2XFXB

Cattle mhc class i n01301 presenting an 11mer from theileria parva
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
AIQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC CLASS 1
publication title Mhc Class I Bound to an Immunodominant Theileria Parva Epitope Demonstrates Unconventional Presentation to T Cell Receptors.
pubmed doi rcsb
source organism Bos taurus
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xfxB00
4XWGH 5C0BE 1DP0A 2PO6A 1BP3B 5JO5A 3RWFA 3S3JA 1J18A 1HEZB 3GMNA 2DQHH 3QWRD 3BKCL 3GUTA 3SGJA 1V7MH 4U7MA 3W0WE 1MIMH 4XHJC 1ZK9A 2O5ZH 5HJ3A 3OKMA 1DR9A 3KNBA 3VFRA 3BUTA 3QG7L 3HMXH 5FEBA 1MJJB 4NO2A 3VMOA 2VL4A 4QEGA 4HFWB 4X6BA 3NCBB 4OV5B 5I1KL 1QA9B 3LPGA 4HJJL 5KG9A 3SE4A 4GBXC 4MD5A 3R06B 1U8PB 4MA7H 4X6FB 5C9KA 5CGMA 1U8IB 2NXZD 4WFGD 4Z0BL 1UEYA 2A83B 4ONHB 5EU3B 4ZQKB 5ANMA 5T1DH 4MAYA 4GW4A 3STZB 1DBJH 3WJJC 1WLHA 5ANME 5KJRL 1HI6B 1MY5A 3MLPA 1JGEB 4LCWD 4OFVA 3UAJC 3RL2B 3HE6C 1RHHA 4H25B 3VRIA 1B2WL 2EYSB 1LP9B 4PJGB 4WFFD 3MGTB 3GI8L 4C59B 2B4CC 3O3AB 1HXYB 2I5YL 1KJ2H 3HRZA 5HTSA 4H8WC 4CVWA 4LCCC 4TTDD 4PJ7F 3UX9B 1QSFB 4KKCC 4ZOAA 3D25B 3IETA 5FYKL 2WQRA 3BP7A 3GSQA 1TETH 1NH6A 5FCUH 3QEUB 1RSFA 4EN3C 1J1XL 2D7TL 2HWZH 3AM8C 3U9PL 1WIOA 3T0DA 2R8SL 3DRQB 3ARUA 3BYTA 4L1HA 3QDJA 5J12C 3MRHA 1F3RB 4H1LH 2GJ6D 1DQLL 3QDJE 4ZD3L 5D4QA 2OK0H 3KJ6H 5CHNB 2GHWB 2YMXH 3BISA 2GK2A 3QWRA 4X8XA 2EH8H 3VCLA 3BIBX 4KKLC 4OCXH 1F3JA 4BH8B 1IGTB 1SYSA 2PETA 4G8IB 4JQXC 2BVYA 3NIGF 3QDMD 4JO2H 4KQ3H 3LD8B 2D3VA 3UJJL 3QJFB 4K7PY 5HHMD 3X12A 3H7LA 3O8XC 3T0XA 1OB1B 1TPXC 5FDWB 2LAGB 1MSPA 1CGSH 5DD5H 1RJLA 4F15C 4IRZH 4WFGE 3LEVL 1YNKH 4X7SH 4FQ1L 3EOBA 3CXDH 3SDAB 3V79C 3TJHD 2V7NB 1ZOXA 3NCYS 2UZIL 4MXWH 4LCWE 3SO3C 5F9WC 5DJ0A 4NQCD 3OGCA 1BIHA 5KTEL 3DOSA 5DFVC 4DN3H 2NNAB 1AFVH 3QZWA 3KXFD 3QXVA 3DO7A 2GTZA 3W11C 3WXVH 1IFHL 3RIAK 3QHTC 3QPQD 2WBKA 5K9OB 3ULVD 2HJKA 4WWKC 1ZWIA 3IFPB 1MAMH 2QQNH 4DFHA 3LB6D 1RULH 3GSRB 1FG2A 2CKBB 4ODWA 1RV6X 1H0DB 5GS0C 4DAGL 4Z76A 2GJ6A 4WO4C 3QRGL 3EYUL 3GK8H 2GJ6E 3WE6A 5CZVH 4PRIB 1I8KA 4ZG1A 3BP6A 1CGVA 2AKRB 3GMQA 4UBDC 1F4AA 4MWFA 1W72L 1M7IB 2K1MA 4G43B 4YEEA 1J87A 5D7IB 5I1IL 1NEUA 4HUNB 4PJ9C 5EG6C 4KUZL 4Q74A 5LJYH 1LO3H 1KTDA 3PGCA 3QDMA 1AR1D 2OTUA 5EU4B 3ZLQC 3DXAD 1QTYT 1IE5A 1E0OB 3LIZH 5I30L 1D9KC 3QDME 2ZUYA 1MAJA 2R1YA 4PLKC 4S11A 4K7PL 1ES0B 1MFAL 4QHKJ 3TBVA 2ITCB 3JV5A 5EFIB 5HHME 5JXAH 1KENL 4YHZL 4EDXB 2MFNA 1JTPA 3HAEA 4OD2B 4HKXB 1DUZA 5EZOL 3RQ3A 1HYSC 3BPOB 5CZXD 1SBSH 1UQSB 2FATH 4UILH 2EXYD 5HGGS 4HUUA 3RGVC 4LLMB 3RVUC 2OSLB 3CFKA 5JIPA 4L8SA 2DYPD 4NQCA 1JPTL 3O9WB 1XGPB 2HFGH 2F58H 3UTZB 4ZTOL 2AJSL 3KXFA 4NQCE 4WNQB 3L9RA 1W0WB 3VU2A 2P47B 4YPGB 3QFDB 3KXFE 3BVNA 3SGKC 1QBML 15C8H 1MEXL 3OWEA 4NWTL 3PGFH 3QYCA 4JFQA 1NCBH 5FO7A 1FC2D 3ULVE 3UZQA 3Q48A 4JDZA 2F5BH 3O6KH 4MLSA 4JQVA 3L3IA 3PQYB 1KPRA 1UKTA 2DBLH 4DCQB 4PBVC 3NPSB 1AO7A 4LL9A 5MENB 3MRRB 3MO1B 5BOZG 1S9XB 5CJQH 3P11H 1UM6H 2EE3A 5F70A 4UT9L 4YBQD 4NQVB 4MNGA 5TDNB 3D87B 4R0LA 3V6ZB 3V5KA 5JDSA 3VXOA 1P1ZA 1GCFA 1JZ2A 1OARH 3DXAA 3STLA 4P23B 5INCA 1U8HA 3UJIH 1Z3GL 2Y72A 3DXAE 1Q9KB 1LO4L 3CU7A 3EO0B 4LSSL 5JTWA 3KPMB 1D5IH 2QKIA 3IJYB 4R26L 2PXYA 3T4YB 3MRDB 2X4TA 3SDCC 1RVFH 4XVTL 1JWMA 2NTSP 1U8KA 2YEZA 2EKSA 3QG6A 4LHQB 2VISA 5KSBF 3LN5B 3N85L 2WLZA 5F1IA 2EDWA 4IBLT 2J88H 2DYPA 4BSWA 5JNYB 4YQXL 5HDLA 2XTJD 4W6YB 1TVBB 3MACL 4BH7B 4U1JB 3UDWA 4HLZG 4FQPA 1ACYH 3HUJA 1B0GB 3MSPA 2YZ1A 5IB4A 1V5JA 4I3SL 2RCSH 2VQUA 1OSZB 2ZOKB 1DZBA 3QHFL 4LPVA 1EO8H 3NBNA 4UQ3A 1FO0A 2QHRH 5DMKB 1QEWA 1ZV5A 4R2GD 3VGAB 4YHIB 2CPCA 5JZ7D 1XIWB 5IWLA 4KU1A 2XWJB 1DSFL 1F97A 1UM4H 4O5LL 5CSBA 5IVXA 1MHHB 4WJ5A 5E03A 3RZCC 2WW8A 2W92A 5IB2B 5TF1H 3SKMB 2Z9TA 4AY0A 5AYQA 1FV1B 3JTTB 3UPCA 3M17A 2AJXL 4TUJB 1M4KA 2XV6B 3QFJB 5I66B 3QHZH 2HLFD 4YDVB 4NC2B 1FFQA 4Q6IC 1OAUH 5LBSH 3G9VA 4JN1H 4F33B 3G6JE 1MFBL 2NX5B 3KLDA 4NKDB 1AGFA 4PGDA 2O93L 4KRLB 5F7MC 4PV8A 4XMLH 2X5PA 3S35X 3TN0D 3ZDYE 4MNHA 5C08B 5D6CB 1SJEA 5GZOD 4LLQB 1DUYB 1KIQB 5TDOA 2WIMA 1S7QA 5H2BA 1UWEH 5JR1H 3TNMA 3VXRB 4ONFH 5E2VL 5HD8D 3PWPD 2AXGB 3QIBD 5D5MB 4BFBD 5JQ6H 2YD1A 1GHFL 4NM4L 2D2OA 1JHTA 1S78D 3G5YA 1EIBA 4KUCF 4KVCL 4NOBA 4XP5L 4HIXH 4P9HC 3S96A 2JIXD 2I27N 5KOMC 3QB7C 1XAUA 2XTJE 5DUPL 2R9HD 1YY8A 5KSAC 4MAUH 4RFOL 1RZ7H 2IPTL 3F6LA 1U3HC 2DQUH 4UOW0 4DKAA 2JE8A 1NJ9A 3FHQA 3QA3B 3NGBB 3BXNB 1IKNC 5DMIH 3G5ZB 4CADA 3OJ2C 1ZHLB 4RBPK 3MRPA 2YUXA 1FNEB 1AH1A 4KZDL 4XNQB 3V4PH 1AY1L 4XP6L 3BZEA 3VRJB 1K5NA 1QO3B 4R3SB 5GRVK 4P4RA 4PYHA 1I3RB 4U6HB 2HTLD 2ZCHL 5FFLA 4MB5A 4O2FA 1MJUH 1N5AA 4WTZG 1WIPA 2A6JA 4JKWA 4F37F 3QDGD 5F89A 1M6OA 1I8LC 2GEEA 4P2OD 3VFGH 4GOSA 1EH9A 1PSKH 5DK3A 2JKXA 3E6FA 2CIKA 1QFWI 4IOIB 5E95B 4FZ8H 4LARH 4NUGL 1I1CA 4NM8L 1GIGL 1P4LA 4K3DH 4NZUH 4JDTH 4WV1A 2R0KH 3FQRA 5I71C 4N90D 3NFPA 3DYPA 1S7WA 1NLDL 1CVSC 1CE6B 3DX8B 3TN0A 1A9BA 5FYJH 5HHXL 1T66D 3QNYA 3SE3A 3MROA 1CXLA 4KXZH 5FOBB 1I8IA 1U3JA 3LKSB 4HUMB 4WTZA 1RJYA 3W9EB 4BZ1L 3PWPA 3QIBA 3QH3B 3BAEH 