5J11C

Structure of human tslp in complex with tslpr and il-7ralpha
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
190
structure length
190
Chain Sequence
GVQIQIIYFNLETVQVTWQASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymic stromal lymphopoietin
publication title Structure and antagonism of the receptor complex mediated by human TSLP in allergy and asthma.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 35
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2016-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j11C02
4HJ0D 3GHBL 4LLWA 1R3HA 2BRRL 1FFNA 1S9VA 2DKMA 4PLNC 2R0LH 5AYUH 2VQ1B 1UGNA 5JQ6L 2DQDH 4MWFA 4PJHB 2AJZB 1FLRH 3I3DA 1V3LA 1HQ4A 3OKMA 3S35H 1CU4H 3MACH 1KIQB 1A6ZB 1LP9E 3BEWB 3PP3H 4P4RB 4KRNA 4QOKB 5HHMB 1CIDA 1SMOA 4J3XA 5C08E 3SEPA 1BD2B 3GMLB 5D7KD 4ELMB 4HT1L 3GM0A 5FO7B 1GGCH 4JRXE 4QHLB 5DJCB 3FRPA 3QCVL 4HIJA 1U0QA 4OZ4A 2B4CC 5E99H 3OKKA 3TN0A 1YJDL 1JGDA 4PJDA 3TCLA 1DE4A 1I9RL 1QFWH 2RIKA 3UTZB 5L8KB 4WHDA 2I07A 5JUEH 1D5MA 4XCYA 5E8EB 2IBZY 2NXZB 2AV7A 5F7DA 1RUKH 3VFVA 2B4CH 3QCTL 2GW5A 4HWNA 1R3IL 2AJSH 1H15B 1OGAE 1PLGH 1IQWL 1T0NB 2WNGA 5HPMB 2ATPA 3BUTA 3BGFC 1JCKA 5GJSH 1DBAH 2YPLE 4P5TC 4Z6AT 4HHAA 5HYJE 2X7LB 3KDMB 4MD0B 3U30B 5ANMB 2UZIH 3MRJA 3PWPA 4HS8H 5HVGB 1UZ6E 2R0KH 1IC5L 4A6YA 5K9KA 3QULA 4G43A 2X40A 1FNHA 1QSEE 2I9LA 1NFKA 4PRPB 4EUPH 3ET9F 1U8PA 5HGAB 5T3XD 4DKEL 5MEQB 3ULSB 1MHEB 1NFDE 3ILQD 1I7RB 3MJ9L 4NUJA 4ZD3H 2DQGH 2YUZA 3G6JE 3IAQA 2L7JA 5D1ZC 3CZFB 3GBLA 3TA3B 3O45A 1PG7L 3TV3H 4PLJD 4P46A 4D9QE 5J56B 5JMOC 2VLKB 2YN3A 1NQBA 1T20B 4XNZC 3RVUD 2Y07L 1CXLA 1MFDL 4JVWA 3MV9B 3O6KL 4LLMA 1S9WB 1NGYB 4MB4A 5DF0A 1RK0A 1FJ1A 3H9SA 3DETD 3B2VL 4GAGL 3V6ZA 4MA8H 3OKNB 5C07B 5IM7A 1KPUB 5E2TH 1QG3A 3ZE1F 4XAWL 2A1WH 1MFAL 4B53A 2IANB 3X3FH 4ZFFB 4KHXL 5GZOC 1IAOB 1VHPA 1H8SA 1II4E 4U1HB 5KS9B 3BFOA 5DK3A 3BO8A 4Y16A 1Q9WA 2UWEA 3BX7C 2DM7A 3FQNA 3L95B 4JFFE 2Z4QB 3MR9B 4EDXB 2AEQH 2BC4A 1J1XH 4OBSA 4XCFH 2R0LL 3HE6C 2BNQD 5C0DA 5SV4A 1CGSH 1FLRL 1T1XA 1CDYA 3S35L 3BIKA 1CU4L 3IDYB 4G8GD 4L8SC 5ACZA 4QF1B 3MACL 1I85C 4MAYA 1T1ZB 5TF1L 1K3ZA 4RMRA 2GK0A 1SEBA 5J6HA 4MDJB 4ZSOE 2P8MB 3KXFD 4NN6C 1OF2B 3V5DA 1WIOA 2R69H 4FXKB 5IROA 3FHAA 3MV01 1T7WA 1ZLWH 5E99L 2VDRH 5IW3A 1S7XB 2NYYC 3OKOB 1AE6L 4MJIB 5JUEL 4BKLA 3KYOB 4XGZB 1JK8B 4JG0H 5T1KA 2QQNL 1RUKL 1YC7A 3VXMA 2B4CL 3U46A 3HZVB 4P57B 4RWYH 3V5KA 1KNOB 3HE7B 3NBNA 3MLVL 2L4OA 3CDYA 3DYPA 4LVNB 1DBAL 4P2YA 3D3VD 2HFFA 2FEDD 2NY7H 2EKSB 2FGZA 5JPMA 3GMPB 2GY7B 1T2QH 4EN3C 4HS8L 1ED3A 4KXZI 1DUYB 1INQB 2R0KL 3DTXA 5ALCH 1CLYH 4G8IA 1F3JA 1OGTB 4LVHB 2Q8AH 5JHDB 1XZ0A 2EE9A 3T77A 4KROC 4I48A 3UTPD 4JY4B 3SGJA 2R1YB 4LSQH 4FZ8L 1A7RH 3MV7B 2PNDA 1PX3A 5CGTA 4RGMC 3T8XB 5E94A 1ZANL 1YPZB 1WBYA 2P42B 4ZD3L 1NJ9A 4RZCA 3E1F1 4WIQA 1M4KA 1WLHA 2NX5D 3DXAE 4JFEB 2C4FT 1YDPA 3EZJB 3ZE0F 2N1KA 2PO6B 2A6DA 5GIRA 3TV3L 1CBVH 3MRCB 5DHVB 4PGZA 3CXDH 25C8H 4YXHH 1XFPA 4Y4HC 2BVUA 3AB0B 1NAMA 5HYQB 4U33A 2DQTH 1S5HA 2FSEA 3MUGB 3PWJA 5KBNC 2P45B 3BGMA 2V2TB 3WXVL 4KQ3H 4MA7H 3GSWA 1X44A 3MRIA 5T33L 2J6EA 3HC4H 4GXVH 3QDJD 3RY5A 3IDJB 3Q6GL 4MNHA 5E2TL 1HHIA 4AEHL 3T2NH 2A1WL 4U1MB 4O02L 4YX2L 2IAMD 4WW1B 1P7KA 4PJAE 2GKIA 5INCA 2PW1B 5F1OB 4N8CL 4J1UA 4KKNA 3T3MF 1FNGA 5J89A 5HHOD 4OTXH 1YY8B 2AEQL 2X9YA 5F7KC 1EEYA 4XCFL 3HCVB 2ERJC 2R9HD 1EZVY 1FSKC 2X4SB 2Y9RT 5TDNB 4E5XA 1LEKB 1NCBH 5DHYB 5E6IA 1H8NA 4M48H 4XXCA 1KXVC 1HINH 5L7XH 1UJ3A 4KH2A 3C60A 4TVPE 2VN7A 12E8H 2MSPA 2X4NB 1RUQL 3LRSA 4I0PB 3ARGD 3FMGL 3LEXB 1VGKA 4P2QA 2MHAB 3QWOB 4BFIB 4TPRH 3ARFD 3TJHD 2WQ8A 2V2WA 5HHNB 5DHXB 3G5XA 3CMGA 2R69L 4K3DL 2XV6B 3IB4A 4HMCA 3I2CL 3JWOC 3WBDA 4JHAH 4LKCA 4GKNB 3MBED 4HH8A 4LHQB 2VDRL 2ED9A 3JWOH 5C9JB 5C0CE 1NC2D 5FV1L 3WHXA 4JG0L 3KYNB 4ZAKB 5CP7B 1LO3L 5JA9A 3CFDB 3PHOB 3VMOA 3FRUA 4I8DA 4RWYL 4Z7OE 4BJLA 2GUOB 1TJGH 1DFBH 1T4KA 4IRSB 4W68A 1HSAB 2HLFC 2UV3A 1JWUB 5JQHC 3IRZA 1BBDH 5FM8A 5DI8A 1H8OA 2NY7L 3HI1A 2QADD 1T2QL 3H8NA 1EO8L 1XEDA 4MA3A 2LABA 3MNWB 2W65A 5ALCL 5FGCB 2EC9U 1CLYL 4KK8C 2AV1A 5KVEH 4I5BA 1F00I 3S97C 2WUBH 3QDMB 5D2NB 5JDSB 1A7RL 4HX1A 2NY3C 4R4BB 3IETB 2Z93A 3S88H 3SCMC 4AH2B 1OAZL 1MLBB 4PV8B 3QUMH 4HJGB 4LRIC 4E42A 3BKML 1NBZA 4Y1AA 2CDEB 2NY6C 2EIZA 3CDGA 3F58H 5DJ0B 3SO3C 4Y5YB 3KPTA 4JJ5A 3UBXB 4NP4H 2GAZA 3OB0K 4ORGA 2YZ8A 3VD7A 1T66D 1OT1A 3ARUA 4R2GD 3TNMA 3FFCE 3QDGD 2DQTL 3WJLC 1XIWC 2P24A 2F54A 3RWEB 3AU1B 3DARA 4DEPC 4KQ3L 4MA7L 4OLWH 1RIHL 4D0DA 5C3TA 1ORSB 3HC4L 4GXVL 3EOYG 3RU8H 1P6AB 5IV2A 2GSGA 4ZUWB 1TTFA 3T2NL 2HH0H 4NCC1 3ALPA 2DJSA 3ZYJA 1C12A 3MRKA 3VDAA 2FJGB 3QP3A 3FN3A 2BVYA 4WFEE 4WVRA 1X5IA 5IMMB 3N1MC 1A6TB 4DN4H 2DQEL 4DW2L 5KN5B 4OD2A 3NABH 4Y2DD 1TZIA 3D1MC 4NO0B 3D39A 1IGJA 1NCBL 1GAFH 1GGBL 4M48L 4MX7B 4U6VH 1HINL 3WKNA 4R9HA 4UDTB 4U2ZA 2ZUSA 5L7XL 1T6VN 3OSKA 2YEZA 4C55A 12E8L 4BUHA 2R56H 3RWHB 2B20A 1EMTH 4TPRL 2WZPD 3SY0B 3TIEA 3RZCA 1CFQB 1CIUA 1SEQL 1ZSDB 3NFNA 1F4XL 1A7QL 4JHAL 5SWZA 3DIFA 3M17A 5FM5O 1KIUA 4C4KT 5D1XB 3S37X 1CGVA 2DS4A 5JW5A 1FFPA 