5J11C

Structure of human tslp in complex with tslpr and il-7ralpha
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
190
structure length
190
Chain Sequence
GVQIQIIYFNLETVQVTWQASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Thymic stromal lymphopoietin
publication title Structure and antagonism of the receptor complex mediated by human TSLP in allergy and asthma.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2016-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j11C02
3L3KA 1DBMH 4YDKH 3HMWH 5IVNA 4P23D 4LLUA 1ZHKA 2XYCA 3OHXB 1DUYB 5CMAA 4I4WB 1MPAL 2R56L 4NWUL 3GMMB 3MMEB 4JDZB 4YPJA 4LCUA 1WZ1L 4BSJA 5CZVL 2R8SH 4RZCB 1JNHA 1I7RA 4LSUH 4JFED 2J6EA 5DMGC 3ZT6A 3VWJD 1YPZB 4WW2F 2H9GB 1TJGH 5ADOH 3OKNB 1EBPA 3VD9A 5J12C 5I19H 4M6NH 4E41B 2JIXA 3TV3H 3S3SA 1AXTL 5HTSA 1R24A 1JPGA 4R0LC 2QR0A 3V52H 5BW7C 5IR1B 1DQML 3W9DB 3C6LA 1F2QA 4P23B 1S9VB 3U4BL 1NANH 3WUWB 4IRJA 3IXAB 4QYOB 5CEXB 5FDWB 1MAJA 3QUMB 4LU5H 4R2GB 1Z9SA 3WMSA 3U2SB 1FVCA 4S0SD 5J56B 2Q7NA 4OZHE 1I8MA 3BE1H 4X0KB 4KK6D 1D9KD 5FV1L 5IBLD 1XF3B 2BHYA 4KPHH 3GJFA 1P2CB 2CK2A 5A2FA 3GHBH 2AXFB 3NIDE 3DRQB 4JFEB 4Z7NE 4HBCL 3X11A 3VWJB 1FV1B 4QY8B 4XP6H 1KOAA 3ILPA 3T2PA 1U2HA 3G5ZB 2I9TB 4LEOB 4U31A 5CLTA 5GJTH 1ZSDB 1JUFA 4M1GH 5DGRA 1U8KB 3QDGD 5JMRA 3P2TA 3I6GB 1U2CA 2NY5L 3MCLH 3MRQA 3VI3E 3CCHB 5E8NB 4YZFE 1KUMA 4WUUD 4I1NB 3KWWA 3CFBA 1T83A 3BSZL 3VFTB 3TVMA 5F6IB 4HJ0D 4P2OC 2D4DA 1VFAB 4JKKA 5DJCB 5B8CB 4WI8A 4D9QE 1PVHA 1I7UA 1IQDB 1JGEA 1D9KB 5CEYA 4J3VA 5D1ZA 4MCYB 4GBXD 32C2A 1NBQA 5EBMA 4OZHF 5J7CC 5BOPA 3LKOB 1GCFA 1RIUL 1MH5B 1R3LA 2PYFA 5FF6A 3EO1A 5SWQA 3NIDF 4PJIE 4Z7NF 1QG3A 1CDJA 1FGNL 5HYEA 1JYVA 1IGYB 2FX7H 5JTWA 4N1EA 3AREC 1RUMH 1QLRA 2DD8L 1S7QA 3QDGB 4LVEA 5T1DL 3SDXA 5GGSB 3TBYB 4U1SB 5GRWA 5DJ0A 4EVNA 5E9DD 2H2SC 3P9WB 3B5TA 5JMOC 5MEQA 1WUNT 4XMPL 4WUUB 3VI3F 3VFWB 3GSQA 4ZS6C 2DIBA 2NYYC 4YZFF 1JTPA 5CJXC 4M93C 5DEZA 4UZGA 3G5YA 1I3UA 1S8DB 3C5ZD 5T1KD 3IFOA 5GS1C 4WU5A 4XGZA 1EIBA 3EO0A 1UJ3C 3F8UB 4GBXB 4MJIB 3BP7A 1AC0A 1FLRL 4NNXA 1UCBH 5GRUH 2OTUA 1HINL 2NXYB 4WEMB 2XXMB 2QHRH 1TDQA 2YA1A 2FSEB 2FHCA 2D7QA 4KMTH 3MV7D 9CGTA 4EXPX 1A6ZB 1WBXB 4PJIF 5FOBA 4Q9RH 5C9JB 1ADQA 1QNZH 3OKEB 3O2VL 4GKNB 1LD9B 4GAYA 3D39E 5E9DB 2VQ1B 1FNEB 1I8LC 4RIRB 4PGBA 2FBOJ 1Z9OA 1IGIH 3HC0A 1LE5B 4YXKH 1S7WA 4PJ9C 4M8QA 1AR2A 4FZ8H 4LF3B 5D7LA 3C5ZB 4OLUL 1VA9A 3HAEA 3SY0A 4KKBD 4P57B 3P9MA 2Y5EA 3O2WL 3HRPA 4GRWB 5L6YH 2ICEB 4LPCA 2C1PB 5IVZA 1EERB 1AKJD 3SGDI 4I0PD 1VFBB 3OX8A 3RWHB 2FL5A 4K7PY 4HIIB 3MV7B 3DIFA 4JPVL 1MVFA 5A2KH 5JIPA 3QQNA 2Q6WB 4GRLD 2YA0A 1T66C 4M62H 1WEJL 2A74B 3K1KC 4B53A 3SCMA 3QJFB 2RAMA 4CL7A 3DXAE 4LMQI 2ARWA 1MCFA 3QULA 2Y5TB 2OZ4H 1UKSA 4GKZB 4NYLB 3VDAA 1L7TH 5KAQF 4BZ1L 3RIAK 4LVNC 1IE5A 1FCCA 1INQA 6FABH 4AT6A 4UT7H 4NPYA 3UDWA 3BVNB 2IPTH 5ACZB 4ODBD 4NKMB 4U05A 1HIMH 2JB5L 2OTWB 2ORBH 3NMEA 2OJZL 1AKJB 4I0PB 5H35B 4ZO8A 5GISL 4GS7B 4NQDA 3AS1A 1MFCL 2PO6C 1ZHBB 4ZXBC 5EBWB 5T1MA 1EFXD 3HE7C 1RUQL 4GRLB 2G2RB 4MXWL 4G9FD 5CBAB 3UJIL 2GJJA 5AAMA 4HWZA 3M17A 3O0RL 3MGTB 3V7AG 3V5KB 3PGCA 4UU9A 3RWEB 2XFXA 3MRCB 4RGMB 1Q0XL 4PJBE 4PRDA 4C83A 1K5NB 3HB3D 3EOBB 4K94C 3MA9H 1IGFH 3HZVA 4YHKL 7FABH 3MRKB 2YSSA 4JFQA 3SDAD 2IGFH 5C08A 1YYLH 4OFIA 3HR5A 3SE4A 4JO3H 4XPTL 3UTTE 1P4IH 4ELMB 5BW7A 5GRZA 1F6AB 1EEQA 1FC2D 1KTRL 3U0TA 3U7AA 1EFXB 4K94H 4WTXA 1WQVT 4DK3A 1MNUH 1BIIA 2EDDA 3DV4A 4Z77B 3QEGH 1DN0A 1YJDL 2X7LB 4JN2B 3VH8G 5CZKA 1YYML 4M6OH 1M6OB 4UAOB 5HHNB 4JZJC 3QDJA 2XKUA 1OW0C 4N0FB 5GGRB 3QJHB 1HSBB 4GMTL 1MQ8A 1YEGL 2Q8AH 5BV7B 5E2WH 3QEHB 4GH7B 4OZFH 1GPOL 3C5SB 4JHWH 3T0EE 1ND0A 2VLMD 4JRYE 5F9OH 5C2UB 3LEXA 4FABL 1LK2B 3MRDA 4WHYH 1PY9A 5E2VH 1YC8A 5B3JE 2D2OA 3P4NA 4QRRD 1ZT7B 1QR4A 4O51A 5DHYB 1NFIA 2X4QB 4NC1C 3NTCH 2AJYL 2W0KA 4XCFH 3EHBD 4YBHA 4F15C 4OGAC 3FQTA 3QPQD 5CD5D 2JJTC 2HJFB 4P2OA 5HVGB 2Y72A 1NL0H 2FLBT 3SN6N 1JF6A 5EPMA 5HGAA 2BHZA 4ZSOA 1OVZA 4L1HA 1A3RL 1CGTA 5F6HJ 5JLZB 3NCCB 4ZO7A 3PDDA 2AJUL 2WWMD 1XCQA 4YO0B 1XGUB 5ESVB 3UCRA 3X13A 3RTQD 1MPAH 1PX4A 1A6VL 4U6YA 1YEKL 5J57B 2F74A 3N50A 3WXWL 4DJMA 3FO1A 2ZKHL 5DUBA 2YMXL 4QRPE 4J7RA 2MCPL 1EXUA 3R0MA 4ETQB 3AREA 5DD6A 5EUOB 1ULVA 2O5ZL 4FQXD 4HXAL 1HYSD 1QSEA 3FFCE 5KSUB 1KYOK 3BPNB 3S5LA 1KPRA 3GSVB 3L6FB 5CJXA 3C6SB 4RDQG 1DQMH 4O9HH 1TJIL 1TMCB 1OAKL 4UIMB 3DRTB 1BVKA 4WI2A 3EFDH 5KVFL 1E4JA 5GS2D 5E8EA 1UJ3A 4WWKD 5F7UA 1KJ2B 3NABH 3OR6B 3KLAB 3RTQB 3NCFB 1FE8L 4ZNEE 1R3KB 3BGMB 5FKPB 3GGWB 3EAKA 4QT5A 3O8XC 3OGCB 2X40A 4NBZB 4KZEL 3B8SA 3O3DB 1UXSB 1ZHNA 3HMXL 4BSVB 3K2UL 5E8OB 2EDOA 4LQFL 1UYWH 4FQXB 5EOCH 5IT2H 3WFEL 3ULSA 3RVXD 1MEXH 1RZ8B 4F2MA 3SGEI 1D5XB 3ARBB 1I8LA 2FGZA 2VDRL 1JHLH 4ACPA 1RZIB 5C92A 1TVBA 4JFFE 1NBZA 4F7MA 2HTLD 4OD2B 2NY3B 2C3VB 4WV1C 1FN4A 4OCYL 1N8ZA 3T65A 5I16A 3LMJL 1XCTB 1HDMA 1U8IB 4HS8L 1F4XH 1BVLA 3ARPA 5F8QC 1DE4A 2JELL 4Z0XB 4AENB 2OZ4A 4D8PA 4S1QL 2GSIB 1UQSA 2XTJC 4XXCC 2DOCA 4EBQL 1DDHA 4UUJB 2IADB 4JKWA 2FATH 1IC5L 2IAND 3TIEB 2Q76B 3MCKA 4J3WA 5HSFA 3V4PL 2GHWB 