UZXB 4BH7B 3BN3B 2J6EA 3K4AA 1PD6A 2YC1A 4JPKH 1J1OL 3NCMA 3QO1A 4K3EL 3KNBB 4JN2A 2VDOH 3DNKA 2YMXH 3OAYH 2AVGA 3NIGE 3GHEL 3RWGB 5EDXA 1P84J 1YZZA 4N8VG 2F53B 4L4TA 4KDTA 1X7QA 2H9GB 3HNSL 3IXTA 4U7KA 2E7MA 4XX1G 1FL3A 4JRYB 1EH9A 1VHPA 4NUJA 3GO1H 2R8SH 4M62L 4M1CD 2YA2A 1Q0XH 1EUTA 4OAWA 4M9PA 1AY1L 3KPRA 4MWFA 1NL0H 4JDZA 4Z95H 1Y18B 4L3ED 2I24N 3C60D 4J1UA 3WFCL 3NFSL 3OX8A 2NR6D 2YBRA 1A9BB 3BZFA 4EBQH 3WJLC 1LP9B 1OW0A 1B6DA 1P1ZB 3L7EB 3SDAC 4P2YA 5GRUL 1UH2A 1E6JL 1HHKB 3MRPB 4OD1L 3O8XA 1DUZB 4Z7WE 1FCGA 2AKRA 1B2WH 2VUOA 4RGOL 4DZBB 2BOCB 3BSZL 3WO3B 1FZMA 2P44B 3PUCA 1QLEH 3JUYA 4U3XA 3IU3A 1GCFA 1N0LA 4XAWL 5LGKA 5KS9A 5D7JD 3B2UC 1LILA 1NEZG 4K94C 4R9HA 4OB5L 1NSNL 4JFOA 4AM0B 1YEFL 4R90H 3RAJL 5HI4D 1PKOA 2DLFL 2AP2A 1T03H 5FGCE 2DQTL 3CSYB 3V5KB 2VDRL 5CEXB 1T2QL 5T1MB 3HRZB 3MCLL 6CGTA 4JFYB 3AGVA 3KLSA 3ROOA 4NO3B 5CGMA 4OZHB 2VAAB 4UOJA 5CWSB 4XVSL 4QXGL 2ID5A 3PWUB 1NCCL 1NLBL 1DQLH 1QFUL 1MWAH 4PJBA 2V7HB 3OKLB 4XBPA 2X4SB 4HK0B 4TVPD 1AKJA 1NFDB 1IBGL 2VWEE 3GSRB 3AXLA 1A47A 4JO1L 3GHBH 4PRPA 3VFTB 4XNUH 3GMOA 4DVRH 3W9DA 1CVRA 1KB5H 3BKCL 2YSSB 4NQXB 2HLFC 3EJYD 5BV7H 4LARL 2ADGB 2WBJD 3QEQE 4UT9H 3H9HA 1ZKAA 3O2DL 5KVDH 2GFBA 4U1HA 1CFVH 1NCDH 1FZJA 4MSWA 5ESVB 3LMJL 3QQ3B 3A6CH 3TO4B 1I1CA 4P2QE 2VERN 2VQTA 3IAGC 5TFSL 3UTSE 4JPWH 2XXMB 3IVKB 3RGVC 3TZVD 1MJ8L 3BQUD 3SDAA 5EOQH 3CFCL 2HTLC 1UB5B 1H3PL 1UH4A 3WFDL 5DD0L 3NN8B 3GSQA 3Q6GL 3QFJA 2R0ZH 1VGEH 3ARQA 1HHIA 5DQJA 3MUY1 4ELMF 2ICWJ 4MB3A 1OGAD 4EQ3A 2QKIB 3X12A 3JUZA 1QYGL 4L4JA 4N8VB 4Y5YB 3BXNA 4HQQH 1JTTA 1WWAX 4U1KB 3GSOA 1GAFH 2ARJA 4IHOA 1YMMA 2DQGL 2UV3A 1GC1C 1WAAE 2BFVL 2VXUH 4XP4L 4Y4FC 1KCLA 5I1JH 4WW2B 3D1MC 4JN1L 1TZGL 1WBYA 1DQMH 4ZAKD 3HNTH 5I1KL 2PXYD 4CMHB 2CDEB 2JLLA 4WI2A 2UY7A 4R8WL 4IM8A 3CSPA 5DO2C 2IMNA 