4XRCB

Antibody hemagglutinin complexes
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
223
structure length
215
Chain Sequence
QVQLQESGPGLVKPSGTVSLTCAVSGGSISSSYWWSWVRQPPGKGLEWIGEIYHSGNTNYNPSLKSRVTISVDKSKNLFSLKLSSVTAADTAVYYCARVALFDILTGGWFDPWGQGTLVTVSSASTKGPSVFPLAPSAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H5.3 Fab light chain
publication title Vaccine-elicited antibody that neutralizes H5N1 influenza and variants binds the receptor site and polymorphic sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
total genus 40
structure length 215
sequence length 223
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xrcB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xrcB01
4LLQA 5J6HA 3AREB 3HNVH 4YHIB 4C58B 3FOLA 4V2BA 1S8DB 4FQ2H 3VFRB 1OHQA 4L8DA 4XWOD 3Q5TA 4R0LA 4YPGB 1R3HB 2BVEA 4ZNEE 4XMPL 3EYVA 3BT2L 4KWUA 5I1HH 3JBG7 5ECJE 5C0FA 3ARWA 3MV8E 1GRWA 1EFXD 1UACL 1ULVA 2EIEA 3BKYL 4LF3B 4HK3J 1W0WA 4HS3A 3LKQA 5C0GB 4HBCL 3MLPA 5K9JH 3BH8A 2YSSB 1G7IA 3FTGA 3QG6B 2HTLD 1AGBB 5CIPB 4UZGA 4Z7QF 4JFOA 2P4AB 3RIAF 1H8NA 3RL2B 4KPHL 4Z7WF 3UTTD 2VWEE 3SGJA 3P0YH 1UJ3B 4OAWB 1U8IB 3QO1A 1MFEH 2J2ZA 3U9UA 3D39E 4QXTB 4U4BA 5KN5B 3QFJA 1CFNA 4DKEH 1NEUA 2NY4B 3VFOB 3D2UA 4H5SB 3EYSL 5IJKC 4N8VA 1I9JH 5IW1B 1C5DA 3X14A 4ZQKB 3RTQA 4HQQL 5ERWB 4DN4L 4OF7A 4NQCE 5CIPH 5SWZE 4U6YB 5E2TH 1EAPA 5DSCB 4OF6A 1PDKA 2Y06L 3HZYB 2E8YA 2P5EB 4XPGL 4M43L 2DDQL 2ICEB 3CFEA 4NO0A 5CWSB 1WFUA 4WI9A 1KCRL 3L3OB 4G6KH 5ALBH 3FQNB 3VWKA 3IDJA 5I8EB 3T3PF 4AG4L 3ALPA 3WFCL 4P23D 5EBWB 5F6IB 3RUGB 4OZGF 4X4MA 5JOEA 1ZT1A 5HHMD 2EDHA 4POUB 1E4KA 1YPZB 1F4YL 3I6LE 4DFHA 2ADJA 1DBAH 2DQCH 4M62L 3MUZ1 3RNKA 4NQEB 2DQUH 3FT3B 2AJSH 2EYTA 3KLHD 2XWTA 4KDTA 1MCBA 5D7LD 1IGYA 3CSYA 3JWOC 3KLSA 3KNBA 3ESVF 3LN4B 1EX0A 1NGWB 2AGJH 1YEDB 4G6AC 3RVXC 3WFDH 5D7IE 1FNEA 3AB0B 4Y4KC 5ADPH 5IHBA 4YHLH 4H20L 4H0GA 3RKDD 1KULA 1C1EH 4WO4A 1P7HL 4I48B 1KCSL 4LCCA 5C0AA 1BD2A 2C3VA 1RZGB 1QYGL 3B5TA 5T1KB 3DO3A 4NO2B 2W0LA 3IDXH 3CUPB 1RJZA 4PJFB 5F7EH 2DQFB 1J0YA 5EUKA 4NO5B 1GC1L 4HMDA 1NCUA 4G6JL 4JFPB 5I16B 1L6ZA 3CFJA 1K3IA 4JQXC 5EB9A 4ZYKB 4ODSL 1CGSH 1D6EB 2R0WL 2N4IA 1M05B 4L4VA 1WC7B 1S9VB 4FA8A 3PL6A 1A5FH 4IRJA 1BQLL 4N0RA 3BVNB 4OIIH 1JUFA 3RJDA 2Q7NA 3PQYA 1IL1B 4ZFOB 2OS7A 2RR3A 4NYLB 1Q9KB 3H9HB 5B22A 4KUZL 2C3XA 4PRDB 1HSAA 5JOFB 4QTHB 2LQRA 3BEVB 4Q9QH 4FQPA 4HHAA 2EE6A 2JIXD 3U0WH 5BQ7A 1RIVH 5DJXB 5TH2A 2DF3A 2EDOA 2NX5B 4PJHF 2AQ3A 3QFDA 5EZOL 4HUUA 1UVQA 3QEQE 2FWOA 2HKHH 1IT9L 4LSVL 5IHZB 1ZE3C 2Y72A 4I0CC 1R5VA 4Z0XB 3ULUC 4A2LA 2DKSA 2X4QB 4LPTA 1NAKH 5FUOL 4PJAE 3IU3B 4P2QB 4M7LH 4S1SL 4G9DA 4O4YL 4PJEB 1V7NL 4P4RA 4MMZC 5M7QA 4OD2A 3L5HA 4OQTL 4PRNB 2IFGA 1OW0C 3SKJL 5HYIA 3FAXA 4HIIA 1OB1A 3EYQD 1GAFL 1HXMA 5GGSA 3SE9H 2VXTL 4ETYA 5DEZA 3RPIA 5F9OL 1ZTXH 5MEND 2C9AA 1FVDA 4XCNA 3ZLQC 1JV5A 1MCCA 1FAIH 1DBJL 4K3EL 3IFPB 4QYOA 3MUGA 1TJGH 1CDIA 5GRUH 5C0CB 5H94B 4XNYL 4LLUB 1I1YB 3C09C 3X12B 1LO5B 4WHYH 4UBDC 2FYYB 3MNZA 5CZVL 2X70A 4M48L 4PJ7B 4Y4FB 3SPVA 1RY7B 4MB3A 2W9EH 3CH1A 3RI5F 2A83B 2ZPKL 4D2NA 3UPCA 3QDJB 3KXFB 4K8RD 3WEXA 5IQ7H 1I75A 1IQWH 3BGFC 3CDGA 3PDGA 5DMGD 5TF0A 3V2AR 1T7YA 1YJDH 5HYSB 2ADFH 2BP3A 1TZIA 3MNVB 4PJGF 2OTPA 1JWMB 3STLB 5EULV 4KK9C 1LP9E 43CAA 3RZCD 4RGNE 2FBJL 3DO7B 1KACB 3E3QE 2Y6SD 4N0YL 4M7KL 5D5MA 2J8UB 3ARVA 5B4MD 3GMMB 3TT1H 2AVGA 3PP4H 2VDOH 3GIVA 3MBED 5E8NA 4Z76A 4RA0C 3P9LA 3UC0H 4FTVB 1JYNA 3QHFH 1QSEE 2G5BA 2WBJB 4R4FH 1FDLH 3WIHA 1TVBB 2P5WE 3MOQA 4JZJC 5E6IC 5FYKD 1J18A 4GRWB 3QUXC 2HLFC 1EK3A 5DJYA 5CJQL 1RHHA 5C0EA 1LD9A 4N5UA 1FH5H 1PG7W 5H35A 5ACZA 1NC2A 4FXKB 1NFDB 4NJAL 4GMTH 2ZNXA 3RWJB 4HUWB 4DTGL 3QDMA 2A1WH 4KY1H 2VQTA 4ZOBA 2WUBL 4MAUL 4KXZI 1U8NB 1AQDA 2FIKA 4MD4B 2ILLA 1GHFH 3LKOA 4K94C 5CKGA 2VZTA 4OF8A 3B8YA 3S4SG 2PXYB 3BEWB 4NRXA 4Z7NE 2VH5H 3W9EA 1BFOB 4NKIL 4P4KD 4BUHA 4NHUB 3JWDC 2DLGA 3NFNA 3OAZH 5JPNA 5IK3A 1ROWA 4GBXB 3LPFA 2HFEA 3O6FD 3PWPB 4KKNA 3GJFH 3OJVC 1RAMA 2X9WA 1QA9A 4JRXE 3T77A 1NDMA 3FN0L 1EA9C 3SN6N 4LLMB 5ITBH 4P2YA 1FL5B 1MLBA 4QOKD 3RIFK 5J1AA 3DXAD 4OZFH 4TTDC 1IAKA 3ARBB 4M1GL 4X6CF 3G9VA 5CINH 4NQDA 4M03A 3MLWH 3TNNB 4R26L 1C8PA 2KKQA 1FO0L 5BS0A 4WW2F 2XWJB 1KFAH 5EO1A 4XVUD 4PP1C 4ZODA 2F53A 3VWJA 2PCPB 2FEDC 4NNYB 5IB1B 2ICWA 4PJXA 1KT2B 4BH7A 2EH7H 3PWVA 3IRZA 1IRAY 2RB8A 3FRUA 