4GKZA

Ha1.7, a mhc class ii restricted tcr specific for haemagglutinin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
202
structure length
202
Chain Sequence
MQSVTQLGSHVSVSEGALVLLRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVSESPFGNEKLTFGTGTRLTIIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Alpha chain of Class II TCR
publication title Minimal conformational plasticity enables TCR cross-reactivity to different MHC class II heterodimers.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2012-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gkzA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gkzA01
4WHYG 3GSXA 2ZUUA 2LV4A 4LCWE 4XXDB 2C1PB 1MCBA 1PVHA 1YYML 5HJ3A 4QRTB 3O9WA 5F9JB 1GHFH 5JIIA 1KN4H 1R5VB 3FHQA 3ISWA 1LK3H 2OTUB 3RVXD 3BW9A 4PJ5B 4L3CB 3MBEC 5TE4H 2Y6SD 3V8CA 2YPVL 5ETUA 4F33B 4NKIL 2I9LA 5KSVA 5L8LB 1MHPH 5CZKA 1Q0YH 3ARFC 5FO9B 4PRIB 2VDML 4Z18A 3THMH 3QNYA 5D7LA 4MNQB 3WIFB 4K9EC 2VDNH 3IDXL 4QTHA 2H26A 2XY1A 3PDGA 4P5KA 1ZWIA 4IOIB 4KJPD 4O58L 5LAXA 3OXRA 4NQCE 1D5IH 1P4IH 1KPUB 3FB5A 5J11C 2JJWA 3MV7B 1I9RL 4EOWH 2JB6B 4DN4L 3BZEB 5I1JH 4R26H 3PJSA 3WV0A 4R0LA 3PIQA 1QQDB 5HVHB 2ADJA 4EVNB 1MHEA 2BP3A 3DVFA 3O8XB 4V2BA 4M7JL 3NIGF 3G08B 1OF2A 5MENB 2P43B 2R4SH 3QUXD 5E99L 4UT9H 2BY1A 5JOFA 4KKNA 1T20A 1FCGA 4NO5A 3L95B 3O4LB 5EB9A 1T1WA 2Y25A 1A7RH 1ND0B 5I1LB 3KPPB 4OM1L 4AT6A 1HHHA 5M94B 5EPMB 3EDFA 5T1LD 4U6HA 3IXTB 3QXAB 3NIGE 3RY6C 4OLXH 5D1ZC 3CFKA 1FFPB 2YRPA 4RFOL 3UP1A 3TO4A 2GITB 4JFHD 1K3ZA 5EH1A 1V5JA 3U83A 1ZHKB 4KK5D 2F58L 3BH9A 1QHPA 4G7YH 4ODSL 3FB6B 5ICXA 2F74A 1AKJA 1B9ZA 1CXFA 3V4PH 4FS0A 4M6AA 4FN0A 3FOMB 1QVOB 4KJQD 2EDHA 3G5ZA 2Y4SA 2PXYC 4KMQA 5IBTL 4IRJB 4N0YH 1L6XA 5DEGA 5KZCB 1J0YA 2ADIB 5D7SL 1MCDA 1W0WA 2H2PC 4IJ3C 5KS9A 2XTJE 4PP2B 1J10A 1E28A 1T04A 1XF5B 5I15L 1QBLH 3EJZC 5GRVL 3FOLA 2A2QT 4Y5XC 1WC7A 4LSTH 1OGAD 1DE4A 2V2XB 3VFNA 1YDPB 4F7CA 3WE6B 4XXCA 1OCWL 3C2AH 3OKMA 3RDTD 3QQNA 1E4KC 5INDA 3R06A 5ESQB 3WLWD 1KULA 1KV3A 4MD5A 4CVZA 4J8RA 3BZFA 3BKJL 4LSSL 4RBPK 2XTLA 4I2XA 5ID1A 3LY6A 1L7TH 2KPNA 2X1PA 4L8DB 4ZS6C 5EC2A 3MRHA 4L9LA 1FYTB 4OZGB 3EFDH 2IWGA 4ZUSA 3GJFH 4DQOH 4KGLA 3OWEA 2G5BB 5EZIH 2FWOB 2EH8L 1IC5L 1AD9B 2E27H 4M03A 1BJ1J 1YEHL 2R1YB 2IFGA 3BMWA 1LO4L 3CDFA 4DFHA 1ZSDB 2QR0A 5GS3A 4NZDA 4JO1H 1UWGH 3QO0B 4O2FA 5D1QC 4LP4A 3KPLB 1WJ3A 4OIIH 3QFDA 4UINL 5EU3A 5L6YH 1OL0A 1NAML 2Z9TA 3ARDA 4HLZH 4CU6A 4JGJA 4GAYA 1P84K 2BNQD 3FQNA 1RHHA 4P2OD 1HHJA 2J4WL 4MCZB 3SKOB 5E6YA 3PWJA 3ZL4H 1RIVH 4XNMB 4Z95L 3MLXL 4OLWL 3EYQC 5BRZD 3L5HA 2X9YA 5T1DH 1CI5A 5CBEA 2JIXA 1X4XA 4OV5B 3QNXA 4E0RA 7FABH 1R3HA 1A6TA 1CGUA 3RVXC 1M7IA 4MD4B 1JWSA 2Y6SC 4P2CG 2QLVB 1I8MA 3RIAK 4KJYB 3UPRB 3ARBD 2Y5TA 1QLEL 4N1EA 4C57C 4CVXA 1XT5A 5DMIH 1P5VA 3UTPE 1MH5B 3T04D 1WT5C 3E3QC 1S5IL 3VI3F 1IEAA 3EYUH 2V17H 4MZ3A 2H32H 2X1XR 3RWEA 5BXFB 2AJXL 4LSQH 1G7PB 4KJPC 5EU5A 1MWAA 3AAZB 4JFQB 3PWVB 3TBYB 2CRIA 2SEBB 5JNYB 4JM4L 5SWSD 5DJYB 4P57B 1XF3B 1XR9A 3S4SA 2NPLX 3O3BB 4Y19D 3MXVL 1T5XB 3VI3E 1JYVA 1MIEL 3U36A 2GCYA 4AIXA 1J8HB 4FFVC 2YUZA 4H5SB 1N5AB 3U0TA 1YNKL 3QUXC 4QHKJ 3WJJC 1N64L 3IKKA 1RAMA 2ICWJ 1NKRA 2O5XL 3TFKC 1F2XK 3SOBH 3SGJA 3PWNB 4O5LH 4LSVL 2IPTH 4R90L 1QFHA 43C9A 1U2HA 3MGTA 5T3XE 1ZVHA 4AIOA 4DN3H 5LBSH 4NJAL 1EVUA 2FATH 2CIIA 3GNMH 3RL1B 1P7QD 4OLZL 1ZVSA 1NBYA 3VXRA 1MRDH 4LNRB 3UTTE 3VWJB 1P2CA 4P23D 1VDGA 4NHCH 5GPRA 4K7FA 2DM3A 1JK8A 3U30B 2IBBA 1FO0B 2ZCLL 3VWKB 2P5ED 1VKXA 2EIBA 4WGVB 3VMOA 1DBJL 2HH0H 5DRXB 3RBGA 4IIQA 5GJSL 4PTUA 3D0VA 3GSNL 1QYGH 2Q6WB 3OAUH 3QCTL 1T7XA 4YPJA 3OZ9H 4LLQA 3MBEA 4NC1E 4PV8A 2UY6A 4K8RH 5EIVA 4RRPG 4ZSOA 5INCB 4QRUA 3S37L 5IJVA 4PR5B 2ADGB 4NPYA 5HI3C 3S9DB 3LD8C 3MRJB 2EE9A 4G43B 3RDTC 1MSPA 4RX4D 1NLDL 4BQ6A 4HS8L 2DIBA 2OI9B 2EKJA 1FVDA 3C08H 5IT2H 2AK4D 3D6GA 2CO6B 1HKLH 2VZVA 1A7QL 2YK1H 1L9MA 2PCPB 3QCVL 3PABA 4P5MA 3VFGL 4YLQT 4P2RB 2ZP0T 2C4FT 2XXMB 2ZUXA 1RZKH 3ALXA 5E00B 4QRQB 4QTIL 3GGWB 3BDXA 3C5SA 5DJXB 5FIEA 3CH8A 4PRID 4FQIL 2AXJA 2MWCA 3FN9A 4N0UA 4MNQD 3WYRA 4YDKH 4K3EH 3CMGA 4WW2C 5AWNL 3WHE0 5F96H 5EOCH 3RY6A 2DRUA 5HHXL 3KPOA 5C9JA 3QJHA 1IGTB 1YY8A 3NIDF 1Y0LB 2ITCA 3DRQB 3OB0H 3MV7D 1G1CA 2RCSL 4RFNC 3F65A 4P2OC 4K3DL 3BDYL 4I3RH 4XZUA 3ELAT 4OM0H 2X4UB 2X1OA 3D9AL 4Y1AA 5J4MA 2PXYA 5MEND 3ESUF 3DUHA 4KV5F 2X4OB 4X7CC 5CJQL 2CKBL 3DHMA 4P5TA 5E08L 5E5RB 3T65B 1A9EB 1KTDA 2N4IA 4Z7VF 2NY5C 3O4LD 3NIDE 4OGYH 3WKMH 2X09A 1ETZB 4QYOB 4YHIA 1FDLH 4FNLL 1U93A 5TF1L 5I8KL 2HFGL 4NQSB 4JM2B 3MROB 3ULUL 4NT6B 1RFDH 3L9RA 4Q9QH 1AO7A 3OQ3B 4RCAA 1W8OA 2NY1C 4L29B 3S37X 4ZNEA 2CK0H 4KV5E 5IMOB 3QRGH 1GPOH 1UCBL 1JZ2A 3ARBC 4U1KA 4U2YA 3RWFB 2NY7H 1XZ0A 4O9HH 5L0QC 4Z7VE 4CU8A 2ZUQC 3U0WL 4E42B 2XYCA 3SE8L 5M95B 1R24B 3EYSH 2AXGB 1MHHB 1MCEA 4Y4KA 5E5MA 1HEZB 1KJMB 1F11B 3GB7A 5C09E 4J6RL 1SBSH 3LEYL 4IRJD 3RPKA 2HT4D 5HPMB 5KZCD 3NGBC 4QHUB 1N5YL 4PJ9A 1AGCA 4HWEH 5DVNA 3U4BL 3DI2B 1U8OA 5IEKB 5BS0E 1I8LC 4P2QB 5IESL 1KXVC 4NZRH 3BP5B 5E8PA 1KN4L 3K1KC 1LK3L 1IQWL 2EDRA 5TPWL 5TE4L 3O3DB 1WIPA 