2ERJB 2F53A 2WBKA 5JW5B 3EOYG 2VR9A 3H7LA 1T5WB 4L4VE 2L0DA 5HPOA 2QSCH 1FGNH 1DL7H 5DJ2A 4GG6B 3O9WC 3KPOB 2DD8H 3EOAB 1R5WA 5T1DH 2JJUA 4BYHA 2XA8H 4MD0B 3TPKA 2E9WA 5FUZH 4XPGH 4BZ2L 4KRMB 4X9HA 2VISA 4H26A 3BJLA 1U8NB 4N68A 5C0JA 1E4XH 4O2EA 3PE9A 5GHWL 4XPFH 4ZS7H 3VFRB 4YHML 1MHPL 3H3KA 2X1WL 3BXNA 5IJVB 4DTGL 5HYSA 4PJHE 1EJOH 5CEZL 3T4AA 4OF0A 3KS0H 2IANB 1OP9A 3HE7A 2DWDB 4MDJB 5KSBB 5JNYB 4WDIB 3O6KL 4X8XA 1QBLL 5CSZB 4YHNA 1YQVH 4LCWA 4WW2B 3T0VA 5DVLA 3C60D 3WL9A 1O0VA 3QHFL 5CIPH 3ARRA 2HVJA 3DV6B 3M07A 1T04A 4BH7B 2XNAA 2RCSL 1HWHB 1T5XA 2EXYC 3GMQB 4Y4KC 5EH1A 1NCUA 1W8OA 3HI6H 1I1FA 4E41E 4N0UA 3WJJC 2AJ3A 4MB3A 2XQYG 3OAUL 1WBYA 3U0WL 3FB6B 3RX7A 5CEZD 3AMKA 4GXUM 4YIQA 2X4TA 2EXWC 4YHPB 1A7NL 1QBML 1LO2H 1UWGH 3D3VD 4J6RH 4AIXA 2NMSA 3H9ZA 1ONQA 4L8SC 3PWNA 1J1OH 1UKQA 4HGWA 2FCBA 2B1AH 3D1MC 1U8OA 4QHMA 4F8QA 5TH2A 3KPMA 2GK2A 2ZCHL 1KB9K 4KKCC 4IIQA 1HI6B 3AY4C 5C3TA 4AEEA 4PJHF 2W92A 2BY1A 3UC0H 1FAIL 1FG2A 5GGTL 4OZFA 5ANME 1WWCA 3VXRD 1G6VK 1RV6X 3C60B 4YHZL 4LIQE 2VUOA 1T2XA 5IB3B 4JZJA 2FJHA 1WEJH 5DJ6A 2JB6B 1OW0A 4LL9A 2AV7B 5AZEL 1M71B 3V6OC 2LFGA 3BFOA 4K3JL 3FQNA 4NC2B 1LEKB 2R9HC 3FN0H 3DX8A 5E24E 1IM3B 5HHPB 2XACC 1PKQE 5EUKB 1BF2A 1FJ1B 3L5XH 4N9GB 3PHOA 4PJ5E 4Z76A 2R0ZL 4XPBL 4GXVH 3FMGL 2VRAA 3HLAA 4JO4L 1KULA 1U8HA 1Q94B 5CKAA 1FZMA 1FBIL 4M4PA 3F6IA 1VERA 3U7YL 2E6QA 2JJTA 3HNSH 3VXRB 4BSWB 2NZ9C 1T03L 1HHKB 1LMKA 4RMTA 4JHAH 5DQJB 5L2KB 3QP3A 4J23A 3FFDA 3HZKA 4G7YH 3WIHL 3HC4L 2BRRL 5J6HA 1MJ8H 3IDYC 3WS6A 2LAAA 5L2JA 1A7OL 5J89A 4P4KD 3FO0H 2DQTL 3QNYB 4M5ZH 4G3YH 1G7JB 1UB5A 1FZOA 3KG5A 1RZFH 4N8VB 3GSRB 1CD8A 4J3TA 5B4MC 5CINH 3B6SA 4DOHE 3CVIL 2DS4A 4OQTL 3EDDA 5BS0A 1KLUA 1IAKA 4LHQB 3RWCA 1ZT4B 3GMRA 2WQRA 4KK5C 3KR3L 4OB5L 3RNQB 2VR4A 3SKUD 1FDLH 4KMLB 4PJCF 2DJSA 4MJIE 4JCMA 3BKMH 1EBAA 1CIDA 1UWEL 3WYRA 2WUBL 3HAEG 1KIUA 2C3WA 1G7PB 2VIRA 1VHPA 1EDQA 1I7TA 1LDSA 2Z35B 4HXBL 4X5LA 2P8LB 4CGTA 1X3DA 3NVQA 4EUPB 3O8XA 4JHZA 4Z7UB 3VWKA 3FT3B 3ABZA 4KROC 4L8DB 1A6WL 2OL3L 5DUML 3GI9H 1JZ2A 3N85L 3HUJB 4TULL 4LLWB 5E2TL 4OAWA 4FTVA 3G6AB 4MA1B 1PLGL 4I77L 1AH1A 2XG4A 3BN9D 1JFQL 4PUBH 4QXUH 1PEZA 2NX5D 2HFFB 5I73B 4LPYA 3QIBD 4XNMA 3VRIB 1F3DH 1DQQB 4FABH 2PNDA 1GGCH 3VXNA 2AXHA 4KK9D 4R96B 1E4KC 4WV1A 1QFUH 4H0HB 4O58L 3TN0D 1IM9A 3D69B 4ZUUB 1UADC 3SPVA 4NKOB 4PJFA 3RI5F 1T2JA 1EGJL 1T21A 4EQ3A 3W0WE 2X70B 4J4PD 3F5WA 4OIBA 1HCFX 1F4YL 5F70A 3VGEA 2A0LD 4U1NB 1A3RH 2A9NH 4G9DB 1MHEB 4XXCA 3FQUB 5E6IC 2AJUH 1RK0B 4XNYH 3NIFF 2AI0L 4I3RH 1YEKH 3Q0HA 1H9VA 3MX0A 3VXSE 4LOUC 2NX5B 5DD5L 2YMXH 1CDHA 2FEEL 5KW9L 3O9WA 4IHOB 4MS8D 3MLVH 5JXAH 3OL2A 3QI9D 4DKEL 4NQXA 4GQ9L 1MJUH 4POZD 2O5ZH 4W4OC 1BJ8A 1MI5D 4J8RB 3IT8D 3TN0B 4X7SL 4AG4L 1YEJL 2V17L 3P77B 4RISL 3U0PA 2MQCA 2RJMA 2W07A 1JGVL 4RX4A 5JUEL 5CIPA 1OAKH 3W11D 2QSQA 2WWKT 3QWOB 4OIIH 3REWA 3BRGC 1QFWH 3DX6B 2VR5A 5SWZE 3GJEB 5H2BA 3TBVB 1UM4L 4HIXL 1OB1A 2ZOKB 3PWVA 4X6FA 2CLVB 3RP1A 5I8KL 4YBLB 4LSQH 1AQDB 3KJ4C 3QUZD 4KQ4H 1VDGA 3QI9B 5TFSH 5C7XH 2W59A 2EIBA 1X5IA 3WFEH 4Y4KA 43CAA 1MI5B 3VDCA 1OSZA 2Z31D 2WZPD 2IAMD 3WJJA 1ZWIA 2VDRH 3SJVD 3IJSB 4X4XB 1OSPL 2GITA 2X4RA 4KVCH 4WI5A 4N8CH 2P47B 5AWNL 1S9KC 3VXQB 4L8SA 2YUWA 4OCYH 1NGXA 4G6AD 2VLLB 3CSPA 1KCKA 5AG8A 4CBPA 2J8HA 2X1PA 1FYTE 5JPNB 3LKRA 1T2QH 5F7KC 3TM6A 5I6XC 1I3RB 4N0RA 4UINH 3T77B 4PV8B 3AY4A 3BRFA 4MAYC 2FJFA 5D7JC 4F7EA 4S1QH 1IEAA 1BLNB 1IARB 1XEDA 2GK0B 3JV5A 3IU4L 4YHLH 3EKCA 5JQHC 3JTSB 3FTGB 3IFPA 3G6JF 4W6XB 3QUZB 5DUPL 5CCKL 5F1KC 1LE9B 5IHBA 3D9AL 4PP2B 5FGRA 3MRJA 2ATPA 4P2RD 5EOQH 1JF5A 3PP4H 3V6OA 2R4SH 2Z31B 2IAMB 4HKZA 5T3ZL 3MRGB 2A38A 4QF1B 4Z8FL 5DRXA 2J88L 3SJVB 3HN3A 2J8UA 4KTDH 1ZGLB 8FABB 4KJQD 3RAJH 3P0YH 2AJXL 2ZUTA 2A1WH 2Y06L 1FL5A 1KCVH 5HYJD 4NO0B 2ZJSH 5HGBA 1UGNA 5F6HI 3LEVH 4GW4B 4DN4L 1YEIL 4G80A 5I1IL 3WFHB 1R3JB 3S5LG 4LP5A 4WI3A 4CDGC 4U3XA 4I48A 3WIIH 1BD2A 2IEPA 3IDGA 4XTRC 5GSVA 4DTGH 4RGOL 5T3ZD 5JW3H 4MLIA 1G9NL 4OGXH 1EH9A 1ZVHA 3FT4B 4FQ2H 5INDB 2SEBA 4HPOH 2J5LC 2E8ZA 2YRLA 3KPRA 1MFAL 3O6KH 4GW1B 1QBLH 3BPLB 4P2RB 4RWYL 1CLOH 4HIHA 1G9EA 2HLAB 1MSPA 4QOKA 3QHFH 3QG6A 4FNLL 3GK8H 2F54D 2EIEA 3O4OB 3X14A 3K46A 4PGJA 5HHMD 4U6XB 5IQ7L 3NPZB 3UZQA 3BPOC 2XI9A 3U0WH 5HYJB 3W5NA 3HI1A 5MI0C 3K8MA 1W72H 3QFJA 1QLFA 1T3FA 5DS8B 4QHKJ 3THMH 3P0VL 2ADJB 3V5DA 1BQHB 3FB5B 3GM8A 5A1AA 2VQUA 1Y18A 1BWWA 2R23B 4KHTH 5EORL 3WFDH 1UB6A 3RVTC 3Q5YA 1U9KA 2LV4A 5DEGA 1FAIH 4P4RB 1CGSH 1J5OL 3R8BB 1J7VR 3BEWA 3L3GB 3JXAA 3SDCA 5J1TC 1Q9WA 4MNHA 5C6TH 2F54B 3ULVD 4P5KA 4YGVA 3L5JA 5HHMB 3DBXB 5AZEH 5MEOB 1RVFL 2YKLL 1IGJB 4HFUL 3I6LE 4HKJB 3MRBA 1HOCA 4ZPTA 3GSXB 4L1DA 2VDLL 1NGPH 2YC1B 1U8LB 1OAZH 3VD4A 1A9EA 3CXHK 4Y19A 1CE1L 4HS6A 1AR1C 1FIGH 1YECH 4G8EB 4CW1A 3FONB 1KIPA 4JO4H 3JWOL 2BNQD 3QWRA 1KJVB 1TZIA 3QEQD 1G7HB 5GS0L 3GHEH 4LKXB 5IFAH 1BOGA 3VCLA 2OYPA 1QA9B 1RHFA 3GSOB 1T80A 5JW4R 4YNYA 2P8MB 1TQBB 2DQDL 1EV2E 1I9RH 5E6IA 3SE9H 2AK1L 4NKDA 2ZUXA 4ZTPH 4CNIB 1I4FB 4G8IA 3STLB 1EHLL 1R5VB 4QTIL 4K07A 4ZNCD 5C07A 3UPRB 2F8VA 