3FOMA 5DRWA 3JWOL 3QEQE 2OI9C 1JGVH 5BJTB 5E2VH 2FDBP 3GMNB 4OIIH 4ZQKA 2FEEL 1DUZA 4YEFA 2FCBA 3HS0B 4ONFH 3TBYB 4G9FD 4JREB 5D1QA 1DFBL 3RUGE 4CVZB 3EFFA 4K3HA 1BBDL 4HK0A 2H26A 5GQBA 5D2LF 1FG2B 1WEJH 1CXHA 5E5MB 3WIHA 1B4RA 3MRBB 4M7LT 5AEAA 4K3EH 3QG6B 4G3YH 4KI5D 4PJBE 5JOEA 3EGSB 1U9KA 4WJ5B 5IVXE 2EYRA 3T3PE 2WUBL 4ODHH 3BN3B 1PSKH 4NHCH 1T3FB 3UPAA 1B0RA 4ODBD 4Q74A 3DO3A 3S88L 1NBYB 4Y0GA 1NEZA 5D7KE 3QUML 5IP4A 4N0UB 4RMVA 1BFSA 4HIEA 3ILPB 3KLHC 3BE1H 3VXRD 3F58L 4Y5XA 3TBWB 3S37H 1DVFB 4NP4L 1P4LB 2G2RA 2HMID 1AHWB 5EU5B 3NGBC 3VXOB 4ODSH 3SDAD 2BNRB 4HS6A 2G9HB 2HTKC 3DETC 2JK5A 3A6BH 3PV7A 1MCKA 2PXYD 5ADOL 4OLWL 3PABB 3MROA 4O2EB 1BFVH 4KJQD 4OFVA 1MPAH 4G6AD 1TVHA 2MQ3A 4JDZB 5D7IA 3VRIA 3D9AL 4DFHA 1DQJA 32C2A 4YFLI 1JMXA 3NPSB 2J8UF 1U8KB 5DJ6B 2PYED 3HG1A 4DZBA 4PY7A 3TFKC 4PJXE 1BQHG 4ZFGH 5D6CA 4K07A 2NZIA 1O7VA 2P5WB 2NW2B 3GSQA 3PIQA 4NRXB 4C58B 3KPSA 5IBLD 3BKJH 1GAFL 1CWVA 4BH7A 3DROB 2G75A 4HKZA 4U6VL 3FTGA 1ZT1A 3W9DB 1N3NB 3VJ6A 1IRAY 4AL8L 2VDQL 2Q7YB 1WWBX 4QCIA 3KLAB 3RAJH 2Y25A 2R56L 4PP2B 4KDTA 2RQ8A 1EMTL 2YBRA 4PJFB 3NACH 3L9RA 3WUWA 2VWEC 2F58L 2YWZA 4U05A 3VD4A 4NKDA 1EX0A 1U2HA 3NH7L 3LD8C 5F9AC 5TH2B 2CPCA 5KAQG 5B3JE 2ZUWA 2DLTA 5C6TH 3IFPA 4ODWA 2RBLA 1KJ2L 3KJ6L 1MCBA 1I75A 3WLWC 5FOBA 4HIIB 2ARWA 5E4EC 4GMTL 5AG9A 2OSLB 1EFXA 3IDIB 2FBOJ 4E0RB 1DP0A 2CKNA 3LVEA 3QT2A 2X4PB 3DV6B 2P7TB 3O6FC 2N7AA 4H26B 1RJLA 3NCFB 5IBTH 3QHTC 1WEJL 4IHOB 1MAKA 3TC9A 1I1AA 5DD0H 3QFJA 4MAUH 4CADA 3GBNL 5EU6E 2BNQE 5E8NA 3TVMD 4PRDB 2OMBA 3GJFK 1IL1B 4NNXA 3FOLB 3TWCH 5FHAH 2NQCA 1K2DB 3FT4A 4ODHL 1JP5A 1T21B 4PJ7A 1S9XA 5IHZA 2M2DA 1PSKL 4G8GE 4GKOA 3STZB 2JCCF 1QLFB 4GAYA 3T0WA 4TULL 3TBSA 3LKOB 3LRGA 4ORZC 1X5XA 4E41B 3KXFE 1G7PB 1RK1A 4YZFF 4QXWA 4D94A 1G7MB 4XZUB 5ETUA 3H9HA 4HWZB 3BE1L 2V7HB 3S37L 3MGOA 1G7JA 5I30L 1NLDH 1ROWA 4O00A 1NGZB 2ZUVA 2EIDA 3UTQB 2AK4A 1BFOB 4GH7B 4NKQB 1P7HL 3FQXA 3O81A 1RPQA 5H8DA 5F97E 1FZKB 1MEXH 2AGJH 1A7NL 3A6BL 1BFVL 2XWBB 3ZTNL 2ENYA 5FYKD 3MRDB 3QUYD 1MPAL 3D3VE 1QO3A 4G6FB 3LV3A 4XNYL 4GJTB 3TYGL 2R23B 3KPMB 4AENB 1PJ9A 1MCIA 3G5VB 3RTQD 4YHZL 3GHEL 4CU8A 2R0ZH 4WI4A 5I17A 3UTPE 5BS0B 4ZFGL 4O9HL 1SQ2N 2LFGA 1T2XA 4NFBA 1HH6B 5DMKA 3IAGC 4GRLC 4X8XA 2EDWA 4NNPL 5ENWA 2CMRH 5E1AB 5D7JB 4OFIA 1P4BH 1HWGB 3C6LC 2NX5E 3KYMA 1MIEL 3MODL 1QSFA 5B4MD 4LGSB 3BHBB 1G7IB 3C9NA 5GS1A 1P5UA 5F44A 5C09D 1HHHB 3B9KB 1S7QA 3WEXA 5I9QC 4IRJA 2IH3B 3QXAA 3NACL 4WWKD 5SV3A 1ZTXL 4J4PA 2OTPA 1A2YB 1FL6A 2Z31D 1AO7D 2N7BA 4N5ED 4PJEF 2QSTA 1A1MA 5A43C 1H3WM 5LBSH 4GG6B 4FQHA 2BY2A 2XACC 4LPYA 4QO1A 5L2JB 4RIRB 3QDJE 5C6TL 4OZGE 2YD9A 3VXNB 2BY3A 5IUSA 3JUYA 3C6SB 4KZDL 4G8EA 4JFYA 3O2DA 3EOBA 4WEBH 4GUPA 2R4SH 4GSDH 1XF4B 4XPGL 4MXVE 1Y6NR 1E4XH 4CUCA 1MRFH 2QADC 3QPQC 1GHFL 4HDIB 5IBTL 3TH3T 4YBQD 3GIVB 5HHOE 4Z7VE 2PTVA 3FO0H 1PDKA 5DD0L 5TDPA 4MAUL 2VDLH 5KSBE 5KTEH 3HPLB 2DJUA 2XQYG 3TWCL 1ND0A 5FHAL 5GRUH 1BLNA 1YEJL 4P4KD 4DOHB 4K3JH 1SBBA 1BVLA 3HRZB 1CL7I 3SDXA 2DMKA 1FVCB 2AABL 4LDLB 5FA4A 5EBWB 5DMGD 4M7ZC 1S7VA 4TRPH 3VRLE 4RFEA 4X7CC 4PP1C 4YE4H 5C08A 3UPRB 4KY1H 3TO4A 5BRZD 4WGWB 1N8ZB 1JI1A 3CH8A 4GW5A 3DUUA 4N1EA 4JRXA 1NAKH 5D71H 5GRZA 2QLVB 3QO0B 5CGYD 4Z7UB 4M5YL 3UXFA 2AJ3A 4LEXH 2GJZA 1WZMA 3V52H 2P8LB 3SGKC 1ZGLP 1UB5A 2EDLA 3V6BR 1OAXH 3AM8A 1MEXL 4UILH 1GOFA 2AGJL 1FH5H 1OLZA 1OQOA 1MCOH 3BP5B 1WF5A 4BH8B 3Q3GB 1FFOB 1OGAA 1PY4A 3O3BA 4MDIB 4N0YH 3KLDA 5EFIA 2YPLA 1TETL 4C59B 4ZO6A 1RU9L 1U8OB 2B39A 4YDLC 4V1DD 1RFDL 1D6VL 2KBGA 1WFNA 4K8RD 3WL9A 5I18H 5DRZA 1JVKA 2H6PA 2R0ZL 1BJMA 2FL5A 1QSEA 2Y23A 2D0GA 4GW1A 3P77A 5FUOH 4YIQB 4ZYKA 5C0IA 1TDQA 4PJIB 4Y2DC 5IG7B 7CGTA 1YA5A 2VITB 2JB5H 4ODVH 1S7UA 3MREA 3N1FC 1NFDA 4HQQH 1UWGH 1JGEB 2CO6B 1V7MH 1P1ZB 1ZVYA 5LGJA 4JFDB 3T2PA 1UQSA 3FFDA 4HUMB 1XGYH 3MMEA 5J6GB 3RVWD 1UYWH 5DUPL 4EJ1C 3D18B 4GRWH 1G1CA 4AK1A 4NSKA 2ADFH 4NKOB 5FCUH 4X0KB 5T1MB 4JDTH 4EDWH 4YGAB 3QDGE 5LQBH 3CFEA 43CAA 2HKHH 3QI9D 5F6IB 5JLZA 5LBSL 2ORBH 4C4KO 3JUZA 3BPNB 3IKCA 4MS8D 3WHE1 5D93B 3PL6B 4HKXB 3FB7A 4J3UA 3VGAC 4H1LB 4LL9A 5IW6A 3C5SA 3FONA 4LSVH 1GPOL 1UWXK 5JIPA 3MJ6A 2OR8A 2R4SL 3WSQH 4GSDL 5KZCD 3G9VA 4S1DD 4X9GA 2FYYA 3SGEI 5JORB 2GFBB 3ZYZA 1GL4B 3UJTH 1FQ9C 1G9EA 1FNEB 4H25B 3FO0L 4RQQB 1D9KB 1TQCC 1BF8A 2PTUA 1JNHB 1ZS8A 4JFFA 4KI5C 5B8CC 2LVCA 4M1CC 4EXKA 1MUJB 1YEHH 2GJ6B 2IWGA 5GRUL 4ZG1A 4K3JL 4XX1G 1PVHA 2VAAA 4I4WB 2VDMH 2DM4A 4FP8H 1T83A 4NO2A 4A2MA 1T22B 4L4TD 5HDBE 3I6KB 3LKPA 2EXWD 3EYQD 1K9TA 4NQED 4KY1L 2VQ1A 3MRNA 2OK0L 1R3KB 4RAUA 4ZSOA 4L8BB 1CGYA 1EEQA 4J2XA 4PJHA 5LAXB 1EEZA 2OX5A 3VWJA 5C0AB 1NAKL 4DCQB 1JZ4A 5D71L 3X12B 3BH8B 3BD4A 2UWEF 1IEHA 4JKPH 2X4RB 3ZHDA 3IJHB 3BEWA 3V6FB 5B38G 3SDAC 3QEHB 5D5MB 1KN4H 4QOKA 3TM6A 3GMLA 2NY1D 4UILL 1AGFB 1FH5L 2CLRB 1MCOL 4QHLA 3MRFA 4G9FE 3D25A 1J8KA 3H3KA 3RWIA 3ZTJH 4G6AC 4NGHL 1SVZA 3IXAB 4N0YL 2NY5H 5EORH 3L7EA 5D96C 1DJSA 1DN2A 3HI6H 3RDTD 1CFTB 2N56A 5C0FA 3BAEH 4TQEH 4ZOAA 5E8EA 3PF2A 4UIMA 2VR4A 4KI5E 2XTJC 4X5LA 5JOFA 5I18L 4FTVB 1E27A 1R3JB 1H15A 1T0NA 