4MA1C 2MKWA 2R69H 1KJVB 1DBAH 3STLB 1VACB 4H8WH 5HHOE 1Q0YL 3O3EB 3DX7A 4LPUA 4WFGE 5I17B 1FNGA 5GQBA 3THML 2MQCA 3DGGA 4JRXA 2Y07H 1EH9A 2VDNL 1T66D 3P0VH 4PRBA 4BA8A 2C7UB 5DFWH 1OY3B 5IWLC 3K4ZA 1INDL 3HZKA 4P23C 2HN7A 1P4IL 1QO3B 3HPLA 4M6NH 4EOWL 2NY6B 1SJVA 1KCUL 5FDYA 1RY7B 3QEGH 5I1JL 1WFNA 3OAZK 4OSUH 4R26L 1DANU 3JVGA 4NO0B 4OZHF 5D6DC 3V6BR 5FM4A 4U1IA 2C3GA 5D1XB 4U1SB 1ZT7B 2R4SL 2XY2A 5A1AA 4V1DD 4PRPE 1DVFB 1MEXH 1YMMA 4UT9L 1J86A 4KK6C 4ZUUA 3SO3B 5E6IB 1Q9LB 1RPQA 1CD8A 4YUEH 1EAPB 1U3HB 4H1LG 1TMCB 1A7RL 1QSZA 1FAIH 3SQOH 1KLUB 1HK6A 4OZHE 3LS5H 1QR4A 4D94A 1OAXH 1A6VH 4OLXL 3HPJB 2EECA 5KAQG 1JYNA 1QNZH 2E9IA 1V7ML 1HIML 1AQKH 1Q0XL 1C08A 3MNZA 1MJJB 4Z7UB 4NC2B 4HUXB 2JB5H 2VL5B 3V4PL 2YPKB 3S98A 4HFUL 4TSBH 4YO0A 3CX5K 2XKNA 2G2RB 2QEJA 3QUXA 3L3HA 2DTML 3LDBC 3GEWB 3JV4B 2AKRB 4I5BA 3L5WA 1QBBA 4LSTL 5ESAA 5LGJB 1HDMB 2E6QA 3O2WH 3LMJL 5KOVC 1EHAA 5T1LA 1RUPH 2PTTB 1FL6A 5LGKA 4PV9B 2FZ3B 2V5RA 3UC0H 1R6VA 4ZO8A 2NXZB 2QQKH 5E8OB 3MCLL 4RWHA 3SGKC 1IGMH 4F37F 4D9LH 1QP1A 4GG8A 5DD5L 1FBIL 3QUMB 2VMFA 5HVHC 3MODH 3O8XC 3A6CL 5EWIH 4NN5B 4NKOA 1S9VB 1T7YA 4P3WA 1Z0NA 4DQOL 2NLJB 3PWUB 5DI8A 2G9HB 2FRGP 4F7MB 5EZIL 2Z93B 5IFJB 4UT7H 3FO9A 4NZUH 4BKLA 3CVHH 4JFPB 2E27L 4P99A 5IQ9A 1IAIM 2BOCB 4HPOH 3QDMD 4X6DF 2GT9A 2ZUYA 5A2IH 2OZ4H 4AQ1B 3IDIA 3TNNB 1OGAA 3ARRA 2AV7A 3RDTA 2FL5B 4OIIL 5HDQL 3QFJB 3AVEA 4XHJD 3VWJD 3ZO0A 5L6YL 1XCQA 4C56E 5ERWA 2X05A 3VWKD 3MLTB 1NGXB 3N06B 3KNBB 3V7AG 5CJXC 1EJOH 4X6DE 4QCIA 1INQA 3GMOB 3SBWA 3I6LE 5GJTH 4M61B 2V7HB 4XWOD 4Q6IA 4F2MB 3ZL4L 4MXVF 4HK0A 1KB9K 4IRJC 5JXEC 3A0OA 1S7SA 3MOAH 1CQKA 4DEPB 2HT4C 4WRLA 1ADQH 4L8CA 5IBUB 1EO8L 1TIUA 5BCAA 2OMNA 5T1DL 1IC4L 4AK1A 3SDXA 2AQ1A 1I7UB 4MNGB 3H42H 3W0WE 4XBEH 5IHZA 1YNTA 2EXWD 4JLRA 1JF1A 2X7LA 4XP5H 4YGAB 4MJIE 4MXVE 5I9QB 5HGHA 4WW2A 3CFBB 3NCJL 4BELD 1KB5H 3ZYJA 4S1RL 5D7IE 4RDQG 1AR1D 2DQGH 3FT3B 4G6FB 1G7HB 4MAUH 3BUYA 1CK0H 2X40A 5DVLA 2CR6A 1UKTA 1MRFH 2HKFH 3EYUL 4KDVA 1XCTB 4PG2C 5B39A 1AP2B 4P2RD 3NCYS 1QKZL 4LSQL 3KXFB 3MGAA 5D5MA 1HH6B 5GGQH 3SGDI 4RA0C 4D0CB 3MFGB 4G8FA 4BZ1L 1G9MH 2VLMD 1AQDB 1FLRL 5BRZA 3MJ9H 1IM3A 2MCPL 1Q9OB 4JY4A 3LEXB 1LP9A 1CDYA 4B50A 3SJVE 1G7QA 4L3EB 3RUGF 1XR8A 1NUNB 4NNYB 4E9LA 5J56B 1U91B 5FV2A 4WUUE 2QSCH 3O45A 3SOBL 3JZ7A 4O5LL 3ARBA 2ATKB 2ESVE 1WZKA 3B3IA 2JTDA 2WAHA 1WV7T 2MNUA 1U8IB 1KGCE 2VR5A 4HJGA 1IGJB 4X6FA 1VEPA 1YEFL 4I48B 4DN3L 5D2NA 5LBSL 2QTEA 1DSFH 3SKMA 2FATL 1PBYA 4X5WA 4K07A 5HHNB 3RUGE 3GNML 5KBNC 2CSPA 3SKJL 3IETA 2HFTA 4PGBA 1MRDL 1LEGB 5CJOH 1XGPB 2K1MA 3FAWA 2X4PB 3WO3B 5C7XL 4X0KA 1W0YT 3F6LA 5FKAA 3DV4B 2JLLA 3VGBA 5SWSA 5L2JB 1ZHBA 2R56H 2HH0L 3C09B 3DPBA 1NUGA 5DJ6B 3QUZB 1I8LA 3I85A 4JM2D 4Y19A 5FOBB 5H2BA 4LSUH 4QRPE 5HPOA 3IYLW 4G5ZH 2MQ3A 1UXSB 2XIDA 4X7SH 4K8RL 4NP4H 5IM7B 2NQCA 4NYLA 5EN2A 3V5DA 5E4EB 3PHOB 1CLYH 4TOYL 3OKLB 2XPGA 3KPRD 4G9DA 2XQYG 3NPZB 3BIKA 4G8EA 1FN4B 5CGMA 3BYTA 3MV8B 5JHDE 5AG8A 2J8HA 1BM3H 5I1GL 5C0GA 3MOQA 5I6XB 1P7QA 3VXSB 1SEBB 2WK2A 5DTFA 1BVLA 5GZND 1EEYB 4ODUB 1LEIA 5DC0A 3C08L 5IT2L 4BQ8A 1PGRB 4P23A 1HKLL 4R96A 1T22A 2EIEA 4RAUA 2YK1L 3VFPB 2P5EA 4P2QD 1BD2B 2B8OT 5BVJA 2E7MA 5D6DA 5CUSH 4CDHA 3BDBA 5EUOA 4NN7B 2RQ8A 3S34H 1P53A 2EO1A 2J7LA 1EIBA 1MFEH 3MRIA 1PQZA 4WY7H 3BPCB 2FECI 2ILLA 2W38A 4LGSB 5KJRH 8FABB 4Z77B 4E41E 3EOAB 4YDKL 1S8DB 2BRQA 4ZFOL 3H3BC 3TV3L 5EOCL 1AC0A 3WS3B 3ME0A 2BXYA 3MRGA 4XHJC 3SPVA 4RX4A 3VWJC 1HOCA 5I66A 2HRPH 3MLZH 3U30C 2NY6D 4RMVA 4LEXL 3VWKC 3SQBA 2EDXA 4FXKB 1YEDA 5DHYA 2AK4A 2HAZA 4XXDA 4NO0D 2C1PA 4GJTB 4KTDL 4I3RL 4XWOC 5F9JA 5EZOH 1R5VA 4WI9A 4TYUA 5D1XD 1F4HA 2OTUA 5F9AC 4LPWA 1TTUA 1E4WH 2QQQA 3EIFA 4U49A 3VG9B 2OCFD 4KRNA 5E6ID 3DSFH 3CLEH 4UIMB 4G8GB 3G5YB 3L3GB 1NDMA 3GI9H 5FYLD 3VFMA 2GAZB 2OL3H 3TA3B 4PY7B 2EXWC 4CVWA 1RFDL 4PJ8B 3JXAA 4MNQA 2VAAB 3WIFA 3AY4C 2CK0L 2NMSA 3QRGL 1GPOL 4XCYB 4IOIA 1JGDB 3ECBB 5HY9A 2OI9C 4HBQA 4O9HL 3GSNB 5TDPB 3EYSL 3CDYA 5FOJA 1A9BB 1KPUA 5DD1H 5DUPH 1LO3H 3MV7A 3SGKA 1JGEB 1PEWA 4HKZA 3DXAD 1QQDA 2BSED 1MJ7H 3Q0HA 1NEZB 1OTTD 1SBSL 4DOHE 3IJSA 3IRPX 3G08A 1B90A 1N3NB 5MENA 4ZG1A 4G6JL 1X6LA 1G9EA 3ULVD 1DQJB 3I6GB 4HWEL 4XPGH 3CSYB 4Z7OF 3O4LA 2FEDD 2WWKO 4JFDB 1ND0A 1KYOK 2VXUH 3KPPA 1FZMA 3O3AA 3W81A 1IFHH 4JHAH 3QXAA 1VFBB 2M2DA 1UB6B 1FFPA 4PGEB 1F00I 2GITA 1DBAL 3CSPA 4H8WL 2WQRA 5DFVD 1ZHKA 4NC0B 3B9KC 4Z7OE 3WKNA 3VFVB 1F97A 3AFLA 1JUFB 4KTEH 1OD9A 4GG6B 4W4NA 3FOMA 2FIKB 2ENSA 1TVBB 2IH3B 1RK0B 4GH7B 5K59F 1HQRB 1U0QA 3MX0A 4TUJA 3GBMH 1HN1A 4IRJA 3BE1H 4M6NL 3E6FA 3QEGL 1YPZF 3CMOL 3X3FH 1W72H 4M9PA 1CDHA 4PP2A 1I1AA 4L4VE 4WEUD 5SWZB 1TCRA 3RA7L 1J5OH 3PE9A 1LNUA 3C6SB 3FO0H 4JM2C 4YQXL 4RWYL 1YDPA 3WE6A 4JZOA 4BFIB 5K59E 4UDUB 5CZVL 1M05B 1DQML 5IB2B 1JCKA 4AEFA 3QFJD 1RZFL 4PY8J 2R39A 1EO7A 5ESQA 2QHRH 2X4TA 3UBXB 4YUEL 4HIJB 4MCYA 3O11A 1YPZE 2IPKA 2CKBB 1VA9A 3QDGB 3SQOL 3LS5L 1IGIH 2P47B 1OAXL 4HXBL 1A6VL 4PG2A 4XCEB 2YD5A 1UADC 4LCCB 1QNZL 4EQ2A 4OZGA 5MP6H 1AQKL 2VLLB 5DQ9B 1CU4L 1U8PB 3FO1A 3ZT5A 4YAQB 1RZIB 2G5BA 2JB5L 5DMGD 3W82A 