2DQTH 1RZKC 2Z8RA 1U0QA 4XNZC 5BRZA 5GS0D 3KPLB 3TNMA 4BQCA 2Z8VC 3CVIH 4ODUB 4OLVL 3LQZA 4GRMB 2BNQB 2R2HB 5CILL 3H6JA 3QEQB 2FRGP 4MXQD 2O26U 4CU8A 1RZKH 2F5AL 2HJKA 4XX1G 1CZ8H 4Q9BA 1S7XB 4L3AA 1FVEA 4PD4J 3DECA 3HRZB 1YDPA 2DQUL 2OR7A 4JPKH 5EWIH 2WUBH 3OZ9L 4IOIA 4MX7B 1P7QB 2Y36L 1TZGL 4ODSH 1YMMA 3ORJA 1IEBA 4B0MM 2CLRB 4ZUTB 1AJ7L 5F9WB 1CXFA 1A6WH 4OZFG 3ULUE 3L95B 2VC2H 3TO4C 2VL5B 5E2TH 1MCLA 4EIZC 4WHYG 2FO4B 4K7FB 1UH4A 4WFHE 4LIQL 5A3ID 5C0CD 3MOAL 2NXZD 1JFQH 1X6LA 3MUZ1 2VSDA 4Z5RA 4F33B 4YDVB 3OPZH 1I9IL 4OCMC 3LEYH 4L5FH 1IBGL 5FM5O 4UIKH 2H8PB 2P7TA 1JV5A 1IC7H 1X44A 1QOKA 2APWA 3KYKL 3V6FB 3GB7A 2FEEI 3HZMA 3I9GL 3MUGB 2DLFL 1U8QA 4LSRH 1EGJH 2DMCA 2EH8H 1SJEB 2Y4SA 4Q6IB 1CFTA 3TWCH 3NAAH 4XNUL 4MAYA 1F4YH 5D7JA 4XXDA 3BAEH 1KJMB 2G60H 5DC9B 4PRAA 3SE8H 5I8OL 2EDLA 3K0WA 2RQ8A 2A6DA 2HJLB 3LN9A 5DRNB 2P5WD 1W0VA 1KEML 3ULUF 2AI0H 5DJAB 1YEEL 3BDYL 5C0CB 2NXZB 3QUXC 1XIWD 4X6BA 1F45A 5E2UL 2JLLA 3WFBL 4A2LA 1P5UA 1V3MA 1O7SA 2Q7YA 5DJDA 1KN2L 4G6FD 5BCAA 5IHUL 5KW9H 4U1GB 5FDYA 3QFDA 1OP3K 4ZQKA 4TTGA 1CD9B 1NKRA 4DKEH 4GQ9H 1U8MB 2MKWA 4TUKL 4X6DB 1QUNA 2BMKB 3RGVC 3ZLQC 3S96B 3KNBA 4X7SH 1UZ8B 3NZ8B 5LCVL 4RNRB 1N7ML 1BMGA 1IZKA 1MHHA 4HPYL 2O5XH 4HCRL 2DYPD 4ZOAA 3O41A 1A47A 1T0NA 5AUMB 1TETH 3Q3GA 1XGTA 4TSCH 4NM8L 5L2KE 5JHDD 2IALA 4X80H 4HUUB 4Y4HD 5KTEL 2IH1B 4C56B 3QWQB 5IB5A 4OZHA 4KJYB 3TH2T 1LDPL 4O5LL 1U91A 2NLJB 1ACYL 2P5WB 1U3YA 2FDBP 2X89A 3CSYA 4L4TD 4MNQD 4WY7H 4KRPD 2RR3A 4HIXH 4UQ2B 1XIWB 3IU3B 5I8KH 3MV8D 3ZE2E 4LDLB 4F57H 4G6FB 3T0EC 2VDPL 2Q8BL 3EBAA 2X1QA 4R26H 5E2JA 4OQ1A 2PW1B 5ESQB 2PCPA 4K71C 4ZYKA 4LK4A 2ENYA 1FFOA 2EKJA 5HBBA 1D5ZB 2IPUK 2DYPB 4S10A 2AEIT 1VFMA 4Y2DD 4JG1L 3E8UH 1NFDE 2VDNH 1TJHL 1LO3H 2VZVA 5JHDB 4Q0XL 1A9BA 4FRWA 4ODTH 3MLUH 1OT2A 2GFBA 2VLKE 5KSAC 5CUSL 5EBLB 3SO3B 1ERNA 4MHHG 3E6HB 2DQIL 2BXYA 1HN1A 5TE7L 2OQJB 3RI5K 4L4TB 4ONHA 5DK0A 1CXHA 2DLEA 1K8IB 2Y7QB 1CXKA 3IF1A 4KRPB 3WLBA 4TN9A 5HVHC 2CJUH 3IU4H 1RJYA 3DX7A 3MV8B 5ECJE 4R97B 4PJIA 4KUCD 1PJ9A 5DMYA 2BY0A 1FFPB 4R8WH 3ZE2F 4N8PA 4QKXB 3AAZA 1ORSB 3WHXB 3MXWH 5IMLB 3C08L 1XF5B 5D8JL 4L9LB 4NGHL 1ZLUK 4GAJL 4CADB 5DR5L 5LGJA 1NMCB 1O7VA 4Y2DB 4MA7H 4RFNB 5MERA 4P59L 3TJEH 4LGRB 3ZKSD 5DYOB 5B3NA 1NFDF 4EDWL 1EAPA 1JBJA 4OSUL 1Z9LA 3CNKA 2ADGB 5TQ2L 1GZPA 3LS5L 3ZYIA 1GGTA 4M03A 3PL6C 3IVKB 4G8FB 4ODHL 3ZKMC 3QZWB 2OJEA 4WI7A 5F7YC 3GM0A 3WFCL 4K3DH 3SBWC 4XC3L 4JFHD 1B2WL 2QEJA 1C7TA 3LKSA 3L1OH 1FNAA 2Y9RT 2KUTA 5LWYL 3D39A 2HKFL 4R4FH 3P4OA 4FNLH 5C0NC 2Z93B 1LQSR 1WFUA 2LVEA 4HC1H 3LKNB 4AY0A 2VLRE 2XZAL 5LKNA 2C4FT 5JR1H 4OZ4A 3DVNA 4WFFD 5E00A 3PIQB 1C1EL 2BC4A 4K9EL 3DVGB 4PREA 3VXPB 5SWSE 1V7NL 3DMMC 3QCUH 5HJ3B 5JORA 3C5JA 3GMLB 43C9A 3NACL 3CAFA 3HG1B 1RQ5A 1DSFL 5GGSY 1L4IA 5GRVK 2HTKD 3FRPA 3T8XA 3RY5A 4LVOC 1VPOL 2I9LB 3T0WA 3HFML 4JZOB 2HA1A 3UTSD 5CWSB 3HC3L 2P5EB 5JW4N 2ZUWA 4EDXB 4HLJA 5C0BE 1HHJB 2EDBA 4MZ2A 3SGDH 4LNRA 4HIEA 3P4MB 5IMOB 1CD0A 3ZL4L 5IESL 2ARJA 1FYHB 1Q1JH 2XKSA 3H42L 2ICWJ 1A64A 3VXTB 4HBQA 4HHAB 5HHOE 3JWOC 4HFUH 2D31A 3PUCA 2L7JA 3OJVC 5LJYH 1NPUA 1EGJA 2ADIB 4K3HA 5BXFA 3RWFA 4ZPVB 5J1AA 2VDLH 5EG6C 1LO5B 1HILB 2VABA 3EYSL 1XGRA 2BVYA 3S34L 2UVFA 3SEPA 2G5RA 1HQ4B 3HNTH 4TSAH 4M7KH 1A5FH 4NKIL 1N2RA 2ZP0T 4NJ9H 1WIOA 3JWOH 1AO7D 2CQVA 1I3VA 4DGYH 2F58L 4HS3A 5I1LA 2P24B 4XVTL 4C4KT 4APQC 3G6JB 1M7DA 3UTSB 4NCC2 5D1QB 3KDMB 5EU4B 3GI8H 2XV6B 3OKKA 1OM3L 3E0GA 4QXGL 1WZLA 4U6HA 5DO2D 5ESAA 4E42B 1ETZA 3TYGL 4KGLA 5I1AA 4IRZL 3ZTJH 5IB1A 5E94B 3C87A 2XOTA 4GKSB 3F7YB 4PJBA 3D0LA 2VAAB 3PHQB 5DEFA 1GVIA 4OCRL 3QUXA 2HRLA 1AD9A 3ESVF 4OI7A 5INCA 2J8OA 4OFKA 4ZOCA 1DP0A 2F19L 1II4E 4XZUA 4LKCA 4P23C 1N4XH 4LASH 3AFLA 3RGVA 3HS0B 1WJ3A 4WFGD 3UTTA 4OLVH 1AO7B 2BSED 2QQLH 3LVEA 1SQ2N 2H3NA 3OQ3B 4R2GC 4YWGL 3DROB 1UVQB 2VZOA 2KZ1B 4YHOL 5EZLA 2B1HH 2CKBL 4P9HC 3T08A 4NO3B 4HQQH 1BQLL 1ZK9A 3PWLB 4KY1H 5I74B 4NRZA 2Y6SD 4OF5A 3VWJC 1NCCH 2I07A 1YEHL 4U1LA 3GO1L 5IEHA 5JQ6L 1AJ7H 4KC3B 1TITA 3KXFD 5HDQH 4NP4L 5TDPA 4TPRH 3B9DA 5EN2A 4P9HH 3T0EA 5C0EA 3X3GL 4JRYA 4LIQH 5E4IA 1C16B 1KPVB 4NUGH 5TGBA 5F6IC 3V5HB 3ARFD 2AV1B 2CUMA 4WO4D 3Q1SL 5B8CC 1K4DA 3ZDYE 1IC1A 3QIWD 4HFWB 1NCDH 4PS4H 1D9KC 4JLRB 5IBLC 5DK2B 3GIVB 4TVPD 3KPSE 3I9GH 4IS6A 1CDGA 4PR5A 1HK6A 5KSAA 4TNWF 4CVWA 2GAZA 5TQ0H 2FHBA 2VXQH 1T4KB 2QJDA 2O61B 4XNUH 3VRJA 5BVPL 4NDMB 3WE6A 1U41A 5KVEL 1CF8L 3PF2A 1DVFC 2Z91B 3O6FC 3HHRB 3TPUA 4LVHC 4HW6A 1L0QA 4QRPA 1KEMH 3DUSB 2GT9A 1CFSB 2BDNH 1QSFD 2ZSVA 4H25A 3FFCA 3U30B 1EUTA 4XCYB 2MJWA 4X6CB 1I7ZA 4HJ0C 5IM7B 3ARZA 3H7BB 3ARFB 3A6OA 4WO4B 3VFMA 5T3XE 4HDIA 3JWDC 1CDYA 3SDDC 2QQNH 3DPBA 2DDQH 5LCVH 3WIFA 1Z3GH 3B3IA 3DHJA 2GQHA 4GBXC 1QACA 3HNVH 5CJOH 2NXYC 4HK3J 2DIJA 2W38A 5IBUB 4NM8H 3UJTL 5FYLE 4ZNEA 3PL6A 2X1OA 4HC1A 5KTEH 5LXGL 3JWDH 5FYKD 3VRLE 1YNKH 1BFOA 3MQIA 2YBRB 2CUIA 4MJ6B 1KCUL 1K2DA 4KI1A 3SBWA 4KRNA 2JJWA 3BH8B 4EN3D 4E5XA 3BPCB 1I9JL 1QSFB 1F90L 4D0CB 4JHBA 1UC6A 1IILE 2JJVA 1X4ZA 3MBED 2V2XA 4JFFA 2EH7H 3C5ZC 3FB7B 2GSGB 3ULUL 1DQJB 2AK4D 