3MGAA 3QA3B 5HPMA 5FUOL 5H35B 4ESKA 3EYOB 3KDMA 3BGFB 4MD0A 4CKVX 5ANMA 1FYTD 4LDOB 4P5TB 1VACB 5CMAB 1YECH 3LHPL 4HQQL 3UROR 1V7ML 3D85B 4Y4KC 4L3EB 4EUPB 2F5BL 2WM0A 1RZ7L 4H88H 2Z9TA 3VXRE 4AMKL 4RGND 1XGYL 5KSUB 4PRPA 1LDPL 4FNLH 5HGAA 3T08A 5MEQA 3STBA 2Q20A 1MY5A 2NY0B 1MHEA 2ADFL 4PG2C 1LNUB 3MV8D 3VMNA 3IDMA 4JDTL 3NCYP 2Q6WB 3WIFA 3QUXC 1QRNB 2EE3A 2P8PA 1FN4B 3GM8A 2ORBL 2XI9A 5GSRB 2YRZA 2WK2A 3TA3A 1XGRB 4OCYH 3WXWH 1PZ5B 1PEZA 2P1YA 2V5SA 3EUUA 2HJFA 5DFWH 4XNZB 3HNVH 1KN2H 4PJAA 1XT5A 1WFUA 2YUXA 1S9WA 3S3PA 1NGYA 4RDQG 3QUZA 2PYEE 2ZOLB 3WHE0 3FO2A 2FATH 3QCUH 2PUQT 4WW2C 2B5IC 3UJTL 2XFXA 3OKNA 5C07A 1OTUC 5EC1A 1KPUA 3P4NB 3TVMC 4AT6B 5IFJA 4DQOH 1JZ7A 5I73C 1AI1L 1H3GA 3WNMA 4ZFFA 2HVKB 1I8KB 1SJVA 5B22A 1YEHL 4U1HA 5KS9A 2JE8A 1TJHH 3JZ7A 4CVXB 2R2BB 4FP8L 5E08H 1OTTD 5TQ2H 5MEPB 5MENB 2Z4QA 4EDXA 3SDDD 4Q6YA 5BVJB 1OTSD 4OZIB 2W9DH 1QHOA 4LAQH 1ZA6B 1TMCB 3RJQB 3HE6B 2H2SC 2DTSA 2EDNA 5ITBL 5DC9B 4PJCB 3BWAA 1NANI 3DHJA 4L8SB 1KN4L 2DJ4A 3AMKA 2FLBT 4MDJA 3DURB 3X14B 1MJJB 5C0CA 3DO7B 3RWJB 2P8MA 3IXTA 1OF2A 1K6QH 5EIQA 4PJ9D 4FXKA 2YHGA 3MXVH 4NN6B 2FO4B 1OSZA 3H2WA 4OCMC 3DVGB 5EORL 1FGNH 3HI6L 1S7XA 4P9HH 3RTQC 1BQHB 4MJIA 3BQUD 1DBBL 3L6FA 5DD5H 5ITFA 3BAEL 3KYOA 4TQEL 2HVJB 5DVOA 3WE6A 2F53B 5C70A 5T1LA 3HZVA 4K3GA 4NO3A 4P57A 3KVQA 1H3VA 5ADPH 5CHNB 1KNOA 3P30H 1K4DA 2HG5B 4X6FA 5CEZE 1PEWA 4JFXA 2CO7B 5MERA 2X70B 4ZUSA 2EKSA 5CEZD 3GMPA 4XXDB 1J0HA 5E9DD 2H3NA 1DUYA 1E6JL 3V2AR 4HV8B 1OGTA 4M1GL 4H88L 4JY4A 2R1YA 5FUZL 4K71B 5IB3A 3OB0H 1CI5A 2Z8WC 4XWGH 3MV7A 4KROB 3U1SL 4WWKC 1TITA 4LFHD 3ZE1E 3T8XA 3D69A 3VH8B 4RGMB 2Z31C 3QIWD 4N5EC 4XVJH 4EEEA 1GZPA 4ERSH 2VSDA 4EI5C 2L0DA 2PO6A 4KQ4H 5FYKE 2QHLA 5CEXA 4OCYL 4FQQA 4GKZB 1GRWA 1JNNL 5DHVA 1S7TB 5BV7H 3B9EA 1VFOA 4Z5RB 1C7SA 1KN2L 5CBAB 1QTYT 3MUGA 4Y4HB 1NCUA 1KCVH 2KZWA 5CD3B 3ES6B 3SJVD 3MLTA 2FATL 4NWTH 5JDJA 3WS6A 5HI3D 3NA9H 4O2CA 3VFNB 1VEPA 2OTWB 4DQOL 1I4FB 3UAJC 4F8TA 2PW1A 4UU9B 2C1OB 1TJHL 3QFDA 2IF7A 1KELH 4UOW1 1KF9B 5C7XL 1B9ZA 4P2RB 4RMWA 5DMGC 4FFWD 1ZVSB 5ERWB 5TQ2L 5HGBB 5C09E 1ZHBB 4PRID 1HWHB 1N5YL 4UTBL 4LAQL 3O8XD 2G5BB 5TDOB 5DHYA 2ERJB 4OAWA 1FSKB 3REWA 1AO7E 2ZUQC 2BVPB 4S11A 5GSVA 2M1KA 3FAWA 2BDNH 2ZG3A 4LQFH 2BY1A 1ERNA 5IK3A 3W39B 2PTTB 5GRVK 2J2ZA 3LEXA 3I6GB 3O41B 3HLAB 4GXUN 3QEQA 4HC1A 1P84K 1LE5B 3ETBF 3FO1B 4XP9H 1RUPH 2C3GA 4B7LA 1KB9K 5HHNA 3AXLB 4R96B 1K6QL 1RZJC 3VXUD 4M5ZL 5DURD 2BK8A 3HNSL 4QWWD 5HHVL 5FEBA 3RUGA 4TSBL 4KGJA 3B6SB 3TJEH 5C9JA 2EDQA 1G6RH 3QXTA 4ZAKA 5CP7A 1KT2B 1TVDA 1Y0LB 2D0HA 4L5FH 3EHBD 4PJBA 1MLCB 4RGOH 4IRSA 3ZE0E 1TVBB 1WBZB 2FGWH 5A3IC 4LHJB 1N6UA 2CKBH 5DWUH 4S1QL 2VR5A 1KIRB 2BSTB 5BRZE 2E7BA 2FD6H 1VERA 1UXSB 3D5OF 1U8MB 3EIFA 4LGRB 2WBJD 2D03L 3RVWC 5CILL 1Z5LB 1OPGH 2OCFD 4QT5B 5JDSA 1TPXC 5DEGB 4LHUG 4XWGL 4MHHG 2V9RA 3QUMB 4APQD 3IETA 2XRAH 2NY3B 1JWSB 5ILTH 4AH2A 3S9DB 1MLBA 4XVJL 4PV8A 4KVNL 3SCMB 4HJGA 4ERSL 2LU7A 2C4XA 2EH8H 4TTDC 1BIHA 4F7MB 4H20L 4KFZC 3T3ME 4KQ4L 2NY6B 3ARBB 3UBXA 4BELD 2VABB 3SO3B 3UO1H 1ADQH 1U6AL 1A3RL 3HZYB 1OQXA 2DBJA 3V0AC 1FYTB 1MAMH 1WGOA 4ODUB 3I84A 4O58H 2HAZA 3T4AB 5DGQA 1SHMA 4Q6IC 4V1DE 5JHLH 5F9WC 1XIWB 4OQTH 1FV1B 4DEPB 3MCG1 5E00B 4PJXA 4NWUH 3ZTJG 3LEVH 3QQ3B 4HJJH 5H37H 1A7BA 2Y06H 4DN3H 2R8SH 3WNKA 2UYLB 5TQ0H 2MCPH 1H3PH 1QBMH 35C8H 1E4KA 2FIKB 2FJGA 5HGHA 3MRQB 1KELL 1F3RB 4RISL 4JM2F 3OKYA 3RKDC 4JQVA 3PHSA 4KDVA 5T5NF 1YN6A 2DTMH 2NY2D 5KN5A 2VZ3A 3L3KA 5INDB 2QJDA 3HPJB 3RIAF 4GW4B 1HILB 1IGMH 3BPCB 1QACA 1KB5A 3BN9C 3EO0A 5CEYA 1FO0L 2ZUUA 2BDNL 5J12C 4LQFL 2AEPL 2VERN 3ZZ1A 3U4AA 1RZ8B 3PNWA 2ZNWA 3SY0A 1SMAA 4XP9L 1CFQA 1ZSDA 3EYSH 1NC4D 4X4YB 1U8QB 4YHMH 2I5YH 4YDVA 1UKTA 3R06A 2AQ2A 4NQDD 3N1QC 3TJEL 4JPIB 3FKUS 3RDTC 1C5BH 3TN0D 1RZJL 4PJGB 3GJFH 1F02I 1G6RL 5CCKH 2VZ1A 2IG2H 5IR1B 2BNQA 4UAOC 4MNQB 2HT4C 4LASH 3TBYA 3TCXA 5ACLA 2XZAL 5IJKA 1FZOA 2FX8H 4JO2H 1RZFH 4L4TE 5AD0B 1XF5B 4Z9KB 2XWTA 5EG6C 4NQXB 5DWUL 2YRLA 4UUJB 2YMXH 1I1FB 5E5MA 5DUBB 5M95B 3PWPD 3MRBA 4NQEE 2JTDA 3QG6A 2FD6L 4G5ZH 1IZKA 2BNUA 3SE4A 3EGSA 4WJ5A 3DSFH 4XP5H 4I18C 1OPGL 5BCAA 3A6CH 3LS5H 4BQ6A 5H2BA 4CGTA 2W60B 5ECJE 4C56B 5JOPD 1QYGH 3H6JA 9CGTA 2XRAL 5I8KH 1UM5L 5ILTL 3MOAH 2FJHA 1NBYA 6CGTA 4NIKB 3RVVC 4HG4K 3IYLW 5I1DB 2EH8L 5DYOB 4N0UA 1F97A 3HUJB 3WN5C 1JYVA 1CD0A 2DLFH 3AY4C 4N1HB 5EOQH 4JHBA 4ZPTB 1DVFA 3HTLX 1ADQL 2D9QB 3D3VA 1AHWA 1X9QA 5EU5A 1QLEH 3RZWA 1MAML 2BNRA 4OT1H 3NGBB 4I2XE 4KI1A 4O58L 3ZKMD 4KKCD 1IGIH 2ITDA 1UZ8B 5JHLL 1BZQK 4OQTL 3O3AB 3H9SD 3CUPB 4I9WD 2FIRT 2OQJA 4NWUL 5ALBL 3RRQA 3KS0H 4JDZA 4OJFH 4YXLH 3LEVL 4DN3L 2R8SL 2XY1A 3OKEB 3JBG7 4WUKH 4I3RH 4C83B 4YHLH 5T1DH 2MCPL 1H3PL 1QBML 35C8L 4HWEH 4HS3B 2I9TB 1U8KA 4U6TA 5E5RB 2DL2A 1CICC 5CZVL 3DX7B 4Y16D 4RGNE 2DTML 3H7BA 4JLRB 1QFHA 2NW2A 3WFZA 4NRXA 5TGBB 5F9JB 5B38B 3MV8E 1EGJH 1IGML 3DROA 4Z76A 3IJYB 4R0LA 1SY6A 3W9DA 4ZOBA 4J3VA 5EZJB 1N3NA 4YK4C 1S7RA 4QRTB 3TO2B 5C71A 3GSXA 3SJVB 5DLMH 1BZ9A 1Z0NA 2DQFB 2Y5EA 3BGAA 3KLAA 4QRUB 5D2LE 3QDJA 3RNKB 4MLIA 3VE0B 1W0YT 2XG5A 