3L9RB 1U58A 1KLGA 1UWEH 1T3FB 1IGFH 1KOAA 3FL7A 3ARZA 3GJEA 4LVOB 4L3EB 2BNQA 3C60B 4KZDL 3MGAA 3BYYA 5AG9A 1JK8A 2OJZL 5J11C 3SE9H 3WCYA 4OGAC 3L5XH 3OG4B 4FXKB 4NZTL 5F1SA 3HUJF 3CFKA 3L1OH 5B8CC 5SWZA 5DC0A 4N8CH 5EO1A 2VL4A 2NTFA 3LQMA 5J6GA 4PBXA 3EFDH 1KTLA 1A7RL 1CIDA 2YKLH 3SJVD 1DQTA 3UTPD 1LQSR 2J12B 3GBLA 5FF6A 5E6ZA 3IS1X 2PYEA 5BO1H 2BVPB 4KKLD 1VCAA 2AW2A 2NY7L 1ZANL 2HN7A 2FO4A 3FT3A 5L9DL 1RJYB 1X4XA 2IAND 4H5SA 3W82A 2VDKH 3U46A 2R69L 3ARSA 5D7JB 4KTDL 1UVQA 3P4MB 3RNQA 2OTPA 4IS6B 3WBDA 3WLBA 1ZGLA 4LHQB 1MRCH 3EYVB 4P4KD 2P24B 1KEGH 1M4KA 4QYOB 1T80A 5MENB 3HZKB 4GW4A 4YHIA 2F19H 4PV9A 4ZFFA 4KQ4L 5JW4N 3I6GB 3FN0L 1KIPA 3T3PF 4Z76B 1LO4L 5E8EA 4U1LA 3KPQA 1S9XB 4O2FB 1OP5H 4PB9H 4MA1C 4RRPG 4P5TC 1K4DA 4L8SC 4LOUD 1T21A 3U2SA 3MR9A 1C5DB 3LRGA 1MLBB 1EFXD 1AD0B 2Y6SC 3LSOB 5ACLA 1G0XA 4EOWH 4NGHL 4YE4L 2A77L 1LEGA 2ATPB 4FMKA 5TE7H 5HGBB 5FYLH 2P8PB 1IC5H 1MCNA 4L1DA 2E7CA 3MRQB 1N2RB 2PYFA 4LU5L 2YRLA 4JPVH 1IGTB 1RZJH 5EZOL 5CD5C 1KXTB 3OKYA 3QCTL 5FO7A 4I5BB 4KQ3H 5E8PA 3JWDC 4QF1A 3ARFA 2DQEL 4BFIB 3P11L 3SDCC 1BZ7B 5E9DE 2AXGA 1T66D 2BOBA 1WBXA 3BPNC 2R4RH 2AV1A 2WBJB 4PJEE 3F5WB 3IXAB 1MSPA 1ZLUH 3U0TB 3G5YB 3S36H 4F58L 3EO0A 4YDJA 3W9EB 3BRDA 5I1GL 4Y16B 4KI5E 4E0RA 3KPPA 2Q86A 4QHUB 4X6CF 2CLZA 3VXSE 1PG7X 4IJ3C 4TULH 2FBJH 4PV8B 1XGUA 3RKDD 2E6QA 1R3LA 4ODUA 5DGRA 2CD0A 3SGJA 2J7LA 4FFWC 4LCWB 4WJ5A 4Z7VA 3MJ9L 5CD3B 2C7UB 5BS0A 4ONOA 1S7QB 4JQXC 5JPNB 3MSPA 1OB1B 4CN6A 3RVUD 3H42H 4Z7UA 3B9KC 4ZO6A 3QRFM 3F62A 4WY7L 1OGAB 3F7YA 3OKOA 2OXHA 5FKAA 4ZDHB 2WWMD 4YXHL 4X5LA 2J8UF 5IVZA 4HJ0C 4QHMA 3KWWB 5IUSA 1LGVA 4WI7A 2F5BH 4HULB 5EOCL 1KLFA 3GMRA 4GLRI 5IW1B 2Z91A 3MO1A 2WIIB 2NY6C 3UYPA 5I1AA 4S1SL 4JFDB 4ZAKB 4YHYB 1HCVA 1R5IB 3N85H 3QULA 1NCWH 3HB3D 1OAKH 2VLRE 3IJSB 4FQXD 4RX4A 5DFVD 