2KL6A 4KAQL 3RRQA 3TH2T 3WL9B 4L8DA 4OCNC 2HKFL 1MQ8A 1TZGL 4OBSA 3MRQA 4KMLB 2A1WL 1SEBB 3BDXA 4U2YA 4GQ9L 2R0ZL 5I6XC 3UYRH 1B88A 1IC7H 2AJVL 1J12A 4R90L 4LP4A 3SE8H 3MA7A 2J8HA 4UDUB 1QHOA 1QLFA 3GI9H 1LEGA 1RJCA 4LNRA 5AZ2L 1K4DA 3WFZA 1WBZB 2COQA 1MHPH 4AEHH 2O61B 3PUCA 3T0EB 3BPNB 2NY7L 3ARED 2XZAH 5DD6B 5HHQA 2Y7QB 1CBVH 5C0DA 4HEPG 4YBLB 3NCCB 4X0KA 3TT1L 1KB5L 2VLLB 5L8KB 4P2OA 4P99A 4TVPH 3QDGE 5GGUB 2MCPL 5KAQG 1Y18A 5LXGL 5D93C 3LVEA 3OKKB 3FOMB 1Q8MA 4OB5H 4Q0XH 4HPYH 1MFDL 1A6AA 3OHXA 4R4BA 5DO2D 1G84A 3IU3A 4JY5L 1FZOB 3V9FA 3WXWL 5CS7A 2ZSVA 2P4AB 4Q9BA 3OB0K 3ROLB 4D8PA 3VXSD 4P2RB 5K9KA 5EU6B 3K8LA 3LHPH 1R5WA 5F6HJ 4FQHA 1N64H 4OLVH 5HXMA 1UB6A 4LLUB 4HHAA 3L7EB 1BD2D 4TOYL 3VXPB 4OF0A 4HXAL 2E3VA 2WUBL 4X9BA 1J5OH 4UNTA 3H3BC 5DEFB 3BO8A 2GSIA 1ZA6A 3G6DH 3UC0L 4Z7WB 1BF8A 1JP5A 4OCLC 1Q9LB 1BWWA 5IEKA 3HG1D 3EJZC 4HS3B 5E5RB 1T7WA 3RNQB 43CAB 1M71A 5BQ7B 3MLUL 2R69L 3WDJA 2PO6B 5DJ6A 3W0WB 2UY6A 4PJXF 5IROC 2QEJA 4BSVA 5JIHA 2IG2H 1KIUA 3VWKB 1Q0XH 4ZDHA 4IHOA 4JANA 4M5ZL 4IEFB 3TT3H 2X1QA 3H7BA 4X5WA 2JCCB 5JW5B 2J4WL 5TFSL 5LWYH 3AREA 4HWEH 5L6YH 5EU5B 4OZHF 5LG1A 4ELMA 1L0YA 4PJDF 1VA9A 4PJIB 4XTRC 1A2YB 1HKLL 5IOPB 1FZJB 4ELME 3TBYA 2PTVA 5IEHB 2V5RA 3NFNB 3TVMC 3H9HA 4U1IB 4CNIA 5GZNC 4HX1A 2BC4A 12E8L 1P7KA 5TGBB 3GBMH 2B0SL 3FO0H 4KVNH 4U6VH 1P4IH 4F8TA 4MQXC 5IBTH 3MLXH 2WLYA 5HVWA 1PG7X 1QSVA 3L3OB 4JKMA 3VXSA 3I3DA 1F4XH 1GOGA 3DV6B 3PIQB 3O11A 3OPZL 3UTTD 2LVCA 1EGJH 3FZUD 5DURB 4QHKI 3JZ7A 3WSQL 1TJGL 5EWIH 1A21A 5F3BA 4GAFB 1BD2A 1F6LL 5J1AB 4F2MA 3C60B 3DVNB 1MELA 2ZUTA 5AEAA 5ACLA 5JUEL 1BD2E 5EZLA 3RPKA 1PW3A 1QRND 4JFDD 3K2UL 1VFAB 3K1DA 5C8JA 1CXEA 4OI9A 4JPKL 1G6RA 1EERB 2R56H 4U4BA 2VYRE 2X4OB 4QYOB 1SY6A 5E6YA 2Y07H 3HG1E 4WGWB 4XH2A 4K3JH 3SKOB 2J8OA 4LCYA 2FO4A 5ERWA 4F7PB 1UEMA 1KCRH 1U8OA 5CP3H 2BVOA 2BRRH 1AD9A 4UT6H 5GSVB 1WZLA 2OJZH 1SYSB 3SDXF 3FQNA 1IBGL 1MHCB 3VXTA 2P1YA 1T2QL 3BE1L 2BERA 3SPVB 2X7LA 2GTWB 35C8H 4PRBA 5KZCD 3MFFA 1YEIL 5IKCA 5F1NA 3BP5A 4DW2L 4GXVL 1T83C 2PTTB 3GHBL 4U1SB 3B9KB 2NW3A 2BVPA 4H20L 3OR7B 4XPBL 3VJ6A 4HIJA 3JWDL 2DQEL 3GRWA 2YRZA 4JM2C 4F3FA 3HI5H 1H3VA 3CFEA 1F6AA 4N9GB 5ICZB 4KTDL 3K74B 3WS3A 1U58A 4LDEB 4LCWB 3S98A 2VH5L 4GRWH 4Z78B 5BVPH 2OZ4L 4G7YH 1CFVH 4Z8FL 3L3GA 4OCSH 1A4KA 4OGZA 5F21B 5FYKD 3OGCB 3UTTA 4BFIB 5B8CA 1UENA 1U2HA 4NDMA 4LHUB 1I7UA 5IMMB 2BOBB 5HYEA 3TV3H 3UTTE 3LSOB 2X40A 1MRDH 2AABH 4ZPTA 1CFNA 2QSVA 5ITFB 5A2JH 1CF8L 1ZAGA 3REVA 4QRSB 3FO2B 2X6MA 1I9JH 1QRNA 2NY4D 4JFDA 4PJCB 4L3AA 2OR9L 1QRNE 2ADIA 4JFDE 1F4HA 1R24A 2GAZA 4G8GA 4XX1E 3BQUB 5IMOA 1PQZB 2XICA 5AZEL 3LN9A 4OZFG 4XPFH 4ZOCA 2YA1A 3GMQB 3I6GB 3D69B 4HKZA 2X70A 5B39B 2VN7A 4FFZL 4Z7QF 5JHDD 2XZQH 1BVZA 2UYLA 2MSPA 5HDQH 3EHBC 1K2DB 2H2PC 3QDMB 1IC4L 4QHLA 4WW2A 1R5VA 1OW0C 3ZYIA 4G8FB 3BN9C 5DJAB 4FTVB 1NLBL 4EDWL 3P4NB 4M6NH 2WK2A 3DURA 2NY1B 1I7ZA 3KYMB 4QRTA 4OTXH 5J6HB 5T3ZH 4B0MM 2BNQB 3HAEB 3RJDA 1G0DA 4X4ZA 4ODXA 1AQDB 3HC0B 3MLVL 2IMNA 3IDXH 3ZKMC 3EIFA 3QNXA 4HFUH 2HTKC 4Z7OE 4LRIC 5FO9A 3OR6B 3AMLA 2XKNB 5DDHB 4IRSD 4Z7VA 4L8SB 1IILE 5E8NA 4Y2OA 1WVZA 3UZVB 4Z7VE 4HK0B 2VIRA 4XZUA 4CW1B 3R1GH 4LSUH 1BFTA 2VTFA 1NDGA 3P3YA 3BRDA 3AUVA 1KIRA 4XHJD 3QIUD 3ZYOA 1H5BA 4KTYA 2R23A 5I19H 5DZLA 1JYXA 5CBEA 1IGYA 2R4SH 4PGEB 4AMKL 4K23L 4X4XA 5I0ZA 3ARBB 2VZ1A 1GAFL 4GG6E 1T1ZA 1I3GL 4OJFL 4N1CA 4FA8A 3U4EB 1LDPL 2VLRD 3MREA 5E6IC 3MOBH 1F2XK 4DVBA 1DVFD 3IJSB 5GJTL 3MRBB 4K3EH 5C0RH 1XEDA 4CMHC 5JHDE 4JFYB 4JDVA 4U1KA 5JDSB 2HT4C 5DVKA 3WKNA 1AGBA 2ZJSL 4F37K 1PZ5A 4UQ2B 1ZT4A 4ZUUA 3MRKA 4QT5A 5HHOD 1FVEB 5HVFB 2CIIA 2WSKA 1BEYH 3ZHKA 1QPPA 4XBEH 3K0WA 1X5XA 2OMNA 3D3VD 4U31A 4OGAD 3O6LH 1I7RB 4PJ8B 1OAXL 1KIPA 1U8KB 2KDGA 5JA8B 5ALBH 2FYYB 1HH6B 4C4KT 1NBQA 4W4OC 2APFA 3CVHH 1ZVHA 1N3NB 4LVOB 3D9AL 5F1IB 4KRPD 1SBBA 5HVGB 1U0QA 3TO4B 1XGRA 4Y1AD 3BW9B 5HHNB 4Y89A 1G9NL 3LZFH 5D2LF 3QXTA 1OAQH 1FZMA 3TA3D 1HE7A 4LK4A 5ELIA 1LO0H 1ZT7B 3QIUA 4ODVH 3DX7B 1IQDB 1OTUD 4NSKA 1S7VA 4JB9L 5IIEB 1BWMA 3E8UH 4P5TD 4OI7A 3QIWD 4M7LL 5MERB 1BZ7A 2Y5TB 1W72A 1TCMA 3SY0A 1EMTH 1JPGA 1JPSL 2BVUA 1JN6A 3PHOA 4TSCL 5DQJB 1KXTB 2XZCL 1T1XB 2CR6A 3LOWA 2MMXA 3ELAT 5EC2A 5B4MC 1C08B 5CKGA 3ZKNC 5BV7L 1AGDB 1DVFA 2VLRE 5KSVB 2A73A 3G6JB 3V6OC 2GKIA 3QP3A 4D9QD 5GGTL 4L9LC 1FORL 1OTTD 3VH8G 5GS1A 5H35B 2OLDA 3ARSA 1DEEA 5HHOA 3N06B 5D1XB 5LGKA 1UWGL 3Q1SL 5HHOE 3RA7H 4XI5C 4ZFOL 1XGTA 2W9DH 3IF1A 1Z9OA 4GMTH 3D3VA 3FQTA 2Q76B 1RD6A 5BZWB 4W81A 4X99B 2ZUUA 1AR2A 3D3VE 5H2BB 3MLRH 5LVEA 5D71L 4XVUD 5T1KD 2Q20A 3HA0A 5GS0D 4PGCA 5ECJE 4QTHB 4MLIA 3G5YB 4MD4A 4Y1AA 3QCTL 4RQQA 4YZFF 3OV6A 1BIIA 1SM3H 3GMMA 3VFNB 4OLWH 4YGAB 4Y1AE 4HUXB 1MFEL 3GSUB 3KG5A 3QUYC 4MJ6B 4O2CA 4UIMA 1JK8A 3VH8A 5C0FB 3TA3A 5GS3A 5D8JH 3S36X 2GSGB 4JFHD 5HYSB 3C8DA 3QDAA 4FFVC 4YHKH 3WNPA 2V17H 4P5TA 4PJ9D 4BZ2H 3KYAA 2VZSA 5TH2A 4JFXB 4RMVA 3QIWA 1WEJL 4G9DB 4U3HA 2EIEA 3D18B 3JXAA 4HCRL 2QSTA 1P84J 1QKZL 3C6LC 3CMOH 3DWTA 2J5LC 2G60H 5I74C 3O6MH 4KKAC 2V2XB 2AJ3A 4OLYH 3ULVF 4IMLB 3QXAA 