2X05A 4WTZA 2IAMA 5EO1B 2XOTA 1AXSB 1F2QA 1C5CH 4YHML 2I5YL 1ZGLB 3U7WL 4XPAH 2NY4C 2BOBB 5EDXA 1C5BL 3BQUC 3LD8B 3JWDC 4XH2B 5HHOA 4NN5C 5CCKL 4HIIA 1CE1L 2EZ0C 2OSLA 2B1AH 2A9NH 2IG2L 2EDOA 5KSBA 3IDIA 3G08B 4E0RA 3NCCB 2VZTA 1MWAH 5GGQL 4LASL 3EYUH 2H41A 2X4PA 3DV6A 2P7TA 2FX8L 4H26A 4HUKB 1RZFL 5HYSG 1ZWIB 2C7UA 3O6FB 5K9OB 4N9GB 1BP3B 3O3EA 5GRYA 2YMXL 3MJGX 1CG9A 3TZVB 3LSOA 3AVEA 4PRDA 4PS4H 1IL1A 3ARFA 3FOLA 3MNZB 1OM3H 4NBXB 1B0GB 3IDGB 1Q1JL 2XN9D 3DSFL 1J9CT 4XP5L 3MFFB 1T21A 1T7ZA 3LS5L 4QRQB 1T7XA 3MBEA 3NA4A 4ONHA 3STZA 1DL7H 5D6DA 3TESA 1QLFA 2GT9A 5HD8D 5MHSD 3LKOA 1ODAA 3MLUL 3MOAL 3NZ8B 1NC2A 4E41A 1OD7A 1G7PA 2XA8H 4MYWB 2J8UE 3OPZH 3VFPA 2DLFL 4JPKH 4RNRB 4FQCH 4KK5C 3SDXF 5EOQL 4WRLA 4KGLA 4KRPD 1QFUH 2NTSP 1X3DA 4AJ0A 4LOUD 3MX0A 2WLYA 1MIMH 1QLEL 1R24A 1BFOA 3GRWA 3UTQA 4HUXB 3P4MB 5I1HH 2GQHA 5DFTA 4OT1L 3D0VA 1BPVA 5DS8B 2APFA 3BRGC 1T5XA 1J0KA 1H3XA 3V79C 1FZKA 4F9LA 3QNZB 2GK2A 1HQRB 4UT7H 2Z8VC 5D4QA 3OXSB 1MSPA 2XWBA 3UX9B 3ECBB 3QHFL 5DK2A 3K1DA 3ARED 4OJFL 5DEFA 3F6IA 4WUKL 2R23A 1QKZH 3KPMA 4I3RL 2VISB 1JGUH 4L9LC 4MQSB 4AENA 1NCNA 5T1DL 5M94B 5DRXB 3G5VA 5E9DE 3K4DA 3W0WB 1FL5B 1EPFA 3MJ8A 5JZ7D 5E70A 3RFZC 4JR9L 4JGMA 5GZND 3V4PH 1P9MA 1HH6A 1BEYH 1OAQH 5EZLB 4N5UA 1A02N 2FB4H 3H3PH 2HN7B 1NKRA 2Y4SA 4GRLB 4WV1B 5D7JA 1P7QB 2YD5A 5DSCA 4BSJA 5HY9B 2Z35B 5E6ID 4LU5H 2K1MA 2JJWA 5SWSB 4UZGA 3H7LA 3C6LB 1NGPH 2CR6A 3C60D 5DLML 5A2KH 1AGCB 1I3RA 5E8OA 1T2JA 1UWXH 3M45A 1SJXA 5I9QB 4PR5A 1A2YA 2K7PA 1I8LC 3QRGL 4HAGA 3WS3B 4HCRA 4GG6A 3QQ4B 3MYJA 4FQ2H 2VO5A 4RIRA 2JCCE 4XRCB 3BT2L 3VFMB 4PRAB 3PWLA 1UC6A 3VXNA 4LCYA 2A9NL 1NBQA 1Z9SA 3FAXA 4XVTH 1MWAL 4YZFE 4KKBD 4BA8A 5DJ8B 3JWDL 4LVOC 2DMBA 1KJMA 3EYUL 4RRPG 4XBEH 5DD3L 5FAAA 4F7EB 2EDRA 3GIZH 4RSVA 1LK3H 3U83A 1XF4A 1KCRH 2AAVA 4HDIA 4PRIE 3GIVA 1DQQA 5TJWK 2BHZA 4PGEB 5LWYH 2VKXA 5JW4N 4PS4L 4U1KB 2WBJC 1QD0A 4ZNEE 3ARYA 3EDJA 3UBXI 1AGEB 3HRZA 4DVRH 2Z8RA 3TNNB 5BO1H 4NQCD 3X3GL 4G6MH 4EI6B 1FVCA 3MQIA 4LKXB 2ZOKA 2C3VA 5EBWA 1J0YA 1BGXL 3JVGC 3O4LB 3DX9B 5F7LB 43C9A 1AGBB 2VXSH 3UPRA 1EHNA 3KPPA 5LGKA 1W2KT 3UTSD 2JJTA 3VXUE 4JPKL 4Y1AD 5DQ9B 4FQCL 4G9FA 4Y4FC 1B6UA 1D5BA 4Z7UA 4FZEL 1I9JH 5EO0A 2VZVA 3MUHL 4LSUH 3PWNB 3BI9X 5EN2B 1MIML 3VWKD 4F2MB 4PLKD 4HLZG 1VB9A 2AVGA 1MCRA 4U7MA 1P4IH 3GFUA 2ZSVB 3VRJB 4OGYH 4M8QB 2F54D 3WFHB 1WIUA 2ZUXA 4PJHF 4UT7L 1G7HA 1AR1C 4OI8A 3L5XH 4BH8A 1WZ1H 1S78D 5CWSA 3Q3GA 5JXAH 1YQ2A 2KQMA 2BSSB 4DK3A 3CFCH 3EOAB 4U1SA 4JY6A 3JTSB 1U8JB 4PB0H 2OL3H 1MVUA 4ELMF 1U8OA 2VYRE 4ZS6C 3WNOA 1DLHA 4PJEE 4YDLB 2HFGH 2OZ4A 3WNPA 2F8XC 6FABL 5CD5C 2X1PA 3VXRA 3L3JA 3PWUB 4YIQA 3OHXB 1WV7T 2BFVH 5IFHH 4F58H 3DLQR 1OP3K 1XGQB 1BEYL 3VFWA 5A16B 3H3PL 2F74B 5DVKA 1JGEA 2CDGB 4LU5L 1P1ZA 3MRLB 3CPLB 3VFRA 2YA1A 3GBML 3PV6B 4GRWB 1NGPL 4KHTL 1YNKH 4X6EB 5J6GA 2Z91B 1QPPA 1C5DB 4U6YB 2DKUA 5BMFL 3RZCD 4WNQB 4DGYH 5T1MA 2AQ1A 3KS0J 3EJZD 5SWZD 2E7LC 1FP5A 1BQUA 4GRMA 4U1JA 3OAUL 3B2UD 1SYSB 4FQ2L 1G7QB 4Z0XB 2DI7A 2YSSA 3QPXH 4HKXA 1EA9C 2ICWI 4H1LA 2JJVA 4KPHH 2NXYB 4Y19D 3E6FB 4XBEL 5IWLA 1R5IB 3GIZL 1LK3L 2DLEA 4NZJA 4RX4D 2IADB 2XKNB 1Z2KA 5I0DA 2EEBA 3VCLB 4H25A 4BQ9A 4LHUB 1JNHA 1TQCB 3RP1A 5IVZB 2OS7A 3HN3A 5TE4L 5B8CB 2BVOB 2GJ6A 1WZLA 3D87B 1U8HB 1YQVL 4YUEH 3P2TA 4DVRL 4G6ML 1VESA 2CDFA 4XHJC 1J0JA 1T22A 2MWCA 5FO9B 3TBTA 2YXFA 2VXSL 5CJQH 1R3KA 1KEMH 4L8BA 5TPWH 3PP3K 4OF5A 5LAXA 5KS9F 2DIJA 1SJHA 2WWKT 5DEZA 1Q9LA 5C0AA 4DCQA 4P46C 4YDJB 1RY7B 4NQDE 5IB5B 4OFKA 1U8IB 2Y6SD 3IJHA 4OZFA 4LSUL 2LTQB 4AEEA 1PX4A 1L6XA 4TN9A 4AQOA 4Z7NF 4Z7WB 4OGYL 3CH1B 2IPUG 1NFIA 1ZT7B 2AXFB 4LEOA 2CLRA 2X5PA 3L5JA 3EDDA 1OP9A 3L5XL 4JM2D 1WZ1L 3WUZA 3O4OC 5IB1A 4BZ1H 4KMTL 5J9PB 5JXAL 3QNXB 3CSBA 1R6VA 4P3WA 4D8PB 4DVBA 3NN8B 3CFCL 3SKNB 3GSUA 3S98A 5I1IH 5EU7C 5L0QC 3FT3A 1HN1A 2NTFB 4PB0L 1GGIH 2OL3L 3PWPE 5CSZB 4YPGB 1RUAH 4YQXL 4Y16C 5T5FH 1R3JA 2XTJB 1DQTA 1HXMA 1JWMA 2R29L 1OW0A 3P4LA 5F8RC 3BZFB 5IFHL 4F58L 5JOPE 5EZIH 2F15A 3FQRA 4JAMB 3E2HC 3MSPA 2UZXB 3RWDB 1M71B 2R1XA 4GO6B 4IMLB 4L3EA 4EUPA 1AIFB 4RFNB 5JNYB 1A22B 1FCCA 2Q76A 4MAYC 4Y4KB 5E2WL 4FQ1L 5KSUA 3Q5YA 4PJ5D 1U92B 3V6OA 1A6WL 3EFDH 4ZXBC 3SOBH 3SDCB 2WINB 4GBXD 5IB2A 2ZSWB 3QUXB 1NEUA 1XR9A 4YH6A 3H9SE 4X7TB 2WWMD 4I9WE 4G80B 4YHIB 1FNSL 1XGRA 3BKYH 3C09C 4M93C 1EH9A 1LEIB 1E4JA 1YMMB 4PFEA 4KPHL 3RWFA 2ZJSL 3SKJL 1EFXD 1YPZF 3VXQA 3TPUB 1ZAGA 1MHPL 2YD3A 5EH1A 3UJJH 3JV4B 1MHHB 1I1RA 3QRFM 4LCCA 3VU2A 1JN6B 2UWEE 2YD4A 4XWOC 3QWRA 4WW2B 1I7TB 5C09A 5KJRH 2B5IB 4PRNA 2EXYC 3JTTA 3WFBL 4WFHD 2DDQH 1A3LH 4G8FA 5DD6B 1LK2A 1AO7A 4YUEL 4ISVB 4CVXA 4F37K 2R2BA 4A6YL 2QQLL 4LMQE 5MEPA 1KULA 5MENA 2VQUA 3BXNB 4BZ2H 1JNLH 1A4JA 4U6HB 4OZIA 5CJQL 1ZA6A 1FRGH 1KEML 5TPWL 3I50L 3HE6A 3UTOA 3GMMB 3N0PB 5J3HC 1RSFA 4PJCA 4P48A 2DYPB 3I02A 5C0EB 4QRSA 1V3KA 4Y88A 5DD1H 4OF8A 3SO5A 4Q7DA 1L0XA 3FQWB 4L8SA 4UDUB 3V4VL 4WI3A 2AK4D 1VCAA 3DURA 5JO5B 3BISA 3X14A 1MJJA 3DO7A 1KCLA 4HIXH 4QY8A 3CFKA 1BQSA 3MRRB 4HWBA 4P4KA 5DTFB 2HJLA 1QR1A 4IS6B 1FDLH 5C0ND 4XPHH 3DVGA 3L3GB 4EQ2A 