4MD0A 4JJ5A 1TZIB 1FAIL 5DHYB 3MLTA 2X7LA 1Q9LA 4Z5RA 4Y2DA 3WDHA 1F45A 3GNML 4FRWA 3CK0H 4U6XA 4DZ8B 3QWOA 3BPLC 2LABA 2FB4L 2X4QB 2FH8A 1KJ3L 4DCQB 1OQOA 3MZTA 2H32H 3D0VB 1A22B 1CFBA 1RHHB 5KN5B 2GTZA 2A38A 4EXKA 4GKNA 5BMFH 4JQVA 5LXGL 4EQ2A 1BREA 1FORL 4HZAA 3LV3B 5GS1A 1FVDA 4PY7B 3ZE0E 4WEBH 1XIWC 4UTBH 2ADFH 3TV3L 5H8DA 5FAAA 3DARA 4O00A 4S2SA 3MNVB 5IQ7L 1G7MA 4HC1H 1CGVA 4ORGB 2IANB 4PJ8C 5DJ0B 3TP4A 3QIBC 1HHHB 3CNKA 1AFVH 4U1IB 4PD4J 4FXGB 5ALBL 3I3BA 1BQLH 1QQDA 4KKBD 4GG6B 4EUPH 2QQLL 4P4KB 1BIIB 1DBML 5JUEL 1YNKH 4ZSOE 3MRHA 1QVOB 4JZJB 4YHKH 1FH5H 2X40A 3L3KB 1SMAA 3QEQD 4LLWA 4WUUB 1MQKL 4UV4H 2EIDA 4PP1C 4GXVH 1HI6A 1N5AA 5F8QC 1HQ4B 4G5ZH 4XGZB 3S35H 5IB1A 4WRLA 3SPVB 2BNRA 5DMIL 1EFXB 4P2QD 3RY6A 5E8NB 3H3PH 1IAOA 3UTSD 1I1AA 3RWEA 5JOFB 5EO9A 5C1MB 1IQDA 5ADOL 2FIKA 2Z35B 4LQ1A 3DSFH 4PLKD 1WLHA 2G9HB 3DMMA 3O0RH 2QEJA 4GG8A 2W65A 3TEUA 4PG9A 1YN7A 4PJIF 1IJ9A 3CU7A 1JHLL 4LSQH 1LO3L 5IWLC 5I66A 2HRLA 3EJZD 1GJIA 2W60B 3F12B 3KXFA 2VLJA 3CZFB 5DR5L 1FBIH 1K6QL 4OFKA 7CGTA 3AAZB 4HHAA 1JPST 3MFFB 3MRJA 5KAQG 4LIQE 2D4FA 1CFTB 4HKZA 5F1NB 3OHXA 4ZG1A 1T4KA 4Y2OA 4K9EL 4I9WE 4PB0H 2RGSA 1T7XA 1CT8B 3VH8B 1XF2A 3O41A 2OL3A 3IDUA 5C0CA 2D7TL 1IM3B 4L4VD 5FHAL 4FABL 3CCHB 3VE0A 2DQFA 4JEGB 5D5ME 5GJSL 4HD9A 4ALAH 1TJGL 1B9ZA 1P7QD 1CK0L 3OKDA 4OZIE 5DHVH 4ENED 1YN6B 3JZ7A 4DQOH 1GZPB 1QSZA 4PRIA 4AMKH 2MCPH 3G6JA 3VMOA 3P73A 2LU4A 2CIIA 4HWEH 1QKZL 4BYHA 1NDMB 3DV6B 2X4UA 4TUJA 3RDTC 1XIWA 4B50A 1EUUA 2FZ3B 4PREA 4QT5B 3I50L 3DURB 3ZKMC 3MRFA 5KVGH 1CCZA 3MLYH 5FO9B 5HYJA 3TPUA 5DSCA 3NCEB 1HKLH 3QIBA 3WKNA 4G8EB 4U1GB 4WFGE 4RNRA 2IEPA 4KROC 4I2XA 3FO2A 4Z7WB 1EHLL 4OSUL 2WBKA 3QUYC 1FVCB 2JIXA 2A6DA 3GJFH 1AGBB 2IG2H 4HH8A 1UZ8B 1T6VN 1F3DH 3U4BL 3IDGB 2IC2A 4NT6B 4YX2H 3ZYOA 2R2EB 5FO8B 1RFDH 