2EDFA 4OLXH 4YFLI 1WFOA 5D6CB 2VZTA 3DMMA 5SV3A 2DKUA 5EOTA 2FWOA 1S9XB 1R0AH 2MCG1 3O6LH 2FD6L 5J9PB 1KG0A 1JPTL 5IF0A 1R3IH 3MOBH 4DVBA 4L3ED 3SDYL 1OF2A 5JXEA 1ZA3B 5FO9B 4YE4H 4AQOA 3MSPA 4EN3B 1OQXA 1LEIB 3UZVB 4JY5L 5SX4I 1ITCA 3QIUD 3NH7H 1QPXA 4KUZL 3BUYA 2QADD 5AYUH 4L4VA 1HQRB 3MBEB 3O4LA 4O2FA 4OFDA 1I1AD 2NY2D 4D0BA 5DRWA 4PJDF 2HH0H 3W5MA 2BNRD 3EJYC 4H88L 4WCYH 1CD1B 1H8OA 3FZUD 3UTZA 4NQCE 2AK4B 3C08H 2FIKA 4FFZL 4ONGH 1B4JL 2CDEA 2FZ3B 2VNCA 4NM4L 3OAZH 4MA8L 3I02A 1J0ZA 1BX2B 4YDIL 4P59H 1Y6KR 4LLYA 1JZ7A 5L7XH 3KHQA 4GRLC 4G42A 4EDWH 4KTEL 1T1XA 2OSLB 2W91A 4L3EB 4PJHA 3OHXA 4QXTA 5TQ2H 3LS5H 1IZJA 5I66B 4APQA 3GDBA 4LNVA 4K2UL 2PYED 3EOTH 4RDQF 1HHHB 3GMMA 1JTTA 3CFIC 4JDZA 4HUVB 2EDWA 5FA3B 1F42A 3QIUB 1JWMA 4YC2C 1MRFH 2R2CA 2QADB 1LO0L 3BP4B 1G6RB 4RZCA 2MOVA 2HLFD 3CDGA 1I1AB 4BH8A 3B8YA 2NY2B 2NY7L 4N5ED 3WLWC 5C09E 3ALXA 2BNRB 1CDBA 5AYQA 3ZHLA 2C7UA 3OKNA 1D5MB 3V9FA 4C57C 2IBZX 4LHUA 1ZTXH 2XN9E 4E41A 3GMOB 3L7FB 2HN7B 4F58H 1J18A 1CU4H 1GGBH 4NJAH 3U1SL 5IR1A 3DO7A 4DCQA 3KYOB 1SJHB 4XH2B 4X7EC 3WUWA 5D1XC 1N5YH 5T5FH 1SY6L 1X7QB 4QYOA 1EO8L 5I2IA 4ELKB 1GL4B 5JHLL 1MCEA 1IGCH 3KPPB 1A1OB 4KQ3L 4LDOB 4NHUB 5HI3C 4FG6D 2YS4A 5K9KB 1KSRA 2PYEB 2G5BB 5I71B 4C56E 4I2XB 3ECBB 2W0LA 3UAJC 4UAOC 3TA3D 5ANMA 5EIIB 1VPOH 4PRIE 4HKXB 4FOMA 2DICA 4XPAL 5C8JB 2AXFA 2NW2B 1MAML 3DRQA 3A67H 2JCCE 2V5TA 3HB3C 5BV7C 1E0OB 1FV1A 5HYQA 2WNGA 1KIRA 1JRHL 4JEGB 3BKJL 5IESH 3G5XA 1U8KA 1E6JH 2CIKB 3CCHA 1GAFL 3KHOA 1PKQA 4L29B 5E8NA 3IXTA 5KG9A 1HH9B 2YZ1A 4PJ5A 1H3PH 5BV7H 4Q9CA 5KBNC 2HFEB 2YWZA 1N0XH 5C70A 1LO4L 3S34H 2QV2A 5GRXG 1T22B 5B8CA 4LLDB 1C5DA 4V1DD 3P0GB 1S7TB 4OKVB 1ZVSA 1ED3A 1IQDA 3TA3B 1D9KA 1VESA 1A7PH 4JRXE 4MCYA 1FL6A 2F58H 4LQ1A 1FFNA 5A40E 1JL8A 1UFUA 4DFHA 1A4JB 4O2CB 4R4BA 5I17B 1F4WH 5IGXL 5E8PB 4N90D 3U9UB 4ZAKC 3CU7A 4F7TA 2JCCF 1NAKL 4FXKB 2D4FA 4J3OC 1KIQB 4GG8A 1S9YB 4JO1L 5FGCB 1DVFA 3O6FA 4MQXD 4QGTA 3F12A 1NJ9B 1AGCB 2HFGL 5L8KB 4U1SA 5JOPD 1NCAL 4NQED 3EDJA 4FXLA 4KRLB 1V3JA 2BOCA 5DD1H 4EI5D 4Y4FC 2BNUB 3QAZB 3EHBC 4S1DD 3VFPB 4F7CB 1KGCE 5CD5C 2EICA 1F4HA 5KAQG 2O5YH 4AH2A 2VXUL 1RMFH 3SDDA 1MVUA 3RVUC 4OBRA 4X5XB 4OIAA 4D3CL 4GBXA 4MJIA 5DVMA 3MLSH 3MJ7B 2XQBH 4YEFA 3VJ6B 1QPPA 2FB4H 1EEZA 2FSEA 3V6ZA 3ZDZF 2CO6B 2E3VA 5E99H 3NCJL 3QXAB 2Z8SA 5I1GH 3O11B 4TVSa 4JY6A 1OHQA 5IBTL 5C9JA 3FRPG 4PJ7B 3OKEA 4Z18A 4Y5YB 4FQXC 4QRQB 3RDTC 4LSTH 2WV3A 3ZE0E 1HYSC 1EHXA 3LN4A 1KJ2H 4I18C 2D7PA 2GCYB 4H8WL 4NHCH 4NQEB 5JQ6H 4HUWA 4PRBA 3BQUA 3ARBC 1FNEA 4EI5B 4TUOB 1E6OL 1KB5H 1OAUL 2NY3C 1U95B 4NFBA 4Z7VB 3W9EB 1LE5A 4HK0B 1J05A 1NKOA 4JE4B 3X3GH 2DQCH 3VXUD 4NN5C 4JN1L 3UTQB 3UZEA 3CJJA 2VITA 4KXZH 5LAXB 3DUUA 4TRPL 3R06B 4LEXL 1T7ZA 1FGVH 5FO7B 1S5HB 2ICEA 3HG1E 5IVXE 3V0WH 1JGUH 3KYNB 2BFVH 3RWHA 3CFEB 5EIQA 5C0RH 2IWGA 4NO2A 3W0WA 1NMAH 5J11B 1WT5C 3SDXF 3X12B 2P5EE 1BBJB 1F11A 2E6PA 2ICWI 2DTMH 4Q6YA 3KPTA 4JM4L 3BISA 3EFFA 4JJ5B 3RVXC 1NUGA 3QPXL 5DMKB 2C9AA 3VXSA 3IDIB 2HT2D 1PSKH 1JWSA 3VXUB 1JPFA 3IDMB 3UEZA 1MFDH 4R7NB 5J6GA 4XVUD 3MGOB 3MLRL 1NBYB 5FB8B 3ZT5A 5ADPH 3CVHL 4R7DB 3FT2B 2EYSB 4JQIH 1YNLH 5D7KE 5HPMA 1AKJA 3BO8B 4BA8A 1Z0NA 1OAQH 5IVXF 5F3HA 5F7NC 1EEYB 5FUOL 1XR8B 3D25B 3EYFA 1ZHBA 4PJGE 4U3HA 5EBWA 3PDOA 1QFWM 4GRLA 5KN5A 1J10A 2G2RA 3REVB 1H0DB 4PJ8D 4GSDL 3B2VH 5SWZA 5L9DH 2HKHL 3T3MF 3MGTA 2XT1B 3FOMB 4W81A 1F8TH 1NAML 2ZCKH 1J86A 4TSBL 1KCUH 1UXWA 3ILQC 4KH2A 4OD3L 3GSWB 3S4SA 3GMPB 3OBAA 1REIA 3EOBA 5FO8B 4OM1H 4KDWA 3OXSB 4B41A 1FPTH 3QH3B 1J9CT 1V7ML 2AGJL 2PKDA 1VB9A 1RFDL 3G9VA 3C8KA 1B6DA 3VD5A 4CVZB 4FQ1L 5I75B 3QSKB 5TPWH 1XH3B 3WN5B 4G7VL 1MQKL 2AW2A 1F6AA 1LP9E 2A6IB 4AIZB 1CG9B 5D1XA 2DL2A 5J0BA 2DJ4A 1UACL 4MMZC 1FYTA 4Z77A 3FQRA 4PJ8B 4PJGF 4E9LA 3FQXA 2X7LA 4P3CL 2X42A 3C60C 1RIHL 3HE6D 4JGUA 5A16B 2KH2B 1M7IB 5HHNA 4XP9H 4LARL 3MFFB 5B38A 1P7KB 5E08H 1H15A 1AQKH 2VDMH 2XWTA 4HT1H 4N0FA 5GGRA 4G43A 3PWUB 3PQYE 5IV2B 1HSBA 2NNAA 4PY7B 5DK3A 1C5BL 2LQRA 4F37K 1RZ7L 4IBLT 4HWBH 3CLEH 3QEHA 4MD4B 4MJ4A 1U6AH 1HKLH 4KUZH 3U36A 2PTUA 2F8XC 2H26A 3ESUF 1RULH 3MLZL 5D70H 5JPMB 3CFCL 1AI1H 4XAKD 3UYPA 4H88H 4HZLB 1BM3H 1ZT7A 3DYMA 4MAUH 4QLRA 5DHYA 5EA0L 3Q5OA 1FL3A 5K9QI 4XAWH 4H20H 4FFZH 4WEBH 2EDNA 4NNYB 4IOFC 3QDJE 1NGZB 1LP9F 4G5ZL 1RZJL 4HGKC 5C0FB 4DGVH 1W0WB 1QBBA 3RWIA 3HE6B 4OZIE 1DANU 2YD1A 4NWTH 4XHJC 3TFKC 2KKQA 2YK1L 3MREB 1XGUA 5ESVA 5BZDA 5CGMA 3H9HB 3AXLB 1M1SA 1DBBH 1QBAA 1VGKB 3FQWA 4ZAKA 5KS9E 2YN5A 1XF2B 3U4AA 1INEH 2DQFB 2A77H 4YHYB 2WLZA 3T4YA 1OQOA 5K9JH 3VGDA 3RY4A 4RMUA 1ZT1B 1MUJB 1CLZL 1ZHLA 1RK1B 5GSRA 1MCDA 3MLTA 1DCLA 5I8EB 4AIOA 1FH5H 1UKTA 5IQ9A 3MNWB 3SGJC 1JI1A 4ZSOE 4Y4FA 4F3FB 3ZKNC 4JFDD 4ZUVA 3U4EB 1K8DB 3L6FA 4OI9A 3C6SA 2CKBA 4NQTA 4HG4J 3DRTA 2XRAL 4KZDL 1IT9H 2R1WB 1KBGL 1EO8H 2NZIA 4XC1L 4YQXL 3FB8B 4TNVF 1FNGB 4ZDHA 5JHLH 1KJ2A 3OR6A 5GGQL 3BN3B 2XWJA 5D5ME 1R3KA 3TZVD 1KB5A 4R90L 1UA6H 4Z7QE 3O3DA 2UZIH 3VH8B 4QHNA 2GTWA 1B90A 5E8OA 5KS9F 1NLDH 3D18A 2W65A 3RDTA 1IGTA 1RJZB 3NA9H 4DUVA 4I18A 5DMJB 5I73C 4NRXB 