5E2WH 5FGBA 2IADA 4M9OA 1C5CH 5EN2B 4F58H 5JORA 5C86A 4LMQE 1A3LL 5D70H 3F12A 3FONA 1P4LB 4PJBA 1MIEH 4KKNA 4WV1B 2ZUWA 3FQWA 1DLFL 1YY9D 1KFAL 4PJBE 1J86A 4R9HA 4XPTL 4JN2B 5I8OL 4RGOH 4FG6D 2GCYB 4DN4H 2ZUQB 3X13B 3TF7C 1T89C 1I8IB 3NTCL 4G8EA 3VD5A 1LEIA 4OLEA 1TQCC 3L6FB 4KQ4H 3QCVL 5T1KA 5D96B 4EUPA 3MMEA 4HSQA 4KROD 2R2EB 1FFOA 2VDQH 3KDMA 1MVFA 1DQDH 1S9VB 2CK0H 2HH0H 5IMKB 2A0LC 1A6WL 2F5AL 2JIXB 3DJ9A 4QRQA 2VDPH 1YYMH 1KC5L 4Y5XC 4U0RB 3RX7A 2CLZB 4NCDA 2WINA 3PXJA 2BVTA 4YGVA 1BVKB 2R0LH 5KVDL 3RFZC 1KN2H 4Y5VA 4RGMC 2R2HB 1JF1B 1IEAA 2GYSA 3CZFA 3OJMB 5EIVA 5E00A 1AXSA 3DROA 3MXVL 2B1HL 1Q9WB 2ENSA 4BZYA 1MCPH 4YHLL 4PJEB 4KHXH 3UBXB 1BOYA 2Z4QB 4HXBL 1NUGA 3HUJF 1KG0A 4PP1D 3QDGB 5I8KL 5BJTB 4H88H 1HIML 4P2OB 1NGQL 4Q2ZB 4X4MA 4PY7A 1E27A 4GKSA 4L4VA 5BMFL 4X9GA 5D9SB 3EYFB 2Q3ZA 1MRCH 5I1JL 3OXSA 4XMPH 1DTUA 3GIZH 1A6AB 3OHXB 3SEPA 3WN5C 3AY4C 5E24E 1N6UA 5CP7A 5IVXF 4YHYC 2YUWA 1MCDA 1H3GA 4NRZB 5K9KB 1RUPL 3I2CH 1E4XH 1HHIB 1CTOA 4F7EB 2Y6SC 1AJ7L 1RUKL 3RJQB 1A9EB 4KI5D 4HHAB 5JXEC 4H26B 4FFWD 3FCTB 2X4PB 3RVWC 4QHMB 4V1DD 5TQ2H 5EC1A 1JFQH 1KOAA 4P4KC 1G9ML 3RWJA 5EZJB 4DGIL 4Y4HB 5FUOH 4OM0L 2D0GA 3RZCD 1QG3A 4DGYH 2YD4A 3GMLA 4K2UL 3PJSA 4LCUA 1DBBL 3VFUA 2G75A 3ARFC 3WFCL 4BSVB 4ZDHB 3SGEH 4IHOB 4JANB 3QUZB 4S1QH 3TO2B 4K7PX 4M43H 5J11C 3KS0H 2EDBA 5CD5D 3HPJB 3MUZ1 2DI7A 5BRZB 1XR9A 5IF0B 3WFHA 3HNVH 3WKML 4S2SB 3AREB 5JA9A 4NRYB 4PJ5D 1X3DA 5EH1A 3GM0A 1FL6A 4O9HH 3AS0A 2ADFL 4LEOB 1PY4A 3QJHB 1OP5K 1CD9B 5DJZA 2IH3A 4PP2A 3H9HB 2LAAA 3MV8D 1XF2B 2VRAA 2DLIA 1XGUB 1O0VA 3ILPB 4MB3A 3PNWB 1U93B 2BC4B 3P0VH 4YXKH 4N1EA 1P2CA 4TUOB 2JJWA 5FA4B 1WQVT 1YEEH 5AWNL 4AL8L 5IQ7H 3E1F1 3HE7B 3IXTB 3CLEL 4AIZB 1U3HD 3KPOB 1A1OB 2Z91A 4P59L 4Y2DD 5KS9A 1TJIH 1JRHH 4QNPE 5CFHA 3MLSL 3VGFA 5KS9E 1RIVH 4M8QA 1DBAL 4NGHL 2CMRL 4HWZB 4PJHB 5C07D 4PRAA 2WNGA 4KI5E 2ADJB 4M5YL 1CL7I 4WEUD 1JNHB 2ICWB 4RX4D 4UT7H 2VDLL 3FB5B 4V1DE 4DTGH 4JPWH 4OGYL 1UACL 3KPPA 5JW4Q 3BP4B 3HG1B 2HLAB 3FRUB 4XWGL 4WCYH 4ZUTA 3RY6A 1J8KA 2F15A 2PYEB 1HXMB 3DYOA 4M6AA 4X4YB 1V7ML 1CD0A 3WIFA 1MIML 5D1QD 4J3XA 5HI5C 2O5ZL 4MNQD 1BM3H 3WS6C 2LU3A 3GMOB 4WEBH 4Y8DC 4KJWC 1NBZA 3HZMA 5EBLA 1UA6L 4P2YA 3X3GH 3LN4A 4JG1H 1KB5A 4DZBA 3RNKA 4JPIB 3WHE0 5IW6A 5E8OA 4PJ5A 2IQ9H 3MV7B 4P3CH 4PRBB 2DQDH 3BEVA 3WUWB 2H2SC 5IKCB 4PJ5E 5F7DA 2YD2A 5CJOL 1AQKL 2DIAA 4UV7L 1PVHA 2NY3B 3O4OB 1IAOB 3ARVA 3DUSA 4Y4FC 5T1DL 5JPNB 4YC2B 1TMCB 4H0GA 2J12B 1DBJL 4TRPH 3OAYK 4ZUSB 3MV8A 1G7IB 5TE4H 2Y06H 1S5HB 2HFEB 5HYJD 4JHZA 5KVFH 1XF5A 1KNOB 3MV8E 3GSVA 4NNYB 5DSCB 3L7FB 3FB7B 4HMEA 3IAGC 1WT5C 3L3GB 4F9PA 3G08A 1N7MH 4P57A 4NNXA 1KJ2L 4Y2DA 5C0IA 4PFEA 4OIBA 1S8DB 3B2UC 4PJGF 1MF2H 1EZVY 4XP1H 2XN9D 3BZ4B 4LMQI 5FCUL 3BESR 4Y16D 2HWZL 2P8PA 3RTQD 1TTFA 1D5MA 5C07E 1IGJB 1QRNB 2IWGA 4GLRI 4RX4A 3SDDC 5CJ5A 1KJMB 2DJSA 3WLWC 3Q3GB 4LPCA 3ULUH 1R24B 2PN5A 3WLBB 4WI7A 4PRNA 3BIKA 3UYOD 5CJBA 4CKVX 2CKBH 2OK0L 3KJ6L 2VAAB 1JZ4A 3SDAC 4HBQA 5I17B 5IMOB 3VG9B 5A40E 1TJHL 3PWVA 3NZHH 2EH8L 1E4JA 1UKQA 2Q7NA 5D1QA 1T21B 1MUJB 4CMMA 3ES6B 4MNQA 4OCXL 4I18A 1RUAH 4Y4KB 1T1YB 4MNQE 3U83A 1X5AA 5KAQF 2UYLB 3IDIA 1RZGA 1FBIH 4J3UA 4I0PB 4DOHE 3C2SA 4CN1A 4JO2L 4KQ3L 4KJYB 2G5BA 4JFOA 3CC5A 1I7TB 1QLEL 4XCNB 1A7RL 3PWJA 4IIQB 1D5ZA 2IALB 3E2HC 2Q7YB 3ULUC 2BSSB 5DD5L 1T2JA 3EO9H 2H32B 1BQHG 1U3ZA 3R8QA 5BXFB 4JJ5A 1KPVB 1YJDH 1YNKL 2D4DA 4X7SL 3GFUA 3CXDL 3GMPB 3VG0H 1FVDB 4YK4C 3RVXD 3VGBA 5HYJA 1TQBC 4YDLC 1GVIA 1MCOH 4MXWL 5HYJE 4CGTA 5IV2A 4YDIH 3MXWL 4ODBD 3O2DH 1UXSA 3QNZA 5FECB 4ELMF 4MS8C 5CGYC 2EDTA 4FNLL 5MEQA 2ZOLB 3IXAB 3V6FB 3WXVL 1PEWA 1U8JA 4YAQA 4GQPH 2XN9A 2DLEA 2QHLA 3SCMD 3RP1A 2R23B 5D7SH 5DRXA 1I85C 4Y16A 1MAML 2ZUSA 2XN9E 2QQNL 3RTQA 1BQHA 2C3GA 4OF5A 3U0PA 1RULL 3AB0B 2CXGA 4OZGB 4GG6B 4KK6C 3GK8L 2OP4H 3BPOC 5DJYB 5CZVL 1UYWL 5JPMB 3AGVA 1T1WB 5HYQB 5J3HD 3MREB 4DVBB 1GOHA 1NCAH 3TVMD 2G9HA 3T2NH 4EVNB 1KJVB 5JHDB 4GW5B 5I9QB 1KLGB 4JDVB 4MCYA 1LO3L 3WHXB 1F3DH 2AK4D 2QBWA 4Z7UA 3BKYH 1IVLA 5D7IF 1OAYH 3LIZL 5IQ9A 4Z7UE 5DQDH 4QT5B 2UUDK 1EAPA 2OI9C 5FB8A 2ZNWA 4RAHA 5JXAL 1RQ5A 4LCIH 3OQ3B 1GGYA 2WV3A 2FR4A 1JHKL 1LK3H 4DZ8B 2OZ4A 4RWYH 5F93C 4GO6B 1SBSL 4FN0A 1Q1JH 1T04B 4XPAH 2Z92B 2FATL 3QUXB 2HG5B 4UILL 1SJVA 2GITB 1Z0MA 3QEHB 4RNRB 1P4BL 1BECA 2V5MA 2MJWA 1FL5B 5JLZB 4IRSB 1XGRB 3E6HB 5T3XE 3CNKA 2I25N 4EI5D 2HFGL 3EO1B 1V3LA 1A7PH 4LSTH 3RUGA 1HHHA 1OAZH 3MNWB 5IJVB 15C8L 3PGFL 1FIEA 2Y36L 3C5ZD 3RUGE 3SCMA 4ZPVA 1A64A 5DUBA 3D0VB 3FT4B 1S7VB 3M1BA 2NY6D 5JOFB 3DYMA 3OXRA 4KDVA 2HRPH 2F5BL 3O6KL 5IG7A 4K3HA 1SMOA 3PF2A 4BQ9A 4WI9A 2DBLL 1IL1B 4GBXB 3MBED 4EIGB 3ARTA 5SWZB 4KGJA 4Z0XA 2N7BA 1DL7L 4Q9RH 2H45A 3IDJB 4WHYG 2VLRB 4YEFA 1UM6L 4KDTC 2VMFA 2N4IA 2FX8L 4WI3A 5KSUB 2OL3B 2MQ0A 4ALAL 4CRPA 1OCWH 2EEDA 3HE6B 1OARL 1NKOA 5TDPA 1H3PH 4AEIH 3UJIL 2AK4E 2DAVA 1S9WA 1DEEB 1YNLH 4LBEB 5J56B 4Q9QH 1NAMH 2EIZA 1CLOH 3MYJA 4P46C 4MQSB 1D5IL 3WFBH 3EYQC 4PRDB 1YMME 2P7TA 3C2AH 3D3VB 3FQTB 4OIIH 1RVFL 4M3KB 2BSRA 4Y19B 4EN3B 4RGND 4U7KA 