3ZYIA 2GJZB 1DQDL 3MJ7A 4LSRL 5IV2A 5FCSH 4PJ5E 1U95A 3MRLB 1SEQH 2BERA 5CILL 5EC2B 4OFIA 4WU7B 4ZS7H 3REVB 1WIOA 1YPZB 5TDOB 5H37H 4G9FA 3C5JB 5TJWK 5E8OB 1QRKA 2E6JA 2I26N 1N3NA 1WFTA 3U6RA 1KNOA 1FO0H 3UJJH 4K2UL 3MV8E 5C6TH 3WIIH 5JMOC 3NOIA 5FGCB 4PJDA 2XTJD 1KT2A 4H25B 4BUHA 1HHGA 1I7ZA 3T0XA 4NRYA 5I1IL 3QR2A 1JTPA 5IWLA 1WTLA 3QNZA 2W07A 4YDVA 5IR1B 2Q8AL 2P7TA 1DL7L 4KK6C 3FQNA 4G6AC 5KSAC 4PRHE 1I3VA 1DBAH 5I73B 4M7ZB 8FABA 4N9GB 1NMBH 2H3NB 5HDQH 3ZL4H 2VLKA 4JPIB 3RWJB 5GGRY 4LSSL 3MV9D 1AP2A 4L5FH 2Z4QB 5IT2L 1MIMH 4YHMH 1HDMA 1T0NA 1QBMH 2E7LA 1T2XA 2DBLH 4KJPC 4G8FB 5E9DD 5ESQB 4M4PA 1MAML 4W4OA 3A67L 3QEQB 3WIHH 1NGWA 4HH9B 3OKEA 5KVFL 1MNUH 4MQ7A 4I3SL 1XF5A 3CU1A 5ISZA 2UVFA 5BOPA 3SKOB 4KI5D 1HILA 4YDIH 4GJTB 1KN4L 4P2QB 3VWKB 1RZIB 3VXSD 1A6PA 4OLZH 1KGCE 3UTSB 4HAFA 1U8LB 5DRNB 5EZIL 2AK4A 2VITB 3B9DA 2B5IB 1ZTXH 2BNUB 1CLOL 3MV7E 4WVRA 2UWEF 3F7RA 5I74B 3NZ8B 4X4YB 5GGTH 3QUYA 4X6FA 1OTUC 1MHHA 5CBEB 3L3IB 1A3RL 4M7LL 3V0WH 4QRPE 3ALXA 1AQKL 4WO4D 5JA9A 2QSCH 1BJ1H 2I25N 2RFXB 1UEYA 1KJ2A 4JKWA 4XZUB 4J3TA 2GKIA 4O58L 1OAYH 4JLRA 3RA7H 4PY8I 2VQ1B 5J1AB 4MQXC 2VLRD 3WHE1 3FTGB 4G8GA 3P4OB 4LAJH 1HSBB 4U6YB 3GMQB 1JHKL 1NGQH 4R4BB 4RWYL 2M2DA 1ZVSB 2HJFA 3G5VA 2HT4D 5D1XC 5ALCH 4XBGA 1IGML 3BO8B 4PLNC 2QQKL 3BT2H 2HT3D 5DJDB 2Y06L 2ZOLA 5I17B 5SX5H 1BGXH 2PW2A 3LIZH 4ELME 3SE8H 5KSAA 1M6OB 5D93B 1NL0L 1OTSD 5T3ZL 3CD4A 2XFXA 5IMLA 1G84A 2WUBL 4WWKC 5GRJH 4Q6IB 1U8JB 1A64A 2X4RA 3CFEB 3RWHA 3ULUL 5JNYA 3QWRA 4JGUA 2X4TA 5F70A 3MXVH 5AZEH 3QG7L 1JZ7A 3RVXD 1A7NL 4JHZA 1FG2B 4PLJC 3OTTA 3TCLB 1ZAGA 4QY8B 4M3KB 5H94B 3HC4H 5AD0A 2B4CL 1AGEA 1G7PA 1EO8H 1C16A 4YK4B 2EYTA 1XCTB 2BY3A 4UAOC 5EBWB 1NC2D 2QADB 3EDFA 3HUJE 1PG7W 2FEEI 5F9OH 2A0LD 3GSNA 4ZOEA 1T04A 3DUSA 3B6SA 1XR8A 1TCRA 4Q58C 4IRJA 