1U3ZA 3ARBA 1RZIA 1YMHB 4XWGL 5DRZA 1PQZB 1MHCA 1SM3H 3L3HB 1L0XA 4OD2A 3IDUA 4LLQA 2C3VA 2IG2L 3QQ4A 1MCQA 4F9LC 4JKPL 4WTWA 4GLRI 2LAGB 1XCTA 1X5ZA 1U8IA 1NCTA 1IJ9A 4G8GD 5DT1L 1H5BA 1VENA 3G6DH 2PETA 1PG7X 1KCSL 2UYLB 3LPFA 4RAUA 3TZVB 1JIBA 4P48A 2B8OT 3RA7H 3Q5TA 5EDXA 4HWNA 5D2NE 1N5AA 5D5MF 5GIRA 1WT5A 2IMMA 4WUKL 3LB6D 4L3CB 4PRNB 4Z7QF 4MSWB 3ZTJG 5IGXH 2Q76A 3BWAA 3NCYS 1BGXL 4LLVB 1DBAH 4BFIA 1JN6B 5CSGA 5DTFB 1NAKH 3D87B 1OT1A 4JFPB 4PG9B 1NMBH 2WINA 4GG6A 5KVDL 1MFBL 3QQ3A 3MODL 5ERWA 2YPLD 1H3XA 1EZVY 3MRHA 4Y88A 4MD0A 1J11A 1MCOH 1GGUA 4N9OB 4KAQL 1HSAB 3QUKB 2NW3B 2CIIA 1QYGL 2GJ6E 3LKPB 4U6VH 4G8GB 2X6MA 4OFYD 2YEZA 3BMVA 4NO5A 4LHUG 4J4PC 3MRMB 1AD0B 3TP4A 3PHSA 1KELL 4OLYL 2MWCA 4WI9A 2XZCL 3ZO0A 1UM6L 2ZNWA 3E6FB 3AGVA 3L3OA 4UTBL 4EKXA 4JO2H 1PZ5A 5IKCA 2R2EB 4JM2C 1PG7H 4UTAH 5TE4L 1JP5A 2VAJA 3QQ9D 5HGDA 1CFQA 4K3GA 3WUWG 4AEHH 5L88L 1DLFL 3QNZB 4MDJA 1DEEA 4IM8A 4LCCA 3WNKA 4WDIA 2J4WH 3VFOA 4JKLA 1AIFB 2VWEE 3ROLB 4WW1B 5FEBA 2A73B 4YHIB 4OM0H 3QG7L 5C09D 2GTZA 2J6EL 4HUNB 2YPLB 1J0IA 2A83A 4PJEB 3MZTA 3MYJB 4H8WH 1ZLVK 3MXVL 1FORL 1KEGH 5I1DB 1Z2KA 3RPIB 1NLBH 3HPLA 2ESVE 3V2AR 3W11C 5DMIH 3GBLA 2X4UB 2A9MH 3A6BH 3LY6A 5FCUL 5EC2B 1HI6A 2AJVL 4M7LH 5EZJA 1ES0B 1IKFH 5I9QB 1WFTA 4HSQA 2JIXD 2FLRT 3DSFH 1P1ZB 1U93A 4IMKC 3C60A 2V9RA 1BF8A 5DD3H 5IB3A 2EC8A 2J1KA 3L3KB 3SKMB 2KL6A 4LSVH 3C6LD 5I15H 1N0LA 4HZAA 3LKQB 2AV7A 3E1F1 4IRJD 4LLUB 2Z31C 1ZHKB 3GUTB 5KOMC 3MTRA 1MCBA 2R0KH 1INDH 1DLHB 2BSTA 1CGWA 2EIZA 3MCG1 1J87A 4OCLC 5EUKA 1BAFL 1U36A 4XPHL 4LCUB 2DKSA 2D7TH 5A2LH 3RBGA 3CVHH 3MRRB 1I7RB 4Q97A 5ID1A 3MLXL 1NC4A 2IPUG 4JCLA 1OTTC 4Y89A 3MUJA 4M1CC 3J7HA 25C8L 1KCRL 3GJFK 5TF0A 5FM5M 4KI5E 1JPGB 4NZTH 1HHKA 5L2KA 2QR0B 2XQYK 1EVTC 3TBWA 3C6LB 3U83A 3BPLC 1CL7I 4M4RA 2Y07L 4IRJB 5I1KL 3UX9B 1NDMA 2MHAA 1HEZA 2AJSL 2ILLA 3TVMD 3VXME 1P7HL 1IAIL 4NC1E 1NCNA 1FVCB 2JTDA 5C0AE 2XTLA 4OD3H 1ZEAL 4N8VA 3W2DL 5D1ZD 4WJ5A 5IVOA 2EYTA 2CLZA 3QCVL 1ZANL 5BVJA 3S9DB 3X11B 1AGDA 5GZNC 1P6AB 5E6YA 4YX2L 4XBGA 3KVQA 3WKNA 3BGAA 2RB8A 1JUFB 1NFDA 5KJRH 3GIZL 4N0CC 1Y6NR 5ISZE 2VLKA 5CGYD 5IWLC 3N0PB 5HHXH 3GZKA 3MACL 1OGAD 3KWWB 5TE6L 4BKLB 3CFBB 3N9GL 5E5MA 1CS6A 3UO1H 5D72L 2JJSC 1ADQL 5BS0E 4PGDA 2NY4C 2P44B 3HUJA 3IFNH 4LLWA 2QLVB 1CTOA 3RWJA 5CEYB 5DFVC 4HMCA 1RZ7H 5D1ZB 3TT3L 5EBMB 3MJGX 5BZWA 1OARH 3VRIA 5FF6B 2PYFB 1R3LB 3BRDA 3EO1B 3U82B 1LK3H 6CGTA 2JF1A 5SWQB 3MLZH 5DQDH 3TNNA 4ZFGL 4UDTA 4NZUH 4R96A 3WHE0 3T2OA 3VFGH 2DQGH 2IFFH 2IC2A 4FP8H 1RUPL 1I75A 1G9MC 2BOBA 3V4VH 3HI5L 4Y5VA 4F8TA 1QLRB 1S7QB 1OCWH 4F9LA 1A7QL 3QDHA 1CICA 4NKOA 3SDXB 3RGHA 4EVNB 5DJ0B 4TTDD 5MEQB 1TQBC 1OGAB 3GSQB 4J1UA 4U1NA 1BIHA 1XAUA 2ED9A 4UILH 5T3XH 2G75A 2YK1H 3ULVC 2V9TA 5LBSL 2BRQA 4KU1A 1G9MH 3G5YB 1A6AA 1BZ7A 5D7LD 4PV9B 3VGGA 1H3VA 4XGZB 3EO0B 4DGIL 3VA2C 3BP7B 4P99A 4NNXB 5ALBH 2OTUB 1DBML 3HMWL 5J06A 3AM8A 4IHOA 1WGOA 2V7NA 5FYLH 1WZKA 4PJFE 3ULVH 2VLRA 5IIEB 4CN1A 5FOBB 2VMFA 1T6VN 3S4SG 4J12A 4JG0H 3SCMD 5SWSA 3TBTA 2KBGA 5ICYA 4GO6B 4PGBB 1B6UA 2R8SL 1JF1A 3HC0B 1CQYA 2F8OA 1S7WB 4JM2A 4X98A 4M8QB 4ZUSA 5ADOL 2LU4A 5D7LB 3GJEA 5FYJE 5I19L 4M6NL 5HYFA 5FV2A 3HAEB 3SY0B 4JREB 3P9MB 1IGMH 2ZOKA 2CLVA 5C0BA 3DETD 1AQDA 2WAHA 3Q6FB 3OX8B 5D2LE 1S78D 4OCSH 4NQDD 3RPKA 3U79A 5B38G 3DIFB 4Y1AD 2DIAA 5HHOA 4B5EA 4PJFF 4LU5L 3B9KC 1BJMA 1L9NA 3SCMB 1FFRA 2UWEE 3BH9A 4PBWD 3QA3A 4KPHL 5EU7C 5H37H 4FFVD 4NBYB 3GHBL 1PX3A 3U46A 3LH2H 1A4KB 5IW6A 4DEPC 2DLGA 5IJKC 2XWBA 3MO1A 4FHBD 4XP6L 2NR6D 5DMGD 4UBDC 4PV8A 4N5UA 1EPFA 1FP5A 4MD5A 1INQB 4AT6B 5GJTL 4M1GL 4NPYB 1JMZA 3MCLL 5C08D 1V3KA 3JTSA 3GSUB 5E1HB 4HX1B 4JGMA 2Z4QA 5D71H 1MFNA 3CVHA 4HIJA 1CE6A 4NKQB 1WITA 4Y1AB 5D2LF 3IDNA 4UDUA 3G08B 4LLMA 3MRGA 1K85A 4U1GC 1G7IA 3GFUA 1GGYA 1DFBL 3M17B 5LVEA 4NQSB 2XKNA 4UU9B 1P53A 4NO0A 1QYGH 2XFXB 1Q8MA 4IDJH 4HWUA 4AM0A 2LE9A 4PRDB 4C83B 1D3CA 3OR7B 3QUYB 4CMHC 2F15A 3WFHA 2FX7L 1T0PB 5I0ZA 3HZVB 1RUML 3S3JA 4UTBH 5J12B 2YSSB 1NAMA 4MQSB 1S7UB 4LCIH 3V6OE 5C08B 5A2IH 3MRPA 3NPSC 1DLFH 1DBKH 1OD7A 4TNVK 3IAPA 1CFVH 1XIWC 2YD9A 2X44D 2CR3A 3FO2A 5FFLA 3L5WB 1FCGA 2AEWA 4PP1C 1JNLH 1BIIB 3DV4B 1SYVA 3QG7H 1DN0B 3ROOB 3QRGH 1SEQH 1IFHH 3MRLA 1UCBL 1FORH 5GRUL 3U6RB 2HT3D 3B2UD 2QHRL 2CDGA 1QRNB 2E7MA 3MPCA 5ACMA 2ADJA 4OLEA 1ND0B 1QNZL 1BQHA 3EJJX 3SO3C 3UYRH 3LEXB 3ARED 3MRDB 3P4NB 3KPSA 3QCTL 1QSED 1JZ3A 5IWLA 3QDMD 4KRPC 4O51B 3KLHD 2H2SD 4PTTA 1IGIL 3L3GA 4ZUWA 4YK4C 1NSNH 2IBGA 4YXKL 4NZRH 4ZS6D 1ZLSH 4R97C 2VE6A 4Z0BH 3WS3A 4FZ8L 3FQTB 2JJSA 3QFJE 1QO3A 3DBXA 5EPMB 3RUGE 5HGAB 2IBZY 2YD7A 1IGJA 5L6YL 2FR4B 2IMNA 4L9LC 1KENH 1IKNC 1XCQB 3X13B 3LN5A 1PDKA 1JGLH 1NMCC 2YC1A 1U8LA 5F7EH 4M7JL 1KCLA 4Y2DC 1SYSA 4U6YB 4EI6A 3EYOA 3WUZA 4RFNC 1JYNA 1BAFH 3C8HA 3NFNB 1FZKB 4QHLB 4HK3N 4G8EA 2MTPA 1EXUB 2X5PA 2BCKB 5F7DB 5J4MA 5DD6B 1AXSB 2OZ4L 1QSEB 3M1BA 1G7QA 3VDBA 1TFHA 3QDMB 4XBEL 1YC7A 1L7TL 4R3SA 3GSOA 2P8MA 3S5LB 2PXYC 3GRWH 1BVZA 5DI8B 3LIZL 1NGQH 2W1NA 1BVKB 2Y07H 4OTXH 4UT7L 5I1KH 2IPTL 1YEDA 3STLA 1DQDH 1R5VA 2YPVH 