1BVLB 4F7CA 4OF3A 5I1CH 3WEXB 4KJPD 3K4ZA 2YWZA 3ARDD 3FQXA 1XZ0A 2CR3A 5KVEH 2V9RA 5CMAB 5J12B 2X10A 2J88L 4MJ2A 4WW2F 3REWB 1CK0H 2WWMD 4R7DA 4EI5A 1J0IA 2ICWJ 3HI1A 1L9NA 3BFOA 4MJ5A 1ACYL 1RZFH 5DF0A 2H9GB 1LE9A 4NZRL 2RCSL 1AKJA 3ALPA 1JK8B 5T1LD 5CCKH 4BUHA 3TZVD 4OZIA 3GSNH 4FFYL 3C5ZA 4B7IA 3ZMRA 3ILQC 2EC9T 2NXYD 4OZIE 4R7NB 3NIFE 2I9LA 4Z7OF 3LQAH 4D0DA 3WBDA 3ZKQD 1AHWA 1UJ3C 1OAKH 3MYZA 4D9RD 1VADA 2WIIA 2YPLA 4XNMA 4PREA 1F58H 2VSCA 1Q9OB 5DVMA 2Z93B 3BD5A 4Z7VF 3MV9B 1BJ1H 3MBEA 3O8XB 2DKSA 5B3JF 1TPXB 4OQTH 1A14H 5MEPA 1D5XB 2VDRL 5TF1L 5IHBA 1R3JB 3LV3B 3C6SB 1XF3A 4GRLD 1R0AH 2R1WB 1AD0B 1C1EL 1IM9D 1S7SA 4WRLA 2AV1B 4YLQT 5J89A 7FABH 3MOAH 4H5SA 5GRYA 5I1EH 1NFDB 2FSEA 1OAUL 3R8BB 5E7FA 3RPIB 4E42B 3SO3B 4PJBB 5F9WB 1DBMH 3NGBC 3H9ZA 3GKZA 1YEFH 1XR8A 5DT1H 3MRLA 1V7NL 4J2XA 2V9QA 3MUGA 1I1YB 1UWEL 3NABH 5JR1L 4NT6A 1H3XA 4S1DD 4WWKB 3GGWA 3H42H 5EU7E 3UTOA 2VDMH 4ONFL 4TTGA 1M05A 5JQ6L 3ARDA 2BY2A 4RGNE 2QTEA 5CEXA 2WANA 1S7XA 3FO1A 3AXLB 4L29B 4KK5D 5C6TH 2XRAH 3KDMB 4HIXL 4WO4B 5T5FL 2ESVD 4P5MB 3GSXB 5D5MF 3EYVB 2W1NA 5HVHC 1KEGH 4YWGH 4MAUL 5T1LA 1N0XH 5EO1B 1MREL 1RZ7L 2X4NA 2DQUL 4R97C 3TZVA 1E28A 3GO1H 1F4WH 4JZJA 1WC7B 5A2IH 4MX7A 3BSZH 5DMIL 4A6YH 4LEXH 1MJ7H 4PJ9B 2OQJB 2VKXA 2OS7A 4H0IA 3DROB 2GJJA 4Z95H 4D9RE 1D9KB 5GSRA 3OX8A 4X6CA 2EC9U 3O2VH 1MJUL 4X6CE 2DS4A 3ZE0F 1PJ9A 2ERJC 2V2TA 4GRLA 5GGTA 2AJZA 1J10A 1YA5A 3VFGL 1T5WA 1IM9A 1PSKL 2Z8WC 2QL1A 5E8EB 4IMKA 3O3BB 1KTLA 4NFCA 4C83A 3R0NA 1LWRA 4FZ8L 4LARL 5FUZH 4JREB 4LF3B 3RGVB 4ZFOA 2J6EL 2DM3A 1J1OH 4NZUL 4JDTL 1ZSDA 2OJEA 2R0KL 4M61B 1EEZA 5AYUH 4M9PA 1BZ9B 4X98B 5DD1H 2X44D 5FYJL 1NSNH 1U8NB 1E4WH 3I02A 5FK9B 1KSRA 2E7BA 3EDKA 4G6AC 1U92B 1CQYA 3GSOB 1I8MB 4QCIA 2W0PA 2E7LC 4UAOC 3BAEL 2DB8A 1ZA3A 3MCLL 1HCFX 4JZOA 5DLMH 4I13B 2FJFA 5SWQB 4M6MH 3V7AG 4HJ0C 3FAWA 2ESVA 1WJ3A 2O5XH 4NRXB 4K8RH 4NKIL 2LQRA 3DX9B 2ESVE 3UYRL 2IGFH 5DMYA 1IC7L 1XCTA 1R3LA 4NYLA 1F8TH 4ODHH 3ALWA 4AENA 1OP5H 2YD9A 3PJSB 3SE8L 1ZGLA 3DTXA 3GI9L 1BJMA 4HCRA 1JIBA 3LKQA 2CLRA 3JVGA 2NPLX 2AXFB 3MRGA 3SBWA 4UDTB 4UOJA 3HFML 4J6RL 2FWOA 4D9LH 4YDJA 2X9YA 1FYTD 4PJAE 1OL0A 2XZAL 1YPZA 3D2UD 4KH2A 2PR4H 4L9DA 4HIIA 1CDIA 4J1UA 4K8RC 1MWAB 1YPZE 3SDCB 3JWOH 4TVPL 3T0WA 4EKXA 4E41B 5IK3A 2NY0D 1NDMA 3QUMB 2XFXB 4HKBB 4OB5L 4QXWA 4YHPA 1FJ1A 4Q0XL 1EHLL 4HPYL 1H3TA 1FDLH 2XQYG 4IOFC 2PO6C 1AGCA 1CWVA 1FRGL 3DV4A 3SGJC 4K07A 1OSPH 1U95B 4LHJB 5IB3A 3QQ9C 3UTSB 5EA0H 3LHPL 1N64L 4PRHB 3HR5A 4OLVL 4FFVD 4FQJH 2HVJA 2PYFA 2DQFA 3SE4C 4CJ0A 5KN5B 4V1DB 3LDBB 4XMKH 4IJ3C 3T1FB 3G6DL 3MJ7B 1I3UA 3DRTB 1H3WM 3RVVD 4E5XB 1EEYA 2XPGB 3S37H 4MAYC 3KPPB 3RZCB 3B2VH 2AVGA 2XZZA 4H0HB 5I1GH 3UTQB 4KTEH 1T6VN 3OAYH 3MQIA 1KLUA 5EOCL 2IG2L 1Q0XL 2Q8BH 5CKAA 3GB7A 4FQQA 1T03H 2EYTA 2Z0BA 3MRFB 3TT3L 5DYOA 5FO8A 4HZLA 3CXHK 3HZMB 3U7YH 4GKOA 4Q6IB 2FX7H 1CGUA 1I1AD 5KOVC 1HDMA 5F7UA 4DZBB 2AQ3A 3EFDH 1F13A 1FYTA 2D7NA 5LWYL 2GT9A 3RDTD 4HWEL 3VFVB 3VFPA 3D2UA 5L6YL 1GGBH 5ISZB 2EDRA 5LGJB 3HLAB 1FYTE 4JHWH 4N0FB 4NUJA 5F7DB 5IR1B 1X5JA 3PDGA 3HB3D 1UKSA 3N1FC 4ESKA 3DUUB 5DC0A 1OPGL 3PDOB 1TTGA 5CJ8A 5EIIB 3ESUF 3WNOA 1MCFA 3CFCH 2YK1H 3MV8B 3V8OA 1INDH 3DX6A 1BQUA 4HK3J 4JE4B 5FYKU 2XWTB 4OUUB 4GKNA 4U6VL 2H6PB 1P4IL 2BHZA 2ILLA 2BRQA 1IAKA 1J0ZA 5KSAB 1F4XL 3WIHH 1FFPA 1U3HB 1EGJL 5GGRB 3IKKA 3VI3F 3VFMA 3U48A 4JKKA 2EO9A 3I75A 2FD6L 5AAMA 2C1PA 1RZJH 4RAVA 5C07B 2CUMA 2NTFA 2ADGB 5D7JD 3QXWA 4LKCB 4LVEA 2IANB 2NXZC 3C5JA 1FHGA 1F00I 2R56L 3BIKB 1UXWA 1HNGA 4GUPA 2Y07L 1WIUA 4K3JL 4ZAKD 4EXPX 2FRGP 4WDIA 3MLTA 4L5FH 2YBRA 2AGJH 4ODSH 3TPUB 1IC5H 4QHUB 2BRRL 4UT6L 3HZVB 3CUPA 4N8VB 5GGQL 2OMBA 1QFWM 3PV7A 1I1AA 5DVLA 2OJZL 3C5SA 1ZMYA 2HFFA 4DOHB 4OFYD 5I71B 3LQZA 1EJ6A 1KBGH 5HGDB 5FA3A 1YN7A 1JWUA 1KJ3H 4TTDC 4U1HA 3DMMD 1TLKA 3RDTA 3W39B 1GGCH 4GAYA 3IDMA 1WZ1L 3TC9A 3RWEA 2BMKB 3EOTH 4JFFA 2FCBA 4OGXH 3L3DA 2C7UA 1P7QD 2UVEA 4C55A 3ZL4H 5D72H 4GKZA 1INQA 3HI5L 5DHYA 4N68A 3TIEB 3HAEH 4EI6A 1QBLH 2A6DA 1EFXD 4QO1A 4NFBA 5I6XB 1HHJA 1CFVL 2YA0A 4M48H 3QNZB 5GPRA 1IMHC 1LNUB 3TV3L 1AE6L 5E9DD 2B8OT 4UIKH 1GZPA 1MRDL 2AABL 3FHAA 5H94A 4NQXA 1AI1H 4GAGH 3OKOA 5KANI 5D7JA 1I9JL 3RTQB 3HZKA 2FIKB 2R2BA 3P4MA 2UUDH 4XC3H 3QEQE 3OL2A 5J4MA 3PXHA 3U7AA 2C1OA 4OKVA 4PJCF 1A6TA 4XXDA 5EB9A 4ELKA 4ZAKA 2JELH 1UZ8B 3TJHC 5KS9F 1KCSL 4JLRA 4IDLA 5D93B 3L5WB 4MJ4A 4KI5F 1A4JB 3NIGE 4L8SC 1ORSB 2P44B 4M7KH 2XZQL 1QSZA 1S7TB 2WWKT 1X5ZA 32C2B 5GGSY 4JRYA 4I77H 2VABB 4OFYA 5HDQL 4MA3A 5K9JH 2OX5A 3RAJH 4LIQE 5I1DB 2F53B 3DMMA 4PGBB 5BS0B 4HMDA 2NMSA 5I8CA 3Q5YA 4IM8A 2PF6A 2YD6A 1OQOA 4JQIH 3ULVC 4X8JA 1EAPB 4M6NL 2RIKA 5FB8B 1ONQA 4H1LG 2C3VA 5EO0B 3LB6C 2IEPA 1HYRC 4FZEH 3JBG7 1P7QA 4OTXL 4NHCL 5EDXA 5T3ZL 4JQVC 1CDCA 2IH1B 3AMKA 4MDIB 4F80A 2GJZA 4TNWF 1OLZA 2Y4SA 1QQDA 3A67H 3WV0A 2BSTA 2AXHA 2Z31D 3IDXL 1KJ2A 1EFXA 3JSSA 1OVZA 4AH2A 1W0VB 4G6FD 3X11B 3D6GA 1YEHH 3IJHA 4ZFGH 5HY9A 1ORQA 3D48R 1YUHB 5IVZA 3R1GL 4R0LC 4LSUL 5E9DA 2XYCA 2O5YH 1XF4B 3GJEA 3RUGB 4L4JA 1AR1C 4W4NA 5E9DE 3EYOA 