4UOJA 2FWOA 1A7NH 5BZWB 4YEEA 2R1YA 3RWHB 1KIPA 4TSBL 4WFHE 4XVSH 1IL1A 3KG5A 1ZSDA 1B2WH 2N7AA 3QO0A 4V1DA 1RJLA 3K46A 5M7QA 3IU4H 2NZ9D 3KPLA 1C8PA 4LRIA 3T2OA 4GMSH 1CFQA 3QHTC 1U41A 3WHXB 1ZV5A 4X5LA 5GGRA 4UQ2A 1REIA 3O2WL 3SDAB 3B9DA 3SGDH 4DKEL 5FYJU 2BHYA 4QHKI 3KXFD 1A64A 4MCZA 4U1HB 5FUZL 3SKOA 3TN0B 3HE6B 2Z8RA 3KS0J 2QQKL 2RHEA 3MOBL 4PRDB 4P59H 4XPTH 1TNMA 1KJ2L 4FQCH 5IKCA 4D9LL 2HTLC 1D5BA 3BO8B 1FNAA 5CJ8A 3TIEB 4HEPG 5CKGA 4OV5A 4M9OA 2C1OB 5SV4A 4L3ED 1I75A 3BP6B 2GJ6E 5D1XC 1DVFC 5HGBB 3GIVB 1JZ5A 4XP1H 3O6LH 4R4ND 3SO3C 5E6IC 4HS6B 4CN6A 5IQ7H 4UT7L 3NAAL 4NZUL 1CXLA 3CVHL 4CL7A 5DQJB 5IW6B 1U3HC 5D2LB 3DETD 4RAHA 4Z7WA 3PDOA 4TNWF 3D48R 3QXDB 4D9RD 3MLUL 3IXAA 4QNPF 1MH5A 4TTDD 3SDCB 5GS0C 2OQJA 4QRRB 5BXFA 4F9LA 5ID0B 2YD2A 4HD9A 1G7PA 3QULB 4Z7NF 5IFAL 1CXEA 1OOAA 3AAZA 3KLAB 4JFQA 4ZFZB 4L5FH 3PWVA 3TBYA 2WZPD 1O0VA 2SEBA 5LCVH 4YXLL 5JNYA 4WCYH 5DJYA 5ANMA 4P57A 1EJOL 1A21A 1KELH 1XF3A 5FKPB 1ZGLA 4QNPE 3QUZD 1T5XA 3WD5H 3MOAL 2Z4QB 3FQWB 3M8OH 1KF9B 1P84J 4H5SA 4FXGB 1N5AA 3HUJF 2YS4A 4G7VH 1B6DA 3RQ3A 3ULVC 3MTRA 5JA9A 4Z7NE 4KRMB 5KN5B 4FP8H 3FFDB 3H42L 3AC0A 4I4WB 3MNWA 4ONFH 2E7LC 4MJ5B 4OKVA 3QDMA 4HCRA 1BGXH 3BX7C 1ZHNB 3GSOB 5F1KC 4LVHC 3BP4B 3MV8D 4XAWH 1Q1JL 5I76B 1WFUA 4YHOH 5IG7B 1KB5L 1NH6A 1KT2B 3HUJE 3VXSD 2NXZC 3MREA 4LNRA 3VWJA 3MUGA 4TSAH 4X9GA 1FO0A 3G5XB 1CFNA 5K9QI 4PBXA 2HKFL 1EEQA 4HGMA 3IDNB 5GGSA 3VD3A 3VFRB 1KIRB 3OSKA 1JWUB 4NN5C 4PJDA 3HTLX 1J11A 1E0OB 5GGQL 5DK2B 2Q6WA 1J0JA 4M93B 1OQXA 1N8ZB 1G9ML 4NM8H 5INCA 4M1DH 4KKCC 4HX1B 4PR5A 2C9AA 2ADGA 5EA0H 2Q76B 1O7VA 3EO1B 1EERB 5E8EA 2BVTA 1RUQH 1H8OA 3T4AB 3MRJA 5E9DB 1M6OB 4G43A 4JFOB 2AQ2A 1IC7H 3NFPA 2QSCL 4JPKH 5MEOA 4L8BB 1XGRB 1X5IA 4FHBD 4TUOA 4LPVA 3L5XH 3QH3B 3PUCA 3VG0H 2ARJB 3UJJL 5GGTA 3VXMB 3P0GB 1EX0A 3ARWA 2D0HA 1VESA 2EIZB 2PCPA 3DBXB 4P2RA 4DEPC 5J89A 4YXHH 5CJOL 3RNQB 3TPUB 1U8HB 1ACZA 4NBXB 3GGWA 5DMGC 1MQ8A 3RVVD 4G8GD 2L4OA 2R56L 4KH2A 4PJGF 3TA3D 5CEYB 2J6EA 3GFUA 3OF6D 4LSUL 3UZVB 4PJ8D 1II4E 4ALAH 5I9QC 1JZ6A 3MV01 4X7SL 3EJYC 4NP4L 3I9GL 4MSWB 5C1MB 1CICB 1I9EA 2DD8H 1IGTA 5E8NB 3VH8G 1CLYL 1Y0LA 3DRQA 2Q86B 2XA8L 1V3MA 1A7OL 3IFPA 1O7SA 1YYLH 4PJGE 4PJBF 1KTLB 2YA2A 1BM3L 2DLTA 5GXBB 2X4UA 2VXQH 4ETQB 4KQ4H 4OLVH 5IK3A 1DUYA 5IF0B 3PQYD 1NCNA 2H41A 3MBXH 3ALPA 4JEGB 4JO4L 1HSBB 1T0NB 4JVWA 1NC2B 4Z78B 4PJBE 4LK4A 2EDNA 5CUSL 3RVTD 3MROA 1OP9A 3S34L 3PF2A 4X8XA 1BJ1H 5IHBA 3IT8D 4L29A 1ZA3B 1JNHA 1MFEL 4R4NC 4Y4HB 4WY7L 3T0EC 3RWFA 4HZAA 1YEKH 2B1HH 3PHSA 4KDWA 4E42A 3WNNA 5C70A 1R24A 4JVPA 3ZTNH 1RHFA 4MQSB 1HEZA 2EDBA 1EA9C 4TTDC 4NQEB 3KPRA 5H94B 1F11A 4KRPB 2FJGB 3OAYH 3CFEB 5FK9B 5I8OL 4ODVH 2FHFA 4UB0H 4Y0GA 2HRPL 3MRPA 3MLZL 2CDFA 5D7LE 4JFYB 1RMFH 4DUXA 5T3XL 1N2RA 2HTKC 4PYGA 5SWZD 3QUZC 5EO0B 2Y23A 3BP5A 5EZOL 1HI6B 4DGYH 1LE9A 3J7HA 2NX5D 2UUDK 4TSCH 2NR6C 1MCQA 2P49B 1FORL 2GUOB 3O3DA 3WXVH 1NAKH 3RHWK 4OT1H 3K2MC 3CLEL 3X14B 4MD0B 3W39B 5E4EC 3O2DH 3GI9L 1K4CA 3QDGD 5FUCC 1SY6H 2OL3L 3ES6B 4I18B 1ZOXA 2LAGB 3RVUD 4ELME 3CD4A 3G9VA 4P4RB 1EFQA 4CVUA 2C7UA 5HSFA 1PSKH 5I6XC 5MHSD 3MZGB 1I9IL 1CR9H 2D7OA 2RAMA 3E1F1 3RZWA 1QO3A 5DUPL 1LO3L 4F7EB 2MKLC 2HFEB 4JZNA 5DEFB 4RGNB 1I7ZA 4X4ZA 1MJ7L 5MEPA 4NO0A 1YN6A 5KS9F 3O4OB 1IKNC 4NN7C 2DWDB 5D1XA 3LZFL 4HDIB 4U1SA 4KMLB 5IVXB 3TYFB 3SDYH 3TJHD 5CILH 1U42A 5E6IA 1DEEB 1Q9LA 1R5WB 1IARB 3ZSTA 1EAPA 2VXUL 1BREA 4I77H 1KLUA 1UM4H 4WU5B 4KC3B 3RY5A 3UTQA 4ZUVA 1IFHL 4JHAL 1UH3A 1MNUL 1L0XA 4M6OH 3TN0D 3CK0H 2R29H 3GMPA 1TNNA 2H9GB 1ES0B 4PJFB 5F7WC 4Z7UA 2YKLH 5JHLH 1LK2A 5LGHH 4I13B 1ONQB 2HVKB 2DM7A 4GKNB 4KTEL 3CZJA 1CFVH 4BSVA 3HAEB 2YPKA 1BFVH 1PG7X 2XZCH 3DXAA 1BAFH 3ZKQD 3DARA 1UZ6F 1VGKB 4JDTH 4RNRB 4PUBH 3VG9C 3LB6D 3BE1L 3HHRB 4ZFOB 4I2XE 1U95B 2VQTA 1RJYB 1YJDC 3RVVC 1W72L 5GS1A 3JV4A 5DC9B 1JPTH 1RJCA 3JWDH 3JWNC 3TA3C 3FO0L 2E7LA 1FVEB 4PJ8C 1JNLL 2GK0B 4PV9A 5JW5B 3N1FC 1A22B 2QHRL 4LHUA 3WFHB 4MA8H 2DQDH 2AJVH 5B38G 3CJJA 2FR4A 4F9PC 1MY5A 3BHBA 5E8OA 3C2SA 4M62L 1D3CA 3V5HB 3QUMA 4PB0L 5DSCA 2Q87A 1HQ4B 1DLHB 1B6UA 4F3FA 1PD6A 2CDGA 5EFIB 3P4MB 1S9VA 4DZBB 3OR6B 2OZ4A 4L8SA 4O02L 2NLJA 3PWUA 3BSZL 2A6DB 3F7QA 3RY4A 2Z93A 2WWMD 4NCC2 4XC1H 4JFPA 2ZOKB 4ZXBA 3LS4L 1FZJB 2WMPA 4UUJB 4ONHA 2FO4B 2A9NH 3VFWA 3TNNA 2JKXA 3FN3A 2ZZUT 1VGEH 3BN3B 4AH2A 5I1AB 2HFFA 2DMCA 3AMLA 3QFJA 3CX5J 1CVSC 4EBQH 1ADQA 3MLTA 2ITDB 2EYSB 5FYJD 4TUKH 1N59B 4F2MA 3RFZC 2DICA 1RI8A 4JFEB 2F5BL 2GTZB 1OT2A 5CWSB 1F6FB 4XPTL 1QRNB 2J2ZA 4QF1B 4FQCL 4Y4FA 1EHLH 4OZFH 3D39D 1I7UA 2EO9A 4MNGA 3TJEH 2Z92B 1E6JH 4NOFA 5E9DD 4KKAD 1KCRL 2WUBH 1OSPL 5GISH 4XP1L 3O6LL 1VSCA 5IQ7L 1EPFA 3CFBA 4YXKH 1ZLVH 4HIEA 4KZDH 2VZOA 2VISB 4HMDA 5CSGA 1A6WH 4ZFGL 4DGVH 1E6OL 4K2UH 3VXMD 3RVUC 2BVQA 2R0WH 2DLFH 3W11D 3MJ9A 2FBOJ 1XCTA 4N1HB 1NFIB 4F57H 2VLRB 5DA0B 4LCCC 1D5MA 5FCSH 5AYUH 3ULUC 3MRNA 3KXFA 5KSBB 2IFFH 5EIIA 4YZFF 1HH6A 1CFBA 4TTGA 4L5FL 4RIRB 5LCVL 1VENA 4WCYL 1AQDA 4Q74A 4WDIA 1KELL 4WNQB 3K1DA 1Q9OA 1TENA 5CEZD 3LEXA 3C8KA 3IFOB 2I60L 4QO1A 4MJ4A 3VXRE 3WD5L 1C16A 3TBWA 