5FYKH 3MJ8B 1A6TB 5C0IB 4HS6B 3WS3B 1FJ1B 1YUHA 5DUMH 4GAGL 2R39A 5DYOA 1JF1B 2VDLH 5C0GB 4C4KT 4JB9L 2WLZA 3M8OL 3GI8H 3NCFB 4X9BA 4BZ1H 3HPJB 3NA9L 1SVZA 4M6AA 5I15L 4H1LA 4AQOA 4HCRA 2C3GA 2XZAL 1HOCA 2DLEA 4CKVX 4X8XA 5DJ6B 2HVJA 5E9DB 1MEXH 2KUTA 5E95B 3UZQA 2VH5L 4PJEB 4BFBD 4P2OA 3MRIA 4OKVB 1T0PB 4MDJB 2VXSL 3PWNB 4GAJH 3SBWA 3T3PE 4PTTA 4HUVB 3BKYL 2FJGB 2H2PD 5D1XA 4WTZG 4X5WA 3L5WA 1WWBX 2JELH 4F9PC 1QSED 3CFIC 3VXSB 5HHOA 1S7TA 5TDPA 3FCTB 2BMKB 3HMXH 2VL5A 3GSVA 1I3GL 4PJHA 5D7IF 4LSTH 3BP6A 5E2VH 2HJLA 5ITFA 4J3UA 4ZUWA 3LPGA 3TO2B 1LK2B 1O5DT 2C4FU 1V3MA 4OBSA 1OARH 2ZUWA 3EYUL 2DKSA 3EFFB 2ADJA 2F5AL 3QB7C 4OZFB 3VFRA 1YQVL 5HYEA 5FOBB 4GKOA 1JP5A 5AAMA 1W0WA 3CUPA 4LDOB 5HHPB 4WFGD 2WANA 4KRLB 1KJMA 4WO4B 3C8DA 4N90E 1AGCB 3REWB 5ENWA 4HQQL 1GXEA 4Y4KB 1MLCB 4YBQC 4ZOCA 5BVPH 4X6CE 4XPAH 4MNQA 3GMNB 1I8MA 2F8VA 2VLRB 4JO3L 4PJ5D 5I1JL 4FNLH 2I07A 3TT3L 2V5YA 1RZGB 2VKWA 2B2XH 4LFHD 4NZUH 4LEXH 1ED3A 4C83A 3ARBC 2LQRA 3VGDA 4PGEA 1G7QB 5JW3H 1TJHL 1S7UB 1HH9A 5D7SH 2WWKT 1I9JH 4WHYG 4OCSL 5A2JH 1AO7A 4KUCF 4BZ2H 3GB7B 1UWEL 2FGWL 1A0QL 3O9WC 4NCC2 1MQ8A 3VXMA 2J8UE 1R3HB 3CXHJ 2QHLA 3DX7A 1ZHLA 4H0GA 3LRSA 5FYLE 1OTTC 4AEFA 3SDXF 4I1NB 3B2VH 3WN5B 3R1GH 1NUFA 4Y0GA 4JKMA 1WZLA 1A21A 1U41A 4JY6A 4NFCA 1ROWA 1BZ9B 1BAFL 2Z31C 3TIEA 4AEHL 5DFWH 1FFNB 3HHRB 3CZJA 1J05B 3DRQB 1P5VA 5IHZB 4NO0D 2VR5A 5L2JA 5D1ZA 3W0WE 5DLML 1G6RB 3VFMA 4QKXB 4JFZL 3K8LA 4F9PA 4XTRC 2YHGA 3CVHL 4ZSOB 4TVPL 4HGWB 2ZUQC 1FL6B 3D2UD 4I0PC 1XFPA 1RU9H 2V9RA 2O5YH 2I9TB 3GZKA 2V9QA 1YEIL 2PCPB 4MXQD 2Y36H 4RAHA 1D5ZB 5D1QA 5B3JF 2P5WA 2F19L 3VRLF 1S7VA 1OAZH 1P5UA 1KGCD 1VGKA 5FGRA 1CD0A 4KJQC 1ERNA 2C3VB 4DVBA 4J4PA 1UACH 4XPBH 2MTPA 1RZ8B 2Y4SA 4IOFD 4PJGF 2Z93B 3V52H 2FIRT 3MV7D 4L8CA 4X99A 4NUGH 4P23A 4BQ8A 2QR0B 4NC1E 1QSFA 