5HI5D 4H1LA 5I19L 3TESA 4ZPVB 3IB4A 5DUBB 5IW1B 3M1BB 5EBMA 2R4SL 3DIFB 1ITCA 3FFDA 1WICA 5T5NG 1CVRA 2PXYC 4J12A 1QR1B 5HPMA 5DI8B 3MOQA 3L95A 5CZXC 4QLRA 4KMQA 2EXYC 4JAMA 2Z8VC 3MOBL 3O3UN 4ZS6D 4C4KO 4LASH 4U6XB 2Q6WB 1ZVSB 3QI9D 4WUKH 3TVMB 3GEWB 4OFIA 4K3EL 5C0RL 2D0HA 2XWBB 5EPMA 5CD3B 5I16B 3UDWC 3QAZC 1HN1A 4U33A 5L2JA 2AK4B 3X3FH 4JRXB 3MJ6A 3HR6A 1NPUA 5GQBA 3MGOA 5CLTA 4DK3A 2PW2A 2YHGA 4KMTH 2EIZB 1YMMB 1FPTH 1BEYL 2RFXB 1DN0A 2F54D 4AQ1B 3BPCB 1UT9A 1LD9B 2AEWA 1VFOA 2NY5H 2VZUA 5IWLC 5ALBL 2Z31A 2VE6A 3T77B 1KCKA 4JFPA 3S8WA 4YIQA 3CVHL 4LLVA 3VXMB 5FKAB 2ZUXA 2NLJB 3TCXA 1ZHBB 3UO1H 3CCHA 3CSGA 1VFBA 5DJCA 2UZXB 4G6MH 1DQQA 1QYGL 4YBQC 4B53A 5F88A 4CN4A 3SOBH 3LZFL 2C4XA 3EOAB 5LAXB 4JFZH 4XCYA 1F5WA 4RA0C 4TPRH 4U1MB 1T0NA 1LO0L 4OZIB 1NC4B 1BBDH 3E8UL 1Y0LB 5DC9B 2CRZA 3WIIH 1MHEB 4NWUH 4DKEL 4Z77A 1VADB 3ISWA 3GIVB 5I1AB 2JLLA 3PWLA 2DLGA 1NMAH 2FJGB 4ZODA 1EMTL 3Q6FA 5FHBH 1FVCB 3BKJH 2V5TA 3ARQA 2ENYA 2OTPA 3FT2A 3K4DA 4X7FC 1RZKC 1S5IH 3QI9A 4WI8A 2D7OA 2AV7A 1T4KA 2XTJC 4HV8B 1B4JL 1MI5E 1JYVA 2VC2H 5FGSA 4KWUA 1RK1A 1I4FB 3D5OF 4H5SB 3QO0A 1E6OH 2JK5B 3BEWA 4B7LA 3EKCA 1HHGB 4MSWB 4TULH 2P24A 4U1LA 2Y23A 2ZZUT 3WFEH 1CD1B 1N0LA 4R2GC 4L8CB 3RA7L 3V7MA 2F54A 2W9DL 4GMTL 1QNZL 3RHWF 3BWAB 3HNTL 5ENWA 5JZ7C 5D1ZD 2F54E 5C71A 3RWCA 3P40A 2P8LA 4PYGA 3PV6A 3MLRL 1RIUH 4RGNB 2F74B 2X1XR 1A1NA 2FIRT 5CEXB 1MLBB 4BQ8A 1JI1A 3LKPA 4K9EC 5MP6L 4KK6D 3TYFA 1SM3L 4OLWL 3HPLB 2W0LA 4UU9A 5IBLD 5ID0B 2HLFC 5T1LB 5D8JL 3P9LB 4RFEB 1RY7B 5INDA 2ICEA 2XACC 5D2NA 4WV1C 4JZJB 2OTWA 4L4TB 4LDLB 4YHKL 1O7SA 2DTSA 2V17L 5D2NE 2Y1VA 4UI2A 4BZ2L 5HGAA 3RWDB 3TN0C 1L6ZA 3NPZB 2X1PA 3SE3C 5GZOC 2FECL 1JF5A 2VR4A 4OCWH 1EK3A 3F7PC 1JUFA 3M8OL 4RIRB 2QSCH 4X6CB 4N0UE 4YO0B 3CMOL 4B41A 5CEZH 5HD8C 3QIBC 1VEPA 2G60L 4WHDA 2A9NH 3NA9H 2IAMA 4FS0A 3O6ML 5IGXH 4GRLB 3FFCD 5M7QA 1WWWX 4X9HA 4OLYL 1CLYH 4AJ0A 4DVRH 1C5CL 4F58L 4C83B 2EDLA 2R9HC 2V2WA 4QTIL 3H9SD 3RI5K 1RJZA 4OD1H 5D70L 4B50A 1BGXH 1MIEL 1W8NA 2D9CA 1F4YH 4NN5C 2ATKA 2H41A 3PG2A 3GZKA 1HQ4A 4OD3H 5TE6H 2ARWA 2PNDA 1DE4B 1DQJA 1YEKH 2EO1A 2JF1A 1WBYA 5D1ZA 4DN4L 2DQGH 4GRMB 4WUUB 1Z5LB 4QY8A 3CSYB 3UCRA 2I9TB 3CZJA 1K4CA 2C26A 3SQOH 2IBGA 5DK2B 2JB6A 1HNFA 4ZO7A 4FQIL 4CVXA 5CBAA 5F1KC 3I6KB 2HTLC 4QCIB 1PYWA 5JQHC 4LLYA 1L0XA 4KQ4L 3FN9A 1AXIB 1VFMA 2D7QA 3KLAB 1QBBA 1G7LA 3CPLA 4J3WA 3RVTD 2VDQL 1DQDL 2CK0L 2HH0L 4P2OC 2VJXA 3MFGB 2ESVB 4D2NA 2VDPL 5I2IA 4NQEA 1YYML 5FKPB 4M62H 1V3KA 2VQ1B 2I24N 4UZGA 5D7KD 1TTUA 1GRWA 5IJKA 1G7JA 1YMHA 1XCTB 3I9GH 2HJFB 3LKOB 4NN6C 2R0LL 1CICD 3LEXB 3AAZB 1KN2L 1XH3A 1S9YA 1EPFA 4CMHB 4PG9B 4HUVA 2CLRB 3UYPA 2UWEA 1T66C 4QGYA 3VW3H 1LGVA 4PJAB 2UWEE 4F9LA 1NCTA 4KHXL 4YDJB 3ULSB 1PKOA 1YPZB 4H88L 4PJEF 2CSPA 3FFCA 1A6UH 2ZKHL 1ED3B 5ILTL 4YHPB 1MRCL 1N6QL 2HAZA 4XMPL 3UPRA 4HDIA 4FRWA 1HSBB 4JGMA 4ZSOA 1LEKB 3GIZL 4WU7A 43C9A 3H9SE 2E6JA 4QGTA 3BMVA 1AGCB 4ZSOE 4AEFA 1SYVA 1EZVX 3DV4B 4F7MA 5DUML 3I2CL 1E4XL 5JMRA 1KCUH 3H3PH 1DJSA 3AREC 4DKFH 1CZ8L 2DQFB 5TQ2L 4XRCB 1JFQL 3MJ8A 4I3GA 4XPHH 2WP3T 3CFJB 2QQKH 1PLGH 5FUOL 4S1RH 2GUOA 1EEYB 1G7QB 2AP2A 3F65A 5LQBH 5IHZB 3IFOB 2DWDA 1EBAA 1X4ZA 1FNGB 3VXUD 1S7UA 4XNUH 4LFHD 1CICA 1CXIA 2D7MA 1OT2A 1YDPB 5DO2C 5DWUH 5BW7A 1HOCB 5FGRA 2FJHA 1SY6H 4FXLA 4FQQB 2XIDA 1MH5A 4FP8H 2CDGA 1AC0A 5ESVB 2RHEA 1G7PB 1J0JA 1TZHA 2PW1B 3HNVL 3LRSB 1FYTB 3T8XA 4YXHH 4JY6B 2X4SA 4KZEH 5ICYB 4ZUVA 1CG9B 2J6EA 5FDYA 4OZ4B 1SHMA 4JKLA 2HRLA 2R4RH 4XVJH 3EAKA 4APQD 5F7EH 1N2RA 3L3KB 3K7UA 1TZIB 4ZTPH 3P0VL 3OKEA 4YXKL 3F7YA 4HH9B 1YEEL 4WHCA 2WM0A 3B9EA 5HHPB 1QLRA 1NFIB 3BH9B 3QUYB 5CSGA 4TNWK 3BZFA 2FEEL 2DD8L 2EYRB 4HGWB 4ZUWB 5E94B 4ISVA 1TJIL 1K8IA 4X5XA 5GRJL 1IEBB 1JRHL 3VFMB 4TNVK 4YHOH 3LKRA 3X14A 1RIVL 4JZNB 4HH8A 4LSPH 5TPWH 3KWWA 3TIDA 2NTFB 3B6SB 1IKFH 1SJHB 4UT7L 5C9JA 4DTGL 4JPWL 4PJXA 2AI0H 3FQUB 2DTMH 2R0WH 3C6LB 5EULV 3VFOB 2ITDA 4PJXE 2J5LB 4AG4L 4WCYL 3EOYG 5I74B 3VXUE 4QXUH 3EZJB 2WBJD 1BM3L 4WEBL 2YD7A 4NO0D 1A6ZA 5EOTA 3X3GL 1H9VA 4PJDA 4M1CD 4LRNH 5LCVH 3S4SB 5B8CC 3FZUC 4OZHE 4PJDE 2QADD 5FA3B 4HJJH 4OF6A 4P2QB 3RDTB 1N59A 2IQ9L 4P3CL 5AD0A 5A2KH 4OI8A 3QUKB 2BCKB 1HH9A 4PG2A 4YR6A 4OAWB 4NC0B 2XA8H 1TQCB 5IFJA 4APQA 1VENA 1INQB 4TRPL 5IESL 1EFQA 4Q7DA 1FFNB 1DDHB 2H32H 1NGZB 2E9JA 5TE4L 4CVZA 3OJDB 4OLXH 3PL6A 1WFNA 5KVFL 5SWSE 4PJ7B 5J6GA 2AJYH 1FN4A 2NYYD 5K59E 4L3EB 2RBLA 4AT6A 4Y5XB 4PTUB 1A6VH 3P77A 3VGHA 5BO1H 3ARYA 2X89D 5DQ9A 4IDJH 4RGMB 1RPQA 2W60A 4WW2C 1CIUA 2D7TH 1R3IL 2R8SH 1VKXB 4U3CA 4NO5B 4UUJA 3QEQB 4QF1A 2L0DA 1UH2A 2FHCA 1FZKB 4LQ1A 4FQCL 4PV9A 1DQLH 1ZEAH 1QVOB 3ULUL 4OCMC 4ZD3H 2CKBL 5SX5K 4HPOH 4X6DB 3SDXA 1YQ2A 5GGVY 4ZAKB 5C0EA 1J0YA 1B0WA 3IS1X 3NZHL 3VE0B 3SDXE 3MRIA 2VKWA 1GH7A 3D0LA 4YBHA 2WBJA 2UV3A 1KT2A 1T0MB 5DR5H 1RUAL 3QWOB 3L3JB 4NO0A 4TSAH 1NGWA 3BJLA 4CBPA 1FNFA 1M7DA 1FBIL 2HN7A 3B5GA 3WN5B 3G04B 1NEZB 2H8PB 2VLJA 5I8CB 4YHYB 1H5BC 4WEMB 3GDBA 3C87A 2D31B 2NY4C 1NCWH 3EO9L 4UTAH 1WCQA 2WAHA 3RL1A 3LEVH 4NKOB 4YH6A 1K8DB 2CDFB 1U8QB 