1UKQA 5GRJL 4ISVA 3M8OL 4HUNB 3I50H 4L3EA 1QR1B 4MQ7A 1XF4B 2DBLH 4NNYA 1UZ8B 1X7QB 4YZFE 1U91A 3TJHC 3U9UB 1KB9J 1G7MB 4ONFL 1BGXL 1U8IA 1JHLL 3SDAC 1M1SA 4GOSA 4XAWL 4LGRB 4YHOL 4ZSOE 4EI6B 4HULB 3TN0C 2D7QA 2MHAB 3HE6C 3WFDH 4PLJD 1BVZA 4Y89A 1LEGA 1KXTB 1XGPA 3T4YB 3HC4L 2FDBP 2E9WA 1Q94B 1D5XB 3HC0B 2NY2B 3U4EA 3GJEB 1QFWI 5J3HD 4X4XA 4M1CC 4CADB 5L2JA 4LCWB 2EEAA 3V6ZB 2IJ0C 5DJ6A 3QUZA 4ZAKB 3VXUB 5FOBA 3WL9A 2X4QB 3LB6C 5HI5D 3BP7A 2J1KA 1F42A 3QWOA 2N7BA 1EXUB 1F4YH 3L6FA 4M1DL 2DMKA 2F19H 1A2YA 3D2UD 4WI2A 2E5EA 3PHOA 5JO5B 4XGZA 3SDDB 2AV1B 3SDCC 5BOZG 3OKLA 3NIFF 5BW7C 1RUQL 1KJ2B 2P8LA 3RIFF 3VCLB 3E2HB 1VEOA 4YDIL 4KRPD 1FN4A 3MV8A 3K74B 1AD0B 1BPVA 4JPKL 1PDKA 2WBKA 3KYOB 3VXSA 5EU7C 2JJTC 3JTTA 4HT1L 4B7LA 3L5XL 1QLRB 4QLRA 4N0UE 3GKWH 4QRSB 1TJIH 3VG0L 5SX5K 4L4JA 4JO3L 3VFPA 3V95A 4ZOAA 2I5YL 3DYOA 3CFDA 3NIFE 4KKBD 5HDLA 1AFVH 1JPFA 2W1NA 1D6VL 1I8KA 4WO4D 4RZCB 3KYKH 3RIAF 1EBPA 3V0VA 4JAMA 3LQAH 1JNNH 2M26A 4MQXD 2WWMC 2RB8A 3BPCA 2K3TA 3KLSA 1WICA 2OJZH 3KPMB 1FSKB 3U0PB 2ZUVA 8FABA 3QZWG 4ALAL 1NGZB 3EOAA 4JG1H 4R2GB 5IEHB 1MCSA 4JRYD 4K3HA 4G42B 4W6XB 3WS3A 3NCYP 3UBXG 2DD8L 4JHBA 2BVYA 5EUKB 1LMKA 2ZKHH 35C8H 4GBXB 3VD7A 4JKKA 1C7SA 3C5ZD 3EW3B 1AO7E 1YYLL 4FTVB 4ZNEE 4RGND 4PRNB 4Z7QF 4BH7B 3S36H 5KVEL 3BAEH 3P9WB 3BN9D 4PJEB 1XF2B 4LNVA 4G3YL 1QHOA 2ARJQ 3TBTA 5DURB 3DVGB 3BKYH 5DRNB 1XGYH 4ZFFB 4M93C 3VXNB 3OL2A 3RNKA 4MMXC 4JB9H 5TH2B 3PP3K 1KB5B 4G8GA 3G5YA 3HZYA 3L3GA 2P8PB 2GAZA 3L3JB 4QOKB 4X9FA 4Z7QE 3QNZB 3OF6A 5EBMA 4DK3A 3BGMA 4PJ8A 2VWEE 2EDTA 4KKAC 2VAAA 4QXUH 4U1JB 5FUOL 5CEXA 4XCYA 4LOUC 1JGDA 1BJ8A 2VLKB 1YEKL 3ECBA 4ZTPH 3VGHA 1MI5B 1Q9KB 5TDPA 3ZTNL 1HH9B 1A9BA 5DRZB 3BQUA 5T3ZE 1U8LB 3W11C 2AGJH 5FF6B 5TE7L 1JGEA 2J8UB 2C3VB 2NNAB 4Q9RH 2LTQB 2O61B 2W9EH 4ODVL 1NEZA 3UYPA 4PY8I 4UB0L 1N3NA 2A0LD 2AEIT 5AD0B 4JRXE 5F1SA 3I6GA 4M48H 1RMFL 3N1GC 3PQYA 1OP3H 1RK1B 4HH8A 1T03H 2PW2B 3HMWH 3RX8A 2V5YA 4XPBH 2HVJB 2IBGA 3GK8H 5C9KA 1A7PH 1TVDA 3OX8B 3MYZA 4DGYL 3QHFL 4TSCL 3DIFB 3D69B 4HXAH 5SX4H 3WXVL 1NAKL 3FB8A 1VFBA 3OG6B 3DVNB 3VXOB 2E7CA 4OT1L 1EFXB 4LLYA 1CICC 4K7PH 3O2DL 3CCHB 1SY6L 1WTGT 1BIHA 4IMLA 1SYSA 4RFEB 4M8QB 4X6EB 1HHIB 1JUFA 1YMME 3HN3A 1T83C 4MAYA 4GG6A 3TNMA 3DYMA 2D7PA 3K2UH 4N0CD 1INEH 4UU9B 2O5YH 1PSKL 1TVBA 2IH3A 4P9HH 2RJMA 5DGQA 4X99B 1HQRA 3ZLQC 1J8KA 1DL7L 3MACH 3S5LG 4YHKH 2FYYA 1FL3B 5J3HC 3WFEH 5FHAH 5SWZA 2F53D 2BOBB 1MVFA 4OCSH 4PTTB 3C6SA 5DQDH 3W5NA 3CNKA 2NX5A 5HI5C 4Y4HC 4UDUA 5CILL 5IB2A 3MA7B 4JQVC 2Z91B 3EGSB 4HIJA 2JK5B 3T0AA 2R0KH 2YC1A 3QDGA 2D03H 1CDUA 1UM4L 1ZS8A 1CLCA 4HFWB 1RZ7H 4KRPC 1N7MH 4M6OL 4HKBA 3CK0L 3HR5B 4XCEA 4MVBC 1H15A 4KROD 1KYOJ 2AEWA 5E2WH 4Q6YA 2VLLA 4OKDA 5DQ9A 3KPNB 1U8PA 3QUKB 2YKLL 5DT1H 4ZOBA 5LGHL 4YAQA 3WIIL 1TQCB 1LO0H 2W0FB 2IMMA 1KLFA 5IOPA 4KKBC 1BFVL 4HKXA 4PP1D 2XZCL 1JHKH 1RULL 3M1BB 1PZUB 3SKUD 1A1MA 3GMMA 5I8EB 4LQFH 2FIRT 4JDTL 1VPOH 4PUBL 1CL7I 3G5VB 5IVNA 3LV3B 3ILQC 5FV1L 1E4XI 1X6NA 4H26B 3WUZA 1JPTL 4QXTB 5C8JB 1JV5B 1GC1L 3WHXA 1JRHI 1N0XH 3PDDA 1CF8L 1NGYA 4I18C 5CGYC 3FFCD 3I2CH 1BIIB 2VZ3A 5KVDL 1TETH 4J23A 2PYEB 3S3PA 2VTFA 4M5YH 2EYRB 4O51B 2Y06L 3DI3B 4LARH 4FFZH 2FBJL 2WBJB 1WAAA 3BXNB 4U1HA 4XBGB 5DJAA 2YPLD 1T21A 2AJVL 4PRDA 3RGHA 5BV7L 2VUYA 1IAKB 1OGAE 3BKCH 3H9SA 3QIWD 2YMXL 4LU5H 5GS2H 2DI8A 2GI7A 3O6FC 4RGNC 5FECB 4D0BA 3IU3A 5L88H 3TIEA 3RZCD 3BN9C 5FO8B 4W4OA 3O4OC 3VFTB 2IEPA 3F7PC 3BP6A 3SDXF 4WUKH 3GIVA 4Y88A 4XC1L 4HG4K 4U4BA 3LN4B 5D2LA 2Y1VA 5F1IB 1CT8A 1UB5A 4WW2F 2IF7A 3QXDA 1FJ1B 3DJ9A 2A9NL 4OCWH 3K7UA 4ZTOH 3MLYH 3OAYK 2V2WA 1VGEL 3SDXE 2VO5A 3F7YB 1QFWH 1CDGA 5AG9A 1XGUA 4WV1B 4EBQL 5I0ZA 2JJTA 3KLAA 4ZFZA 1BLNA 1DR9A 2NY2D 3CZFA 5D5MF 4LCWD 4OUOA 2FB4H 5FKPA 2UY7A 1UJ3B 4Q58C 4ZAKD 5BO1H 3VXUD 5CMAA 4XCFL 3HG1B 1T4KB 4Y5YA 4M5ZH 5MEQB 1IGCL 2Z4QA 2A0LC 3MFFB 2R1XB 1LP9F 2CD0A 1EHLL 5DK0A 4HS3B 5KN5A 3TJEL 4I4WA 5JR1L 3N85H 4MJ5A 3SDDD 5D5ME 1X5AA 4NJ9H 1ZHNA 2Q3AA 4HK3N 5I76A 5GISL 3TP4A 2F15A 5BRZE 3R0NA 3MLSH 5IG7A 1H3GA 1KT2A 4IHOB 1ZLWH 4KZDL 1LP9E 3HA0A 1UQSB 3EHBC 4B41A 3QQ9D 5IHUH 4DGVL 2M1KA 4WEBL 4K2UL 1MIMH 2R0WL 3G5XA 1QSFE 3V5KA 5JW4Q 5I1IH 2DLFL 1T89C 3LKRA 3B5TA 3N0PB 2VIRB 4GLRH 3WBDA 4DWHA 4F57L 3SCMD 5EZJB 3VFRA 1KIRA 1JWUA 5DDHB 5AYUL 5E1AB 5EORL 2IFFL 1HKFA 3DRTB 1N8ZA 1UC6A 2QQNH 3AREA 5D2NE 5JLZA 3LVEA 3D39A 3WIHL 2E8YA 3WXWH 1T5WB 5HGGS 3QJFB 1BQSA 1T80A 3S35H 4KI1A 3LIZL 2W0KA 5HGAB 5IVZB 3RGVB 2DQIH 4IBLT 5E9DA 1M6OA 2DBLL 4JFOA 5SWSE 2VZSA 2ATPB 5FA3A 1XIWB 3K4AA 5FYKU 2B39A 4Q0XH 4XTRD 3G6AA 4JN1L 3JTSB 4Y19E 5GHWH 4GBXD 4XBPB 4Z7VB 3QH3A 3U1SH 5GRZA 3TIDB 4FTVD 3VXMA 5GSRB 1BEYH 3LRSB 2EIZA 5FGCE 3DBXA 5D93C 3PV7A 4A2MA 1NANH 3WFDL 5DURD 5K93A 2DIJA 1RVFH 5HYSG 4KY1H 4R7NA 3RNQA 2WM0A 3F7RA 2GSIA 5EUOF 1I3VA 1NMBH 2HLAB 5H35B 4PP1C 4QOKD 4XWGL 3WJLC 4MA7H 4XNYH 3BD4A 4FMFA 5KSAB 1T6VN 1UYWH 3DX6A 4A6YA 1B3JA 4HKJA 2LU7A 2P5EE 1F4YL 2VLKD 1MFNA 3T1FB 3ZE0E 1NCBH 1MI5D 2UZIH 4YR6B 5E8NA 5EUOE 5HHOB 3BD5A 5F8RC 3V7MA 1ULVA 4OQTH 4P46B 1MWAH 2BRRH 4N8PA 4IOFD 2R2CA 