2ORBL 1HE7A 1UJ3B 3AC0A 5E8EB 3RUGF 2FEDD 3MV9E 3UPRA 2OMNA 1IAIH 5ETUA 2MNUA 3HA0A 5CZXD 2WANA 1ZEAH 1LHZA 4W68A 4P5TA 3W2DH 1UZ6E 1AGBA 4YGAB 3FL7A 4IJ3C 5K59E 1WBZB 3WFZA 2F53D 1T66D 1ZLWH 4OCXH 1WTLA 3ULSB 3C2AH 1H3UA 4YDLC 3GSNB 1S7XA 4F2MB 4PRHE 2FO1A 1TVBB 1NBZB 1E27B 4F7MB 5LQBH 1NC2D 1N6VA 4OUOA 2R0LH 2R69L 3MA9L 1IGFL 5D9SB 1N8ZB 1P7QA 4M6MH 7FABL 5I16B 4CDHA 3CFKA 2IGFL 4MDIB 4ZFOA 1YYLL 1GHFL 1DE4B 1P4IL 4CN6A 3L95A 4Z7WB 1RAMA 2M2DA 2VL5A 12E8H 1MCIA 4D8PB 2B0SH 4K7FA 4F9PC 1UQSB 3VFVB 2OR9H 3QEGL 3C8DA 2UUDH 2G9HB 4YDVA 3MCKB 1UZ6F 3HE7D 3TH3T 4YDJA 1OTSC 3B9KA 2F53B 1BQUA 5SX4H 5K59F 4M6OL 3L7EB 4JPWH 4LCWD 2H8PA 1RHHB 2HTKC 3LRSA 4RA0C 5DJ2B 3WHE1 1F3JB 3HI5H 1FO0B 1NC2B 3I50H 4PRPE 5E2WL 5D1QC 2RFXA 3L3DA 4FQCL 2VISB 4H26B 1QEWA 1S5IH 3F7RA 5F9OL 3OTTA 5C0JB 4O2EB 5E2VL 3K4AA 5HY9A 2VJXA 1MRCH 4P2YA 3BXNB 4XCFL 4TOYL 4DGIH 5F7WC 2Q1EA 3A6CL 1U3HD 3B5GA 1NL0L 2XN9A 4WVRA 1A6UH 2EKSB 2XG5A 4X6DA 3WL9B 4Z95H 3WCYA 1T04B 1CGVA 2XNAB 4RNRA 4N8VG 3QR2A 3LAFA 4XB7A 5JO5A 1T1ZA 2W9LA 3C09B 4N0UB 2AJ3B 1MRDL 5AUMA 1WBYB 3CFDA 1TCMA 3NCYP 5FM4A 3QYCA 2X4TB 1N59A 4YIQB 4C56A 4ZO9A 1ONQB 3PWNB 4KJYA 2C1OA 3N1FC 4HGWB 4U1MA 5DJXA 3DVFA 3OKYA 4PRIA 1U8OB 3S37L 3N06B 2E6JA 3KPMB 4XP4L 2QSTA 2JCCA 1J0KA 4IIQB 2GEEA 1U3HB 4O9HL 2DLHA 5FGBC 4E0RB 1EVUA 4OGAD 3P11H 1I1RA 3EFDL 4CVUA 4GW5A 4RBPH 5DVNA 2NCMA 1EJ6A 5JIHA 2PW1A 3NABL 1MFEH 1CVRA 2FJHB 2VDKL 5DJ6B 1CK0H 3QISA 4RFOH 4I9WE 3CUPA 1KJ3L 3NGBC 3MLPA 1RIVH 1B88A 3FQNB 2N4IA 1U8JA 1P84K 1WV7T 4JQVC 3P4LA 1UYWL 2EDRA 1EO7A 2Y6SC 3PP3H 5EOCL 5IT2L 1I8KB 1MEXL 4JRXA 1JHLL 3L3JB 4RAVA 4MVBD 3HLAB 2Q3AA 4KKNA 2MKLC 1U8HB 3ARUA 3MV8A 3PV7A 1FZMB 1A3QA 2X4OB 5IMKA 4LPVA 5ITFA 2P46B 1FFPA 2R15A 3ARDC 2ITCB 1JVKA 1F4XL 1ORSA 3PWJA 4J3UA 4OKDA 2X4NB 3FFDB 4L9LA 1IKNA 1ZAGA 5I1JL 5J6HB 1PAMA 1DFBH 4WO4C 1TVHA 2XXCB 3OKLA 3O8XD 3VWKD 2FATL 3TT1H 3VG0H 3GRWA 5K9OB 4HEME 1SBSH 2EDYA 4CMMA 4IOSD 1UB5B 1VEPA 5EU6E 4FTVD 2QSCL 1DL7L 3B6SB 1FNHA 5DXWA 2VH5H 4NOBA 4D9RD 1KLUB 2APBA 5GPRA 1IAKB 3RWCB 2XA8L 3GMRB 4PJXE 5D96C 4WFED 5FUZL 4XPGL 1QFOA 2PXYA 4XCEA 1DBJH 4Y8AA 3EYUH 1IM9D 3RHWF 1E4XL 3STZA 4XPFL 5DZOA 4ZS7L 5CBEA 2ZPKL 4NQVA 3TCLA 1I7TB 4PJAE 1EJOL 3DHMA 3O8XB 3VWKB 2XTJD 3WJLC 1C12A 5CS7A 4CRPA 1B9ZA 4U33A 3BP5A 4F7PA 1YQVL 4FTVB 4B7LA 1LWRA 5DHVB 5M95B 5DFTA 5IVXA 3HG1A 4YUEH 4KHXH 4XNMB 3O9WD 2F5BH 1PFCA 5D2NC 3MNVA 1X4YA 2XY1A 3HI6L 3SKJH 2VLJE 3KJ6H 3VXNB 1KYOJ 3QCTH 4PJXF 4JFZH 1P4LA 2P5EA 4WV1B 5C0DA 1JGDB 4EN3C 1IM9B 4J6RL 1UWGL 1LO2L 3UJJH 1HHJA 3B83A 1J1OL 2GYSA 4N1HB 1JNNH 5GGVY 2B1AL 1BQSA 4M48L 4UV4H 3MBEC 3WO4C 5T1KB 2BY2A 4RX4D 5A2JH 3JVGA 4HH9B 1KLGA 5JW4M 4F9PA 1ZVYA 2XTJB 4MMXC 4PJAF 5KVMC 1A3LH 1MWAL 2AABL 3CLFH 3UC0L 3VXOA 5E95B 2Z8WC 3LDBC 4HD9A 2X1XR 3NIGE 4M7JH 3H9SE 3PABA 3X17A 35C8L 4HJJH 2UY6A 1KT2A 4HUXA 4LPXA 1AFVH 1B3JA 2ITDB 4NQXB 2EXYD 5CHNA 4XMKL 4PJGA 4Y4KD 3S88L 4XP1L 4X7TB 5D1QA 4XBEH 3KDMA 3FN0L 3H3PH 3V6BR 3V4UL 3U0PB 2VWEC 1NGWB 2EXWD 1ACZA 3L5XL 3LIZH 3P9LB 4GXVL 5ENWA 4UT9L 1HXYB 4GKSA 3EO9H 3BKYH 4Q7DA 3TO2B 3PHQA 5L0QB 3BD3A 2K1MA 1HHIA 4KKCD 4C55A 5FXCH 5H2BB 3JBG7 4LP4A 3HNSL 3BHBA 1AP2B 3QDAA 1OB1B 3M8OL 4JHAL 2EDKA 2IPKB 1PZUB 2LABA 4G7YL 1MJ8L 1B0RB 4U7KA 3BZ4A 1LP9A 5GS3A 4YH6A 4Y4KB 4OZGE 5DVKA 5IHZA 1K4CA 1YA5A 3FO0L 5I71C 1OSZB 4M5ZL 4G3YL 1ZWIB 4HF5H 1XR9A 2R9HD 3CXDH 2OR8A 2GITB 2X4RB 5BMFH 1JI2A 4DK6A 5IROC 5MENE 1RZFL 5KANG 2HLFC 2R69H 3PWLA 5F72S 1BQHG 2FBJH 5CINL 1I8IB 1NGXB 2W0FA 2XPGA 3H9YA 3LSOA 3JV4A 1A7RH 2DM7A 3MYZA 4JVPA 3PQYA 3LKRB 3S8WA 1GHFH 4R0LA 2AQ2A 1FDLL 2H45A 2NTFA 2FJFB 3MJ9H 4F7EB 5FGBA 2H6PA 3BKML 1EMTH 5GGUA 1IEAB 3E2HC 1BD2D 2APFA 4MWFA 4WNQA 4Q74A 1C16A 3Q6GH 2NZ9D 3IFPB 5B39B 1CYGA 1MOEA 2FNBA 4G9FB 1LEGB 3H3BC 3KPRD 3FCTA 4BQ6A 3LCYA 3RVVC 5EFIB 3MRJB 3V5HA 2ATPB 4FG6C 4OD1H 2YPKA 5GZOC 2WP3O 1I3GL 4QOKD 4HKZB 2LU3A 4HFWA 3GI9L 4OZGF 2J8UB 5DK2A 3GIVA 2EZ0D 3WD5H 1FZJA 4JQVA 3D0VA 4OZIA 3U48A 4KI5C 4BK4A 1FIEA 4PJBF 4PUBL 4QXUL 4FQCH 1FL5B 4QNPE 4BZYA 3TYFB 5B4MD 4NDMA 1G7MA 1JTOA 3SDAB 5HGBB 3S37X 1GGCL 3LOWA 4G80B 4MNGE 3NFSH 3BIKB 3AS3A 3DURB 3ARYA 1QFUL 5KS9A 4HLZH 3PWPE 1KB9J 2B5IC 4KJPD 5IFHH 4I48B 1H3TA 1BD2B 3ARDA 4TOYH 3IDGB 5GSVB 4JDVA 4K7PX 1C7SA 1MREH 4YXLH 2QQKH 3QAZC 2SEBB 3A6CH 3KPRB 4OUUA 3BP6A 4X6CA 3IDYB 3H7BA 1BFSA 2A9NL 4HIHB 3SDCD 3QG6B 4YR6A 3X14B 3OJDB 4XNYL 5F1IA 5EO9A 5F9JA 2YWYA 1OPGL 4I3RL 4DQOH 1FVDA 1GSMA 1MRDH 3U9PH 3BT2H 3OV6A 1NEZB 1WIPA 3HI1B 3MLVL 4PBVC 5D5MA 5JXAL 1T3FB 4X9BA 1R5IB 1MJUL 4X5WA 2R1XA 4PBXA 5GGVH 4QRRB 2AJZA 4JPIA 4KVNH 4Y5YC 3S37H 4Y19D 5B3JF 3V5DB 4P2QE 4X6EA 4XP4H 3MUY1 4HJGA 5D7IB 1NCBH 1Y18B 1QSFA 3SKNA 3K8LA 3DGGA 3QWRD 3BEVA 1MAKA 5DLMH 3ELAT 1TVDA 4K7PH 5GS1A 4OIIL 3BEWB 2H32H 3SDCB 1QFWL 3FB7A 5C0GA 4MNHB 3BD5A 1S7SA 3WJLA 2HRPH 2FIRT 2VDKH 1YN7A 4P5KB 5E6ID 1Q9LA 5D6CA 4YGVB 1CGUA 4P9ML 5EBGA 2ZUQC 1KJ3H 3N1GC 5HI4C 5E0QA 3MRBB 4LSQL 5C07D 3VMPA 2DWEA 4ZPTB 2ZNXA 4KQ4L 2CD0A 5TFSL 1L6ZA 4KGJA 5C7XL 3BYTA 5BRZD 1J8HE 5D2NA 1GC1C 1EHNA 1A9EB 