5IMMA 2YA1A 5LJYH 2ADGA 2CO6B 4IOFC 4XAKD 4Y19A 5C8JB 4NC2B 1IQDA 4JB9H 4EDWH 2VSDA 5DJ8A 1QQDA 3VH8B 2NY5L 1OPGL 1BFVL 3HG1B 4HSQA 3DMMC 4ZUUA 2ZZUT 2J5LC 1KELL 2E7HA 1A4JA 2YRLA 3KPRA 4UT7L 1T03L 1EMTH 3V5DA 4AEIL 1OTUC 1BF2A 3GSOA 4XPAH 2KZWA 3EFFA 5LG1A 3S97C 1KJVB 1Z6JT 1UCBL 1ORSA 2EIZB 1U8IA 4LSPH 2X4TB 5KN5A 5GRJL 1MCSA 2ZJSH 3S35H 2ESVA 3BUYB 2XN9E 5SWSE 3HS0A 2FJHB 5KVFL 1CFBA 4WENB 1NQBA 5L7XH 4AMKL 3HCVB 4JO1L 4QCIB 1JHKH 3NIFE 4AEHH 2OI9B 4ODUA 5FYLL 2YD8A 5B3JF 3MLZH 3O8XA 3T0BA 3MJ7A 3HPLB 1YN6A 3GBML 2FCBA 4F37F 4XP5L 2Z9TA 4NJ9L 4Y8AA 5GGRB 3KPPB 1W72H 4KTDH 4NM4H 5I0DA 1XGYH 3O3BB 1NBYA 4OFYA 4MQXC 5IM7B 3TJEH 2W59A 3ARGA 4EOWL 1AHWC 1BFSA 1T66D 2AI0H 5IR1A 1G7LB 3P4MB 4FNLH 3SKNB 1TFHA 2VAJA 5C7XH 3U2SB 4Q2ZA 3MUHL 5DQJA 1J7VR 3CU1A 3SGKA 4RGOH 1MJ7L 1Z9OA 5C08D 5FUZH 3BGMB 1R24B 1XR8A 3H7LA 5I8OH 1V3MA 4EDXB 1IAIL 1CLOH 2OBGA 5HDQH 5D6DC 5C2BL 1A47A 4OM0H 5T3ZH 1J1OH 4MNQB 1RZJC 2EDDA 2EE2A 2GK2A 4PGZA 5EA0L 5MEOA 2P5EE 3IJSA 3JTTA 5FF6A 2GTWB 2DWDB 3DI2B 2YD7A 3C2AL 4JANB 4L3EB 3MLRL 4NQUA 1RZIB 5LKNA 4AQ1B 1MSPA 5T1KA 3MLYH 5IHUL 1S7WB 4FN0A 4NO2A 4XP4H 3HPJA 1MJ8H 3FO0H 4NKMB 1OAUH 4NUGL 3RUGE 1CXIA 4H25B 4O2CB 4RGMC 5IP4A 4HIHA 2ID5A 5I16A 3AM8A 4UT6H 5DZNA 3VFPB 3W39B 1YPZE 1Y6MR 4U6XA 3U7YL 4M5ZH 4HC1H 5D9SB 3DTXA 1AI1L 3BRDA 2VO5A 4CJ1A 4NQEE 4JFHD 1N59B 1MFAH 4LIQH 1I7ZB 1BJ1J 3AUVA 4LRNH 1NH6A 3CPLB 4M7LT 1MIML 1UWXH 2R2HB 3BW9A 4NWTH 4JFZH 25C8H 3HC0A 3BVNA 3JV4B 1MFCH 4QNPF 5EN2B 1FCCA 5DD6A 1XR9A 4IMKC 4U7KA 4ZUSB 4ZFOA 5AD0A 5F97E 3MJ9H 3O2DA 2YD2A 3TFKC 1EHXA 4ZD3L 1NL0H 2XWBA 4LNRA 3UPAA 5DQDL 2XFXB 4XCYA 4H1LH 5EO0B 2EYSA 2Y7QB 3U48A 1AKJB 4F57L 1U8QB 2JTDA 1NGQL 4KI5D 4OKVA 3OHXB 5B21A 4Y1AB 5F93C 4WI8A 1BX2A 1ND0A 1JL8A 1S9XB 4HPOH 1CF8L 2QV2A 1JCKA 3UDWC 2ZUSA 5D1ZA 4GUPB 3FT2B 4ODXA 1J05A 4PJFE 4LCYA 4PTUA 4CMHC 2JB6A 5CZXD 3VW3L 4P2QA 3K3QA 1NGXB 2QQLH 3VDBA 5GJSH 3EOAA 3KYNA 4ZAKD 1FNSH 1RUMH 5DUPH 5J57B 3QDGB 1BFTA 1A21A 5HGAA 1F00I 5BV7B 3ARSA 5ACLA 5FKAB 1NUGA 4FXGB 3R1GH 3FFCB 5BVPL 1A1MB 1SEBB 1Z9LA 2L7UA 4NPYB 4GSDH 4XB8A 3WSQH 5AG8A 5KSAA 5E08H 3IU4H 5ESAA 1OAYH 1IM9D 1IAII 1TJHL 4NGHH 3QA3A 3QWOA 4WHDA 1DSFH 3HE6C 4P2RD 3VDCA 3ULUH 1WBYA 2H2PC 1ZLVK 1IE5A 1BIIA 2VDKH 3DGGA 1YYMH 5AAWA 4QWWC 1QD0A 2P8LB 1MQ8A 2OTUA 2ZOLA 1MWAL 3FO2A 1T1YA 3TGXA 2NX5E 1PYWB 4I5BB 4ZUVB 3SBWC 1MCFA 4WUKH 1DQLL 5F3BB 2BVQA 4CRPA 1WFNA 1D7FA 2D4DA 4LVOC 4CKVX 4EN3C 2H1PL 4P2QE 1ONQA 4C59B 3SE4C 1N6QL 4JO4L 4PJEE 1WCBA 2OX5A 4TYUA 3HAEB 1JWMA 3V6FA 4RZCB 4TTGA 1MJUL 3NABH 5T1LB 3VGBA 4JFXA 4UILL 4DGIL 1TTFA 4MQ7B 4JM4H 2DWEA 3VI4F 1ES0A 4YHPB 1BBJA 3HMXH 1OAKH 1HK6A 2A9NH 5C0CE 4GAJH 4P9ML 1WITA 4DKFH 2VZ1A 4NO3B 1R3KB 3MPCA 4N8VG 1AQKH 1PEWA 4XPTH 4XNZB 4HFWA 4HXAL 2R69L 4PJ7E 5JMRA 4E0RB 1AGFB 3GSXB 5AUMB 5CILL 5C0JB 3VXRD 5BW7A 5DR5L 5E8EB 1I7RA 3BXNB 1QR1A 1DDHB 3CVHL 4TQEL 3QDJE 3KXFE 4L4TD 1BBDL 4E5XB 3UZVB 4POZD 3PGDA 1A7OH 1CFVH 3KYKH 1MY5A 5EU5B 3R06A 3QIUD 3ZYJA 5HBBA 1P4LA 3GJFA 3MREB 4ORGA 4S1QL 5JIKA 3MROB 4JZOA 5D7JA 4J4PA 4EVNB 1JPGA 5IMOA 1R5WB 3CU7A 4JGUA 2J8UE 2VZ3A 5LVEA 2OJEB 4H0HB 1T4KA 2KUTA 2OR9H 3TCLB 4ZG1A 4OZFA 4X9HA 5E2WL 2HRPH 3K4AA 4JY5L 3V5HA 5D70L 4YHKL 2EXYC 5FHAL 5FYJL 2GY5A 4UINL 4U1LB 1WBXA 1Z5LB 2PW1B 4FTVE 3W9DA 4LBEB 4YX2L 3GZKA 1EJOL 2ZUQC 3ULVC 2HAZA 4NZRL 1KXQE 2FL5A 4F7MA 4JKKA 1OY3B 4R90H 1OGAA 1YMHA 4GRWE 2AV1A 4R7NA 2I5YH 3GJEB 3MRCA 5DUML 5IEKA 3C6SA 3WJLA 2VABA 4K94H 2J88H 2JF1A 2HVJB 4U1GB 1NFDE 5EIIA 3VXMD 5B39B 1QBAA 2PKDA 5MEQA 3RIAK 2VQUA 2EO9A 3K4ZA 3HLAA 3OAUH 4Y5XA 4OCMC 1D5BB 4FS0A 1LQSR 2H6PA 2C4FU 1VPOL 4KZEH 1B2WH 3MOBH 4JQVC 4M02A 5AYUH 4NN7B 3WXWL 1S7VB 4G9FA 2P46B 1KNOA 4UT9H 1FQ9C 2GT9B 4HMCA 43C9B 1SYSA 4PB9L 3GHEH 4TOYL 3GMNA 4OIAA 5DD3H 3RNQB 3UZEA 3V7AE 4OZIA 3JUYA 4QRSA 3GUTA 2FLBT 4HV8A 3V6OE 1U93A 4KRPB 3PWPE 2NXZB 2YPLB 4C54A 1XF2B 1JYVA 3OF6A 2IPUK 5I1CH 1ED3A 3U79A 4GW1B 1W8OA 5B8CC 1ZA3A 5GSVA 2OP4H 4CVXA 4ZXBC 3Q6FB 5EOCJ 1J1XL 5KSUA 1YNTA 3D0VA 4FG6D 4HKJA 3ZTJH 1EVTC 4FQJH 5I71B 3TBVA 3TJHD 4YK4C 3WO3B 3VXOB 4WNQB 1PSKH 4GRMB 2VDLL 2ZWLT 3QNZA 3TNMA 1JNJA 1W72A 4K3DL 5C0BB 1JMZA 1NSNL 3MRPA 5K9KB 2FDBP 2ARWA 2YRPA 3H7BA 1S78C 3AVEA 3BUYA 1S7QA 2EDYA 5MP6L 5B38A 3HRZA 2W65A 4M7JH 5IJKA 1XIWC 1U8KB 5TQ0L 4S1DC 1D5ZB 1MRCL 2BMKB 4J1UA 3EO0A 4G3YL 4JY4B 4JZNA 1QNZH 1PD6A 5D1QC 