3V52H 1T83A 4WHDA 1WLHA 3IF1A 3QI9B 4NRXB 2J88H 1BQUA 4OLUH 4ETQA 3AS0A 1F3JB 3IB4A 2ZSVA 4NBYB 3GRWA 5IF0A 4POZD 4LLAA 2QQLH 4QEGA 4HV8B 5ECJE 2VDQL 5F7KC 4G8IB 1HSBA 1JN6B 1T0NA 4Z78A 1XMWA 2DN7A 1AHWB 4X80L 3KYKL 3OKNB 4GW5A 3LQAL 2AK4E 4C58B 3QG7H 1EFXD 4HPYL 3EDEA 1MQKH 1OTUD 5C07D 1BVKB 32C2B 3IJHB 1N6UA 3D2UA 1C7TA 5I73B 1BOGB 4R8WL 4GW4B 5H94A 4S1QH 4RSVA 3MRMA 3CFEA 5FK9A 3VXPA 2XN9B 1ZLUK 2MJWA 4OTXH 4TVPH 1IQDB 5SV3A 2JJVA 4MNQE 3MUY1 4JFYA 2NY2C 4APQD 3EOBB 5GRXG 1YA5A 3KS0H 3GBNH 2XZZA 5I1DB 4ZAKC 3PNWB 4D0DB 4CW1B 2FEEI 2V7NB 1SEQL 1HI6A 3C9NB 3BKYL 1XGYL 2VR4A 1OSZB 1H3WM 2VQ1B 4YDVA 4WO4A 3MV7E 2VZ1A 4JB9L 1MCHA 4N5EC 5JQ6H 5JW4M 4RBPH 3X14A 3W39A 1J05B 2I07A 4GMTH 5I18H 2QV2A 2OXGA 4KI5D 3FQRB 4YHPB 3ULSB 1OAYH 3SDDC 2VDPH 2W65B 4NO2B 5MENE 2UYLB 3QWRD 2ENYA 3E2HC 1HYSD 4QXUL 3OJ2C 5IP4A 4P4RA 4JRYA 2X4RB 3BIAX 1NBZB 4M7LH 3BZ4B 4ZTPL 1U8NB 1RZ8A 4LPTA 1RU9H 2M8XA 1S7WB 4UBDD 2X9WA 3HNSH 3QQ9C 3MYJA 4ZUTB 4PRHA 3MGOA 4RISL 3RWIB 1CL7H 2DMBA 3C5ZA 2HFEA 4OI9A 1I7RB 5TDOB 1JE6A 1MJ8H 4ZO6A 5D1ZB 1D6EB 4JQIH 5BZDB 2A6IA 1CXIA 2DWDA 2IC2A 4MXQD 2NY0B 5IVXA 3VDAA 1NGWA 3IDUA 2P5WD 4CMMB 1T03L 3I3DA 1DEEA 5GIRB 3HMWL 2GQHA 1VERA 1FSKC 1A7PL 1I85C 4KKLD 2XNAB 1N4XL 1FCCA 1N26A 3NFNB 2I27N 1X5JA 2PYED 4R2GC 4WU5A 1OVZA 2R1WB 3FQTB 2WUCL 5IMKA 1WZLA 4P4KD 3LPFA 1GGIL 3MMEB 3AU1A 4XTRC 5C71A 4K7PL 5HYEA 1NFKA 2H9GA 1FNEA 1ES0A 3EDDA 4OUUB 4GBXC 3ZDXF 4LBEB 5HHMB 4ONOA 3ZDZF 4C56B 1ONQA 4WTZA 4PJAA 4OZGF 3C5JA 5DJDB 4MA3A 4NQDB 4DCQB 2GTWB 1MUJB 3FT2A 2F54B 1INEL 4QGTA 2O5YL 2F9BT 1VGKA 4AENB 3WN5B 1FLTX 4RNRA 5CIPB 4U7MA 3WDIA 4LRNH 1KC5H 2XWJB 4YHKL 2P48B 4RMWA 2O5ZH 1RJYA 4LKCB 3WFEL 1KIUA 2B4CL 3J8F7 5D6CB 2Q8BH 1U8JA 3ZDZE 5FHAL 5IB1B 4OI7A 1HXYB 4O2EB 4OCSL 3W0WB 3CX2A 5DQDL 1FVEA 3VFOA 4PRAA 2N1KA 5K9KB 3I84A 2K7QA 4O2CB 1F45A 4MJIB 1T2XA 4RAVB 5J13B 5JW5A 2IQ9H 1IAII 3C6LB 4ZPTB 1M7DB 2CJUH 1WUNT 4KHXH 5D7IB 2MTPA 3WFHA 3O41A 1XGTB 2PW1A 1FZKB 3MLVL 2R0KL 4PB9H 1FG2B 2NTFB 4V1DE 1N7ML 4YX2H 4IOFC 3D25B 3HG1D 1HQ4A 1DLHA 2LTQC 3ARTA 3MCG1 4YFEA 5EFIA 3CFJB 3P4MA 5E2WL 1HNFA 3OR6A 4PD4J 5DT1L 4CDGC 4NZTL 1MCCA 2A6DA 1LO0L 3OPZH 5T3ZH 4HHAB 1FRGH 1JHKL 1I1YB 2BHUA 4FQQA 3X12B 4JCLA 4EDXB 2F53A 4Z0XA 4LQFL 4UUJA 3QIUC 2FO4A 3SJVB 4Z7WF 4WI8A 3LKOA 4ONGH 2XQBL 5CINH 5DR5H 5I1AA 2EDOA 4F7PB 4WUUB 1X5ZA 1N6VA 2IQAA 5DUML 2ESVB 4IMKC 4UIKH 3I2CL 1S78C 2ITDA 5L8JB 5C0BB 2EYSA 2WNGA 5T5NF 4OZFA 3U4AA 3X17A 1BF8A 4XPHH 2UWEB 4LARL 2EH7L 1PKQA 4I8DA 4S1DC 4LHUG 4Z7WE 5CWSA 2EC9U 4N8VG 2YRZA 3BKCL 4LU5L 2HJKA 3VJ6A 3PL6B 2P8MB 3MV9D 1ED3B 4BZ2H 2ADFH 1T1ZB 5JZ7D 5JTWA 3RGVD 2XWBA 4WUKL 4QRPB 4KUZH 5F1NB 5ANME 1ZT1A 1IZKA 2Y7QB 1A4JB 2QKIB 3L3KB 4DJMA 1WISA 2VISA 1BBJB 3QEHB 4P48A 3BRGC 4HH9B 3BFOA 1IGYB 5DJ8B 2Q7YB 4MHHI 3FFCA 3MLYL 1VADB 2GW5A 1M4KA 4IDLA 3TT3H 3QDME 2YPLA 4UBDC 4WI4A 1WBYB 3Q5OA 1TVHB 5GGVH 1OP3K 1TQCC 3QIWA 1J7VR 4PJDF 4Z8FH 1EMTH 5EU4B 5BQ7B 2FB4L 4WNQA 1AI1H 2OR7A 5BO1L 2CGRH 4YFLF 3RZCA 4M5ZL 5I1KH 2R2HA 3QBTB 1QR1A 3B6SB 4MXQC 5LVEA 3ZKSD 1UZ8A 1X7QA 3L1OH 2ZJSH 2N56A 3VGFA 1EUTA 2EE6A 4KHTH 4CBPA 3N85L 4PJDE 4KKLC 5DK3A 2OLDA 3MRDB 5J1TC 3U48A 4P46D 1MELA 4NJ9L 1EHNA 3GMNB 4E41B 2DKUA 2F5AH 3V4VH 5TQ0H 4EI6A 1K9TA 1R3LA 3MLSL 4JPVL 2WBJC 2MHAA 4HEME 5IHUL 2IALB 4OZ4B 3T4YA 5IB4B 1A6AB 1MIML 1D5XA 5I1IL 5ALCL 4PS4H 5DYOB 3HC0A 4CNIB 1JI2A 3IDGB 1KENH 2CKNA 2DLHA 3GJEA 2X44D 3MRCB 1ODAA 4CADA 4Q2ZB 3QHZH 4KAQH 1BFSA 1S7QB 1MREH 4URTB 4ZAKA 3VXUA 4JFFD 4N9GB 1SJEB 2QQNL 1EXUA 4K71B 2BVEA 2DQEH 4KDTA 2X4SB 3OHXB 4P2RE 4R4BA 3S35L 5DJCB 5BV7B 4LEOB 3SDDA 1G0YR 3U82B 1OW0A 1SM3H 1AGDA 4GQ9H 4XMKH 1MLBB 2VLME 4QHLB 1V3LA 1AD0A 2OSLA 2XN9D 4XP6H 4DAGL 4WW1B 3DURB 3KYOA 3BD3A 4YDJA 4WV1C 5FYKD 2QSQA 3U7YH 4HWNA 1ORSB 3BWUC 4H1LB 4LPCA 1I7TA 4QRSA 3B9VA 5ITFB 2H45A 2VDOH 4Z76B 3MRBB 2IMNA 1F90L 4M00A 1UJ3C 3HE7B 3QDJB 1UM6H 2ICEB 5GSVB 1ZAGA 4EZMA 3MRLB 5E2UL 3EDJA 3WUWG 4KZEH 1QBAA 1NCCH 3SCMA 3U9PH 1RVFL 3S96B 3BRDA 4KY1L 4JGUA 4RZCA 5L8KB 3FMGL 1G1YA 1DLFH 4FRWA 2EICA 1NMBL 4JANB 3UXFA 3CC5B 4FZ8H 4M8VA 1KIQB 1LDPH 4RMTA 3A6BL 3H7BA 4PJXB 1DFBL 1PKOA 3KPMA 1I85A 3WLBA 4PG9B 4XNYL 1NGZA 1UYWL 4P3DB 3DX9A 1JJUA 3UDWC 1R3IH 1NCBL 1I4FA 2UZIL 5EOQL 5GGUB 3FO2A 1JMXA 4GBXA 4OQ1A 3UTZB 1J18A 3CU1A 4KGJA 4RMUA 4FTVA 2BRRL 1IEHA 2B5IB 5EO1B 4PRNA 4UMGA 1S7VB 1FGNH 3V52L 4BH7A 5D1ZD 3V0WH 3HRPA 1DQLH 4PJEA 2J88L 2NY5H 3IKCB 3MCKB 4LKXB 1GJIA 3DVGA 5DRNA 1B0GB 4ZFFA 2NY0D 5DJ2B 3VXNA 1H3PH 3NACL 4G6AC 3KPRE 2HG5A 1GXEA 5TH2A 4N90D 1R3KB 4XH2A 3W5MA 2BSSB 1BQHB 1ZEAL 4X5XB 4U1NB 1R5IB 3EO0B 2CRMA 4QOKA 5JZ7C 3RGVC 4IRSA 3QNZA 2CR3A 2XA3A 3STZB 3K4DA 1CFTB 5L2KA 4M7ZB 5IIEA 1XIWC 1AGEA 3F12A 4UNTA 4ZODA 1MQKL 3ZE2E 4AEIH 2VZUA 2VLKA 2ZCHH 1MI5A 4N68A 1Q9KA 5HHMD 4GS7B 2DQJH 4C56D 1JPGB 2VLJB 3CAFA 5DRZA 3VGAB 2IAMB 1T0MB 4NQDD 4OGXH 2HJLB 1T1YA 5IVOA 2F54D 5FF6A 2PR4H 2J8UA 3I6LD 5T1MB 3NA4A 1I9JH 1X5XA 3P9MB 4X6CE 3SGEI 3TESA 3N9GL 2O61A 2LVEA 1JNJA 4PJCB 4OTXL 2AXFB 2RFXB 4ZD3H 5AD0A 3SE3C 4IS6B 1RK1A 5CSBA 1MCOH 3MR9B 3GBNL 