5IG7B 5J9PB 2EC9U 3IETB 4ZXBD 1LDSA 1OP9A 2DF3A 4OLYL 1MCPH 4ZTPL 4OV5B 2IQAB 2APBA 3BZEA 3B8YA 3PWPB 4QRPD 1V8HA 2FR4A 3RVWC 3IF1B 2DM3A 4PTUA 1A6UH 4JZNB 4R96B 3UBXI 2EC8A 4G42A 2EXYD 1J8KA 2IQ9H 1WCBA 5IROA 5DRXA 1A1NB 5D5MB 1YEEL 3DGGB 5CEZE 5C09A 2R29H 3NFNB 1FYTA 1DANU 4OZIB 4EI6A 3CFBB 5DI8B 3CDGA 2BXYA 3O9WA 3SOBL 5AYUH 4XXDA 1MCRA 3L3HA 1EGJA 2MNUA 3KDMA 2M8XA 1CD8A 1FNFA 4R26L 1U92A 3QJFB 4R4NC 1F8TL 2NY2D 5GZOD 2NYYD 4PJIE 1DLFL 4DAGL 2J4WH 4AEEA 4UDUB 4F7CA 1U3HD 3SHSA 3VD3A 3BIKA 5CP7A 1YDPA 3CMGA 1GGCH 3N1GC 3HNVL 1FGNL 1IAIM 1NAMA 3FOMA 4X7TB 1H5BC 2DQIH 3RI5K 2EIZB 3QNYB 1N6VA 3TT1H 5IBLC 2CR3A 3IJHB 3D39D 5IB3A 4ODVH 2ED8A 2ZG3A 4BSWA 4G6KH 4ZFGH 5FHBL 5LAXB 5C8JB 4F3FB 2ORBH 3D9AL 3BWUC 3V4VL 4PJ5B 5I1DA 4I0PA 4LSPL 5EBMB 2VZOA 3VD7A 5ID1B 2YD6A 3NTCH 1N6QL 1ONQA 5DRZB 5DS8B 2NQCA 2VN4A 5GIRA 3SY0A 5C0FB 1TPXC 3EYQC 2DBJA 3QBTB 4KRPD 5AZ2H 2WSKA 4NJAH 1CS6A 3DI3B 3P9MB 1NBZA 1ND0A 1F2XK 3HCVB 3MV8B 3MXWL 1DQJA 4LKCB 1T1YA 2G5BA 4PJXA 1KJVB 5KS9F 3TWCL 2XRAL 3T0VA 4ONGH 1CDGA 1HWHB 3PP4H 4H88H 3T1WA 4Q74A 1JV5B 4MAUL 3CXDH 5D96C 4MD5A 3UJIH 2FSEA 1PLGH 1BOGA 4NBZB 3RZCA 4MJ4A 5JHLL 3T2NH 1A6VL 4PRHB 2ITCA 3ZKSD 3CX2A 2B20A 4HDIB 4P9HL 3C2SA 4NZRL 4YAQA 2NY5H 4J3OC 4NO0B 4RISH 1D5MA 4WW1A 5IMOB 4FQCH 1JWMA 3KJ4B 3WE6A 4RMUA 1X5KA 3C5SB 2CLVB 3MREB 1AQDA 1Q1JL 4PJBF 2D31B 3KPMA 2XZZA 4JY5L 4LHUG 5BZWB 4OJFH 4K94H 3D2UB 3GBNH 3QIWC 5EIIB 3AFLA 5KJRH 3RX8A 5EH1A 5CINL 1LK3L 1T89C 1VDGA 4F57H 2HKHH 3HAEH 4HIHA 4NBYB 2G2RB 5KSUA 5FB8A 5BQ7A 4KFZC 3VG0H 2AERT 2YA0A 4GH7B 4YEFA 4WHDA 2OJEA 4JM2A 3DVGB 2FATH 4GW5A 1NDGA 1I8IB 3T04D 3UO1L 4KK5D 3PQYE 2DYPD 4WHTB 2XTLA 1NJ9A 1H5BA 3S8WA 3MV7B 3H3PL 2R9HD 1MJ7H 3V6ZB 1U8QA 1OL0A 1K3IA 3O6ML 5DTFA 2A9MH 4NDMB 4RZCA 3VXOB 2PTVA 4G6MH 3BUYA 4MXWH 3DSFL 4R97B</