5JW5B 3WXVL 3BDYL 3HG1E 5T5NF 1KLUA 3HA0A 4MJID 3HRPA 4XC1H 4RMVA 1PLGL 1RK1A 1EXUB 3VFMA 2AV7A 4RMWA 4U1MB 2FATH 1B0GB 4ODBD 5ESVA 2VDNH 3G5YB 3BPLC 4U0QB 4XHJD 3WE6A 1INDL 5FO8B 5DHXB 3GSWA 3HR5A 1U8OB 4JN1H 4QRPD 1R3LA 3U2SA 2X4PB 3C6LB 5HI5C 5JOPE 2E7MA 2NY1C 5BVJB 5TGBA 4OZ4A 1FJ1A 1FZKB 4NQVA 1FN4B 5EU4B 3B2UC 5SWQB 3BIAX 1JE6A 3PIQB 3M45A 1IM3A 4AL8L 2Z31C 1P6FA 3H9SB 5DUBB 3C8KA 3H3PH 1F11B 5GGTH 5J9PA 1IBGH 2C3GA 2IQ9L 3KYMB 3I75A 4KZDH 2G9HA 1TLKA 4Y4KA 1HQ4B 2A6IA 1E4XH 4LGPB 5HHNA 1SJXA 4HC1A 5FGSA 2BDNL 5TDOA 2EDQA 2IMNA 3F58H 4YHZH 3QHTC 2GTWA 4CDGC 1KN2L 3VMNA 2XNAB 2VUYA 4I0PC 1ITCA 1F6LL 1NBVL 4I9WD 1M4KA 1QSFB 2XKUA 5KTEL 5C1MB 2ZUXA 4MJ6B 1VFAA 1MELA 5L88L 3GGWB 3KPQA 3MJ9A 5SX5K 1NUNB 2GJJA 3P4OB 1A6UL 1KB9J 4H1LA 4DCQB 3IDGA 3WIFB 4Z7VF 1CICB 1XF4A 2BSSA 3OL2A 4RFOH 2BNQA 1NANI 2LU3A 4JQXA 1RZJH 1OVZA 3HUJB 4DQOL 4LLAA 2DLTA 3O0RL 2MSPA 2H41A 5E8PB 2YR3A 3SGDI 2LV4A 3FQTB 3MV11 3MJ8A 3V6BR 2DI7A 2V2WA 3RGVD 1AE6L 1CXEA 5GRVL 1H5BC 3QEUB 2IMMA 2MPAH 2VB5A 4MNQE 1IEBB 2CR6A 2V7HA 2FO4B 2Y7QA 5KW9H 2WW8A 4JFDB 3ZDXE 4PRHB 3BH9A 2VLRD 3DX8B 1A22B 4L3EE 4WU7A 2ZUYA 5JNYA 1KTLB 3WS6C 4R4BA 3JV0A 3MODH 3CXDH 3O4LD 1OCWH 1X5HA 3TO4C 2AXJA 2AERT 1EGJL 3L7FA 4PRAB 4WV1B 3QUZB 3W0WA 1GC1C 4KK6D 1A7NH 3ALXA 2D9CA 5KOVC 1WCQA 1JNHA 3HFMH 5A2LH 1LO2L 2H26A 1HYSD 1OW0A 4XNMB 4YJZL 2H9GA 1XGQA 4K23L 5IVXF 3CX2A 3GSVA 4Q9RL 4KAQL 3N1QC 5EBMA 1YY9C 3WJJC 3BIKA 1J0HA 3FFCA 3NCJH 1Q0XH 5DEFA 5DFTA 4LMQE 2CJUH 2IAMB 1A0QL 3RVTC 2JCCA 4ONFH 3HC3H 1CK0H 2WWMD 4LSSL 1CLYL 1K3ZA 3LRGA 1B4JL 1QZ1A 3NFSH 2DB8A 4KI5F 5GRVK 4PJ9B 4Y1AE 4IIQB 5KVGH 4HKBB 1HSBA 4CW1B 5DRZA 1NCDL 1I4FB 1Y0LB 3HMXA 4X5XB 4MJ4A 5EC2A 5LBSH 3DYMA 3KPSB 2WIMA 1P69B 1R3JB 5E2JA 4RFEA 2DLFL 4C4KO 3RX5A 3OKMB 2O5XL 2BY3A 2VDPH 1UZ6F 3MLUL 4I3RL 3IGAB 3QDGE 3O2VH 3MLVL 5CS7A 1JK8A 1RJCA 1F2XK 3CSBA 1LO4H 5D93B 5EBLA 1WZ1H 2R9HC 4D0CB 1FFQA 4GW4A 2VKXA 2G75B 4HK0B 1J12A 3GSNL 3QCVH 4G42B 4OCSL 4U2YA 5F7YC 3NGBB 4BK4A 1U6AH 1OARL 5AAMA 4P5TD 3HB3D 5HYJD 4D9RD 1NMAL 1AGFA 1PGRB 2J7LA 4P3WA 1X5XA 1AR1D 4HT1L 4JZJA 3FT4B 5E6IA 3UPRA 2HLAB 2YS4A 3ILQD 1M1SA 1F8TH 4U6VH 2EZ0D 4JR9L 3QUXA 3S9DB 4ODHH 4ZFFA 5DF0A 3RBGA 4QF1A 4QXWA 4X7DC 3V4VH 5E4EB 3SQOL 1JHLH 4YDLB 3K0WA 4D3CH 2XOTA 5L2JA 5CEZE 2ZG3A 3WFBH 5FK9B 2VERN 3IETA 3WFHB 3G04B 1UYWH 1Q72H 5LGHH 2NW2B 3QRGH 3DIFA 2SEBA 4P3CL 3CDFA 2CLRB 5E9DA 3RKPA 5EU3A 3PWJB 2FJGA 1X4ZA 2AABL 5F88A 3UJJL 4LCWB 2DN7A 1JPFB 4PR5B 5JORB 2H32B 4UUJA 1GZQB 4FQXD 2IPKB 4ZO6A 1NGPL 4YQXH 1U8JA 3S5LB 4U1HB 3L5WB 3TC9A 4D9LH 2JELL 1YEKL 4HFUH 3W11D 1T22A 4HWZB 1WZLA 1F02I 4NNXB 3UAJD 1E4WL 4NNPH 5AZEL 1A6ZA 2HVJA 5KJRL 4F3FB 3U36B 2PO6D 5E00B 1SM3L 2DQHL 1XH3A 1BQUA 1R5IB 1D5BA 4P5KB 1FLRH 3EOTL 5K93A 4Q6IC 3WHE0 1MIEH 4L29B 5GS1C 3MXWH 3KHQA 3ULVH 5E94A 1G1YA 4PY7A 1KTDA 3RNQA 1KPVB 3UJTL 3R0NA 4X6DB 2GFBB 1MNUH 3BAEH 3TT3H 2QHRL 2AW2A 4WFFE 3L7EB 4F8QA 4R97B 4F37K 2BCKA 4N8CL 3G5VB 2A77H 3O45B 4WUUA 3QO0A 2FH6A 1RUQH 2MHAB 1N26A 3DMMA 4S2SB 3T0ED 3WHXB 5IQ9B 5IFHH 4O00A 2IALB 2APVA 1G7PB 3Q6FA 4KJPD 1F4WL 3D9AL 4M7ZB 1MEXH 5EUOA 3PABA 5HPMA 1OTSC 3CFBB 3JTSB 5JR1H 4GRLC 5ALCH 2VXVH 1B9ZA 4GAGL 1DLFH 3MV8D 2OJZL 3MR9B 4WHYG 5DLML 5CJXC 5CJ5A 4RISL 2VIRA 5IVZB 5KVMC 3QWRA 3CIQA 2K3TA 1XIWB 4QHUA 1IGML 1EFXB 3CMOL 2B0SL 3LV3B 5ICZB 4KVNL 4NRYA 1F6AB 5FKPA 4PJCF 4Q74A 1WT5A 4FP8L 4KK5D 2HWZH 4QT5B 4I13B 4U1JB 2YPLE 4V1DB 1M71B 1HH6A 2BRRH 3RAJH 3UTTB 4J8RA 5DDHB 1YUHB 1C08A 5MERA 4YHNA 1WBZA 4LQFH 5GGTA 1AHWA 4KKAC 4TVPH 1DUZA 4XWGH 4NQCD 4FFWC 3O6KL 2ZUWA 3QIBD 1EEUA 4X4YA 5DD1L 3RDTC 3MRIB 5C0BE 1NLDL 3QNXA 3MGOA 4X6BB 2JJTC 1G6RA 2YEZB 1CXLA 4XMPH 3BT2H 4MA7L 4BYHA 2AEPL 5I75C 4XX1E 1UACH 5SWQA 5F71A 5I15L 4HAGA 3BKYH 2W38A 5ID0B 3DSNA 4LLDA 1VFBA 3H9SA 3CFDA 5HYQB 2N7AA 2P48B 2JJVA 4HBCH 1HYRC 2X1WL 5D6DA 4JM2D 3SDAC 4WHCA 4ZS6D 3MYZA 3I6LD 5CEYB 4KPHH 4OZGE 3QFJD 4D0BA 3BGAA 3D2UD 3O41B 5EFIB 3C60C 1UXWA 5HHMB 2XNAA 3U4EA 2D9QB 2X4UA 4XP6L 5ICXB 3VGDA 5DFVD 3EYSH 4UIMA 2G2RB 2UZYB 1I3RB 1SYVA 1TITA 3BISA 1CDBA 4PLKD 5JHDA 1D5MA 4HQQH 4DN4H 1UM4L 1CGYA 2QKIA 5D7LB 4JGJA 2NLJA 2NXYD 4NO0D 2Y06H 3D18B 5GIRA 5D6CB 4OZHA 3R8BB 4XPGH 4M43H 2DDQH 3VWKD 2D0GA 4YHOL 3H9SE 1KCRH 2AP2A 2OTWA 3H0TA 4WEUD 3MRDB 1H5BB 4IMKA 4WU5B 3H6JA 3U83A 5KAQG 2WSKA 4AG4H 2O5ZL 3WFCH 4Y5VC 5F44A 4OZFG 