5IBLC 4ZS6D 1NFDA 4XVTL 4S10A 3OX8A 2W9LA 1IAIH 4NO3B 5KSAC 3DIFA 1C5DB 1XAUA 1BZ7B 3D69A 4FG6D 4LL9A 1OP5K 3EYOA 5J0BA 3CPLB 4PGJA 3MC0A 5EBWA 3DVNA 3VXOA 1EFXA 4EI5B 5C07A 1JTPA 1OAYL 2D31A 3CCHA 3TF7C 4ZPVB 2BNUA 4P46C 4IMKA 4M8QA 1ITCA 4X6EA 3S8WA 2ZPKH 2WINB 3LKSA 1WZMA 4NN6B 1T1XA 3IGAA 3QI9C 4Z7UF 3SKNB 2H1PL 4CJ1A 4M7LL 1RU9L 3P9LB 4X99A 5FYLE 3ZTJH 1U8KB 4S1SH 3RPIA 1EHXA 3MJ7A 3GHEH 1CL7L 1K8IB 4U05A 1L0YA 3TGXA 1RZGA 4APQA 3IFNH 2LU3A 4OI8A 3M45A 2YA0A 4PTTA 4DVBB 3ULVF 4FFYH 3MO1B 4Z7UE 1MFDH 2GJ6B 3W9DA 1JTTA 4TN9A 5D72H 4EUPH 1U6AH 2AJ3B 3MA7A 4HIIB 4B53A 1D9KC 2X4NB 1FIGH 2Z91A 2GEEA 3EGSA 3O6KL 3DXAE 2YUXA 3I02B 4MMZC 1UG9A 2ESVD 3QG6B 4DFIA 5I73C 3ROOB 2XWTA 5C0BD 2DL9A 3LKNB 1M71A 2YEZB 3QWRA 3R1GH 3JBG7 4HFWA 3ULVE 1TJGH 1A4KB 3HR5A 3LDBB 1CG9A 4JKWA 2QADB 3VGDA 1AIFB 4EDWH 3KPNA 3I6KB 3RWGA 5IMLB 3T09A 3HCVB 2AJZB 2AABH 4P49A 4QT5B 1O5DT 2Q7NA 1J1OH 4YHYB 2W0FA 3NA9H 4TNVK 2D4FA 2FGWH 3FB7A 3M1BA 5I30H 4M1GH 4X9BA 2FSEB 4MDIA 2DM4A 2GYSA 4BFEA 3G5VA 1BFOB 1EGJH 4LRNL 1KC5L 2ZWLT 3UO1H 1WWAX 2NW2A 4EXPX 1PZ5B 12E8H 1X5GA 3D1MC 4KVNH 2DL2A 1EAJA 4H26A 5A3ID 4MXWH 3KR3H 2P5WA 2Q8BL 5C8JA 1JV5A 3REVB 2BSTB 3DV6B 1QA9B 3KPQB 1JZ7A 2HP4A 3UPAA 4FFVD 2PYEA 3JV6B 4NRYA 4LAJH 4P4KA 3TFKD 2IQ9L 5LXGH 4AEHH 1ZXQA 1DBMH 4XBGA 2CJUL 1DDHA 2DDQH 1V3JA 4KHXL 1YMHB 4XC3H 1S9XB 3ARPA 4PB9L 2CUIA 1FNSH 4WTXA 1BJMA 1F58H 1KXQE 3W2DH 3HZMB 4YX2L 5FECA 1NPUA 5AEAA 3QPXH 3UJTH 5FO8A 3M17B 3VFTA 5A16B 1AGFA 1YQVL 3MUHL 2NY0C 3RHWF 4LSDA 2BVOA 5LKNA 3OPZL 1GGCH 3SE9H 4Y16B 4KRLB 3T8XB 5T3ZL 1BOYA 3LN4A 4NQUA 1NKOA 1RUKH 1X5LA 3LN5B 5F1IA 2A1WH 4NRZA 1YECH 1JGLH 3HC3L 1G7LA 1FJ1A 4E41D 2IGFH 4OCLC 2XG5A 1MAJA 2C4FU 1NBVL 4LP5A 3UJIL 4MNGE 5CINL 4DUWA 3U6RA 5F93C 1XGQB 2BMKB 3OGCA 4Y8AA 4OD2B 2C26A 5F8QC 3WNLA 5HI3D 3RWDB 2J3SA 4UIKL 4XX1E 3CSGA 2FJFB 5JPNB 1FFQA 4XPHL 5ICZB 3P4NB 4OBSA 3GSWB 5FFLA 3HG1A 2B1AL 1T4KA 4ZDHB 3OKDB 3WN5C 5C0FB 3O2VH 3MFFA 5F7NC 5IW1B 2R1XA 4YDLB 4GAGH 4J1UA 4D8PA 4XB7A 4FABH 4UT6L 3KXFE 5T33H 4HUWB 5I8CB 2BZDA 3QWQB 4KUZL 1JGVH 4OBRA 4FG6C 1C12B 5J13C 3C6LC 1YN7B 1WCBA 3DGCR 1NCAH 2IAND 1A6PA 1UQSA 3G04A 4L3EE 2FX9H 4Z5RB 1GGUA 4KMTH 3KJ4C 4OCYH 3HE7D 4YHNA 3QDJD 1BQLH 5JDSA 4HG4J 1QFOA 2CLRA 5HYQB 4PJGB 4U1GC 3QAZB 5BMFH 5EZJA 3OKEB 4JN2A 3U46B 5E1AA 4QXWA 5AAWA 5C0EA 3Q3GB 1XH3B 4DKFH 1FGVL 2V5SA 3DRTA 5GGVL 3FONB 1MFCL 3LH2H 5J1SC 2LQRA 4Z8FL 2ZSWB 1EMTL 4M4RA 1Z9LA 2HA1A 4PJ7B 4OLYH 3S3JA 2DQCH 3MV9A 3RIFK 3P77B 3RRQA 1T5WA 4GRLB 4JY6B 5I1KL 5HGAA 4XNXH 2VR9A 3OB8A 5FGBA 1MCPH 3QQ4B 3MRQA 4P2YA 3L1OL 1CGXA 3GSXB 5DJ0B 5CSZA 1SYVB 4EQ3A 3UTSE 2HRLA 3O9WB 4KHTL 4XBPA 2OBGA 1FC2D 3TO2A 4UNVA 3V4VL 4HWBA 4N8CH 5GSRA 5C08D 4K94H 2NY1D 2OK0H 1E27A 5CKAA 3OJMB 2DS4A 2I9LB 2OJEA 5KSVB 4MB4A 4U3HA 4JDZA 2VC2H 3TVMA 3PL6C 4HSQA 4PS4L 4JZJA 3MV8E 3SE3A 2HLAA 5H35A 5D71H 1YC7A 1ZWIB 4LLWB 3VXSE 1KN2H 4R97B 4JKLA 4PFEA 5TQ2H 2QHLA 4YC2B 3OXRB 4OQTA 3VD5A 3QRFM 1YQ2A 3HRZB 1JGUL 5ESVA 5E4IA 3GSVA 2AJUL 3PJSB 5A3IC 1BF2A 2DQEL 1CDBA 2DQFA 4R0LB 3PIQB 2ADJB 2G5RA 2A6KA 2VLJD 1F8TH 2FH8A 4P46A 5DMKB 4ELMB 4GQ9L 4XMKL 3WCYA 3B43A 4ZO7A 5JOFB 4XP6L 1T20B 4NWTH 3GHBL 1WBXB 4NRXA 2HKHH 3U7YL 4YGVB 1T1WB 3PP4H 3Q5YA 4JQXC 4ZUWA 1CLOH 1GGTA 3B9EA 1FZOB 1HHHB 4HV8A 2DJ4A 4HC1A 1LHZA 1PY9A 4XP4H 4U6HB 1ZANL 4G8IA 1YEEH 5J9PA 1UM6L 3B8YA 3TO4B 1JN6A 1OAQH 3D5OF 3INUH 1NCCL 3U9PL 2Z35B 5KVGL 1AHWA 1S7XA 1CGYA 5BJTA 1A1OA 3TCXA 1PY4A 3BH9B 5C6PB 4JFFA 4HCRH 3VDBA 4EI5D 4FZ8L 1LDPL 3WFZA 1VCAA 2LAAA 3AB0C 1QPXA 1BVKA 3G5ZB 3IJHA 4J3OC 4NUGL 1VFAB 1A02N 1BX2A 1BOGA 4OCNC 4GW4A 3T2PA 4AIZB 5CHNB 1FO0H 4KK6D 1R3IL 4G8GE 4ZNCD 2XN9A 1E28B 1T04B 1PJ9A 5T1KB 1IQDA 4I0CC 3FOLB 4U6VL 3ARFA 3ARUA 3LKQB 1DE4B 4LDOB 4F7CB 1RJZA 1X5KA 4GKZA 1FGNL 1GC1C 3V0WL 1DQLL 4OLEA 4D0DA 2EEDA 3U79A 2NY5L 2V7NA 3ILPB 4FFWC 3C9NA 2PF6A 1FC1A 3AM8C 4PREB 3JWOL 4PGZA 5KW9L 1OSZA 3R8QA 5HVFB 2I9TB 4TPRH 4J8RB 2DJUA 3BZFB 3VXQA 2F8VA 4K71C 5ID1B 5CD3B 3W9EA 4YHZL 3WFBH 1J05A 4X98B 3MRHB 4L9LB 4YHPA 3RTQB 5BV7C 3ARQA 4NO2A 2UYLA 3ESVF 4NGHL 3N1QC 4PJ5D 3L3IA 4NM4H 1YY9C 4J4PD 4WWKB 5DVMA 2APVA 3ORJA 2BY0A 5CS7A 5CP3H 4K3JH 3PQYE 5GGTH 5F6IB 2X4RA 1NBZA 5F70A 2QADD 3BZ4A 2UZXB 5CD5D 2YA1A 1QFUH 1U8NA 2ZCHL 4LMQI 4GG6F 2BFVH 2KZ1B 2DQJL 1KNOB 1A14H 4U31A 1UH2A 5J1AB 5TE6H 4OGXL 3RWIA 2LU4A 4X4YB 3HE7C 1WITA 2DIAA 2NW3A 4O2FB 5EC1B 2D3VA 4I1NB 1I7RA 1I9JL 4PJHA 3B83A 5TDOA 3G9AB 1CXKA 5D1ZA 3QFDB 1D6EA 4L1DA 5EU3B 5BZDA 4UOW1 4HIXH 5DGRA 2J6EH 1Z5LB 1VHPA 3LSOA 3B9KB 4GAYB 1MFAH 1ZHLB 3OKKA 4GG6E 1NMCB 5FHBH 1MCOL 5GIRA 5ABDE 3EUUA 4NCC1 1HHJB 2VNCA 3O8XD 2A77H 2PYFB 5ICYA 2V5TA 3NFNA 1JI1A 2MPAH 2ZNWA 1UA6H 1T7ZA 2R1WA 3FQTA 3P4OB 3T2NH 3M07A 2JELH 4FQ2H 5E2VH 2YXFA 3MMEA 5TDNA 1RUAH 5SWZE 2JIXB 4HF5H 1KBGH 4OUUA 3O0RL 1NCUA 5BVPH 4LFHG 4E0RB 4GXUN 4JPIB 1LE5B 4R3SB 4YIQB 2IG2H 2NX5E 4Y5XA 2ZPKL 5DJDA 2B5IC 3D18B 1ACYH 2ED9A 4NQDA 4DCQA 1MUJA 2YD6A 2F54A 1J1XH 5C0RH 1E4KA 3G6DL 2JCCA 2QL1A 4JKPL 4CVXB 5ADPH 3QDGE 3WN5A 4AENA 5CIPA 1GZQA 4S1SL 1SVCP 2XWJA 3GHEL 4XMLH 3HMXA 