1E0OB 3U36B 5ISZB 5I1IL 1ZT4B 3ULUF 1N4XH 3AS0A 1BREA 2VTFA 1GGIL 2J6EH 3P0YL 1X5YA 1QEWB 2HJKA 2F53A 3PGDA 3PQYB 5JW3L 1RUAL 2EE2A 5BRZA 3K81A 5T5FL 5CHNA 2XN9E 2HG5A 4NKMA 5EIVA 5D7LD 2CUIA 3RVXC 2E6JA 5HI4C 3O9WB 1QA9B 4W70A 2X70A 3C8KB 1XGTA 5EZIL 4WHYG 4XXDA 5MHSE 5DZLA 3R0NA 1VA9A 5FO8A 2CXGA 5CLWA 1TNMA 3ZT6A 2APXA 4HV8A 1G0XA 4X6DB 4DZ8A 2X1WL 5KVFH 1UJ3C 3VXPB 1QSFD 3C60C 3U2SB 3NAAL 1AQKH 1ZHNB 3BRDA 2CLVB 4OB5L 3EOTH 1UWEL 4P2OD 4LBEA 5F3HB 3SGDI 1A47A 2EC9T 2DWEA 4IRJD 3VH8A 3CFJA 4UNVA 5F7NC 1MCFA 2IFFH 4J4PD 1IQDB 5EBMA 5HDQH 1Y6KR 4EI5B 3LPGA 1A9BA 3BKYL 5CKGA 2FH8A 4GKZA 2NR6C 4FHBD 4HKJB 2J5LC 1AD0B 1HSBB 4UBDD 1S7TA 4PGCA 4U1IB 5D9SB 1J7VR 2AJXH 4WY7L 1NGXA 1HYSC 5CBAA 1JMZA 4Z5RA 1PBYA 2YN5A 1YEIH 4Y4HA 3UJJL 5BXFB 5J1SC 4LIQH 3RGHA 3OMZA 3MUZ1 3QAZB 4HBQA 5I1LA 4E9LA 5KJRL 4D9LH 5CUSL 4AM0B 1AKJD 2XZCH 1EAJA 2OTWA 5C92A 3QIBC 1I4FA 1D5ZA 1FIEA 1A3LL 2C1OA 1CK0H 3QXUA 1PG7W 3U79A 2V7NA 1V7NH 3QI9A 5IEKB 1Q9OB 2C4FU 1MF2H 3VXTB 5ERWA 5DJAB 5LXGH 1ZHBA 4BZ2L 4F33B 4WCYH 2FWOA 4MD5B 5IW1B 4LCWD 2F9BT 2VXQH 4POUB 2G5BA 3INUH 5TDOA 3TO4D 2JIXD 1KIPB 3VXSD 1U58A 2BVPA 2ZUQB 5DD1L 5EUKA 3W39A 1RZGB 3RPIB 3I6GA 3HLAA 5HHPB 3UZVB 1A14H 3FO1A 1JV5A 2K7QA 4HIXL 1CL7H 1HXYB 4P59H 3V0WH 3AXLA 4R96A 3RPKA 1A9EB 2A6JB 2W38A 2CK0H 3GNMH 3UYOD 2P47B 4JM4H 3M1BB 2D9CA 3HAEH 4YFEA 1NAML 2O5XL 5H94A 1FDLL 2AXJA 5BZDB 1G6RB 3IU3B 4XPHL 1T1WB 4TOYH 4KJPC 1LQSR 3VW3H 1N4XL 4L4TA 1PW3A 4Z8FH 3K74B 2J6EL 3FRPG 2A74B 4NZDA 3DWTA 3MCLH 4NPYA 1Y0LA 3MRGB 1A7PH 3MJ7A 4JZJC 5I8OH 2CKBB 4PRHB 4WWID 4NQCE 4P23D 4QKXB 5I19H 4OV6F 2DLGA 5L6YH 3CVHA 1BIIB 2DQCL 5FYLH 5LCVH 4JVUA 5KVFL 1OAKH 3UTSE 1UXSA 1VADB 1U8MA 5IBUG 1AQKL 4Y1AE 3DMMC 4FQXD 4WFFD 3TLRA 3TT3H 3IDNA 3CGTA 2RAMA 3EOTL 1NCAL 3O6LH 4ZDHB 1TPXB 3RZCC 5DZOA 4DGVL 2FZ3B 4OGXH 4NUGH 2A6KA 1JWSA 1P2CA 3DX8B 1X5JA 2IFFL 5FK9A 3B2UC 3IFOB 2F54E 1Q0XL 5HI5D 1D5IH 2VLJD 4O5LH 1F4YH 4F7MA 5HDQL 4ELKB 3QJHA 4R4NC 3ARBA 4EBQH 4HUWA 2H1PH 3CAFA 1FNAA 4ODXB 5J11C 3EDFA 1ACZA 1FYTA 3OGCB 2DQIL 4ODUA 3BW9B 5D1QC 5C0BD 2KH2B 3R1GH 3RJDA 3PXHA 4LIQL 3TIDB 1LEGA 5J1AA 3SKMA 4G42A 4Q6IB 4PBWD 1MCPL 4XP4H 5E00A 1VKXB 3GDBA 5KSVB 1NKOA 3B3IA 4HH9B 4C54A 1OSPH 4UINL 4V2BA 4D9LL 2J3SA 3ULVC 3QQ3A 1UJTA 1WJ3A 5E95B 5F1IA 2UYLA 4AEIH 3PWVB 1CFNB 3D0LB 3MV8A 5CINL 1CK0L 1WC7B 3EO1B 4QRRB 5L9DH 4MXQD 3ULVH 1GC1C 3VGEA 2ESVD 1MF2L 4X99B 3HB3D 2DBLH 2A0LD 4WO4B 4MCYA 3HMWH 4FFZH 4WCYL 4LPUA 3I85A 5INDA 4GOSA 1GC1H 4NJAH 5A1AA 2VXQL 3INUL 3P0VH 3HPJA 1Z9OA 3SGEH 1QFWI 5C0RH 4Y5XC 3ZLQC 1F4HA 5SWZE 2WWKO 2UZYB 2BP3A 1ZA3B 2VDOL 2HKFH 3EBAA 4W6XB 5CKAA 5DJXB 1AD9A 2LVEA 5HYEA 3KHOA 3VFOB 4HZLB 3GK8L 4M7KL 1RZ8A 1U95B 4ENEC 5JR1H 1XAUA 4QOKD 5HHMD 1A14L 5CZXD 3MLXH 1MQKL 3U0PB 4P59L 4G6KL 1CL7L 3V0WL 1BD2D 4Y19E 2HFTA 1U8QA 4L8CB 3GNML 4JM4L 1QBLL 3HMXH 2IMMA 3GJFB 3VFTA 4RAVA 4QYOB 3ROOB 4JPIA 4TOYL 4Y7MA 1NMBL 4FRWA 1TNNA 4GQ9L 3VW3L 4N1CA 3UDWA 4Z8FL 3LS4L 4PJFF 4X4XA 1P84J 2NXZD 3SDDA 1K8IA 3MA7B 5IR1A 4IOSD 1KB9J 4XC1H 1X5KA 1XGPB 4TNVF 1A7PL 4XBPB 5I8OL 4JHWH 5EU3B 2ZUTA 4YNYB 2YC1B 3EJYC 5AD0A 4XCNB 3CFBA 4NQXA 5L6YL 4HKBB 1I1FA 4U0RC 5DUBA 4XPTL 3DSNA 3PHQB 3RNQA 1JIBA 1V3MA 5ESAA 2J8UA 4PJ9A 2JLLA 3I9GH 3KNBA 3T65B 4PGBB 3EKCA 4I18B 4PRPD 1YEGL 3RBSA 1U3HD 3FCTB 3GO1H 5I8CA 4OGXL 4UT6L 5JMRA 1I9EA 3WNNA 3GMOB 4KRMB 5I1DA 3P73B 4OD3H 2HTLC 1D5IL 3G6DH 2WWMC 4O5LL 1F4YL 5FYJU 2PCPB 5T3ZD 4HK3J 3WN5B 5AAWA 4ZPTA 3TA3D 3OF6D 5DDHB 1Z0MA 1XMWA 4XNMB 1FE8H 2VLKD 5A2LH 1QPXA 2XICA 2MQCA 1IAII 1X6LA 4PTUB 4M3KB 5TE7H 3MA9H 3ARZA 3MV9D 3R1GL 2IALB 1MFCH 4U4BA 1A0QH 1MI5B 3HG1E 1RZKC 1UCTA 3SBWA 1JYNA 1I1AC 5C07D 1OSPL 2HRLA 4LPCA 4X83A 1MHCB 4KKLD 2DB8A 4I1NB 3OKEA 3O6MH 4AEIL 3KPOA 4C83A 1U3ZA 4FS0A 3KPSE 2IAND 1RZKH 3VGGA 3T1FB 1G1YA 1HHKB 3MRHB 4WHTA 2ADGA 3QIWA 4HS3A 2I9TA 1F11B 1MH5A 4KKAD 4X5WA 5ICZA 5L9DL 3B5GA 3ULVL 4XMPH 5K59F 5EIIB 5EB9A 2DBLL 2VSCA 4UT9H 1Q9KB 3DOSA 1CICB 1QFOA 3GSVB 3HMWL 4FFZL 1FYHB 4PJ5E 3IGAA 3AC0A 2IPTH 4NJAL 1GC1L 2VXVL 3OX8B 5CJ8A 5B38A 4NFCA 1J0ZA 5F9OH 5C0RL 1IC7H 3IJYA 4M6NH 2Q3ZA 8FABB 4NM4L 1X4ZA 4QRTA 3TO2A 4FG6C 4CDHA 1WZKA 4HBCH 4YK4B 3SJVA 4R97C 4QEGA 4EQ3A 4QRUA 2X4UB 1J5OH 5JR1L 3KPRB 2A2QT 4F7TB 3VE0A 1J05A 2BMKA 3MLXL 4LDEB 5IESH 1JGLL 2C3HA 4Z77B 5EO1A 5GRJL 1L4IA 5GGUB 4KUZH 3HMXL 1RJCA 3G04A 5KW9L 2O61A 3IS1X 1ETZB 2BOBA 1KTDB 3FQTA 3IF1B 3SKOA 3RKPA 1DEEA 3OKLA 3L3OB 2NY4B 1NGQH 1MWAB 4MJID 1FZJB 3GHBH 2FECI 4X7DC 2BRRH 2DKSA 3ARPA 3KG5A 4NN5B 4WFHE 3G08A 3O8XA 1NANH 1BVKA 4XC1L 1RMFH 4WENB 1KG0B 1OD9A 4JHWL 3HE7D 3UJIL 3BP7A 2X41A 4RMTA 4ZNEA 4GG6F 1CD8A 3MGTA 1U93B 3FQUB 3F62A 4GS7C 3TZVA 3O11B 4FA8A 5ID1B 3CX2A 3MNZA 3C5ZB 4Y8AA 4YXKH 1YEKH 2CIIB 5JHDD 1B0GA 3IDGA 2XG4A 2SEBA 4OFYA 5GS1C 3MFFA 1JHLL 1OCWH 3I9GL 4CJ1A 3QCVH 2X10A 3GO1L 5E8PA 1PG7X 5K9QI 3GSOB 2AK4E 2ZKHH 1CQYA 1I9RH 2EDKA 4JRYB 4MQXC 4OCLC 5EUOB 4NC1C 3G6DL 4JFED 3QCTH 2VE6B 4PJ8B 4HFWB 1R3IH 2PO6D 3DJ9A 3C8HA 1QOKA 3MNVB 5AZ2H 1J86A 3OJDB 1DN0A 4F7PB 1FE8L 4MNGB 4UBDC 3KPQB 3Q5TA 3KPNB 1KOAA 