1NCCL 4JG1H 2MMXA 3EDJA 1AIFA 1SEQH 5HGHB 3O81A 3RWEA 1F4YH 1HEZA 1HQRA 4M62H 1QSFE 1QFWL 5I1DB 5I8CA 3IF1B 4NZJA 3UDWA 3ILPB 4OTXH 4MHHI 2UWEA 3RWGB 2W91A 1EO8L 2L7JA 3LD8B 1GJIA 2L0DA 2HA1A 4WO4D 4QGTA 5C0AD 1WAAF 4H20H 1BD2D 3HUJE 1Y18A 3QT2A 4MNGB 4NSKA 1KCSH 3QEQD 4JHAL 3IKKA 4OFVA 3SKMA 3DX7B 1QYGH 4ZO9A 1F4XL 3DYPA 3HE6A 1ZHBB 3BN3B 1NFIA 5CSZB 1HHIB 1GC1H 4JFDE 4CU7A 4PRHE 1JF1A 1UM5L 1XF5A 1X5GA 3MRJB 3SJVA 4L4VD 3SBWA 5C86A 2GUOA 2Z8SA 4ODSH 1M7DB 3PL6D 1YC7A 1I8LC 1T80A 2GITA 2R0WH 4IRJD 4NZDA 3PQYD 1HOCA 4EN3A 1CGWA 2V5RA 5F7DB 1JRHL 4Z0BL 1QHOA 3EO9L 4Y2DB 3O3UN 3SE4A 4U05A 3W2DL 3SEPA 3S96B 1BJMA 1QACA 3OKKB 4KUZH 5CUSL 3HI1B 1DUYA 3FB7B 3PE9A 3MLTA 4YC2C 3L5XL 3IJHA 2IADA 4XI5D 2E9BA 4KTEL 4U1KB 5EZOH 3U30B 4YDIH 5IIEB 1K85A 2X6MA 3TBSB 1IT9H 3E6FA 4LSVH 3TO2A 4ZPTA 5INCA 3UROR 5B38G 2Z35B 3FMGL 1ZGLM 4DKAA 1ADQL 2GQHA 5FUOH 3VXUA 1LHZA 2BSRA 3GMQA 4S1SH 3QQ9D 4O4YH 1V7NH 3OB0K 5HJ3B 1X7QB 4OQTH 4P2CG 4RGND 3SKJH 1QFWI 3JV6A 3QULB 5FA3B 1GAFH 2VXTH 4H0IA 5F9OH 3KPSE 5K59F 1L0QA 1DQQB 4KXZH 4GG6A 3RZCB 1DBJH 4U1SB 4K3EH 3SO3B 4U3HA 4NFBA 4HIXH 3ZHKA 4HWBL 4DVRL 4XNYH 5IBUG 2Q86B 4U6HB 3QAZB 2X4SB 1DVFC 1KGCE 4K8RH 5EOTB 3ALWA 3MBEB 2XKNB 1RV6X 3O9WC 5CZVH 3B3IB 4M48H 3RVUC 3OKEA 3OKLB 4X80L 3BJLA 4DZBB 1ZGLP 1QLEL 3TIDB 3L3GA 2Y23A 3UBXI 2ZPKH 4LVNB 1UG9A 4WEBL 2D7PA 4KVCL 2VLKA 1AD9B 1YDPB 3GB7B 1WJ3A 3WO4C 2FX8L 4PJIF 5DJ6B 2ORBL 3EJJX 3MA7B 3ARFC 3I84A 1F58L 1ETZB 3AU1A 4AQOA 4X98A 3IFNL 2FBJH 3REVB 2HJLB 1JRHI 4N0YH 4JHBA 5FYKH 1P5UA 5IBLC 3KLAA 3DURB 4Y88A 15C8L 1P84K 3VD4A 4MAYC 4H1LG 4JQVA 3FB5A 3L1OL 4HGWB 1NC2D 5HVFB 4YZFE 4YFDB 3QP3A 4LCWE 1KEML 5CJQH 5TDPA 5JPMA 2PF6A 1LE5B 1I8IB 3N1FC 3UJIL 1UGNA 4NJAH 4QOKB 1NKOA 3C5ZC 3DXAB 1NEZB 2FIRT 2ITCA 2VN7A 2ED8A 3HKFA 3MCKA 1HI6A 2MHAA 4DTGH 3SDDC 3WHXA 3WLWC 5B8CA 2WUBH 1T5WB 4MAUH 2JE8A 4ZXBA 2ITDB 1RUKL 1P7QA 2VXUL 1I8KB 5ICYA 1KCKA 4HCRL 1BLNA 1NBZA 2X4RB 4WWKD 4JFEB 1JZ3A 1SBSL 4NKIH 3NPSC 2HT3C 1YY8A 4K07A 3QRFM 1P4IL 2VZOA 3VGFA 4U1IA 2VR9A 3IJYB 1TETL 3LSOB 4NUJA 4WI7A 1XIWA 4X6DE 2BK8A 3WLBA 5C0IB 4HS6B 5ICZA 1EV2E 3FN0H 2ZKHH 4BZ1L 3V95A 4UTBL 4OFPA 3FQRB 2E7LC 2HG5B 5D1QA 4I18B 1T1WA 5T33L 2XA8L 5IEHB 4M1GH 1FIEA 2N7BA 2F53D 4MA1B 4R26H 2A74A 3VWJD 1FO0H 5D1XB 2XN9D 2VE6B 5DDHA 1MCPL 5FHBL 1QUNA 4FQHB 4Z7UA 4R96A 3X17A 4KJYB 3LQAL 1JGLL 4FQ1L 5KG9A 3VXPB 1HH9B 1U8LA 3RU8L 1GGCL 3VJ6A 2GW5A 1IEAA 3QHZL 1MLCB 2HRLA 5A1AA 1QRNB 4R3SA 4ZDHA 3VG9B 5EOCL 1KLFA 5HY9A 3H9ZA 1SJVA 2NY5H 1OPGH 1BFVH 1JTTA 5I6XC 2Z31A 4TRPL 5CGYD 1L9MA 4N5ED 1WEJL 4JRYB 4Q0XH 3MV7B 2AKRA 1K4DA 3SKUD 3TYFB 5INDA 1KELH 1CDHA 4H26A 3ZT7A 1ZGLA 4UT7H 1T03H 3ZE0E 2H3NB 1T21B 2GJZA 4AEIH 3T8XA 5L8LB 3LKSB 5DZLA 4V1DE 5CEYA 1S7SA 2ESVD 2XPGB 1UCBH 3KLDA 3UTTE 4ALAL 4M00A 4FMFA 4I0PA 1L7IL 3QUMB 1CGVA 4XP9L 5EO9B 5GRJH 2DQJH 2R23A 4ZMAT 1CWVA 5KS9A 2JLLA 7FABL 5J3HD 3MRMB 2YBRA 1SMOA 3WUWA 5KVFH 1FFNB 5DMJB 5J13B 1QLRB 4AMKH 4WHTB 1KIUA 1RI8A 1X9QA 5DJAB 3ROLA 1WUNT 3EW3B 4PIRF 2EICA 3MCLL 4JO1H 5C08B 3SE8L 1N7ML 5FYLH 5IESL 3EDFA 2GK0A 1JGUL 4MA3B 5EZJB 1X5ZA 4EI5C 6CGTA 3GBMH 3KPOB 2I9LB 4FABL 4XP5H 4C83A 4OFYD 4NJ9H 3T4YA 1QR4A 1JGEA 3D0LA 4BFBD 1I1AC 1FL6B 1VEPA 2C26A 1FSKC 1MF2L 1NUFA 4JKPL 4JO2L 5IKCA 3C8HA 1WWWX 5JHLL 4EOWH 3MUJA 1ZHKB 4Q9BA 1L9NA 1T1ZA 3IXTB 3UX9B 1QHPA 4JM2F 3Q3GB 3EOYG 5LGKA 4XBGB 5F1NA 1MFDH 4OI7A 5HGHA 4QRQB 1U95A 1HDMB 2CLVA 2XYCA 1YEGL 5HHME 1E6OL 3W82A 3NZHL 3IF1A 3WS6A 1S7XA 1MJ7H 4MVBC 3TO4A 1OSPL 3ME0A 4AEEA 5D7IF 1MUJB 5JO5A 5CJOL 4PJBB 4YAQB 1IAIH 1A14L 5D7LE 4PREA 1NGZA 5C2BH 3K46A 3EJZD 1DZBA 5DO2C 5IMLA 5FGRA 5EA0H 4AT6B 3SDXA 1ORQB 2NY0D 3WJJA 5T1KD 2ZUVA 4PGDA 3C2AH 3O11B 4OD3L 3MLRH 4PTTB 3LN5B 4G8GB 5IHUH 4APQC 4LLWB 4YDJB 3ZTJG 4ONHB 4NUGH 5HD8D 5H2BA 3GI9L 1YMMA 3O2DL 1UENA 1MAML 3OKNB 3EO1A 3MRJA 3U7YH 1AY1H 4ZAKB 5F7WC 1AI1H 3A6OA 2UUDK 5ITFA 1IC4H 2GI7A 4G8EB 5L2KB 2VDML 2ARJA 1MH5A 1UFUA 1ZLVH 2XY2A 4CADA 4OGXL 1MIMH 1TCRA 1MI5A 4K71C 4HZLA 1H3GA 1IM9B 5JA8B 3VCLB 4M6NL 4XXCC 5MEPA 1INQB 4ZD3H 4OQTA 2BFVL 3H8NA 1FVCB 4P2RB 5DQDH 1SJEB 5KSBB 4PJDA 4F57H 4MNGE 1DLHA 1R3IL 4GQ9H 1NGQH 2PYEB 3K1KC 4R7DA 1Q1JH 2B5IC 5D1ZD 5IIEA 1CF8H 2XZAL 5F7UA 4P2QD 4HH9B 4PJAF 1RZ8B 1A3RL 2R1XA 2X9YA 4OLZL 3VW3H 2A2QT 5DC9B 1BM3L 1IGIL 1KB9K 2IBGA 3BPCB 1OAZL 4DAGL 3WKML 2NTFA 1CS6A 3F5WA 1HZHL 2HYMA 