4Y16D 4LKCA 1IEAB 1HCVA 4JHWH 5D6CA 1MPAL 5IB1A 3RWEB 3HI6H 1NLBH 1NUDA 4FFYL 2WANA 3RJDA 5JXED 5EU5B 1MFBH 1MFDL 3GMLA 5D72L 4M7ZC 1LILA 2V6HA 4GXVH 4O2CA 1I3GH 1U6AL 3BH8B 1XR9B 4RRPA 5C3TA 2R23B 3B5GA 4ZPTA 4F58H 1M7DA 1MJUH 3UEZA 4GS7C 5D7IA 2ZCKH 4LCUB 1XGTA 5F7EH 1GHFL 3U36B 2GCYB 3VGAC 2IAMC 1WAAF 4YWGH 3R1GL 4C54A 3U0TB 2NTFA 3SE4C 4D9QE 4HUVB 1TJGL 3D25A 5FGSA 4XCNA 5D1QA 3H0TB 2A83A 1G6RB 1MHPL 3CFJA 1OPGH 4HJ0D 3E8UH 4HUKB 1MAKA 43C9B 1MF2H 3MGTB 1NL0H 4GKOA 1B4RA 1A5FH 2AABL 4IRZH 4HAFA 1J1OL 4NFDA 1PX3A 3NA9L 4ELKB 4ZYKB 2V2TA 1WAAE 4RGMB 1I1YA 3X12A 2FGWL 5I30L 1FYTD 2I25N 2FD6H 1JHTB 1NBYB 3VXRB 15C8H 4GXUM 3H9SE 2X9XA 1D5IL 1U3YA 5D2LF 3FJTA 4BK5A 2ARWA 2A38A 5HYIA 12E8L 1F3DJ 4KVNL 2W91A 5GRUH 4EI5C 4F7PA 3MRFB 3P30H 4JDVB 4GO6B 4EXKA 5FB8B 9CGTA 3F58H 1I8IB 3ZHLA 5C0BA 3L7FA 4NN6C 3QIBB 1TXKA 2CMRH 2UWEA 4LLQB 4PV8B 4ZSOB 5D2LE 4QRUB 5IJVB 5LXGL 1DP0A 4AEHL 1CYGA 4XC3L 3DROB 4NPYB 1FH5H 1Z0MA 4IDJH 2YUVA 3VH8B 1HILA 4MJ2A 4HUUA 3T77A 1F58L 4C55A 5ADOH 3BT2H 3KPSB 1WT5A 4GRLD 3DLQR 2XFXA 3UJTL 1F02I 2ZUTA 2E7BA 2BSRA 4M3JA 5FYLH 4ERSH 4G7YL 1UVQB 4Q97A 4J7RA 4O4YH 1GGCL 2L0DA 5HI4C 2Y7QA 1A4JA 2W9DH 3O9WD 3L3KA 3GUTB 3PGCB 2KH2B 1RUKL 4P5MB 2A1WL 5J6HA 1YECL 1JGLL 2C3HA 2ERJB 3ALWA 3IFLH 4WHTA 4KUCD 5C0ND 5EOTA 1Q38A 4N0YL 4J4PC 4I0KA 5SWQA 3WJJA 4OCRH 1JTOA 4HGWA 2QADC 3G6JB 5DVOA 5CD5C 1XFPA 2D7TH 1QBLL 4JQXA 3LQAC 1WBYA 4D2NA 1WTLA 4O00A 1TVHA 1ERNA 4N0UB 4OZFG 3GM8A 1A6UH 4YHYC 3C2AL 4LVHB 5BQ7A 5JA8B 3ULVH 3HLAB 1YY8B 4YJZL 2ITCB 5B22A 4HWZA 5FA4A 3I3EA 4GAGL 4OD3H 1L7TL 4ETYA 4FABL 1BQHG 3FQXB 3FT4A 2FLBT 2EXYD 2MCG1 4XZUB 5T33L 5FYJE 3FRPG 4NHUA 1J8HD 2YSSA 3EFDL 5F88A 4E41A 4C59B 4P5TB 4YHLH 5D7KD 1KTDB 2YPVH 2VDLH 4WTWA 3D39E 2J8OA 4NKIH 5IFHH 3QUMH 2VABB 1NCAL 4JY5H 1JPSH 2CLZB 4YHIB 1IGFH 1U93B 3BRFA 4GRMB 4GKSA 5IB4A 1A6AA 4KMTL 5E9DE 4LPYA 5DYOA 5ENWB 4CNIA 1BQLL 4JO1L 1UWGL 3TO4D 1LO2H 5F71A 3WEXB 5BMFL 4PGCB 2UZYB 1S7QA 2X10A 4U1KB 4BZYA 4O58H 1FFOB 1AJ7H 4YNYB 4N9GA 2ZG2A 4Y4KB 4XB8A 5HHPB 3VXME 1WQVT 3LH2L 3F6IA 4Y16C 3GB7B 3K80A 3RAJH 3BI9X 2X4SA 3KAAA 1C1EH 1C5BH 5C86A 1JL8A 1RIVL 5DJCA 3TH3T 1XF1A 2HLFD 4XNXL 4WFED 1NEUA 3D85B 4DTGH 1IAMA 1MCPL 1MCNA 4PJ9B 4QHLA 1AGCB 5ITBH 4NDMA 5T1KD 3MNVA 3BYYA 5CEZE 4UV4H 3UBXI 4AJ0A 1ORSA 5IB3B 2IANA 4H1LA 5E8PB 7FABL 5ITFA 1S7RA 3MRBA 4HZLB 2FX8H 4NIKB 4N8CL 4K94L 2E9BA 2UUDH 2L7JA 3HE7A 2OK0L 3QDJA 1IEBA 5GSVA 1IAOB 2AERT 4M7LT 3R8BB 1FFRA 2Q3ZA 2H6PA 5DMIL 3IVKA 2F58H 4HJ0C 4YDLC 1FNGB 4L4TE 2VC2L 4QHNA 4JRXB 1CD1A 2BDNH 2BNQA 2V17L 5F89B 2EE2A 2X70A 4P2OA 3RTQD 3X11A 5D71L 4PJXA 1QBMH 1KN2L 2APFA 3ETBF 4WWKD 5EU6E 4PG9A 3HZKB 1X44A 1IBGH 4P3DA 2HN7B 4NKMA 4LVNB 3MUJA 5A2JH 3DO3A 5D96B 3KVQA 4NQVB 2V9RA 4R7DB 5GGUA 3MRKB 4U1IB 3UTZA 2AVGA 4X9HA 3KWWA 2B4CC 1X3DA 1YMMB 3TEUA 3QAZC 2AI0H 4ZUUB 5C08A 4UOW0 3V9FA 1ZVYA 2HKHL 3MCKA 2XZAH 3PP4L 3T0EB 2IPTL 1CN4A 1CLOL 5DJ2A 5B38B 3B9KD 4PLNC 5DHVB 3BKJH 4J2XA 2XI9A 4XP4L 1YEEL 4GRLC 2BSSA 3INUL 25C8H 4U1NA 3EO0A 4XAKD 1T0PB 1UT9A 4NHCL 4U7SA 5F3HA 1LWRA 1CFTA 4OZIA 3MJ8A 5DO2C 2K9UA 1IC5H 3O9WC 4MJ6B 1NSNH 3V79C 2A9MH 1NAMB 3RP1A 5C0NC 4YO0B 5HGDA 1QYGL 2VLJA 2WP3O 3DNKA 3OAUL 1T0MA 3QP3A 3V6FB 3OZ9L 1FO0L 3SE4A 1U8QA 5HXMA 5T1MA 3DVIA 2GHWB 4PJCA 1JF5A 2AXFA 3NCCB 1FL5B 4I5BB 2OMBA 3L5WB 1HE7A 4Y2OA 2MSPA 5ESAB 4MS8D 2A74A 1IT9H 1KCVH 4JRYE 5T1LB 3MR9A 2CRYA 1FL6B 5IVXF 1SMAA 2WIIA 2J4WH 4R97C 2YWZA 4YC2C 5FXCH 5DMYA 5IWLA 4LF3B 4NO3A 4Z95H 4PRHE 1C5DA 1SMOA 4TPRL 1BZ7A 3CPLA 4LLMB 1CE6B 5H8DA 4H25A 4GG8B 5FM8A 3VE0B 4R0LC 4EI5A 1OB1B 3QDHA 2EXYC 1F4WH 4NKOB 1K2DA 4ZPVA 1RZKL 3UYOD 3PWPB 4YBQD 3OKOB 5C6WH 2WINA 5EZLA 4K3JL 1A47A 5DI8B 5GGTL 1PEZA 3SKNA 4KU1A 1OD7A 3H3KA 3FO9B 4BKLB 1JVKA 2YUWA 4PJAF 1A14L 4NNPH 2WP3T 2GT9B 2EDDA 4EUPA 5TE6L 5D9SB 1OGAB 4ACPA 3BKMH 4K3EL 2VXTH 3TO4C 2AV7B 5F96L 2YD8A 2Z8WC 2KZWA 1IZJA 1K85A 5ACLA 3FTGB 3MRRB 2J6EL 4PJAE 1MFAL 1Y18A 2AJ3A 4N1CA 2HTLD 2X4NA 4QCIB 3L3OB 1ZTXH 4M4PA 3TZVB 3CXDH 3QG6A 4QRTA 4Q6IB 2A77L 4OM0L 4HK0B 3TH2T 3ROOA 2VN7A 1S7SB 2HLFC 3LKNA 2YEZA 3DX8B 3QIBD 4PJ5A 1DVFD 4L8CB 1UA6L 3MA9H 4J4PA 4L3CA 2JELL 1N64H 3EOTH 5E2VL 1A4KA 1B4JH 4F33A 2O5XH 4OGYL 3WKML 1U3HD 1KBGL 4OB5H 5IHZB 5BVPL 1FDLL 1AIFA 1EGJA 5FO9A 3I6KA 1YNTB 5IMLA 2IPUK 4PRIA 3KPSD 1J87A 2AJZA 4QT5A 5GS0D 4Q9QL 2C3XA 5JXAH 5IGXH 1CQYA 2D9QB 1J1XL 1YJDH 3UAJD 1NQBA 2NY7L 2VE6B 5ADPL 4OLZH 5C0CE 1BFOA 1I3RB 5HYJB 1MCFA 2I24N 3BUYB 4XMLL 4XPFH 1QSEB 2ZCLH 2JB6A 3BZEA 1H3XA 3U7AA 3QQ3B 5KANI 5DUBB 4L9LC 1DBJH 3REVA 3RTQC 3KPQA 4EVNA 1NLBL 3O8XA 3VMNA 4E5XB 5GJSH 4WWKC 3D87B 3TPKA 1MFBL 1OTSD 3QT2A 3PGFH 1IM9B 5F6IC 1L7IH 1I3GL 1B0RB 1QRKA 1FNHA 3VA2C 3S37H 3L95A 4JG0H 4JY4B 3ARGB 2APBA 1TDQA 1LP9B 2F53E 2ZCKL 4NZRL 4XNQB 1U3ZA 5F7EL 5IB5B 3Q6GH 5I1LA 1G7QB 1XR8B 5EPMA 3HZMA 1QSFB 3T1WA 3KDMB 1WEJH 3IXTA 4NUJB 2ZG1A 2R69L 3M17A 2NXZD 1P69B 5A16A 1BBDH 3ARDC 1MF2L 1OAZH 5E56A 4X6FB 3FB6A 1NMCC 2Y07L 3BJLA 1A7QH 1PKQE 3QCUH 5CJXA 3SKMB 3T8XA 3P0VL 4X5WB 1QVOA 3QCVH 2FD6L 4PGBB 3DUSB 4PBVC 4X7EC 5JXEA 