3P4MA 5DS8A 5GS2D 5TE7L 1JI2A 2PW2B 3MA9L 4HG4J 1MFCL 1W72A 2EYSB 4TNWF 1IC5H 1H0DB 4BZYA 4HLJA 1A0QL 3KWWB 3DUSB 3O2DH 2H32A 5D7LE 5A2FA 4PY8J 4Z7UF 1MCJA 3ECBA 5E0QA 3KYAA 3HAEG 1JRHI 5HDOA 3O6ML 4APQA 2P5EB 4DKEH 1RZKL 3L5IA 3E8UH 4NRYB 3EZ8A 1I3GH 5FA3B 1QSFE 1VFBB 4ZODA 4UT9L 1N5AB 3LPFA 1EDQA 2BVEA 1PG7H 1RV6X 4KK6C 3R8QA 3TO4C 3QNYB 5EZLA 4NQSA 4GRLA 4WV1A 1P7QA 1W0VB 4OZHB 5F9OL 3HNTL 3N1GC 2Z35A 5HY9A 3LN5B 1B3JA 1MFDH 1CDGA 2OJEA 2X2YA 4I3SL 4M6NL 3UTTB 3B83A 3O6KH 3BP4A 5CJXA 2VB5A 1JF1B 5F88B 2FLRT 1YMHB 1JPFA 2Y7QB 1AGCA 1WQVT 4HUUB 4GAGH 1J5OL 4QHNB 1RJZB 3D2UB 4I0PD 3ULUD 1KYOJ 4PJIF 1PKQB 2W1NA 1DBKL 4OF0A 1VFMA 3X11B 1YEDA 2MPAL 1GZQB 2ZG1A 4KUZL 4PREA 5DO2D 4DUXA 1K8DB 3WS3A 1IMHC 4BSVB 4PIRF 2Z8SA 4IDLA 5SX4H 3RWCA 4X4ME 4NZTH 5C0GA 4PRAA 3AAZA 4K7PL 5DUML 4ZAKD 3GZKA 3BIBX 1RMFL 4IIQC 5DJ8A 3I75B 4IRSD 1I1YA 3EYFB 4LVOB 4Z0BH 3SDXE 1RUMH 1IGYB 4S1RH 3ARRA 4TUJB 1FPTH 1HDMB 4PGEA 4K55A 5LKNA 5TF1H 1KTKE 4FFVC 2P4AB 1I8MB 3W9EB 4HZAA 1A4KB 4LCWE 4U1KA 4LARL 3AGVA 1ZKAA 4YXKL 1YEKL 3VXSE 1NC4A 1T5WB 3FT2B 3EYVA 1AGEA 1OCWL 2DQUL 2OR9L 4XCEB 5F71A 3TNNA 3QDMD 1G0DA 2DD8H 3CIQA 4EI6A 4NQDA 1R5VB 1WISA 4R7NB 1F3DH 3KJ4C 5CGMA 4X6CB 5CBEB 2ZKHL 3O4LA 4OV5A 1LWRA 3DX9A 1AE6H 4X7EC 1U2CA 2O5ZH 5HI5C 4MSWA 2QQNH 1U8NA 2IH1B 3DRQB 4XMLH 1DQDL 3PDOA 3PDGA 5AZ2L 3MLVH 3WDIA 1J11A 1YNLL 4Y4FB 5C6PB 3PWNA 1UCBH 5EN2A 3ZKQD 4F2MA 3HR5A 5L88L 3MYZA 4WU7A 5FYJD 1K85A 3ABZA 3RX8A 1ZLSH 2ZSVA 3VRJA 1NGWB 3Q1SL 5CSBA 4M8QA 5EOCH 1BFTA 3L3HA 5L2KB 4L4VB 3O2DL 3S96A 4JCMA 4QXTA 3B8YA 2OL3B 2BSSA 3X13A 1OOAA 4FZ8H 4G6JL 1U3HB 3EOAA 3GMQB 5D5MF 1CGWA 2EDTA 3TYFA 3JTSA 1U8JA 1C8PA 2Z92B 5F7WC 3E8UL 3MOQA 1ZANH 2IBZX 1I3GL 1T83C 4OFPA 4YBLC 3RWGA 2A0LC 2B0SH 1J8HB 4WFFE 2CGRL 3PWUA 2VIRB 2CIKB 4XNXH 1FFNB 1S9VB 1XGQA 3BEVA 1CLZH 4ZPVA 3RI5F 4NO0D 2CDGA 3VWJC 5EWIH 3MRLA 1ZMYA 2VLJE 1WT5C 3OKMB 1KBGH 4OI9A 3MRPB 5BZWB 3WXVH 4X6EA 4TUOB 1QUNA 1INEL 5CZXC 5T33H 1C5DA 3Q6FB 4EKXA 3B9VA 3Q6GH 4WU5A 3RGVB 3CSGA 4JPVL 4AEHH 1KLUB 2VUYA 4O02H 4YX2H 5C0BE 3T4YA 1CLCA 4XNUL 4HIJB 5ICXA 1DANU 1AC6A 1WITA 1R3LB 5D1XD 3FB8B 4N8CH 1CS6A 1G7QA 2E9JA 4OZ4B 1J10A 1EO7A 1E6OL 4NZTL 1JGDB 4PJDB 3WUWG 4JPWH 3TCLB 2NXZC 1DE4B 2I07B 2YR3A 4XCYB 3HR6A 2WLZA 2AV7B 3MXWL 3E6FA 1B4JH 4XVUC 2AXGA 5FHBH 1AXIB 1QQDA 3S5LB 1R5IA 3RVTC 4Z0BL 2IADA 1RUML 2ESVE 2XKNA 2ATPB 1QVOA 2BOCA 4S1RL 1U91B 4HHAB 1FPTL 3EAKA 1RUQH 2R2HB 1FL3A 2VLRB 3DV4A 3FMGH 3BRFA 5IVZA 5K9KB 2XKUA 1FIGH 3QULB 4NZRH 5HDLA 5B8CA 2BVOA 4PJHE 1U8HA 4K3DH 3I2CH 4Y89A 2DD8L 3H0TB 4HMDA 3NFSH 5FO9A 1LVEA 4QOKE 5HHME 1YNTB 2WANA 3HC3H 3CU1A 3TT1L 2O5ZL 1R5WB 1BD2E 4ELME 4YHNA 1LO3H 3TA3C 2BY0A 2GITB 4YDJA 1YUHA 4LLDA 4XMLL 1DVFD 3O45B 1CDBA 2EDBA 4P46B 1UCBL 2BNRD 1N59B 4Z7WA 4OZIF 1ZLSL 3QUZC 1EO8H 5EOCL 1ZT7A 4LLMB 5DJZA 2JJUA 4PJCF 1RK0B 1FJ1B 2XN9A 5GS0D 3LB6C 5J9PA 1WTGT 4NC0B 3O4OB 5HBBA 1AP2A 5ANME 4GXUM 3E3QC 5CSZA 3F8UB 4M9PA 1OAZH 4LQ1A 1F4WH 4O51B 3QR2A 4JQXA 2B0SL 3MPCA 5EU4B 4CW1A 3BKMH 3BO8B 1MCLA 1PYWB 4PRPE 3BZFA 2NZ9C 2V5MA 4XNXL 1CLZL 2P5WD 2NCMA 4NNYB 4JAMA 4OQ1A 4TVPH 5C0DB 2QBWA 3RWDA 3F7VB 1M71A 5EWIL 3E2HB 4IMLA 4DJMA 1AIFA 1CT8A 3VI4F 1T1XB 4Y4KA 1KBGL 5T3ZE 5KANI 5ACZB 1HOCB 1RIHH 3N85L 4MAYB 1K4CA 4KZEL 3QXVA 4OI7A 5FIEA 1MJ7H 1ZVHA 3F7YA 2VLKE 3AREA 3FZUC 3GI8H 1GYAA 1MOEA 3ZHLA 2MJWA 4XTRD 3V5DB 1VFAA 3MV9E 3SDCA 2ZSWA 2BSRB 4ZXBB 3SN6N 4S1SH 5IKCA 2E9IA 5EPMB 1OY3B 4YHIA 4NDMB 1IAIM 5DQJA 5C07E 4JPWL 2OTUB 1F8TL 4WUUB 1LEIA 4BKLB 5KAQF 1RHHA 4M93B 1WWWX 5T1KB 1TQBC 1B4JL 2DQEH 2IANE 3VXMB 2ICCA 4DW2H 3MCKB 5FHBL 3E3QE 1BOGB 1EV2E 3V5KB 5KS9E 1HYRC 1HK6A 1GGBH 3BD3A 4LVNC 2C1PA 2CRYA 2D7NA 2GTZA 1JN6A 4Y8DC 1BMGA 2ID5A 3DGCR 2RFXA 4J3WA 4WW2A 1I7TA 5IEHA 4YLQT 3ZKXC 4CAGA 5C2BH 1S9KC 4Z78B 4Z7NE 3DTXB 1FIGL 4NZRL 4P9MH 5GXBB 3QH3A 1SEQH 3ZDYF 1F4XH 2EYTA 1XCTA 1A7QH 4ISVA 5J4MA 4I48B 3B43A 2LAAA 2DM2A 3CDFA 4YDKH 3K1KC 1NCWL 4JKMA 3L3DA 4F15B 1I9IL 3NFSL 5F89B 1MRCL 1I7ZB 3HC3L 4U6HA 4E41D 4RZCB 2APTA 2QHRL 1EZVX 3GMMA 1A21A 3T2OA 1TJIH 2DYPA 2X89D 4OCXL 2A6DB 4QHKI 4UDUA 3AB0C 4MJIE 5JO5A 2QKIB 1JTTA 4HXAL 4YO0B 3GSNH 1S5HB 1KJ3H 3PWJB 2R2EB 3MRRA 2F8VA 3WS6C 4FABL 5DTFA 4FQIH 4UNUA 1ES0B 4IS6A 4YHPB 3MRIB 4JGUA 3L3GA 3MO1A 4NQCA 3V0VA 3U36A 4G6FD 4Y5VC 2PF6A 3IU4H 1ZT4A 3F7RA 1IM9B 5FF6A 2H8PB 1QBBA 2IBBA 3PQYA 1F3DJ 1NL0H 4POZD 1P69B 1F4WL 5JHDE 3UTSA 1JF5A 1WFTA 5BS0D 1FNGB 4K94C 3O9WA 1UACH 1QA9A 3MV7E 3C8KA 3BUYB 4HUVB 3M8OL 2HP4A 3VWKA 4TVPL 1YPZE 5FYKU 2AJUL 5D7JD 4K94H 3VFGH 4X6DA 1HIML 2DI9A 5FGBA 2ATKB 2CSPA 4DWHA 4JFEE 4S10A 1ZHNA 1UJ3B 1TZGH 5IB4A 4YWGH 5ADOH 5EOCJ 1WWCA 3B9KD 5F3HA 1MJ7L 3MLSH 3IDUA 1VGKB 3GI8L 4P2QB 4W6WB 3VDBA 1E4XI 3D9AH 3DRTA 5B39B 3G5XB 4NBZB 4H0HB 4KTDH 4S1SL 1IQDA 3P40A 4LKCB 4BK5A 4HFUH 3K4ZA 4HJ0C 5CJOH 5CIPA 4HKJA 4M6OH 1YY9D 4ZAKC 2DWDB 2WW8A 5D9SA 4S0SD 1U41A 2J5LB 4K7FB 5EC2B 4IRSC 2OMNA 3FRUB 3G6AA 5BXFA 1IGCH 1NH6A 1KCUH 4AL8H 2GYSA 5DI8B 2VDQH 4AM0A 3AUVA 5I76B 2EEDA 5C2BL 1RAMA 4YR6A 1NMCC 2W65B 5F7FA 4P9ML 3QIBB 3V8OA 4ZOCA 