3IAPA 2BVTA 4PY8J 3RVVC 3VRJB 5IWLC 4PRIA 4GKZA 4JPWL 3D3VA 2AK1L 4HBQA 5TDNB 5BVPH 5MENE 3BN9C 2ZSVB 3G6JB 4WW2C 2P43B 4ZFGL 1TJHH 3OJDB 1FFPA 4CVZB 2CDGB 1A9BB 3FQXA 3M07A 4HUVB 1X4YA 1K4CA 3H2WA 2HFTA 5DC0A 3VXNB 1KCVL 5DJCA 5IBTL 4NN6C 3CCHA 1MWAH 4EUPH 1QRKA 1H0DB 5D2LB 3QIWC 3QDJD 5K9QI 3VXRB 5IF0B 1DQLH 1GGIL 4ZSOA 5T1DH 3WDIA 5IB3B 1U8HA 2P7TA 1YDPA 1LE9A 1IAIM 2H1PH 3EGSA 2JK5A 4L8CA 1ZAGA 5EZLA 4L4TB 4XPHL 2RCSL 4KROD 1N6QH 1DEEA 4JO4H 3GSUB 5ENWA 4MGXA 1A9EA 3M17A 4C56B 3TVMC 1MJUH 1LP9F 1FE8L 5JZ7D 3O3DB 2AXGB 3QIUB 1KN4L 3DX9B 4DGIH 3CVHB 4GW5B 4V2CB 4N0UA 2ED9A 2BSTA 5JW3L 1VGEL 3FO9A 3MJ6A 2VISB 1LK2B 1F3JB 5I1JH 4OKDA 4RAUA 4P9MH 1FL3A 1AP2A 4XZUA 2LE9A 4LVHB 4Q6IA 2APTA 3BPNB 5GS1A 4HXAH 2R69H 3MRNA 5CILH 4YGVB 3A67L 5DR5H 2XQYG 3QXAB 4XGZA 4X8JA 3Q2CA 3CVHH 4TQEH 5FYKE 1VACB 2IBBA 5DA0B 1GOHA 4LSRL 2EC9T 4LASL 3DVNA 3S3SA 2XQBL 1H3PL 1U92B 2EO1A 3BIBX 1FNHA 5GS0L 3VXMB 1FPTL 5D7JD 4E41A 4IHOB 4U0RB 3BHBA 2W0FA 1CDCA 3NFPA 4S1QH 4JDVA 5E99L 1VENA 1CT8B 4O51A 3Q1SL 1KF9B 2ERJC 1M7IB 2FH8A 1U91B 3WMSA 2A6DB 2PXYD 3DV6B 4Z7NF 3IFOA 1JHTB 1FVEB 3MV9B 5EU6B 3P9MA 2GSGA 1AGCB 1T2JA 5E2WH 4GRLA 4JY5H 4GBXD 4QGYA 4YHKH 4P59L 5FYJH 2FR4B 4UINH 4RWHA 5DHYB 1FO0A 3BZ4B 1FORL 5CJXA 3LKRB 5GGSY 3FQWA 3GNML 5HTSA 4YX2H 4KUCF 1OGAD 3PWLB 1AC0A 3IKCA 4NZRH 1TQBB 1KJMB 2XACC 3G6DL 1MJJB 1WTLA 5DUMH 1K8DA 3VFNA 3J8F7 1UH3A 5K9OB 4N90D 2FZ3B 4JG0L 4YBQC 4QOKE 4F2MA 3F65A 3PJSA 4D8PA 4PP2A 4GO6B 3DXAE 3IYLW 4HJJH 3O3EA 5DK2B 3CZFB 4CUCA 4G9FD 5HVHB 1VPOH 4XRCB 4IDJL 4P23C 5T3XL 2XG4A 3BP7B 3WXWH 4BQBA 1RJLB 5ETUA 1HNFA 4DK3A 4PB9H 4TOYH 4G43B 4WDIA 4L8SB 1H8SA 3JZ7A 4JFEE 1SY6L 2W60A 4W6XB 5HGDB 3RDTA 4M5YH 1B0RA 1AXTL 1CQYA 2P24A 3OF6D 3SHSA 3VXQA 3T09A 2JJTA 5JXED 4XAKE 5FOJA 1MVFA 3B9DA 3LKNB 2XXCB 3P4NA 2EC9U 2J8OA 2CRMA 3U0PB 2CK2A 5L0QB 3OMZA 2ZCLL 4JLRA 2HFGL 4MJIB 1JZ2A 1J1XH 1KJ2L 2OL3L 3QXTA 3SDAA 4JVUA 3LKSA 4JO3H 3GIZL 5FM5O 3K2UL 2DTML 5CGMA 3QYCA 3ZMRA 3R8QA 2XPGA 2VDLH 4XC3L 5KZCD 4QRPB 4XNQA 2BZDA 4K3DH 1WICA 3C60A 4NKDA 4P46B 1NANH 1LNUB 5EO9A 3L6FB 3PV7A 1BZ7B 5MP6H 2NNAB 1DE4A 4PJ5A 5GGVL 1PY4A 3NIFF 5TQ0H 3IDMB 3SGDH 3IAGC 3ZL4L 5DVMA 2WUCL 1MRCH 1G1CA 2WIIA 1QVOB 2NW3A 4G3YH 4N0CC 3RWDA 4YDVA 1GH7A 1QRNE 4YHML 1EEYB 3KPOA 2A6JA 2CIKB 3WXVH 3OX8B 3BDYH 7CGTA 4IRSB 4YR6A 5SX5H 1JZ4A 4X7TB 2E6QA 1GOGA 2FB4L 2IG2L 5DS8A 1PLGH 4JRYE 5TF1L 3MV7E 3OXRB 3P77B 5JQ6L 5T3ZD 3N85L 4FOMA 4G7YL 3RY6C 2J6EA 5FYLE 1S7UB 1HKLL 2X9XA 5DYOA 3T0WA 3O3AB 4Y5VA 2E3VA 1INDH 4TPRL 5F89B 2QEJA 3TN0B 2HKFL 2O5YL 3P3YA 3F12B 4XBGA 4X5LA 1KCLA 4NKOA 3M1BB 3OG6B 4G80A 5FO9A 1NC4A 4QRRA 1AR2A 1X6NA 2VR4A 1PVHA 2GCYA 4EIGB 3HNTL 1XF3B 5LGJB 2XRAL 4AL8H 4G6AD 3RVXD 1ZT7A 2ZSWA 3WL9B 3MQIA 1MPAL 3EYQC 4Y4KD 5C08E 2R2BA 2IQ9H 3RGVB 4OT1L 4PGCA 3BKCL 4X7CC 2BDNH 2RGSA 3K80A 1K8IA 3NH7L 4RRPA 3AFLA 2Q1EA 3G08B 1KN2H 3QDHA 4GT7A 3MRHB 3S4SB 3MCG1 2VLRB 1CGUA 5KTEH 3T4AB 3RUGF 1GPOL 5IOPA 1BPVA 3PHQB 5L88H 3L3IA 4XXDB 5BOPA 1QFUL 1A6UH 3D25B 3I6KB 2BNQD 1YPZF 4A2MA 3D69B 2YOCA 2XZCL 2BHYA 1D9KC 3DJ9A 1TMCB 1KPUB 4M1DL 5DMGC 2KQMA 2P8MA 2V5MA 1RK0A 1FGNL 1MCKA 4NRZB 3BPOC 4DQOH 1Q9OB 1I8LA 3O0RH 5IVXE 4L5FL 5FA4A 4JFHE 2Z92B 1NJ9A 3B6SA 3I02B 3OPZL 1HIMH 3RWHA 1P1ZB 5GS2D 4BKLB 4JJ5A 2Q3ZA 4PJBE 3H9YA 1AE6H 5DVLA 2BX5A 1SJHA 1AKJD 2Y6SC 3MYJA 5ISZA 1OOAA 4N9GA 4NN5B 4N0FB 4P5MA 2FJFB 5J6GA 1G9ML 1NCAL 4NP4L 4YUEL 5T1MA 3WNMA 5IROC 4AIXA 5ILTL 3HC4L 4PJFF 3ULUD 4OSUL 4G8GE 1NGYA 4PV9A 3PXHA 3HNSL 1RZ8A 3VXSB 1EGJH 3MV01 3OG4B 2K7PA 4NQSB 3I2CL 3O6LL 3U7AA 1MWAA 4X9BA 4EUPA 1TJIL 3FFCD 4I3SL 1GGYA 4K23H 5L2KE 4Q9RH 1DP0A 4KAQH 5J12C 1RVFL 5TDNA 4H8WH 4LL9A 2DYPB 3G6JA 1M6OA 1MHHA 1MREL 1JN6B 2HP4A 3KJ6L 3GHBL 1CXHA 1DANT 1A9BA 4UBDD 1A0QH 2FLRT 1DVFA 3IS1X 4P2RE 4LSSH 1CLYH 5KSBE 3O9WA 3U7WL 4UQ3B 2X09A 2PYEE 1B4JH 4P5TB 5E8OA 3MRQB 4XPFL 4XNXL 1JGDB 3TPUA 1FZMB 4ELMB 3DVIA 2AJYL 2BNUA 1OSZA 4XVJL 3O6FC 4QY8A 2DLFH 3SDCB 2O5XH 4PJEF 4ZO8A 1J86A 4KK9D 1CFTB 1EJ6A 4M93C 1T1XB 3DUUA 3TESA 1JWUA 2A9ML 4I3RH 1KYOK 1I1FB 1PZUB 3MLVH 3ARFA 1XGPB 2GYSA 1CE6B 4ACPA 4LEOA 4CJ0A 4MXWL 3MRGB 3PWUA 4UDTB 4L3AA 4XVSL 2RFXA 3PP3K 2W0PA 2CO7B 4WY7L 4Z7WA 4PG9B 4AZ8A 4G7VL 1J88A 1G7MA 4Y4HC 1A4KA 1MHCB 2OQJB 3GSNH 4OCSH 1KTKE 3WUWG 4HKXA 4AIOA 5I76B 4PJ7F 1OARH 2AAVA 3GSQA 4MAYA 1TQCC 2ZCHL 2QLVB 5E6ID 5HDOA 