4FQ1H 1YJDL 3MNVA 3U30C 3C8KB 5E1AB 2W9EL 3PP4H 4BKLB 3VG0L 5IB5B 4OFKA 4Z6AT 3U9UA 4M7LT 4P4KB 1U8LA 1EFXB 1MCOL 4CN6A 1JPST 2GY7B 4X6EB 4YDIL 1AGEB 3O2DL 4ORZC 4AM0B 2X89A 5IVZB 4Q58C 5I9QC 3I84A 1HHKA 5E9DB 4ZYKA 5BZDB 5M94B 3GJEB 3ARFB 5F3HA 5A43C 4QOKB 5J0BA 2EZ0D 4GXUN 3EYOB 2HJLB 3OKLA 1FL3A 3F7VA 5FF6B 2F8XC 4NPYB 5CINH 3O2WH 4JVUA 5E8DL 3QRGH 4Y5YA 1ZVYA 5CP3A 3LH2H 3D85B 5J8OA 2OP4L 2M2DA 3SKNA 4D0BB 1NGYB 1XCQA 4Z7QE 3GM8A 1ZT1B 3CJJA 4OZGF 5ESQA 2DM7A 3EJYD 4JAMB 4O51A 4RZCA 1U91A 5GGVL 1G7MA 1NCAL 4IRSC 4XBGA 3T2NL 3IDYC 4GG8A 1BREA 2GFBB 3NCFB 1ODAA 4P5KB 1RZIB 2OYPA 2OL3H 4XCEB 2BNRB 1NCDH 3BKYL 3PGDA 4M03A 3VA2C 3DGGB 3IGAB 2VUYA 5T3ZD 4K7PH 1MFAH 2YSSA 3ARZA 1CL7H 3QIUC 5DQDL 4OFPA 2W91A 3T3PF 4LCIL 3S36L 5C0ND 2A6IA 2B4CH 1A1MB 3NN8A 4NBXB 3OSKA 2EE2A 5TQ0H 1LK3L 4FXKB 4G80B 4H8WH 4RWYL 5GIRA 4ORGB 1Q1JL 5F44A 2CKNA 3IDGB 4M4PA 5I0DA 4M8VA 3CCHB 3TFKD 1UVQA 1DVFC 4RMTA 2ATPA 4ZTOH 5FAAA 1Y6NR 4PUBH 4WU5A 3U1SL 2CK2A 2CLVB 1A7PL 4XCYB 5HDOA 1PKQA 4LSTL 4WW1A 5E8PA 5C09D 3QPXH 5DHVA 2FLRT 5GS1C 4R8WH 2IPKB 4HK3N 3RWHA 4N9OB 2DIBA 4HG4J 1CT8A 2HRPL 1OGAB 3H8NA 5I75B 4R6UA 4KXZI 4LLWB 5CGTA 3TNNA 1Z9MA 3P4LA 4OGAC 4J8RA 5CSZB 2F19H 3W2DL 2UZYB 2QSQA 2H3NB 1A02N 2EICA 4E0RA 4PB0H 3FRPG 5IBUB 5J06A 3E0GA 3J7HA 4Q9RL 1JPFB 4UT9H 2R39A 1OF2A 4Y4FB 4KRPC 1WITA 1JZ3A 4OLZH 4QRRD 3QI9B 1MI5B 4YFLI 1K3IA 3N1QC 5DRWA 1QSED 1FQ9C 4D3CL 4ZFFA 1RK1B 1H3PL 4P3DA 1MJ8L 3TA3C 4AEIL 5HGBA 3SJVB 3TJEH 1MVUA 3JTSA 3VD3A 1YNLL 1OTUC 3KHOA 4Q9QL 1MCIA 1CLOL 3OKNB 4P5TC 3HCVB 3HZYA 5KSBB 1EXUA 2F54B 3BOVA 4OIIL 1B9ZA 2IFFH 1NBYA 1I1FA 3QIWC 1HILA 3BGAA 3O45A 1KB9J 3FRPA 3RWCB 2P8LB 5DRNA 5I1CL 1B90A 1XGQB 5D2LA 2H26A 1WAAF 3SDDB 1ZTXL 4D0CA 3U4BH 5D2LE 1CK0L 5GS0H 1KEMH 4EUPH 5IFHH 1RZFL 2ID5A 1KGCD 3MRNB 5FGBC 1X44A 3V5HA 2X05A 2Y9RT 5C09A 5CCKL 4RAUA 5INDB 1OTTC 3L5HA 5C09E 3W9DA 3B3IA 2WBWB 4WFFE 3H0TB 3LQAL 5I1LA 3BRGC 3IKCB 3K1KC 3QXDB 1F58L 1HSAB 3M45A 1X5IA 4ODUA 5JW3H 4N0UB 3CSPA 1R3KA 3E2HB 3GSWA 4OQTL 1LE5A 5GHWH 4PRPB 4XVUC 1Q94A 3A6CH 1X7QA 4TQEH 5GGSA 4QRRA 5K9QG 3RKDD 3DBXB 4HGMA 5FUCE 4U6YB 1F11A 4R4FH 1QSEA 4YK4B 7FABL 4QRRE 2EE9A 4RMRA 3MOAL 3ZE1F 1TQBB 5I1EL 4K7FB 2P5WB 1AO7D 4YDLB 1BQLH 1MFBH 1QSEE 1W8OA 1RJZB 5DJDA 5EZIL 1QP1A 1DBML 3V95A 1YEFL 2VXVH 1FLRH 2YPKA 4LOUD 5FV1L 1NGXB 4Y5VC 5DT1L 1NFDF 5HI3D 3CVHA 3CX2A 3W82A 2KH2B 3MCKB 5BOPA 5E2VH 4XVSL 3H42L 1CFQB 2VDML 5CBAB 4YZFE 1GXEA 4LLYB 5B38B 2R1XB 2VLKD 5DK0A 2MHAA 2XRAL 2BY0A 2PXYD 4HT1L 4M1GH 5F9JB 2X4QA 4DK6A 5L2KB 3V0WL 3SKJH 2XA3A 3O6FD 5I2IB 1GOFA 1T6WA 2LE9A 3ARGD 3TBWA 1JNNL 4RFOH 1TENA 3QQ4A 4YWGL 4JREC 1N0XL 1RZ8A 3AFLA 5FOJA 5T5NF 1TCRA 1KGCE 4NFDA 5C0AB 3VD9A 5I8EA 2B2XH 3GO1L 1F4WL 1MCBA 3BSZL 3L1OH 4LEXL 3VFTB 1YY9C 3FB8B 1MJ7L 3LMJH 4J3SA 2J8UF 4LSVH 3OAZK 5GRUH 5EUOA 4FG6C 3QQ3B 2X41A 1E6JH 2AEIT 1Z9SA 5ID1A 2OI9B 1B4RA 3TH3T 1VERA 1UCBL 3O2VL 3KPRD 1T20A 2EDJA 1U6AH 2AEPH 4XGZB 5I76B 1CU4H 4M93C 1GZQA 3KYNB 4KROC 4Y7MA 5F71A 5C3LD 6FABH 3JV4B 1MWAH 3MLWH 4NM8H 2DI8A 3TM6A 3H9SB 3G6AA 4XNZC 3QUMH 4XP4H 3S4SG 1AO7E 1N8ZA 2DLFH 5AYUL 1CFTA 4QRUA 5DD1L 2C4FT 1WCBB 4MNGE 1E4WL 2ZG3A 1P6FA 1ZLVK 3CLFH 4F7TB 4YNYA 4HS6B 4LGPB 3EFFA 1J8HB 1IAIH 3ZHLA 5JW4M 2P5ED 2VLKA 2Q86B 4PP1C 3D39D 5DLML 2PCPA 3ZDXE 3MJ8B 2VLKE 5J9PB 2O5XL 4K8RL 3O6FA 4RA3A 3Q0HA 1IQWH 3ARGA 5ACZB 1YN6A 1KPUA 5T1MA 2MCG1 1NANH 1ETZB 2IGFL 4IRJD 1F8TL 4ODHL 1BOGB 2FZ3B 4DQOH 2I60H 3O3EB 2FGZA 4HJGA 2E7CA 5I1HH 1IAIM 1CFSB 2FBJH 2VITB 2P8MB 3BDBA 4BFGA 2IBZY 4XXCA 3HS0A 2QR0A 3U7WH 1MH5B 3BD4A 3HUJE 4HKJA 1BX2A 3BGMA 4RFNC 4XWOC 4NKMB 4D9LL 4W6XB 4WY7H 2XQBH 3KPRA 5A16B 4P46B 4KI5C 1KB5H 2PR4L 3KS0J 4FFWC 3KPRE 4ZUVB 3LDBC 2MCPH 3JWOL 1FAIH 4JFED 3B8YA 3BX7C 5F8QC 1B0RB 3KR3H 1MFDH 2FB4L 1FDLL 5IVXE 2EDQA 3PABA 3RY6C 4IS6B 3OKEB 3WXWH 3IDNA 2BNUA 2MQ3A 3BUYB 5C0GA 1OSPL 5J1TC 3BJ91 4P9HH 4L3CA 5EA0L 3U6RB 3G5VA 1NAMB 4I5BA 5DJ8B 1BBJA 4S0SD 3GJFA 5CD5C 5CIPB 4KKBD 4X5XB 4FQJL 4NZTH 3X14B 1ZHKA 2P5EA 1RK0A 1UJ3B 2CGRL 2C4FU 3KPSB 3D39A 4FXGB 3U46B 5GISH 3RBSA 1Q0YH 4G42B 2P5EE 4XMKL 2JJTA 3C09C 1MLCA 3D39E 3S5LG 2YC1B 3FOLB 4R96A 3S37L 4ETQB 1AP2B 4IRJA 5HI4D 3B2VL 5IHLB 1BFOB 3A6OA 5LGHL 5DGRA 3VXUB 4R4ND 5I1GL 4KTEL 4UNUA 3CX5J 3KPQA 2X4UA 4XCCH 3TCLA 3AU1B 2Q8BL 1T03L 5CUSH 3BHBA 1MQKH 3PDDA 3GSNB 5C0JA 2YN3A 4Y0GA 3T65A 3U7YL 5EOTB 5DS8A 2FX7L 4OZHB 4U3XA 2B20A 4PJDB 1KTKE 3FTGB 4F9PC 3RWIA 3RX5A 3U2SB 4Y2DC 1C16B 1ND0A 3SE9H 4MXVE 1GGBL 3HI6H 4UMGA 3UJTL 2A6KB 4JHWL 5CEYA 3ETBF 4QXTA 1HQRA 5DJ2B 4LKXB 4JFEA 3DETD 5EO9A 3P2TA 3BDYL 3KPNA 2ZCKH 3W81A 5IFJB 1NC2B 2I07B 3O3DB 2NY2D 3CFCL 4LLDB 2YK1L 3G5XB 3MRJB 2UWEF 1INDL 5SWSB 2B0SH 2QQLH 3CFDB 5F72S 4JCLA 5SX5H 1OLLA 3RIFF 5J6GB 1FN4B 1IM3B 1DFBH 1JGDB 1T3FB 3U0TB 1RURH 1JF6A 5HVHB 1PX3A 5D1QC 1VFUA 4I18C 3WIHL 2QV2A 3F8UB 1JMXA 5DRZA 4R97B 5IB1B 1MFNA 3VFSA 3PWNB 2YD5A 3FO9B 1YC8A 4GFTB 3EDFA 5DJXA 4GW1A 1UFUA 1RZJL 4U1NA 1R5IB 3MRMA 1PD6A 1VPOH 3H9YA 2DQCH 1N5YH 2ARJB 3TBTA 3CDGA 4JPKH 3F6IA 4B5EA 4QHNB 3D1MC 