2ADIA 2G60H 4XNZB 5E2JA 4FQJH 1JIBA 3OBAA 4ODXB 5GRUL 4WI3A 2WLZA 4OSUL 4KKCD 1XGQA 2BMKA 4U6YB 4OD2A 1XF5A 4FQIH 1UEMA 1AY1H 1EEZB 2V2XA 3H9YA 3QZWB 2CMRL 3P4NA 1MEXL 1Z9MA 4EJ1C 4NYLB 4ZDHA 3IAPA 3OKDA 4PBWD 3V5DB 5C0FA 3A67H 3NTCH 1J9CT 4Y4KD 3FFCE 1TLKA 4IDJL 4GUPB 5IW1A 1FAIL 2AJSH 1CCZA 2PTUA 2XPGB 4KK9D 3BIKB 4MB5A 4MS8C 2ZG3A 3T0VA 4G8EB 3PWLB 4K3DH 2H8PB 4L8DA 5C0GB 1KSRA 5C0AB 2YPLE 1FYTA 3VW3H 3D9AH 1P7QB 4HUWA 3D85D 5I8CA 1MCJA 1OLZA 5DTFB 3ZT7A 1BVLB 5CJQH 5FYLL 4ERSL 5DD0H 1GYAA 1UWXK 5C0DB 4OCXH 3PV6B 1C12A 1CTNA 4O4YL 2P44B 4XRCB 4LASH 1AD9A 2W9DL 5SX5H 2BHZA 3S97C 1J0ZA 1IKFH 2J12B 3IFLL 2APTA 3O6MH 5EUOB 4Z5RA 4YBQC 5HYQA 1RZJH 3EJYD 2XOTA 1UCBH 2FX7H 3SGJC 3QEQB 3TBSB 1XEDA 2D2OA 3Q3GA 4QKXB 4G6FD 2D7TL 2NY4B 5F7DB 3CU7A 4JRXD 4M43H 4NKDB 3EZJB 3KGRA 2OM5A 1OM3H 4PJ7A 1RUPL 2WW8A 4RGMC 4MB3A 1CDIA 3ULVL 4HW6A 4Z0BH 4JY6A 3UC0L 2CK2A 4JFZH 4XNMA 5D8JH 3V6OE 5I66B 2R4RH 3QQ4A 3D3VE 2VXSH 4MX7B 1T2QH 1N5YH 5DHYB 1YEDB 2AK4B 1IGML 4OD3L 5DJ0A 3EO9H 2BNRB 3WO4B 1SYVA 2VZTA 3U4BH 4R9HA 3MODL 5F6HJ 3VXUE 5EWIL 4IIQC 5IESH 3ABZA 5F72S 4L3AA 1IQWH 2C3WA 3QIBC 5TPWH 3N50A 1YMMD 4YHLL 4MD4A 2Z8SA 4ODWB 2VDLL 1QEWB 4KJYA 3LKPB 5IFHL 3UPRA 3QUML 3T0ED 4U0RB 3PP3H 4JY5L 1I1FB 1NDMB 1JPSL 4HPOL 1H3VA 1IGFL 3VFMB 1AH1A 1GGBH 3IAQA 2OZ4L 1LO2L 3VDCA 1MCLA 4KFZC 1G9NH 5IJKC 3F5WB 4LLWA 5HY9B 3ROLB 3UAJC 3WHE1 1MCKA 1AJ7L 1INDH 3HRZA 3NFSH 3S5LB 4DKAA 1KCUH 1U2CA 3RAJL 2HTKD 4HKZB 5GJTL 3O3BA 3VFUB 1C1EL 1C5BL 2ERJC 1P4LB 3IJSB 4QHMB 3B2UD 1J8HA 2NR6D 4DTGL 5DMKA 1ADQL 1OTSC 4ELMA 4H0IA 3NH7H 3VI4F 2HT2D 5ITBL 2GJZB 1WBXA 2PTVA 4UV4L 4YGVA 3PWNA 4XBEL 3DMMB 1HXMB 2DQTH 3EZ8A 4PJEF 1FZOA 1FZMB 2DBJA 3O3AB 4XP5L 2FX8L 3PGDB 1UXWB 1TTFA 4UDTB 4JKMA 3RL1A 1BZQK 3SEPA 2Z35A 2DQGL 2E3VA 3VI4E 4U3CA 1V7MH 1HIMH 1Q0XH 1OHQA 4EEEA 4MAUL 1CGWA 4FTVE 4WGWB 1CK0L 5E8DH 5B3JF 1EO5A 3VWKA 4BH8B 1VFUA 2AK1H 1BD2D 1MRFL 2BDNL 4HGKC 4PJEE 5KOMC 1BWMA 1QBML 5DRXA 3B8SA 3RX5A 1SJHB 4HFUH 3PWPD 1S7TB 1VFAA 1WIUA 4TUJB 4G9FE 1IBGL 4P5TC 4AIZA 2XACC 5F97E 5CHNA 4EKXA 3E6FB 3S4SG 2DTMH 3MJ9L 5TFSH 1I1AB 2Y72A 5ISZB 5B3JE 1TCRB 5T1KA 4QOKE 3IDMB 4HJJH 2J8UF 1LNUB 5FYJH 3LKQA 5L2KE 3LMJH 4JZOB 3WNOA 3GMQB 2NXYC 2AI0L 3AY4A 2VLKE 3HZVB 5TGBB 3ILPA 1MI5E 2X4TB 2XZAL 1ZLSH 3QXUA 5I2IB 4MCYB 4WI7A 3O11B 4PREA 1CDJA 4Y4KC 2IPKB 3GJFB 1NFDF 2I9TA 4WU7B 1WBZB 5JOPD 5CP3A 4KK9C 3MCLH 2KBGA 2ZOLB 2J8UE 5CD3A 5DD5H 3T0XA 3TZVD 1FBIH 1DSFL 1TPXC 3WNMA 5AYQA 4X98A 3A6CH 1J0IA 25C8L 3RTQA 4WWKA 5DXWA 3FO1B 2VWEC 1S9WB 1UWEH 4PJ9C 4QRQA 5E00A 4UILH 4S11A 4U6XB 1NFDE 5DJXA 1NSNL 2A9ML 1KIPB 4MDJB 4QY8B 1KNOA 5I74B 5J1AA 1IL1B 4G5ZL 1NCTA 4X4YA 3ARSA 1BECA 1RJLB 2EZ0D 4KJWC 4V1DB 2DF3A 5CP7B 5EC1A 5HDQH 1CFQB 3LQMA 5C07E 3I3BA 4JR9H 3S6CA 5HYJD 1DQDH 5CEZH 5GGRB 4UQ2B 1QSED 5EO9B 2B0SH 1Z5LA 3B9KA 2AQ3A 4PJIB 2APWA 5K9JH 1IJ9A 1ZHLA 1G7JB 1IT9L 1KCVL 4A6YH 1N6QH 3BEVB 1HHGB 1WWCA 1S3KH 3AS3A 2PYFA 2X4OA 1IM9D 4N5UA 4LVNC 3H7LA 3P4OA 1EO8H 4Y7MA 4KI5F 3T65A 1A9EA 3P2TA 5L9DH 1JZ8A 5IKCB 5D96C 4F80A 1BZ9B 1D5BB 3KHQA 1IC4H 3ARGD 1FVCB 3JVGC 4JFDD 4QYOA 1ETZA 5H37H 3VD9A 1F4WL 1QPPA 4JPIA 1WGOA 1LE5A 4R3SA 4NQSA 4YIQA 4JM2A 1VFMA 4I3GA 1QSFD 4BUGA 4LDEB 4NT6A 3GRWH 3D18A 5LWYH 2D0FA 2WIMA 3L3DB 2H32B 2BJMH 3GSUB 5IMOA 3NCJH 4N0RA 1S7UB 4S1RH 4ZQKB 2LABA 4KI5E 5DRWB 4Z7WB 4NNPL 3PDOB 5KJRL 2PUQT 2AXGA 1MHHA 3IXAB 4EN3B 3BKML 1KJMA 4OAWB 1I1RA 5J12B 2VXTL 2OQJB 2HWZH 3DO7B 4OIBA 1T7VA 1QKZH 1OQOA 5E7FA 1DTUA 2X42A 4S0SD 5HPMA 5EDXA 5F7LB 4QHUA 1NC4B 4BZ1H 2LVCA 1JBJA 5ANMB 3BH8A 1FLRH 5E5UB 1Y6KR 1ZGLB 1DJSA 2MCPH 2R23A 5IEKA 1ZTXL 1GAFH 1HCFX 3CXDL 4P2QA 4LCUA 2EDWA 3TYGH 3B2UC 1FPTH 2Z8VC 1A3RH 1E4WL 4JCMA 3MA9L 2FJHB 4HUVA 3EOTL 3DSFL 2HT2C 2P5WE 1B4JL 2YZ1A 1KJVA 3H0TA 5A2FA 3STLA 1G6RA 1MCIA 1JWMB 4OB5L 1VACA 3MNWB 4OKVB 3O3EA 1F13A 3CSBA 3QDMB 1BFTA 5I17A 2PYEE 5DD6B 5JXAL 1YEFH 5IGXL 4ELKA 4JPWH 3BEWB 4ZYKA 5C0AD 3SKJH 1YJDL 3ULUD 3MREB 1JHTA 1URLA 4EIZC 4KK5C 4CUCA 5HYSB 4XVJH 3MUGB 4ZO9A 4WEMB 4XPFL 5DD1L 1CFNB 4U6TA 5C7XH 1YEGH 3H2WA 4CMHB 5GGSB 3BMVA 3MRFA 4JDVA 5GRVK 3O6FB 2XICA 5FB8A 4KJQC 1Z6JT 4PJDB 1I8IA 3F7VB 1ZT7A 3PGFL 5F7MC 3QIBA 1DVFA 1L7IL 2DAVA 4P0DA 3QEQD 4XPGL 5F9OH 4JREB 1WWWX 4JG0L 1U3HA 3DROA 2NY4D 4H0HB 3GMRB 3Q6GL 1L0QA 5E8EB 3VH8A 4TOYH 3SDAD 4K7PY 4PD4K 4H0GA 1TZHB 3KPSA 1WEJL 5KS9E 3NFPB 3HPJA 4PYHA 3DSNA 5MEOB 3HE6D 5I1GH 3VFSB 3WLWC 5IJKA 4TUOB 3QPQD 3BWAB 1BBDL 3AXLB 5I1HH 1OAZL 1MJJA 1UVQA 4HUXA 2BNRD 2VL5A 4X8JB 5LQBH 3SBWC 3QCUL 3TZVC 4M1CD 1H0DB 5DA4A 3GUTA 3HG1E 3PGCA 4Q6IC 7CGTA 2D9CA 2R9HD 3GBML 2G2RA 4I9WD 2DLGA 2G60L 4FQJL 3VRLF 3X3FL 3AMKA 3G6JA 3HAEH 2AKRA 1F6LL 1J5OL 3OV6A 1UENA 3SDCD 1AY1L 5LGJA 1HDMA 5MI0B 4XHQA 3TV3H 1PYWB 1A1NB 1UZ6E 2EZ0C 4QRRD 2PTTA 4MQTB 2FZ3A 4PPTA 2QSTA 2ZUWA 3HLAA 1LO5B 3A67L 3NTCL 1GSMA 3VRLE 5K33A 3B9AA 2AJSL 4LEXH 1IGIL 3IFPB 2VERN 1Z2KA 2EDYA 4KTDH 3FQXA 3QR2A 1JMZA 3VW3L 5MP6L 4OJFH 2UVEA 3ZSSA 3N1PC 3AS2A 1DUYB 5IK3B 5DD0L 3ZE1F 4OCXL 2G9HA 4F7MA 1G0XA 5IFJA 3MV9E 4LASL 1A7NL 3ARGC 2VABA 3DMMD 3JWOC 2BOCA