3D6GA 4Q7DA 1NMAH 3NA4A 2R1YB 5J1TC 1RZ7L 5D2LE 3QUXD 3OR6B 3QXDB 4FQXB 5D96C 2HLFD 4HT1H 3VXRE 1MHEA 4MXQC 5KANI 2P44B 1HILB 4JR9H 2ARJQ 3EYFA 2VLLA 3PXJA 4BSWB 2BVYA 2VQ1A 4L4TE 3OQ3B 3ECBA 4PRBB 1LEKB 3SQOH 5DRXB 3OJ2C 3C5ZA 2PO6B 2X7LA 4C56E 4TNVF 5DRWA 3SDDA 4X9IA 1J8HA 2Z93B 5E9DD 2J8UF 3BZFB 3UTQA 2AJZA 1ZSDA 2EEDA 1DANU 4P3CH 1NCNA 4LAQL 3NZ8A 4YXHL 1BZQK 4UNTA 1PQZA 1AGCA 2NY2C 1ZT4A 1HHJA 3GK8L 1E28B 1AO7A 2AABH 4YO0B 3I50L 1UXSB 4TSCL 3V8CA 1T04A 4GRWF 1EHLH 1NGPH 4DUWA 1OAQH 5H8DA 3HI5L 4JRWA 1MJJA 3FHQA 2JELH 1YEKH 1I9IL 3DGCR 3T0EB 3C9NB 1FNAA 4KHTL 5E5RB 1E4WH 3G9AB 4TTDD 1A6TB 5AZEH 5KJRH 2E7LA 2QQQA 5F3HB 4WJ5B 3VGAB 2ZG2A 1RJYA 5E7FA 1S9YA 1SM3H 3VXME 2DQHH 2FEDD 3EOTH 5A40E 2AQ2A 3DARA 3IS0X 3VFUA 4I1NB 1CXKA 1OAXL 3GMPA 3GRWA 5JDSB 2ED7A 2DI9A 3MV9E 1A6AA 3T0AA 5EU6E 3UJTH 4JFQB 1MCQA 5CCKL 1FP5A 3VG0L 5BZDB 4KRPD 4M3KB 1H3TA 4FFVC 2QHRH 2YPLD 4RFNB 4K2UL 4P9HL 3PHOA 4WUUD 1I1RA 2VITA 5SX4I 1U3HB 3DMMD 1LO3L 4AM0A 2Q6WA 4YIQA 5I19L 4JDZB 4PRPA 1P53A 1K6QL 2IANA 1W0VA 4B53A 1OTUD 3IVKB 2AXHA 1F4WH 3D9AH 4M8QA 4LLQB 5J6HB 1U0QA 3FOLB 2WBKA 3VXTA 4PJHA 1DN0A 5C0BD 3BP4A 4KJWC 3E2HC 3MOAH 4L8DB 1QFOA 3ZHDA 4R0LB 4GAGH 1F3DJ 2R4SL 4HWUA 4QRTA 2OJZH 3EYVB 4KJQC 4JFFA 5DLMH 3QWRD 4LOUC 5TFSH 4WFHE 4RISH 5C0FB 2OXGA 3L5IA 4HXBL 4ONGL 1FGVL 1UB6A 1W0WB 4HS3B 4GKNA 1IGMH 3CMOH 3LKQB 4HUXA 4PPTA 2R0ZL 3BH8B 5FUCE 1G7IB 2BOCA 3FTGB 4OQ1A 5IW6A 4RA3A 1A1OB 4KVNH 3FHAA 4P48A 4JFOB 3VD3A 4FP8H 2RJMA 4EI5A 1EEYA 1A6VL 4MQXD 1G6RL 1I1AA 2LABA 3U9UB 3L95A 5I73C 5DJDA 4HIEB 4JY6A 4MJIE 3QB7C 4NIKB 1I8MA 3LHPL 1BOGA 2CSPA 1MCDA 4N8VB 3OB8A 2BVPA 4KI5C 1DQJA 1C5DB 3X14B 1IZKA 3RTQB 3O6KH 3P30H 3LEXA 3PV6A 5GRZA 3K81A 5DD1H 1EAPB 2X42A 4QRPE 1NLDH 1A02N 5CZXC 2X89A 3ZT5A 1VKXA 3NIGF 4MMXC 4PJGA 2V9TA 2AEPH 2OMNA 3H9SD 4NO0B 3CFEB 5I15H 4X99A 3F7PC 5I30H 3VWKB 3IDJB 5CP7A 2I9TA 3B4NA 4MB5A 2IBZY 3K4DA 1MHPL 1D6VL 2VR5A 3MRBA 1ZT1B 2AQ1A 2LAGB 3FB8A 3UXFA 3AS0A 3TWCL 3CK0L 2ADJB 3RNKB 4KMLB 1MCEA 4XP6H 3L3JA 4I9WE 5KVDL 2XWTB 4Q58C 1FNFA 5C6TH 4APQA 1IGYB 3CSYB 4GS7B 4N8PA 3KNBB 2JB5L 2LVEA 1PG7X 1DBKL 4GXUN 3MUY1 4GMSL 1UM4H 1NFKA 3D69A 5CD3A 1FNEB 1H15A 3RX8A 4UNVA 4PV8A 4OI8A 5IMKA 5MHSE 4HWNA 3MRKA 1EHAA 3EOBA 4WO4B 1YEFL 2D7NA 2VMFA 1JFQL 4LCCB 5C0AB 5HHOA 2C3VB 3VGEA 4YHOH 1WK0A 3WIIL 3CVIL 1IJ9A 5GISL 3TFKD 5FECA 1QSZA 1DN2A 1RJZB 5DEGA 5B3NA 4XXCA 3FAWA 1CIDA 5EUKB 2R8SL 2O5ZH 4NZUL 5IG7A 2X1QA 3ZDXF 3CFKA 1B4RA 3CFJB 4ENED 2CUIA 1DQTA 3GKWL 5IV2B 4U1NA 3KPMA 3VU2A 2VLRE 1XCQA 1QFWH 5TE6L 1X44A 5TPWL 1W2KT 1EO8H 3PL6B 4IRJB 1JZ7A 2WNGA 1IGJA 1JUFB 5D2NE 1K9TA 3PQYB 3KYOA 2AJUL 3QI9C 3D1MC 3MGAA 4ZS7L 5GGRY 2EKSA 1HSAB 1IGCL 4HHAB 3QPQC 5HHXL 5IWLA 2CKBA 5TH2B 2AXFA 3CLFL 4X6CA 3RHWF 5J12B 3PDOA 4YDKL 4JHAH 1ZANL 3QFDB 4X6FA 4HUUB 1UVQB 1YEIL 4WW2A 3HE6D 1QBML 2H2PD 3OB0H 5DFWH 3UTSA 3FOMA 3QZWA 1JZ5A 1Q0YL 3P4LA 1F4XH 1R5VB 2XTJC 4QWWD 1G6VK 5CEXA 3EAKA 3G5ZA 4PJ9D 4G9DB 3SJVD 4P4RB 4LGSB 3V0AC 1BJ1H 4OD2B 1X6LA 1BAFL 1UM5H 4EXKA 4HIIB 1OB1B 5GS3A 3OR7A 3QIWA 4MDIA 1HXMB 3WNLA 4KKCC 4EN3D 4JREB 3ULUF 1FVDB 4XCNB 1JV5B 3GSNA 4QYOB 3MUGB 3VXSE 3ES6A 3EO9H 3ZO0A 1KIQA 2B1AL 2MTPA 1KGCD 1UWEH 1CYGA 4M93B 3KR3L 4LHUA 3W2DH 2MNUA 2UZIL 2W1NA 3FQUA 4MS8D 5CUSH 3TVMA 3F62A 4ORZC 2X70B 2EDXA 2VL4A 3L3KA 3SPVB 5L8JB 1ZXQA 3EJYC 2WK2A 3CH1B 3HE7C 1CDJA 4KTEH 4LSQL 3KHOA 3WEXB 3VXUD 2OQJA 3CDGB 1ZLUH 3FMGH 1TZIB 4X6EA 4HAFA 4Z77A 1ADQH 5I1GL 5HYJE 4JE4B 4D9RE 1I7TA 1NMBL 3BFOA 1BP3B 43CAB 2WMPA 1T7ZA 4ELME 5D7SL 1HINL 5D5MB 2YD1A 4MDJB 2YXFA 2V17L 1LDPH 3GIVB 2FX9L 5E8NB 1OM3L 4DVRH 4Z76B 1QPXA 2UZXB 3P9LB 1ACYL 4FQIL 1T89C 2G5BB 5DHVH 1JZ8A 1QFWM 2C4XA 5DK3A 3TJHC 3OKOA 4X80H 1NPUA 3C5SA 2VLKD 5IW3A 4YXLL 1QLEH 4UOW0 4OD1L 1Q9LA 5DJYB 3Q5OA 4XCFL 4WEBH 4KVCH 2OCFD 1RHHB 4QLRA 5C0EB 1LD9B 5H35B 1JF5A 3ULVD 5ACZB 1NC2B 5MI0B 2LFGA 4YO0A 2FX8H 3BI9X 1UXSA 5C3TA 2F15A 4LNVA 5I8KL 3TEUA 1G9NL 3EZJB 3Q0HA 4PLNC 3QDMB 4WFED 1JPSL 1AQDB 4RRPG 2FIKB 3IFNH 5F70A 3LKOB 1CDYA 1EPFA 3T2QA 3OGCA 2CDFA 3BRGC 3W9EB 5AWNL 2R2CA 1CE1L 5GS0C 1UM6L 15C8H 4BSJA 3DX6A 3VFTA 5JPNB 5IK3B 1IKFL 1CU4L 4JPKL 2HFEB 4P23A 3UO1L 1DQML 4F15C 1KENL 3MSPA 4HG4K 3QQ4B 4MJ5A 1IKNC 1UA6L 5A16A 1QA9B 2VLJA 3L1OH 5J0BA 3PNWA 3T77B 1NDMB 3FN3A 3MA9L 4HJ0D 1MLBB 4LSDA 1KEMH 2V5TA 5J1AB 4PY8I 4X0KA 1DBML 2AGJL 5F96L 