4Y19B 1ZA3A 4HS6B 1W2KT 4CW1B 1TCRB 2ICWA 3IJHA 1A1MA 2GY7B 1LEIA 4KVCL 4N8CL 3VG9B 2FECL 4PJ9A 1IC4H 1OD9A 1B0GB 3MRNB 3UTPD 3MBEA 4MXVE 1Y6MR 4UT6H 4YNYB 1OOAA 1MLBA 4MCZA 1T2QL 2VXVH 4WWKB 1GC1H 1CD1A 3FO9A 4UINL 1S7RB 2FX9L 5E6IB 4QO1A 5DJYB 3VGFA 5I1JH 1JZ6A 4NKDB 2CKNA 1QKZH 2GJ6A 1YMMD 4G8IB 4YHLL 3O45A 2HAZA 5C07B 3VFNB 1OTUD 5IW3A 2Y23A 3T2QA 1T0MB 4FQIH 3CDFA 1J0YA 1NUFA 3S35X 4LMQE 5BRZB 5EOQL 3PP4L 3LHPH 2R4SL 3O4LE 5CD3A 2DQEL 4KTDL 4FQHA 3LQZB 1XGYH 3RAJL 2UV3A 3P0YL 2JKXA 1FNSH 2HT2C 1J0JA 2EDEA 2A1WL 4IRSD 2HJKB 1KCVL 3RL2B 2ZJSL 4RGND 1FVEB 1A14H 3LEVL 4XVUC 4IDLA 1A2YA 1WWBX 5MP6H 5FYJH 3DTXB 3DARA 3GMOA 2ZPKH 3HCVA 4IOIB 5DJ8A 4WHDA 1XT5A 3WIIL 4JQXC 1YMMB 2HFTA 4MAYD 1CT8B 1IEBB 2BP3A 5D7JD 5JW3L 4RFEA 5C2BH 4OGXL 2PO6A 4B50A 4ZXBA 4FQ2L 4OBSA 3FN9A 2ESVA 4HPOL 4MZ3A 2YA2A 1VGEH 1QFHA 1VACB 3CH1A 3S3PA 4TUJA 3KJ4B 4GFTB 2YOCA 1CLOL 4NHUA 4Z5RB 3S35H 3GK8L 2NPLX 4PB0H 4KKAC 3I75A 1PG7W 1YPZE 3MJ9A 5EIIA 4HKXA 5IROA 5ICZA 3MR9A 2P7TB 1JV5B 4IRSB 4OLWL 3C2SA 4DZBA 5MEPA 1EHAA 4Y16C 1OY3B 1KTLA 4RGNB 4JB9H 3GB7B 1W72L 3AU1A 2QTEA 3SHSA 2DMKA 1IAOB 1U8QB 5HD8D 3V0AC 5I6XB 3THML 4M48H 4PGEA 5GJSH 4QRSA 4JJHA 2HMID 4RMVA 5D7JB 2RGSA 2PN5A 4X4ME 4OF6A 4KHTL 4PRAB 1JNJA 4M43H 1A02N 4XTRD 1MWAH 2AABH 3WFDL 2V2WB 1HH9A 3OMZA 1Q9OA 1CGSL 2AEQH 4UNUA 1XGQB 2HFEA 2X89D 3EDKA 1N3NA 4EOWL 5J3HC 4A6YL 2H2PD 4OFPA 4X6BB 4HKBA 4JFEE 5C6TL 35C8H 2DLTA 5DVOA 2Q7YB 5DJDB 3QB7C 2VDOH 3CD4A 4URTB 4ZQKB 2ZOLA 1YPZF 4O2CA 4XMKH 3S88H 2BVEA 4XP1H 3KNBB 5E8PA 4ORGA 1QR1A 2QBWA 3VGAB 3U9UA 3D3VB 1MHHB 1NGPL 3V4UH 1OAZL 4P0DA 4YHYC 4FXKA 1QRKA 4K3EH 1GOGA 5F88A 3FKUS 1KIQA 1I85C 1T0NB 1BFVH 1FIGL 1YECL 1XGTB 4UT9H 3VXMA 2YD4A 5JDSA 5TDNA 5C0AA 5IB5B 4WHTA 4OZHB 5E70A 4D9QD 3RHWK 5EULV 1CL7H 1BBDH 3GHEL 3T1FA 5IFAL 1Z0MA 1U91B 3CSYB 4OGYL 1A0QH 5JIKA 3M8OH 3F62A 1I9RL 4LSSH 5F1NA 3LD8B 1GZQA 4LFHG 3SE9L 3C9NA 3RWGA 4ZTPL 1ITBB 1J88A 4YFEA 1DANT 1T1WA 2GW5A 3QDGE 3BPOB 2PCPB 5ISZA 4ZYKB 3BZEB 3JTTA 2YD3A 1FFOB 1KFAL 4X4YA 3R4DA 3RKDC 2H32A 4WUUE 4D9LH 1SMOA 4JRWA 3OKOA 1MCJA 1IAMA 1A9BB 5E1AA 1A6TA 1AR1D 1RURH 4NQEA 4Q2ZA 5ID0A 1RZKL 1X5FA 1CZ8L 5F7FA 1U95A 5DK0B 2E7CA 2IF7A 3WLBB 3IF1B 2E7LC 4V2BA 4JPKL 3MOQA 5EWIL 1KTDB 1RJYB 2OX5A 3OG6B 1AE6H 4U0RC 5FKAA 5HYIA 1RPQA 4PJIB 2BSRB 5F9AC 3R06A 4ODSL 3HZYB 2OBGA 5ICXB 2VZ1A 5FO7A 4G6JH 3AAZB 4P4KB 3TZVC 3F6LA 1I3GH 3D39D 1JWUA 2Q86A 2VC2L 3VGHA 5BJTB 2Q87A 5E9DE 4JAMB 5LGJB 5DD0H 1H8NA 1MCKA 3QO0A 2V6HA 3IETB 5MERB 2R29H 3OPZL 3LEYL 4L5FL 5KVGH 2DM2A 4UIKL 3TCXA 1EAPB 4C59B 1GZPB 1IC7L 2W60A 3IDIA 4GRWE 1UWXH 4ENEC 4UOW0 2OJEB 4JDTH 4R7NA 4LSRL 1JZ5A 1NBYA 5FUCE 4H1LH 5FB8A 2EH8L 2PR4H 3TWCL 3FT2A 3MV7E 3NAAL 5ABDE 3VE0A 1D6VL 3VFUA 3BAEL 2G60L 3SE8L 2RBLA 3LKSB 3JV6A 4U1IB 3D39B 3DXAD 3P4OB 4NFCA 2ICCA 3ARTA 1SHMA 1MIMH 1OPGH 4XNZB 4Q9QL 4OZ4B 4OF7A 3DVNB 5E00B 2BC4B 1MIEH 2UVEA 3QIBB 4XCCH 4PREB 5TDOA 3CXHJ 5JORB 1H3WM 4MQ7B 1ZS8A 3FOMA 3CZFA 3OXRB 4OCNC 4PGCB 2OL3B 5DZNA 5D2LA 3GMPA 4GMSH 4HV8A 4TQEH 5AZ2L 4NNPH 2B20A 2O5XL 4EJ1C 3OXSA 4YJZL 1TETL 1BOYA 4M7ZB 4TSCL 1OL0A 4S11A 4NFDA 4M3KB 3K3QA 4X80L 4H0GA 4JQXA 4P5MB 3DXAB 4EQ2A 4DW2H 3JUYA 4LNRB 2UWEA 4HIEB 1I1YB 3L9RB 3JWNC 3MRFA 4BELD 2ARJB 5FOJA 2A6IA 1CG9A 4P9MH 4WY7L 5C6PB 3R1GH 3QXTA 4YFDB 4DVRH 4F57L 3QUXD 3ZTNH 2DQHH 3RWFB 3H2WA 3O3EA 4M00A 4R26L 3W39B 5J1AB 5B21A 4QHUA 1XMWA 2VABB 1XGRB 2PTTA 3MFFA 1P7KA 2P48B 1RD6A 1HZHL 1NBVH 3NZHH 2BHUA 3RGVD 3PWUA 1MWAA 5IV2A 4Y16A 5HI5C 4DZ8A 1WAAE 4ODXA 5EO1A 3UTTD 1YQ2A 2IH3A 4ELME 2O93L 4HS3B 5I1LB 1S7VB 1M7DB 3E8UL 3WBDA 2VDNL 1LO3L 1MCPL 5FK9A 3I3EA 4ODTL 3MLUL 1FRGH 5JPMA 1CGXA 4U6HB 4G9FE 2I26N 1ETZB 5J13C 3GKWL 4LAQH 2FX9H 5IB1B 4KWUA 3T09A 5I8CA 1NGZA 2CJUL 4PJBB 1AGEA 3IJYB 1BHGA 5ITBH 1DR9A 3QUXB 1AD9B 4R8WL 3LS4H 3D2UA 3BZFB 3T0ED 4XZUB 3C6LC 3MREA 3CMOH 4JRYD 4LKCB 1JYXA 1PEWA 3H9HA 3MXWL 3RGVB 1FG9C 3I6KA 4IRJC 3WEXA 2DQEH 3UTTB 2HG5A 1G0YR 3G9AB 1VGKA 3FHQA 3OGOE 3OB0H 1Q0YH 1XF2A 2H3NB 2OCFD 4MA7L 4ELMF 3TJEL 1I85A 2H1PL 1G1YA 1MUJA 1RK1A 4ISVA 4ODWA 5EZLB 1RY7B 3TJHC 2X4SB 2DL9A 2WIIB 5FHBH 4NRZB 1BP3B 4U1LB 4HAFA 5IEHB 3E3QE 4K3DL 1CWVA 2AKRA 5TDPB 5HXMA 1ZXQA 3MROA 4LPUA 5EN2B 4HGMA 4QRPD 1VKXB 1D6EB 5C0EB 3FB8A 1FNGA 3L1OL 4GUPB 4JRYB 4R4FL 2VLME 5EUOE 3V95A 4NN6B 5IFJA 3FFCD 4HC1L 4QRRE 3T0BA 5JR1L 3BGFB 3GBNH 2C26A 4XT1C 4OLWH 4UB0L 1K4DB 4EZMA 5D7IE 1SBBA 3OJ2C 3B43A 3QCUL 1MJJB 3RUGA 4NRXA 3RL1A 2R2BA 2GAZB 1YMHA 2B7DT 3WXVH 2ED8A 2ZCLH 3WE6B 3PL6D 2E7LA 5HVHB 4UV7H 3ZKMD 1CFBA 1F00I 2VXSH 3BZDA 4QRPB 4EOWH 2GT9B 5KSVA 4A6YH 3O3BB 4LPWA 4AL8H 4H25B 2I24N 3FFCB 1Q1JL 4S1SH 3INUH 5C0ND 1I7ZB 4KV5E 5EUOF 5C0IA 1HNFA 4JFFD 2V2TA 4HDIB 2MFNA 4L3CA 3S7GA 1OAXL 2EE9A 2COQA 3KPQB 1VADB 2VO5A 4H1LA 3B3IB 1X6NA 4PG9A 4PYHA 3DMMD 1KTKE 3P30L 2FX8H 1HNGA 3HNTL 3MV9A 4TSAL 4M7KL 1A5FL 1E4KA 3EYQC 4NJ9L 3WO3B 1IAIM 4QWWD 3VFSA 4DGYL 2DLIA 4IMLA 5T33H 1I1CA 3DI3B 4RWHA 1R3HB 1BFOB 3QO1B 2BVOA 2OI9B 3GI8L 5JXED 5SX5H 1K2DB 5F9DC 3IKKA 4OGYH 4E5XB 1XF4B 3MRMA 1AD0A 1J0HA 4OT1L 