4RDQG 2D03H 4JKPH 4S0TD 5GS2H 5DA4A 2ERJB 4G9FB 3PWPE 5EORH 3VXQB 3H3KA 1ZGLP 3NACL 4L5FL 2AGJL 4ODSL 1HZHH 1IC5L 5ADOH 2VL5B 4CU6A 1MJJA 4A6YB 3VDAA 3FAXA 5K9QI 4LVHC 2BY1A 4HFWA 1KBGL 4OV5A 1QA9A 3BE1H 3DI2B 1M7XA 4G7VH 4NHUB 5T33H 3R06A 4X6FA 1GGCL 3KPTA 2KZWA 4QWWD 5E5MB 4AK1A 1U8IA 4H20H 1UJTA 4Y16C 5IBUG 2A83A 4ONHA 5EBWB 3RTQC 3EOTL 4ZQKA 3HN3A 4N0CD 4OGXL 3CGTA 3STZA 3KPLB 4I48A 2B39A 3ZL4L 5HYFA 5D72L 2W38A 4UAOB 5BVJB 4WHTB 3RL2A 3EDEA 3B5HA 3LQMA 2BVEA 4KRMB 1QBLL 2EYSA 5ESAA 4PJGA 3MGTA 4NIKB 1IGFH 3VGDA 4G3YL 3E3QE 3O3AA 1MCHA 4Z8FH 5ICXB 3MRCB 1P53A 4PJGE 3P73B 4M48L 5T3XH 2X1OA 3VFWB 1QSFA 1C5BH 3D25A 1MCRA 4XNYH 3B9VA 1WF5A 4UIKL 1VEMA 2HVKB 3QEUA 1NGPH 4N90E 2DICA 1SEQH 1AI1L 3DRQA 5GXBB 2M26A 4O58H 4FMFA 3QSKB 4XC3L 4Y5YB 1WV7T 2EH7H 5CHNA 4YX2H 2VR9A 3WUZA 5C92A 1FE8H 2E9BA 1G0YR 1TVHA 2JELL 3O41B 3RVXC 4Z5RB 4DEPC 4MHHG 4WTXA 4BH8A 2XKSA 1IGTA 3DVGB 1G7MB 5D6DA 1WTLA 2VSDA 5C0BB 4XBGB 4YFLF 4G8IA 1U8MB 4GG8B 4M7KL 1J1PL 6CGTA 1IT9H 1NKRA 4I77L 2E27H 3SO5A 1B3JA 5K9JL 2OXHA 5JO5B 3RWFB 2VXUH 3T1WA 3QJFA 4HQQH 3GMNB 5FYLH 1P5UA 3GUTB 1NCNA 3ZTJH 1OB1A 4FQXD 5FDWA 5KBNC 4XAWH 4JQIL 3SCMC 1JGVH 5HJ3B 3FKUS 3OKMB 1F3DJ 1DBKH 3KNBB 3VFRB 3S3PA 3BMWA 4FZEL 3ZTNL 4NO2B 2VWEE 5IFAH 4X6BB 3AVEA 2FECI 2V7NA 5L9DH 5KG9B 5KVGL 4MD5B 4IJ3B 3TH4T 1CYGA 4POUB 3O9WD 1YEDA 5J3HC 5ANMB 4MAYB 2NNAA 1G0XA 4GW4B 4ZFGL 4LPUA 2BFVH 2DMKA 1WK0A 3RGHA 4NZJA 2O5YL 4WW1B 3NAAH 5K9OA 1EO5A 3IFPA 1EV2E 1RHHB 5DHVB 4HLJA 3VRIB 3VD4A 3GSRA 1GC1H 3I6LD 3EW3B 4K23H 5CJXA 5K59F 3HRZB 3VXSE 4CU8A 5IT2H 3ZKXC 3MLZL 1U2CA 4WFED 3IETB 4RISH 3BP7B 3GSQB 1V8HA 2D7PA 4J3VA 2AKRA 1G7HA 1LDPH 3OZ9H 4OQ1A 4G43A 2WQ8A 5D7IA 3QDJB 4LASL 1T7VA 3MRHB 4XC1H 4WUKL 5CWSA 4TUKH 4G8GD 5D7IE 2FEDD 4EI5C 4BELD 2ZJSH 1MNUH 5EU4A 4P23D 4CVUA 5SX4I 1GC1C 3X3FL 1OQXA 3VCLB 5HYIA 4FQXA 2L4OA 2ITCA 5EFIA 3C5ZC 1F3JB 3STBA 4KMTL 4EDXA 2NY6C 1FPTL 1FCCA 3EBAA 4OD2A 1AHWC 4HKXA 9CGTA 4WGVB 4MVBD 1UQSA 2NY5L 2AS5M 3DNKA 4LLMA 3X12B 3MBEC 2OSLA 2NXZB 1RJLB 3UO1L 3O9WA 1XGPA 2JTDA 3UTZA 4G6ML 1A3RH 5BCAA 1G9NH 4WNQA 2DQTH 3SOBL 1W0WA 1YYLH 3EOBB 4YPGA 3QFDA 4JFZL 4J4PD 5C09B 4TPRL 4RAUB 4G5ZH 1A0QH 3VMNA 5CLWA 3ZT7A 4JB9H 3H6JA 1BBDL 5DJ0B 1H8NA 1K6QL 2PKDA 4HULB 3DVIA 3IRPX 3QZWB 3WIIL 3I6LE 3PQYA 1XIWD 3DO7B 2GTZB 3TBSA 4WFEE 5EU7C 1R3KB 5FHBL 2HJKB 3MRRA 3MO1A 4RGNC 1ZWIB 1V3MA 2HMID 3DUHA 1S9XA 3BKJL 4KJPC 1X5FA 3ARDC 1A7QH 1G9NC 1FG2B 4ODWB 4DUXA 1X7QB 3GNMH 4NQVA 1KXQE 1S5IL 1BJ1J 1Q72H 5TDNA 4Z76B 1ZS8A 2GJ6B 3QFJD 3V6ZA 2WWMC 3CAFA 1X5LA 2IJ0C 3BI9X 1QSEB 4G8GE 3WE6B 4P23A 3SQBA 1E6OL 1J9CT 1I8KB 3HC3L 3BP6B 4JM2F 2WZPD 4TULL 3TZVC 1Q9KA 4MWFB 3EO0A 4JZJC 3KPMA 2VZ3A 2NXYC 1YECL 3T4YA 1DLHA 3MRDA 1X4YA 1KTDB 3PGCB 2OTUB 3VXRD 2CD0A 1OY3B 5IP4A 5HHMB 5BV7C 1RIUL 3LN5A 2R1YB 5JW4R 2GW5A 1BFSA 2JB5H 2H1PH 3TBVB 3RIAF 3PP3K 1TVBA 4BH7A 4U1JA 4GRLC 1B0GA 1PAMA 1DUZB 3DHMA 1OSZA 2ZOKA 1IGMH 4OZFA 4IMKC 2BOCA 4J4PA 3JV6A 4HUUB 5DMKA 4UB0H 1TCRB 3CFKB 4JHBA 5I8EB 4FMKA 4GRWF 4EBQH 2YZ8A 4NQCB 4NN7B 1KN4H 1F02I 4JR9L 4YHIA 5FYKE 3KXFB 1XIWA 2FEEI 1IEHA 5B3JE 3L9RB 2XWJA 2DM2A 3BVNB 3WDIA 1JRHI 1MHHA 1MPAH 4OCWL 1QKZH 1ZLVH 3V8CA 2QSCL 2L7JA 5IB2A 4S1DC 4N0YL 4NQUA 4JFQB 3MJ9H 5CEZL 4NCC2 5FO7B 4JRWA 1CDBA 3B83A 2A9NL 3NA9L 5F1OB 4JDZB 3JTTA 5ITBH 5IGXL 1GZQB 2DLTA 3CIQA 4KK5C 2EDNA 3L3IB 3QFJA 1KPRB 5I66A 1CGXA 4YDVA 4DVRL 5FYJU 4F33A 1AO7B 1FNSH 4F57H 1QZ1A 2NX5A 4OD1L 3V4UH 1BGXL 4ZS7H 1DLFH 4XPTH 4OD3L 5TE6L 4MNGB 1C7TA 5D6CA 4R0LB 4LLQA 3V5KB 1CDGA 1DUYA 1KIQA 3JVGC 1YEKL 1CXHA 3VXOB 1P1ZB 3MTRA 3FB6A 5TF0A 3SBWC 2DQGL 3VXRA 3DXAB 3STLB 5INCB 1U8HB 2RB8A 3SQOL 4YNYB 2AXGA 5D5MA 1N6VA 3VXRE 1B6UA 5D5ME 3P4OA 5CZKA 2YPVH 2DL9A 1V3JA 2QKIB 2PXYB 2X4TB 2ED7A 1I1RA 1JWMB 4LAQH 1MRFH 4M62L 2ICES 2YEZB 2K7QA 2EKSB 3QG6B 4O4YL 2VISB 3BXNA 1RUMH 3I9GL 2VXTH 1H15A 1KUMA 3G5ZA 1ZHLA 2VZTA 2DYPB 4BSWB 1FNEA 3QAZB 4XNQA 3HUJB 4MHHI 4OQTA 1Z6JT 3VRJA 5IB4B 1QO3A 4R3SA 3VW3L 2VDOL 4YHLH 4YPJA 4U6HA 5A2LH 3T0ED 3ZE0E 4UQ3B 4PTTA 1FO0B 1QEWB 3KPRB 1L9MA 4S1SH 4ZO9A 1C12A 2IPUK 4V2CB 3CD4A 5ALCL 1LDSA 5TE7H 5FHAH 3T2OA 1T2XA 1ITBB 2UY7A 5BMFH 4IOIA 1NCCH 2WP3O 5IVXB 4WJ5B 4JG0H 4OV6F 3MR9A 4JO3L 1CE6A 3DX8A 3M17B 4P2RD 4PJFF 3MA9H 5FOBA 3GKWH 3LEYH 1D5BA 1KCUL 3W9EA 3O0RH 3GJFB 4LSDA 1RUKH 3WL9A 1QFPA 1AGFB 2M1KA 4PGDB 4PR5A 3RU8L 4DKFL 4PV8B 4Z7NF 2YN5A 25C8L 4GJTB 1SEBA 4MNHB 4XPHL 2DMBA 2DF3A 1SJEB 4RBPH 3IAPA 2EDKA 5TDOB 2QQKL 1PLGL 4KK8C 4S1RL 1S7QB 2NY0C 3TNMB 4HWBL 1S3KH 3W0WD 4XNUL 1JHTB 1DBBH 2F8VA 5DWUL 5E99H 3VWKD 4X80H 1WTGT 2XTJB 3S96B 1SY6L 3BYYA 5C0JB 1WBZA 2EDFA 1YY8B 4FP8L 4N5ED 5IW3A 3T65B 3SGDH 2O61A 3T0EA 1NJ9B 1E4KA 5DD6A 2Y7QA 5F6HI 1G9MC 1ND0B 3T0EE 4R2GB 2LVEA 4YXHL 4CADB 3INUH 4KZEL 2VLLA 3MRPB 5GGUA 3BZEB 1KCVH 3OKKA 1K5NB 3FOMA 4RRPG 4P4RB 4XBPA 3RVVC 2R4RL 4XVJL 4MCZA 4O2FB 1N5AB 2A6JB 3BIAX 5F89B 5EUOF 4ZTPL 1FZOA 1M6OB 3S88H 2E7MA 4KFZC 4GMSH 3E6FB 2CIKB 4P2RA 4L4VD 5EU6A 1NAKH 5DURD 4P59H 1CE1H 4P2RE 1I1AC 4LLUA 4D9QE 3L7EA 3FQRB 3GHEH 3M07A 3NFPB 