3FONA 3CLEL 1VGKA 3UJIH 1IAKB 5H37H 1FYTA 1FCGA 4NQDB 5BS0B 4EI6A 5EO1B 4ZXBD 4FFZL 1P7QD 4B7LA 2F53B 1VERA 4MD5A 3VWJB 5I2IA 3T0EE 3ZKND 4XTRC 2ICWB 4PJXB 3WNPA 1RUKH 2VXUH 4BH7B 3BX7C 3PWVB 5KSVA 4HCRH 1AH1A 3QQ3A 1REIA 1LVEA 4DEPB 2D0FA 3FRUB 5BJTA 5IMMB 1J10A 2NTSP 2ADGB 3BE1L 3ZKXB 2BC4A 1S78D 4Y19B 1V05A 1IQDB 1OLZA 2QQNL 5DJ8B 3HTLX 3T08A 4DGYH 1QQDB 1P4IH 4TVPD 1XIWD 1TXKA 2ZUTA 3KGRA 4S1DD 4ZUUB 3OZ9L 3X13A 4EUPG 3TH4T 1TETH 12E8L 3WDJA 4D9QD 2FEEL 1A4JB 4XHQA 3KPRB 4BZ1H 4EJ1C 5D1QD 1A1OA 3V5DB 1FZJA 1YQVL 3OTTA 4UTBH 3V6ZA 3GSOB 4V1DD 3EFFB 3X11A 5T33H 4OV6F 4UIKL 1B0WA 1ORSB 3MGTA 1U41A 4HLZH 4Q9QL 4KFZC 5JMOC 4YHYB 1T5XA 2ESVB 5J06A 4HIEA 1AXSB 2OK0L 1MCPH 3TBYA 5FHBH 3HS0B 4DK6A 1A3QA 3D48R 2JIXA 3RY6A 5IFJA 2GTZB 5TQ2L 3LQAH 1JGLH 4FQ1H 3RZWA 3RU8H 4ODUB 1GGCH 5ANMA 4U2ZA 2VAAA 3O8XB 4PYGA 5HI5D 2NY1D 3MJ7B 3QHZH 3SCMC 1EHNA 1YN6B 3B2UD 3DHJA 4KQ3L 3B9KC 1Z3GL 2Z31D 3CC5B 3MNWB 2CQVA 4KK6C 5EOCH 4BH8A 1NBYB 4P2OC 3NBNA 1ZHNB 3AXLA 4HMEA 4TRPH 2UY6A 3ARGB 1WEJH 3LS5H 2DQEL 1H3XA 3GO1L 1QEWB 5IR1B 3REWA 3C5JA 3O4OB 1X5YA 4I0PD 2YMXL 3QFJE 4Q2ZB 2YN5A 5DQJB 4ALAH 2I07A 3NCYP 4LKXA 1QOKA 1L7IH 1RZFL 5BCAA 1U9KA 4I2XA 4W6WB 7FABH 3X3FL 1XR8B 3HMWL 5E5MA 4RQQA 3NMEA 1YJDL 3MCLH 5CKAA 1N7MH 3CX5K 5IESH 1JGUH 1D9KA 5MEOB 4FABH 5I1EL 3IJSB 1PBYA 3JTTB 3ZDZE 5FF6B 1KXTB 1A1NA 1BVLA 1G7JA 5F8RC 4ZPVA 1ZA6A 3DRQA 2FEEI 3PG2A 1XGUA 2NY0B 1N2RA 1IFHL 1MF2H 2D31A 4JKPH 4JO2H 3KJ4C 2FO1A 3EFDL 3HPJB 2WM0A 3NVQA 5JHLH 3DETD 2XI9A 4IJ3C 3TT1L 1ERNA 2UUDH 4X4ME 1OQOA 4HIHB 3VFSA 2APBA 2QQKH 2AEWA 5CJ8A 3VA6A 4U6XB 3DTXB 2QTEA 5IV2A 1YEGH 5FV1L 2P42B 3NZHH 5IROA 2P8PA 1DFBL 3HB3C 3TO4D 3SDYL 3RWIA 3UBXA 3BW9B 1AR1C 1LEGA 3WS3A 2UV3A 3HC0B 1OSPH 3ILQC 5DD6B 1XR9B 5F72S 5AD0B 3I9GH 4LSUL 5CJOH 4JAMA 4ERSL 1L6XA 4J6RL 3VFGL 1A14H 4ZFZA 2XWBB 4LNRB 5D7KE 1S7RA 3HUJF 4XCYB 2EYSB 3ZSSA 3NOIA 1HE7A 2AJVL 4OKVB 5C0AE 2P45B 4PBVC 3ZKQD 1BD2E 3DV4A 1BX2B 4BFEA 1ND0B 4PUBL 4X4ZA 4OD3H 5BO1L 3RVTD 1D5XA 5GRWA 5D1ZB 4ODXB 4NFDA 3LEVL 1J05B 4LCYB 4PTUB 1DR9A 2VC2L 2XTJB 2JB6B 5E24E 4O2FA 4AIZA 3ZZ1A 4CNIA 3EOAB 3KYNB 4HJGA 4K7FA 3GI9H 3H3BC 3O2DH 5HGAB 4PGBA 2F9BT 1G9MC 1MAMH 4M61A 3DLQR 1JP5A 1K5NA 4RMQA 3BD3A 4JVWA 2NY3C 4L4VE 4U31A 2VDMH 1MI5D 5KSAB 3O6FA 4Y2DD 1KB5A 5ESAB 2DBLL 1U3YA 2NYYC 4OGXH 2I60L 3PQYE 5ITBL 3QA3B 1ADQA 3QWOB 1LEIA 1RPQA 4OLVL 2YKLL 2OZ4L 1WBYB 4X83A 4M6NH 4CVWA 3S34L 1BIIB 3T1FA 2R9HD 3DGGB 4TNVK 3QQNA 1XEDA 3UAJC 5IFAL 2BFVH 3ZKMC 1L0YA 3HZMB 2A73A 2OTUB 2ZOLB 2WWKO 4XCEA 3FO2B 4RMTA 1T1YB 1JMXA 1R3IH 3R0MA 1PKQA 2B7DT 2BVQB 1QFPA 4Y4HA 2XZAH 1I7UA 1NCBL 4ODVL 2EH7L 4HWBA 2EE3A 4NBZB 1A3RH 1ONQB 5E4IA 3DRTA 3OXSA 4OLZH 4OF5A 5IGXL 2BOBA 3IAQA 1WCBB 4OUUA 1IGIH 1NDGA 2IC2A 5DHVA 1CGXA 3V6FB 2ADIA 3V4PL 4KROB 3C8DA 3WFZA 1OAZH 4PRID 4DAGH 2Q76A 2D7OA 3D3VD 5DWUL 4EQ3A 4JFXB 2DWEB 4JPWH 4ODWA 2LTQB 3BMWA 2AK1H 1ES0B 4MDJA 1BBJB 2YUWA 5CGTA 4ZFGH 3ELAT 1ZK9A 3LMJL 1HWGB 2FSEA 4R2GC 3WN5C 2RHEA 3LDBC 2F54B 4KKLC 2KQNA 4HFWB 1KCVH 5IBTH 5EPMA 2F58L 1I7RB 1P7KA 3CH8A 4CU8A 1QR1B 1CLCA 1GGIH 4QHNA 2X05A 1KG0A 1U8MA 3PGDB 1VADA 5E56A 4ETQA 3NPZB 1VB9A 4AEHL 4K7PY 4XPHH 2RCSH 3TIEA 2ATKA 5DD5L 3R06B 4Y8DC 5A2IH 1P4LB 2YUVA 3GJFB 4ORGB 1FE8H 4FZ8H 4JZOB 4NFCA 4Y5YC 5D7JB 5KBNC 2VWEC 1JPGB 1KN4H 4KK5C 5IMOB 1MAKA 1CLZL 4YNYA 4C57C 5D5ME 1UB5A 4HIJA 5JW3H 1T4KB 5GPRA 1VGEH 4OZFB 2AJXL 2XV6B 3V5HB 4DUXA 3F7YA 1N8ZA 1CGTA 3GMOA 1CFQA 1WBXB 3W9DB 4KKBC 4WTZA 2FD6L 2FL5B 4F7MB 3QIBC 3A67H 1OGAB 1YMHB 3QQ4A 4Z7VA 2UY7A 1IMHC 2AV1B 3MACL 3T65A 4R7NB 4XT1C 1AGDA 1GXEA 3MRCB 4YZFF 1CTOA 4HCRA 5IEKB 3C6SB 4LSRH 2VABB 4LASH 2XQBH 5EIIB 1H3PH 4E41D 5MEQB 5HGBA 3HLAB 3AAZA 4Y5XB 5GS0H 4YFEA 4YBHA 1S5IL 1FPTH 2H6PB 3QDME 4MWFA 1G9EA 4JM2C 5IT2L 5E99H 4G9FB 5FDYA 5BMFL 1OTSD 1KNOB 3Q1SH 4QXGL 4RX4A 3L9RA 1SYSB 3GMNB 4QO1A 4JFED 4GRLD 1I3VA 4ZTOL 4OZIB 3FO0L 1E27A 3IDIA 4CAGA 4QRSB 3GUTB 2F74A 2Q7YA 4HV8B 4P59H 2OSLA 4NT6A 2HMID 1FORH 1U93B 1GZPA 2Q87A 1K2DA 3GNMH 3I3DA 3P9WB 3HZVA 3QNYA 1ED3B 3P73A 4X6DF 3G6DH 5I9QC 1PEZA 1ZA3B 4M8VA 5GSVB 4CVXB 2NXYC 2VRAA 5KSUB 1YNTB 2EDBA 3D0VB 4HKJB 1TIUA 2PTTA 4JG0H 3TBVB 4P9HC 4NQDE 3QZWG 5D1XD 5BS0E 3QNZB 3TNMB 5DTFA 1W72B 3ARYA 5JTWA 1EIBA 5FIEA 3MRPB 4B7IA 2F53E 3H7BB 1WFTA 4IDJH 4KKAD 5T3XH 5KZCB 1YN7A 1AXSA 1S7QB 3L3DA 4JFYA 5J11C 2IEPA 5B38B 4HX1B 