1CFSA 2AJVH 2F58H 4M61B 3ZKND 1Q9OA 3VXTA 4YDKL 1UENA 3NH7H 5DJAA 3WO3B 4HX1B 1UH3A 3ULUE 2KZ1B 3PXJA 4F33A 2Z93B 4LLAA 1KJ2H 3KJ6H 1HNFA 4GMTH 2IQ9L 4Y19A 4U1LB 2KQNA 3QUKB 4PUBH 1NBZB 5E6ZA 1TJIL 1X6NA 5KG9B 3CDGB 2ARJB 3MTRA 4PYGA 4JJ5B 4NM8H 4RX4A 4ZFOA 2EE6A 1AXTL 1UKQA 2GAZB 3RPIA 4JZNA 5HHPA 4X7SH 2E5EA 3HAEB 1HXYA 3GSNL 3GBNH 1A9EA 1J87A 1KJ3L 2A6JA 2NW3A 4ONGL 3M1BA 1F6LL 4FQIL 4D0DB 5BZDA 1E28B 1T1WA 2YRPA 5IV2B 3IU4L 2GSGB 2WIIB 3ILQC 4LLVB 3IDXH 1UEYA 3BZDA 3GSRA 1DLFH 1E4KC 4TULH 5E7BA 5KSAB 2A74A 4NQTA 5DJ2A 5FGCE 1NL0L 3MRKB 5MEOB 3MRGA 3T0EB 4ZMAT 2CKBA 2CK2A 3QDME 5D2NE 2FHBA 4JZJB 4PLJC 1UACL 3N06B 4PJGF 4NRZB 3RVUC 5I30H 1TENA 1FG9C 1TZIB 1L0YA 3D39B 1IGJB 1G6VK 4K94L 3VFGL 4KDWA 2YUWA 4JFDD 1JE6A 1IAKA 3P0GB 4KV5F 1A7NH 1TZGL 3U0TB 4YWGL 4JM2A 3MLPA 3DMMB 1KB5H 1BVZA 3ZTNH 1T03H 3NCMA 3MLSL 2FZ3A 1Q72L 3TIEB 4XNYH 4ZTPH 5FYJE 3TYGH 3ULUL 2I60L 2RGSA 7FABL 1IC1A 4HC1L 3IFOA 4KTDL 3KLSA 4YHZH 1EO5A 3GHEH 3DIFB 1KXQE 4LMQI 4ELKA 1KPRB 1CDHA 4HFUL 3TPKA 1FFPB 3FOMB 4X8JB 3PL6D 4M1DL 5CJOL 4O9HH 1OAUH 4M6OL 5LG1A 4ODXA 5ICYB 1XF1A 2R1WB 5T3XE 1O7SA 1W8OA 3DYMA 3PGCB 4OQTA 2CXKA 3BW9A 4NNPH 2ZCLL 4DKDC 5IJKC 3HUJF 5D1QB 1IGCL 5E7FA 3TIDA 3EFFB 1EHLL 3IVKB 1MIEH 1KCUL 3MODH 5DC0A 1T7YA 1VKXA 3IFLH 4HK0B 2H26B 4HH9A 4X5XA 1D9KD 1YN7A 4OIBA 3FL7A 4PJ5A 1OHQA 5L8LB 3SE4C 2VN4A 2HRPH 1CFNA 3C8DA 3D0LA 1FAIH 1ZTXH 3L3IB 2HT3D 2GJ6D 3S3JA 1WC7A 2AJVL 4ZS7L 2EYRB 3BYYA 1NCCL 4GBXA 4LLQA 5E24E 4QTHA 1CFVL 3G5YB 4WO4A 1MCNA 2IGFL 1B0RB 3MLYH 4L3CA 2A83B 4ZFZA 5ID0B 4QRPB 3HZMB 4OLEA 4UV7H 4XP6H 5EBGA 4KZDH 4Y2OA 1K5NA 4PUBL 3DGGA 4D3CH 4HIEB 1DVFC 2E7HA 5C0AD 3SE8H 4Y5XB 4JE4B 4X9BA 4NM8L 3T04D 3ISWA 2FEDC 4XPGH 2IBGA 4MJ2A 1U95A 1GHFH 4L1DA 3RIFK 4BM7A 4DUWA 1VSCA 4X7SL 5DMIH 4HS6B 3U0PA 3IKKA 1G7LA 5C8JA 5I75C 4XNQA 4OLXL 4L8CA 3LKQB 5IT2H 2A9MH 4J3OC 4N8VG 3GJFA 5CJ5A 4B50A 1YEJH 2ADJB 4NFDA 3ROOA 5KOVC 1HEZA 1TVHB 4OF3A 3OJVC 5D7IB 3IDXL 2AABH 1MCSA 1PQZB 1DQJB 1DLFL 3LZFH 3QEGL 2F8OA 3MA7A 3LY6A 1RD6A 5T3XL 1XGPA 4XBPA 3LKRA 1M7IA 4FTVD 4DZBB 5EU3A 4U3CA 4PY7B 1CCZA 4YNYA 2YC1A 2W0PA 4J6RH 1N6QL 2XZZA 1GVIA 3Q48A 2VDKH 2LE9A 4M5YH 3J8F7 4HKBA 4P5TD 3GSQB 5I16B 2W07A 3PHQA 4JRWA 1UVQA 1AQDA 4KVCL 4R0LC 4BH7B 4U0RB 3P3YA 3D85D 4R90H 3FTGB 4L3ED 3SE3A 4N0UE 3O2WH 4WI5A 4BFGA 2E9WA 2D31B 5BW7A 3T65A 3CX5K 4JFOB 4PGBA 4I18A 1KB5L 5DJYB 1T03L 2ED7A 1IM3A 4N68A 2NY0D 3LDBC 5C3LD 2IAMC 2YBRB 1QSVA 4ZTPL 3MV11 2M26A 5C1MB 1TETH 2BNRE 2GI7A 3CLEL 5JW4M 3P73A 3Q2CA 1QRND 1RU9H 4NKDB 4F7CA 1Y18B 4QTIL 2PCPA 1RFDH 1D6VH 4JQIH 3WN5A 4XP1L 5CAYB 1C16A 5D7LA 5DDHA 4EIZC 1PY9A 1OAUL 3IFPB 4S2SA 5HGGS 1JZ6A 1J1OL 4F8QA 5FOBB 2R9HC 4PTUA 2X42A 4ZUVA 1S7SA 1A6VH 5AWNL 1MNUH 3QIUB 1EFQA 1FGVL 4DKAA 1MI5A 2ARJQ 1ORQA 5ACMA 3IFLL 3QXWA 4RDQF 3QWRD 3ARGC 3OR7A 2DOCA 1MY7A 5IMLA 5DUPH 1I1AB 2DAVA 3QFJB 4P2OA 2DQHH 4CADB 2P5WE 3ARFC 3TJHC 4BSWB 1EXUB 4D0CB 2HRPL 5E8NB 1OL0A 1FAIL 5EULV 4ZUTA 5FDWA 3FT4B 1V5JA 3MBEC 1CDJA 4PJ7B 5GGSB 5D6DC 5IHZB 5ELIA 5EIIA 4KAQL 1JTPA 1Q9KA 2BHUA 5GGSY 3MLYL 1EGJA 4GAYB 5MEND 1DSFH 2ZCKL 4PJFE 4UV7L 4CU6A 4R7DB 4GT7A 3VD5A 3OBAA 3FO9A 4XP6L 3HE6D 2IPUK 4Q2ZB 4D3CL 3SE8L 1GPOH 3MGOB 2BXYA 1G7JB 5F7EH 3MLZH 2VL4A 2X4UA 4R97B 4X4MA 3KPRA 2X4OB 4IMKA 2V9QA 1AKJA 2A6IB 5DMIL 1M7DA 4F9LC 3QB7C 3V5HB 3ARWA 4Z77A 3BP6A 4Z7QF 5KVGH 3CK0H 5HTSA 4AIOA 5IT2L 2A9ML 5GGUA 1U8LA 3BPOC 2VL5B 4FXLA 3ALXA 4HPYH 3PUCA 5A2JH 1KTDA 4V2CB 1QO3B 3L3OA 5B21A 3LV3B 3ZDXF 1BBJA 1MFNA 1JPSH 1FZJA 3LZFL 4POZC 3P4OB 5FXCH 2NYYD 3R0MA 4J8RB 1XGUA 2F53D 4LCWA 3BDYL 2OK0H 2JIXA 3MUJA 3VXSA 2EO1A 1P9MC 2QQKL 4J6RL 5DRNA 1O5DT 5F72S 2VDKL 4MA1C 2W0LA 1VENA 3OAZK 2FR4B 1T66C 4R2GC 3F7PC 2BCKA 4E41E 1AJ7L 3C5ZA 4R90L 2CIIA 1JYWA 3KYMB 3FN0H 3O2WL 3WO4B 5F6HI 3CMOH 4LSRL 2GSIA 5B3NA 2Q3AA 5GS1B 1SY6L 1GXEA 4KROD 4NGHH 3WEXB 1A6UH 3GSOA 4LSTH 1JHTA 3L5WB 3QXDA 4JRYA 4O2FB 1SJEA 2EH7H 4HULB 1A1MB 2VE6A 5HGDB 4PJ8A 3TBVB 4JQIL 4FQHB 4ZTOH 5K59E 1JTOA 2EC8A 1DDHA 1YY9C 3ARDB 3OJDA 4P23A 4FQJL 5HSFA 4F7PA 4MNGA 4HCRH 2LV4A 4G8EB 4JFYB 1CXKA 2PW2A 3LHPH 1A6VL 1MNUL 2EYSA 4Y4HD 2IFGA 4GUPB 5C2UB 3UBXG 1H0DA 4RAHA 5MI0C 5EO9A 3SGDH 2F5BH 1RZ7H 4LSSL 1JUFB 4FQXA 5BS0E 2NLJA 4AMKH 2QQQA 3HI5H 1PKOA 4ETYA 4P5KB 1LDPH 1H5BA 5TDPB 2DQHL 2XNAB 5JA8B 3HRPA 1E4WH 1I8IA 4LRNL 2F5AL 1GIGH 3ZKNC 4NRYA 2VKWA 1BLNB 4P5MA 1BWMA 5FA3A 3O2VH 2FJFA 2VLJA 1SM3H 4P2RD 1EAPB 3VGDA 5GJTH 4YHYB 3PG2A 1LP9B 1DSFL 1PAMA 5IGXH 1OB1A 1S7VB 5I1EL 3QNYA 1RVFH 2JJTC 5C08B 5CP3A 1TTGA 4RWHA 1XH3B 5C0BA 3THMH 4GW5B 3DUUB 4JRXB 3KYKL 4GG6E 5HVFB 3DVFA 5F88A 5F7EL 1N2RB 1YMHA 2Y7QA 1B90A 2EIBA 3MLZL 2AJ3B 4M7JL 4QHNA 3D2UA 1KLGB 4X7FC 1D5XB 4JN1L 3DBXA 2PETA 1WBXA 3TH4T 5KVGL 3CK0L 5DMJB 3VI3F 1AI1H 1GZQA 4M4RA 3GRWL 4I13B 3O3DB 1WAAA 1GGUA 1YZZA 1I8LA 4GRWF 3OR6A 4HPYL 4QHUA 2YOCA 1OGAB 5DFVD 1FC1A 2ESVA 5EFIB 4HIHB 2YPLB 3DVNB 1JPGB 5HYJB 2ICWJ 1JPSL 2P44B 4X6BB 2PYFB 4D2NA 4X80L 2ZZUT 1A6PA 3BDXA 4UQ2B 4DOHE 5DRZB 4JKWA 2VDPL 2H6PB 2YZ1A 3U9UB 4IIQB 2AJZA 1S9YB 3ELAT 5ITBH 4HPOH 1IGYA 