4DAGH 3E6FA 5HYSG 4L4VD 1TTUA 4OJFL 2R2EA 4PRHA 4JFFB 4L8BA 1OWRM 4GG6E 2L4OA 1GOFA 5FYJU 5I76A 4JREC 4KK8C 4OV5A 1ZMYA 1AIFA 3ROLA 4WW1A 2AS5M 5I30H 2EDHA 1KFAH 3B9AA 3DMMB 1QVOB 4YHIA 1N4XL 4LASL 4W4OA 5EOTB 2DM3A 2FWOB 4U1HB 4ZOEA 1CCZA 5TF1L 3I85A 4D0DB 4XRCA 4UI2A 4QEGA 2QQLL 1JK8A 5IF0B 4LVOB 2VXTH 1HWGB 3QEUA 1TQCB 4DVBB 1OF2B 4APQD 2B1HL 2IANE 4ZD3H 4XNQA 3G5VA 5I1HH 4HQQL 5KSBE 2D9CA 4KY1L 3BUYB 4L4VB 1DUZA 1QQDA 1NCCL 4O2FB 2R1YB 2YXMA 5DRWB 2DMBA 3QXDA 3EGSA 5C3LD 5EO0A 4X7FC 2ADFH 4PRPA 3UTZB 3AVEA 5HDQL 3K8KA 4GG6F 4LHUD 4CVXA 1LNUB 4TPRL 4E41D 4P9HL 2CDEB 4NUJA 1HYRC 3DETC 4Y5XB 3I02B 4MA3A 3SKMA 1S78C 4NT6B 4HLZG 1S9WA 2OMBA 4LLYB 4NUGL 3UBXA 3LKQA 1RU9L 3VGBA 4PPTA 2VZSA 3GUTA 4G42B 1T1XB 4PJHB 4QXTB 1RJLA 2AVGA 4APQB 1DLHA 1NCDL 4PS4L 4R2GD 2D03L 1G84A 1XZ0A 4FFVC 1Z5LA 2A6KB 4UOW1 1JWMB 3CFJA 5TQ0L 2FGWL 2VXQL 3MRRA 3CDGB 4BH8B 2NR6C 5KSBF 1D6VH 3QUYC 3OAYH 4AJ0A 4RRPA 2C7UB 4U7MA 2ZUSA 2I60L 4LHUB 1AHWC 4K8RC 4Y7MA 4FQQA 5B22A 1YY9C 3SE4C 5CEZE 4Q9QH 2BDNL 1YZZA 3ARWA 3D3VE 3DO7B 4DCQB 2Y1VA 4JR9H 2R4RH 4PJ5D 4BK5A 5I2IB 1KNOB 2QQNL 5F8RC 1QLEL 4K8RH 2B2XL 2DDQL 1K6QH 1Z3GL 5I1EH 3HNVL 2APVA 5ANMB 2MPAH 5AZ2H 1T6WA 2ICES 2WBJC 5CJOL 3LPWA 4M61A 1P4BH 4JFXB 3VXRE 5DDHA 2OTPA 4JFOA 1NGYA 1PGRB 4LCYB 2PW2B 4V2CB 5HYQB 3JWDL 1KIRB 1YNKL 2A2QT 2Z92B 1SJXA 3FN3A 2R0WL 1DVFD 3O6FD 3G5XB 1CFNA 1W72A 3MJ8A 3PV6B 4GAFB 3GMNA 1PKQB 5IB2B 2M26A 3IXTB 5KG9B 4PJ5B 1QSZA 2WMPA 1MJ7H 2HP4A 2A6JA 4BKLA 4MJ5A 2E27H 2EH7L 5IG7A 5E8DH 2HVKA 4PJCB 1HZHH 4OLXL 2GJZB 3SDDD 1C5DB 4PLKD 1ZVSB 1ED3B 3QHZH 1TZHA 1GIGH 4ZFFA 5FECB 2HT3C 1FL6B 3B2UC 3RZCC 1FFNB 4MJID 4RMQA 4R4BB 4A6YA 1R0AL 2NXYD 1MCPH 3O6LL 3OB8A 3RNKA 2EEDA 4Y4HB 4P46C 4F7TB 2YN3A 1KF9B 2BERA 1R3IL 1MLCA 3MOBL 1KXQE 3GKWH 3RWDA 4GG8B 1DVFB 1V5JA 2XA3A 3O6FB 4MNQB 4YE4L 3F12B 4Z7UE 5F89A 4LVHB 5EU6A 3HUJE 3KLHC 3BQUD 3NH7L 2BOCB 4P3WA 5AYUL 5FHAH 5IB4A 1OGAA 5HHQA 4DOHB 2BSSA 4XNXH 2KQMA 1WC7A 1IQWL 2HH0L 4BJLA 4PJXA 4WCYL 3I2CH 3NFPB 4AH2B 4PV9A 3SDDB 1YY8B 1QTYT 1MVUB 5EZOH 2QKIA 4ONGL 2YD2A 1U58A 3D5OF 3OKDB 4FQLH 4UQ3A 1GGIH 1Z9MA 2H1PH 4FFWC 5L7XL 1AXIB 4CN4A 1EEZB 5T1LA 3V6ZB 3W0WD 4PJAA 5IIEA 1PW3A 1ORQB 1CXEA 1WF5A 4GAGH 4JY6B 4W6YB 1XGPA 1WSST 3EOTL 2FYYA 3LN4B 2E7BA 2CDFB 4HUWB 4PRBB 4Z7UF 3BQUB 5IW1B 1MRFL 1F5WA 4YBQD 3MRIA 3LZFH 3HUJF 3VXSD 4O4YH 1WWAX 3WDHA 2NX5E 1J05B 2EO9A 1FSKC 5I1CH 2P1YA 4X7CC 1ZTXL 2VLJA 2JK5A 4KDVA 1L7IH 3EJYD 1GYAA 2VITB 3S97C 4F58L 3DUUB 3OAZK 1C5CH 1YEFH 2FEDC 3GKZA 1CU4L 1GGBL 3PDGA 4GQPH 4Z78A 5IOPA 4NJAL 3GSNH 3ZYOA 1JZ8A 3S6CA 4UB0H 5CZXC 3Q6FA 1N5YL 4NO2B 3W0WB 5T5FL 5AD0A 1AY1H 4M5YH 2BZDA 5IEKB 1C08A 1IGCL 1F11B 1BEYH 4XBPB 1OP5H 2VDQL 5I18H 3K74B 5SWZD 3ARSA 3EFFB 1UG9A 3EYVB 5CP7A 3H9SA 4G6ML 2DBJA 4X8JA 1A4KA 2ZSWA 5DQ9B 2BXZA 3A67L 3VXSB 3DX9A 3MGAA 5ILTH 2QL1A 1JWSB 1GOHA 1JPFB 3WLWD 5J6GB 2V5SA 3SOBH 1HH6A 1OGTA 4FZEH 1RUAH 3BKCH 4PLNC 1X9QA 3MBXL 1MI5E 3KPNA 3OKMA 3TO4A 1E6JL 2CRMA 4PG2C 5HPMB 1FO0H 4OCWL 2WUCH 1NFKA 1MY7A 3GSUA 3WNOA 1TTGA 4HX1A 1QP1A 1OAXH 5EB9A 5F3HB 1M7XA 2D9QB 4U2ZA 1H3PL 5BV7L 4PTUA 5BQ7A 3EYFB 5HGHA 2K3TA 4XWOC 4Y1AA 1N0XL 5D1XD 3G08A 3PDOB 5KN5B 3P30H 3SQOH 1FYTD 1E28B 3IYLW 4M7LT 4MB4A 5SWZB 2BVUA 5HI3D 2DRUA 4U1KA 5AG9A 1A7PL 5DWUL 4NQSA 5D7SH 4JM2F 3UAJD 2BJMH 1F4WL 1UM5H 4YC2B 1ODAA 1SEBA 3B9VA 4KKLD 3U7WH 1UXWB 2P8PA 3C09C 4YAQB 4K23H 3S4SB 3OR7A 3QUYA 4PYGA 3RVWC 1CXLA 4OT1H 2CRZA 1MF2H 4OZGA 15C8L 1AHWA 5JA8B 1S7UA 4OJFH 3C8KB 3TIDA 5FA4A 5C9KA 3SJVE 5MENA 3P73A 1EO5A 5DD1L 4QTHB 4QRUB 3O3AB 4R4ND 4KTYA 1JPSH 4IIQC 2OXGA 3L5WA 5D1XB 1N6QL 1DQLH 1U3HC 4ZTOL 1U8PB 5DSCA 2O5YL 3NN8A 1FYTB 5M7QA 3FQRB 3ROOA 1RMFL 1PYWA 3FQXB 3IGAB 5TF1H 3G04A 4FXGB 3MLSL 3U6RA 2XQBL 2WBJA 5B38B 3ZDXE 1H15B 2XWTB 2AXGB 2FB4L 4G43B 4CKVX 2NNAB 1QRNA 1B4RA 5E99L 4ONFH 4ZAKD 2FJGA 3ZYJA 1MCHA 5I1GL 1A1NA 5DHXB 3U36B 4P2RE 3HPJA 5HDOA 1D5IH 2H26B 4P3DA 2ATKA 4LSTL 4WI6A 1KJ2L 3QUMH 4NHCL 4XVJL 5KOVC 1KB5L 2EYRA 3PJSB 5GRYA 1U92A 1FL3B 2B4CL 3MNZA 4Y4FD 2AEPH 5GQBA 1WWWX 1ZA6A 4NC0B 2DQCL 5HYJE 1DTUA 4MNGA 2D7OA 3RWIB 1HXMA 3PWPA 1RU9H 3RVUD 1FGVL 3V0WL 2FR4A 4H5SA 3OF6A 1JGUL 3RZCA 2DN7A 4H1LG 5BZDB 4LBEB 5T3ZE 2BFVL 5EU5A 3WS6C 4KK6C 5AAWA 2D03H 5C0RL 2R56H 4NWUH 3ZDXF 1NMAL 1ZV5A 4U4BA 1I9EA 3FQWB 4ZAKB 3K4DA 2NY1D 3NFNA 4P46A 5CKGA 5CJ8A 1FZKA 1WZ1H 4QHLA 5CZVH 3BYYA 3T4YB 2FGWH 4QCIB 2ZUVA 3T0XA 4LRIC 3BMWA 2BCKA 2DTML 5F7DA 3LPGA 1AXSA 4XCNA 3IAQA 1ZHLB 5GSRB 2F54E 3RDTD 3KXFB 5C6WH 3MLTB 3QDMA 4MVBC 2I60H 5HHME 5IQ9B 3ARBD 3I6LD 4Y4FB 1PSKL 1AXTH 1D5BB 1H3GA 4BQBA 1BWMA 1GRWA 2NY3D 4ZUVB 4HMDA 5DI8A 1MFDL 4PGZA 2CKBB 1RZGA 4KJWD 5ADPL 5EU3A 3U4BH 4JQIL 1YNLL 4P2QA 1NDGB 3F7VA 4ZDHB 2ZUUA 4PFEA 2Z0BA 2IQAB 3QIWB 1KPUA 1QLEH 1OAQL 2B2XH 2XWJB 2E9JA 1KB5B 3ZDYF 3VWKC 4JFYB 2BVPA 2HYMA 1YN6A 2NY1B 2NY5C 4QHNB 2GTWB 3B2VL 3DWTA 1WBZA 1YNTB 4HBCH 5H8DA 3D18B 2W65B 5L9DL 1Q9KB 3RDTB 1IGTB 3ULVE 3IDJB 4I18B 4X83A 1F8TL 3GSNA 3H0TB 2ZCKL 4JZNB 4DKAA 2R0WH 3W82A 3ZKXB 3FOLA 5DRZB 1E27A 2V7HA 1MHCB 3ZSTA 4NQUA