3VXPA 4YHOL 5E4IA 1EEQA 3S9DB 1S7WB 1BZQK 3RDTC 4M5YH 4LSPL 3EDJA 4PS4H 3QR2A 3TN0B 1A9BB 4Z7WA 1IKFL 3QNYB 3MROB 1Q9LA 4X9FA 1UACH 4Z7WE 2AI0L 3HB3C 2FDBP 4HS3A 4KV5F 3RNQA 3TBTB 43CAA 4MDJA 5BQ7A 1RJYB 2DTML 1I9IH 2R0WL 1INEH 2D4FA 3PWPB 3QIBB 3W0WA 4L8DB 4OCYH 3VWKA 3MRQB 4QXUL 1CI5A 1CLCA 1UA6H 3ZDXF 1KXVC 4OSUL 2JCCA 5JW5A 5LCVL 4LRNL 1RI8A 4NN5B 2JCCE 4TYUA 3MA7B 2UVFA 3MC0A 5EU5A 1ZLSH 4HMCA 1QLFB 4LIQH 5K93A 4JFHE 1LEGB 4XCFH 4PJIA 4JO4H 1JGUH 4LNRB 2K7PA 1A2YA 3ABZA 3B9KD 1CDYA 5IOPA 1FZJA 5CJOH 1AQKH 4PJIE 1K4DB 4UV7H 5D7JC 4DUWA 5IEHA 3OB0H 2XA8L 3NFNA 4I48B 4U1IA 3VWJD 4HS8H 3CFIC 5GRZA 3SKUD 1RMFH 2NY2B 5HHQB 3P0GB 5C0DB 5TGBA 4OLXL 4X0KB 2DJ4A 4ZAKC 2AJYL 4ERSH 5ESAB 3L3OA 1Y18B 3DV6A 2HT2D 4JGJA 3PIQA 1CIDA 3VI3E 3DPBA 2E6PA 4X4ME 2GIYA 3IFLH 4LHUD 1A6VL 5BO1L 1RU9H 2HP4A 4L4VE 4OBRA 4CDHA 4NN6B 3BKMH 1A7OH 4R4BB 3IU3B 5J1AA 4IDJL 3C60A 5JHLH 3DVNA 3DMMC 1AC6A 3Q6GL 3AS3A 2ZSVB 1YQVH 1VFAA 3NZ8A 4D8PB 4XWOD 3DSFH 4NP4H 1R5WB 4FQHB 4U1GB 4OT1H 2MNUA 1L7IH 1ZEAL 2X4OA 2ZG1A 4QYOA 1UB6B 3BQUD 4JJHA 4QXGH 3SKOA 3LS4H 4HPOL 1TJHH 4F7PA 2VZVA 1TVHB 3BO8B 5DFWH 2GSIB 1ZA6B 4OCRH 5DR5L 4X6DF 5GSVA 4TSAL 5IEKB 2ZCLL 3OAUH 1M71B 1MHCA 1L7TH 2A2QT 2P46B 2D9QB 3QZWG 4LHUG 3SPVA 2GTWA 2NR6D 4TSBH 5DJ6B 2IFGA 1EVTC 4M7JL 1EJOH 1QLEH 3VGEA 1IGIL 4FTVD 1A7RH 4U1SA 2PTTA 3B9KA 2NY1D 3OR7A 1NCWL 3H7BB 4UTAL 4X5WB 2BNQD 1A7NL 3VWJA 5DZNA 4N9GA 4KY1H 5ICZA 3WJLA 1UB5A 3PP4L 1QRKA 2A74A 5FM5M 4LCWA 4ENED 3WIHA 4ELMB 5L7XH 5C7XH 4Z78A 5MHSD 4MXVF 3TBYB 4O02H 1YEDB 3MXWH 4BFIA 5B39G 4LHUA 2HYMA 3MODH 1KCLA 5IMMA 2BOBA 3S34H 4CNIB 4FNLH 3LSOA 3BT2H 1NL0H 1RIHH 4HX1B 2HT3D 5ITFA 1P7KB 4ZXBD 1D6VH 4QRSA 3FO2A 3IT8D 4KHTH 4PJCA 4AZ8A 3VXSB 1S9KC 3O11B 4PJCE 3ARBD 5CINL 3O2WL 2RQ8A 1OGTA 5F3BB 1VB9A 3BQUA 3HAEG 3ECBA 1PQZA 3LH2L 1BD2B 1UYWH 4F2MB 3F7RA 1GSMA 2Z31C 5EZLB 3I6GA 1G7HB 3D69A 3TGXA 2O26U 2EC8A 5B39A 5ETUA 5C8JB 4MXQC 5CWSB 4CJ1A 2XI9A 1G6RB 1ZLUK 1JZ8A 1UH4A 1K2DA 1CCZA 2MPAH 4XH2B 2AK1H 2OL3L 1NCDL 4G8FA 2VAJA 2DQHL 2FO4B 2IF7A 4LCYB 4LSQH 5DJAA 5ERWB 4FTVA 5FXCH 1U8OB 3P4NA 4FQXB 1CL7L 5AG8A 2BVOB 3CMGA 4FTVE 1AD9B 2DLHA 2XY1A 3KYMA 5J6HA 1JHKH 3MUJA 2B4CL 2BNQA 3FQNB 3HMXL 4MZ2A 5TQ0L 5I75C 1AQDA 4PJ8D 3VXTB 3HC0A 2BNQE 4H8WL 1FNHA 2X7LB 1BAFH 3MFFB 3P30H 4MA7L 5F1NB 3BP5B 4KK9D 1P4BH 3OR6A 2XKNA 5DDHA 2NW3B 5DD3H 3TO4D 2BVPB 5MHSE 3VJ6B 1NMBH 4HIJB 4NBZB 4ZS6C 3NCYP 3MNZA 3QI9C 4HK0A 4CW1A 4F3FB 3FN0H 4PUBL 3CFEB 1ACZA 1F6AB 3KYKH 4M7ZC 3UP1A 3WS3B 1U58B 2IBBA 4ZXBA 3QPXL 2Y36H 4RDQF 4UNVA 4R8WL 4PGEA 5M95B 2KQNA 1A4KB 1F90H 3UTTB 3ARBA 5B8CB 1J0KA 4HEME 4NDMB 4BQ6A 1I7UB 1LP9F 2FBOJ 3WYRA 3TBSB 4ZPTB 3VI4F 1CFNB 2F19L 1TETL 3ZSSA 3U4EA 5I18H 2VDNH 1DL7H 3REVB 4PB0L 5DD0H 4JFDB 5HDBF 3IJSA 4BJLA 5AAWA 2FX8H 3MRBA 2ADIB 3QWQB 2GAZB 4HBCH 4OLZL 4ALAH 1ZS8B 1SJXA 3PP3H 4G8GB 4JFYA 1JV5A 3LCYA 4M00A 4UQ2A 5F6IB 3AROA 1P9MA 1FGNH 2YMXL 1FVEA 5D1XD 1FIGH 4BM7A 4N0RA 3TJEL 3ZZ1A 4HKZB 5D2NC 2X70B 5E2TH 1DLHB 3B9AA 1I7RA 4V2BA 5JOPD 2IFFL 4PJ8A 4QHLB 4WW2B 1R5VB 2FYYA 1HH6A 5KZCB 1CDUA 3S37X 1N3NA 3UEZA 1CGSL 1G1YA 3DURB 3TO4A 1I7ZB 1OT1A 3BW9A 4JCMA 3HKFA 3K3QA 3V52H 3U4BL 3KLSA 4QRTB 2IAMC 2Z8RA 5HHNA 4IRZL 5E08H 1CXFA 1KEML 4NZRH 4ODXB 5GS0L 5IFHL 4OZFB 2IBZX 2BOCB 1P7HL 1ZT7A 2VQTA 3QNXB 2K3TA 3JV6B 4FFYH 3DX7A 3IFNH 1IQDA 5FO9B 4NJ9H 5IIEA 3P9WB 4Z7VB 4DN3L 1OWRM 1AFVL 5E8NB 4ZNCD 2EEBA 3N9GH 2VIRB 4XZUB 2Y5TA 5MERA 1LVEA 1NDGB 1UZ6F 5D1ZC 5JW3L 5DQJA 1KIRB 4M3JA 1VSCA 1H5BB 1T1XA 2VDRH 2M8XA 5CBEB 1XGYH 1IGYB 1C08A 4NQSA 5GHWL 2NY4B 4NNPH 1QFUH 8FABA 1AGDA 3A6CL 4TQEL 1C1EH 5KSVA 4X4XB 3U30B 4HG4K 3ULUF 3BPLC 3G6JA 4F8QA 2V9TA 4R4FL 1T1ZB 3VRLE 3IVKA 4HD9A 1BQLL 1EHAA 5H35A 5IBLC 5IJKC 5D1XA 2BJMH 4X7TA 5HYSG 2ZSWA 4Y88A 4ZMAT 1R6VA 2VXVL 1FLRL 1GGTA 1V7NH 4OLUH 4NKQB 2Q76A 4P49A 1JTTA 5BZWA 4XT1C 4U1KB 4X99A 1AGBB 4JM4H 1PZ5B 3FB6B 1ZT4B 4ZUUB 1JGLH 1EX0A 3MRKB 4J3TA 5JOPE 4HC1H 4X5LA 4F9LC 2CIIB 4JVPA 4QTHA 3P4OB 5T5FH 3VFNA 3ZDZE 4M1GL 4HUXA 3PWUA 3SKJL 3GSUA 3U36A 1CXKA 4MJ6A 5GJSH 1KIPB 5C0FA 3I3BA 1MREH 3UTPD 1JTOA 1KB9K 2GSGA 5HYSA 2B2XL 1H15B 2BHYA 3IDYB 3L1OL 1YNTA 3KLHD 5I73B 2BK8A 4TVSa 2F58L 5MEOA 3LMJL 2EKJA 4JFXA 1WUNT 1DQMH 1AIFA 2X09A 4G9DA 4LSVL 4P2CG 1XF1A 5GRUL 5CEZD 1AKJD 1FZMB 3D18A 3HNSH 1E6JL 3F58H 4G6KH 3QIUB 4I0KA 4PTTB 4NSKB 4PGJA 5I15H 1NCBL 1U6AL 2AEPL 1C12B 3PHQA 2DQJH 2V2XA 2YPLD 1CU4L 1K85A 3RVTC 4IMLA 3IDUA 3PHSA 6FABL 5EN2A 1BZ7B 4N8PA 1W72B 3LAFA 3SY0B 1MWAL 3T3MF 3MLWL 1JPGB 1JN6B 3PHOB 2J6EH 3NMEA 1OTSD 3QUML 4XP4L 5K33A 5CJQL 3P11L 5EC2B 2DLFL 3MR9B 1JZ7A 4JN2A 1CICC 1DVFB 1SVCP 4ONGH 2IC2A 5BW7C 1I9EA 2GCYA 3K46A 5C6WH 4POYA 2A9MH 3X13A 2MOVA 1QHPA 2A73B 3CLFL 3QISA 1D5BB 5GS1B 2AQ2A 2EDOA 3L6FA 1F42A 5HHOB 1IAIL 3UBXG 5GGRY 3MCLH 3V4VH 1EBPA 4N1HB 3RY4A 4PR5B 2R2EA 5CIPH 3ZE2F 1XGTB 1S9VA 3IF1B 5IMKA 2JIXA 3CXHJ 4Y4HD 3LKNA 4NKIH 5J13B 1CR9H 3K4AA 1IQWL 2CLZA 4RMQA 1BVKA 1JJUA 4HUWA 3UTPE 2R29H 2I60L 4DQOL 4PGCB 4KRPB 2R2HA 5I1HL 1JF1A 4MD4B 2FBJL 4Y1AB 4RQQB 1X4XA 2NZ9D