2FL5B 4OIAA 1QSEB 4GW1B 1MJ8H 2HLFD 4IRZL 4ZYKB 2HMIC 1KIQA 1HDMA 2DLHA 2OZ4H 1A6ZA 1S7UB 3MREB 4P4RA 1NFDB 1I8MA 3W9EA 3RA7H 3K7UA 3CCHB 2D4FA 3X17A 1BD2A 4ELMA 3FN0L 5LGJB 1GSMA 5FO7A 4KK8D 2PXYC 3CMOL 5SX5H 1T5WA 4W81A 3G6JB 4XCEA 5DJCA 4KJQC 3MMEB 4Z7UE 1R5VA 1U3YA 4R7NA 1A6UL 5CBEA 4LSTL 4IJ3C 4HF5L 4JY5L 4AIZB 2NY3D 3KJ4B 3S3SA 3UTZA 3LPWA 3JVGA 1DBBH 3SCMD 3CFEB 43CAB 2EH7L 2IH1A 3DRQA 4ZTOL 5DA4A 2X4QB 2VOTA 2NY6D 3ARBD 4Y4FA 4FXGB 4HCRL 3AFLA 1B2WL 2X7LA 5IBLC 3C5SB 5IW6B 1GCFA 4BFBD 2RCSH 4XPFH 4CDGC 1KFAH 1HCVA 3FONB 3U4EB 1E6JH 5I1AB 4N0RA 5L2KA 1XIWD 4L4VA 1TIUA 4M1GH 2FYYB 4Z95L 4TTGA 3HI5L 5FUZH 1U3HA 1OWWA 4PJIE 3U1SH 1IKFL 1ZS8B 4JFFB 1E4WL 1I1CA 2HT3C 2Z92A 3ULSA 1ITCA 3CDCA 4UTAH 1GIGL 4NJ9H 4Z7WF 1I7RA 4N9OB 4U3HA 2O5YL 4I0KA 4JFDE 3O2VL 2VAAB 1J8HA 2HWZL 1SM3L 4NO2B 4YBLB 3CZFA 5GJTL 1T80A 2VIRA 2CIKA 5D1ZB 3OF6A 5IGXL 4NT6B 3FJTA 5C86A 2LQRA 3LKPB 5F9DC 2VLKA 4XC3L 1RVFL 1T20A 2FX9L 1JNNH 3MRNB 2PKDA 4RAUB 2AEIT 4ZSOB 1T89A 3ARQA 3PP4H 3BD5A 3THML 1EEZB 3MV9A 3CVIL 3VWJB 2HT2D 1S7WB 2OJZL 3U48A 2WAHA 3NMEA 3MRPA 5BZWA 3AS1A 4TUOA 2H2PD 2VXUL 3Q6FA 3WJJA 4XB7A 2DICA 2X09A 1CR9L 3RGVA 2KUTA 1KLUA 4OZFH 5FB8B 2IANA 4JB9H 4F9PA 1IAOA 1EHAA 1CTOA 3MRFB 1U42A 3D25B 3RWIB 1R3LA 2E7LA 3FB8A 5C7XH 3OQ3B 1VEMA 3L7EB 4ODTH 4PGJA 4WTZG 1RQ5A 3LKSB 3L95A 5C0FB 2AKRB 3MR9A 1N5YH 2QR0B 4YEEA 4UIMB 4UTBH 2GJ6E 4NKIL 5JOFB 3S5LA 4MNQD 1E27B 1OW0C 2X4TB 1ACYL 4HPOL 1INDL 2FRGP 1U91A 3LQMA 1MJ8L 4QF1A 2OZ4L 1T1ZA 1M05B 2X44D 4Q0XH 2R2HA 2VLRA 4BFEA 1X5LA 3RA7L 5E5UB 3KPLB 3WDJA 5GGVH 3DVIA 3RY6C 4Q9RL 3DXAB 5C0AE 4XHQA 3QUYC 4M5ZH 2W0KA 3H0TA 3HNSH 3RBGA 2NY0C 3AMLA 5HHVH 3VD3A 4TSBH 4WW2F 4C56D 4RMUA 5J8OA 4LSPL 5D5ME 3V6OC 5IHUH 1YNTA 3OKOA 4UOJA 2D7QA 1A1OB 4KMQA 5FYKH 3IDMB 1R5WA 2BX5A 4XGZA 1JK8A 5CSGA 3WIFB 2KDGA 2P8PB 3B5HA 3BZ4B 4LVEA 2GITA 3HE7A 3KLHD 1KCSL 4W6YB 1MCWM 3QQNA 1IILE 5AZEL 2RCSL 2R0WL 4XPFL 3DUHA 1ZV5A 1N59A 1KFAL 2HJFB 3UZQA 4S1QH 1A6AB 4PJAB 5DZNA 3PE9A 1INQA 1CDCA 3JV6B 4EN3B 5B4MC 4LCCC 4JANB 3QUZB 4FTVE 5JHDA 3FO2B 2HTKD 5DVMA 2D03H 3BOVA 5CILH 2XFXB 5EC1B 1H9VA 2UUDK 4O4YL 5IFJB 4FQLL 4G7YH 1XF2B 4UTAL 4NJ9L 4G9DB 2DL9A 1YPZA 4L3EE 4O51A 4KVNH 2OP4L 5EU4A 4JFEA 4KC3B 2MMXA 1PYWA 1IAIH 4H20H 4L8DB 3TFKD 2MQ0A 4W4OA 4JKLA 2EO9A 3MRCA 4ZOEA 4NNYA 1U6AH 5AYUL 5EU6D 1A3RH 1NDMB 1KSRA 5CLTA 1L6ZA 3V6OE 3OWEA 2DQDL 3F7VA 3ORJA 3PP4L 3GB7B 1QRNE 5HYQA 3NPZB 2YK1H 3BWAB 3VGHA 1J88A 2V2TA 3QQ9D 1HOCA 4N8VB 4YBQC 2AP2A 1J18A 4PGDB 3IDJA 5EZOH 5C0CB 3HKFA 4NOFA 4U1MA 3UP1A 3IXTB 4WW1A 4JB9L 4X6DF 4XPBH 1GGCL 4P4KC 1N26A 2BSRA 4ZXBA 3AS3A 1FC2D 1OSZB 2DM3A 5EPMA 4RISH 4NDMA 4ODTL 1M6OB 2YS4A 5EA0H 5IFAH 2WUCH 4HWBH 2OTUA 1QFWL 4WUUA 3L6FB 5ITFB 3BPLC 1YY8A 3WE6B 3HCVA 3WLWD 5T1LB 5TDNA 2X4SA 4NO3B 3MCKA 1TQBB 1BOGA 1LEKA 4MQTB 2AJSL 4HWUA 1K4DB 2V17H 4X6FB 1PLGL 5CGYC 1A8JH 1FO0H 4JFXB 5GJSL 4NBYB 3V4UH 3O6FD 4UV4H 2OXHA 5MERB 4UMGA 3SKUD 1AC0A 2AEPH 4ZUSB 5MENE 2X4NA 2UZIL 4M6AA 4Q0XL 4I0PA 3TZVD 2K9UA 3ZKXB 4Z78A 5M7QA 2H3NB 2MHAA 3QWOA 4BFIA 4OZIE 2APBA 4WFGD 1I7UB 5GGVL 5K9JH 4MCZB 4K71C 4OFYD 4PJCE 1FNFA 2ITCB 5IB3B 5EBLB 4GKNA 5J57B 4WI6A 5F89A 4CN6A 5IHUL 3D69B 1RZJH 1I7ZA 5FYKL 2DQGL 3IJSB 1GZPB 3KYNA 3FFCB 3RQ3A 4K8RC 3CFDA 3PHOA 4EOWH 2GUOA 2XZAH 5CEXB 2ADIB 1HSAA 2ZPKH 1GOGA 1JWUA 4FQQB 1L0QA 1BZ7B 3GSNB 1UKSA 5IMOB 5E2JA 4K8RH 4YAQB 4HGKC 2QKIA 4YO0A 3G5ZB 2F53E 3MNWA 1LD9B 3W81A 5F1KC 2OBGA 2R2EA 3VI4E 2YPVH 1TCRB 3MLTB 4YHPA 1ES0A 4MA8L 3GKWH 3QDMA 5D2NA 3LAFA 4O2CB 2D4DA 4G7YL 1IM9A 4Y5VB 5HYFA 3X3FL 4R4BA 2H8PA 1UM5H 2EICA 3QI9C 4M8VA 3W0WD 3QFDB 1GOHA 4MZ3A 3A67H 2GTWB 4MS8C 2CDEA 5E56A 1IAIL 2DMCA 4J23A 5DJ0A 4P49A 4Y5YA 1HHJB 3BUYA 4HUVA 1J1XL 3QWQB 2J12B 4OCSH 4GRLD 1CGSL 1P7QD 4OAWB 3BH9B 2ATKA 3REWB 4UQ3B 5SWSD 2YK1L 1JZ5A 1ZOXA 4S1DC 5GSVB 3RWEA 3AU1A 3C6LD 1JRHH 5IVNA 5IK3B 4LCUB 1ORSA 3F7QA 1HKFA 5EZOL 3QEQB 4ZNCD 5ALBH 5E2UH 5IOPB 3PJSB 4ZUWA 2FHFA 5B39A 1F4AA 4OFDA 4XPBL 5C9KA 3ZDYE 1IZJA 3GMRB 2Y36H 5DFVC 3RUGB 1GGYA 5CZVH 5EA0L 5IMMA 5IFAL 2WUCL 4HWBL 4I0CC 2EXWC 3EYQC 1A6TA 2DWDA 1IKNA 4WEUD 3QDHA 1S8DB 4K7FA 5EC2A 4NO0A 2HYMA 4PJBB 1CVRA 4UOW0 2V17L 4MX7A 5IVXB 2ICEB 4H1LG 4UDTA 4P2RE 3SPVB 3V4UL 4UV4L 2WBWB 3HA0A 2XWJB 4HLZH 1WCBB 3QPQD 4K23H 5I76A 4C57C 4K9EC 3RWHA 1FZMB 2W9LA 1B6DA 2NY1C 3QIBA 4PLOB 5K9JL 1NMCB 2Q8AL 3CVHH 2VQTA 4M61A 3U4BH 3ESVF 1X5HA 4S0TD 3U7WH 4K9EH 2FECL 4LSQL 2DF3A 5I8EB 1KJ2B 2GY5A 5D1XA 1ZHLB 1MELA 4GG8B 3O4LD 3P9MB 5BJTA 1QFPA 1CE1H 2OI9B 3GMNA 4U1LA 4R4FH 5ESVB 3QUKA 4PP1D 4EOWL 5KG9A 5GGQH 3ARBC 3HS0A 2ARJA 3LMJH 4CVZA 1CBVL 2FBJH 2ZPKL 1L9NA 4WGVB 4K8RL 5FV2A 5JXEA 1FG2A 1WFOA 3CXDL 25C8L 3HAEA 5I74C 4YXHL 3LIZH 3GJEB 1FORH 2YPVL 4OZFG 1Y6MR 2W0FB 1Q1JH 4RGNC 2X1XR 1MREH 1E28A 4PJXB 3GKWL 3VG9C 4L4JA 1QBAA 4X98B 1T3FA 2WIIA 1FFQA 1UM6H 3OJ2C 4LLVA 3V9FA 4HD9A 3UC0H 5KSAA 3CFIC 3RIFF 3MLUH 1UM4H 5HGHB 1T6WA 5MEOA 4OSUH 3T0EA 3FB5B 3HHRB 1HCFX 3A67L 3RY4A 1UEMA 2AXHA 3ILPA 2CD0A 4JZJA 4BQBA 3TBWA 4OTXL 1YN6B 3RL1B 1B0WA 1P4LA 4CBPA 4NRZA 1A5FH 5FM4A