4PJXE 4FFWD 3HRZB 2W65B 3V5KA 2JKXA 2GTZA 4Z5RA 4NZTL 1CDGA 3RDTD 3VI3E 1V7ML 2KDGA 4KV5E 4J1UB 3EO0B 3GFUA 4N1EA 1SY6H 1QRND 4Y19E 1WT5C 4JZNB 2K1MA 2BNRA 1AXTH 2IH1A 4B50A 4LHUG 3B9KB 2HN7A 3CC5A 3MNWA 1KLUB 4JRYD 3MFGB 5E5UB 3MV7D 5IB5A 4LLVA 1RK1B 5CMAA 4HD9A 1ZHNA 2AV7B 3VFMB 5FYLD 2ZCLH 2HFGH 4KC3B 5IBUB 3KPRE 5ESVB 3ZE0F 3SDAD 4DGVL 1OP9A 1QEWA 3K8MA 5ESQA 4YH6A 4FFYL 5E8DL 3WE6B 5J7CC 3QUKA 1KJ2H 3GSWB 2OL3H 2Q3AA 3HR5B 1NLBL 2V9RA 2X41A 5C0DA 3C60D 3GIZH 1R3LB 2CXKA 3K2UH 2DTMH 1DL7L 1I9EA 2J12B 4XC3H 2ZOKA 2ZP0T 3P0GB 2ESVE 4TUJA 3C87A 4PJ5D 3TA3C 5TGBB 4OZ4B 5F1IA 1FJ1B 4NQVB 5BV7L 3QUYC 5JW4R 1IM3B 2J4WL 5GGVH 1LO0L 2LU7A 3JWNC 4KGJA 3C8KB 5J9PB 2J6EL 3ZL4H 1C5BL 1N5AA 2WUCH 2YRZA 2IGFL 4OLYL 4QHLA 3I75B 2G9HB 1T0NA 4Y4KB 2A6IB 2NZ9C 5DURB 5HHNB 1IGTA 2VDRL 4R9HA 5EU7E 5TDOB 2CDEA 1F13A 2Z4QA 3P11L 4GQPH 1R6VA 4MCZA 1AD0A 3E1F1 1O7SA 4JM4L 2FB4H 2IG2H 3TBWA 3V9FA 1CG9A 1BMGA 4OGYL 5JQ6H 1VFAB 3N85H 1RMFL 4G7YH 4EBQL 3JV5A 3EKCA 3KPQB 2OXHA 3S6CA 3BWAA 1HKLH 3JWOH 3NCEB 4DKFL 4H1LB 4TPRH 1RUAL 5E2VL 3U46A 2HKFH 2O5YH 3IDGB 4EEEA 1NC4D 4QRRD 1XF4B 4BSVA 2BSSB 4UB0L 2BNQB 1XCTA 3BYTA 3TZVC 4ZO7A 1G7QA 3T04D 1HHGB 1QBLL 4O9HL 5CEZL 4L4JA 3HNTH 4LLYA 3MJ8B 5DVNA 1RULL 2V2WB 2DQGL 3E3QC 4GXUM 1MPAH 3L5JA 2R29L 3QI9A 1PX3A 4IOSD 4OV5A 3QCTL 2V7HB 4OT1H 3PUCA 2DL2A 1OGTA 4X5WA 3NH7H 3BH9B 4Z6AT 4WU7B 4G8GD 3UTOA 5JNYB 2DJSA 4R4BB 2B8OT 5D71L 4M6ML 3DOSA 3L7FB 2QADC 3UYPA 3W0WB 1QFUH 5I66B 4RBPK 1JNHB 5GS2H 4P3DA 2XZCH 2H26B 4EZMA 5JLZA 5L2KD 4M1CC 4M1DH 4POYA 2H9GB 1Q94A 1XGQB 1BQHA 2XZQL 1FGNH 3GSVB 5EBMB 3M8OL 4DVBA 3BIKB 3ARPA 4F9PC 1E6JL 3UYRL 4QKXB 5AYQA 5DEFB 3OPZH 5CHNB 1NBQA 1D5IL 5IUSA 4MNHA 5ISZD 1ZWIA 3WCYA 1P84J 2JCCB 3C09B 4UAOC 3KDMA 3KS0H 1BEYL 1XT5A 1U8PA 1VEOA 2PYED 3OWEA 5F9WC 3HZMA 3QJFA 3S98A 2PW2A 1HSBB 2B39A 5DRZB 1G9MH 1CZ8L 4WEMB 1NCAH 4YUEH 3HE7A 2ZCKL 5EC2B 5ILTH 3HC4H 4OSUH 4RFEB 2XTJE 3BGFB 1VCAA 3HNSH 4MHHG 3DROA 3T0VA 3PP3H 3RWCA 3I2CH 1JK8B 2BJML 4X4XA 3O6LH 1VHPA 3WUZA 1T83C 1TJIH 2M26A 4I3SH 5C0NC 5EBLB 4PJCA 1DBBL 5J89A 32C2B 2C4FT 4CVUA 4G6FB 4WI3A 4GW4B 1JJUA 1MY7A 4K55A 1RVFH 1MREH 1DVFD 2CRYA 3KJ6H 3GHBH 3HZKA 3W81A 1IGFL 4BJLA 3O9WD 2F54A 2DIJA 1EH9A 3MO1A 3RVUD 2QSVA 5FGCB 5DQ9A 4LCIL 1T89A 5EZIL 3U7WH 4MQSB 4WWKC 4P49A 4JZJB 2DJ4A 5E6IB 4D0DA 3UPRB 5HI3C 5JIPA 4XPFH 1IC7L 3IB4A 3QUXB 4GAFB 4XNXH 4URTB 5F1SA 4HWEH 4ZFFB 2AJYH 1UZ8A 1NMCC 4XVJH 4QF1B 1KXVC 3INUL 4UDUA 2MOVA 3ARFD 4C56D 1MVUA 3CXHJ 1YECL 3OSKA 5IB2A 5L2JB 4BFIA 1JTPA 3IETB 5DI8A 2GJ6A 4MXWH 4IS6A 2UVFA 2HJKA 4NHCL 1QO3A 4XVSH 3DIFB 2SEBB 1HHKA 4WY7H 5E9DB 5IBLD 4G7VH 5EU3B 1CTNA 2FJGB 3D85A 5F88B 3AREC 4YWGL 3ARDC 4KMTL 1UEMA 4UUJB 2ZCHH 2EYRA 3WKNA 5SX4H 1RZ7H 1U8JB 2AJ3A 2NMSA 1IKNA 2IQAA 4Z8FL 5EDXA 1T22B 1YNLL 5FYJD 1IZJA 1A6ZB 1ZVYA 3V52L 1UQSA 5FGBC 2X4NA 4NCC1 4ZTPL 1BF8A 3N1MC 5F7KC 4KZDL 4N5EC 4E42A 3LS4L 1XH3B 3SDDD 1J8HD 1N6UA 3TBTB 3NTCL 3JWDH 1G9NC 1KPRA 3LH2L 5E94B 1FV1A 1N6VA 2AK4A 1UJ3C 3MV9D 3IRPX 4PY7B 5EU6D 5C2UB 1KTDB 3ARXA 2NY4C 4NKQB 1R0AL 1AO7D 4G8FA 3MTRA 2F19L 4YXHH 3FKUS 1T20A 1A7RL 2D7TL 2HT3D 3UBXG 1UCTA 2GIYA 5J3HC 1YNKL 2LAAA 2WAHA 2ATPA 8FABA 3MLSL 3I50H 2VSCA 2BCKB 4TSCH 3S3PA 4XH2A 3KPLA 4WUUB 3QO0B 5GGQL 3CFIC 3DMMB 1OGAE 2NQCA 1FC2D 3HI5H 2J5LB 1WAAA 5DMKA 3GRWL 5E03A 1I9IH 2O61A 4ZUTA 5EUOB 4BQ8A 3PABB 5HPMB 1SY6A 1RZKL 4KHTH 2FBOJ 5F9JA 4N90E 1WIUA 4PB0H 3A6CL 4WFHD 5EIVA 3ZDYF 1UADC 4OLXL 2VIRB 3DI3B 4G9FE 3ROOB 1I3GL 1HHHA 1ZKAA 4HX1A 1OAXH 2BXZA 2EDTA 4FQQA 4GAYA 3KPNA 2Y5EA 4FQCL 4G6MH 4J3VA 4QHUB 1FG2A 1A2YA 3STZA 1KJ2A 2OL3A 2YHGA 5CCKH 4OZIE 5DGRA 4NRYB 3VG0H 2Y25A 5FKPB 5EIQA 1B3JA 3O4LA 3H42L 3SCMA 2X1PA 4K2UH 4P9HH 2QSCL 2X1XR 3AB0C 3B9KA 1LO3H 1HH6B 3ULSA 4JHWH 5I19H 2V2TA 4J8RB 3FB6A 5IJVA 4P2OA 2HTKC 5TJWK 1C08B 5MERB 1Z9MA 4YHNB 1WBZB 3BO8A 1AHWB 3VRIA 3K1DA 1DUZB 3ESUF 1ZS8B 3NCMA 2NY6C 3SO5A 2DQIL 4IM8A 2CJUL 4X4YB 4RNRA 5DRNA 4JFFD 5FO7A 4P46D 1WFOA 1A6WL 1MFBL 1FNLA 3QNXB 3MGOB 2ZNWA 3U9PL 2R4SH 1G6RB 2OMBA 3MZTA 4K7PL 5KVGL 4KDVA 4X7EC 2YC1A 5C9JA 4HXBH 3NIGE 4ONGH 1FGVH 4LLDB 1VFBB 5FDWA 3CFDB 3RVWD 2R0ZH 4W68A 4RIRA 2M1KA 4JPIA 4NDMA 1FBIL 1OF2A 5BRZA 3ZYOA 4EI5D 5T5NG 3LZFH 3ZTNL 4F7PA 2HVKA 4IRSD 2G60L 4D0BB 3DVGA 2R1WA 1A6VH 1G6RH 1UXWB 4XMKL 3U4EB 2X4UB 4GG8A 1MQKL 3LHPH 3LEYL 4X9GA 4UIMB 3TN0D 5T3ZE 4F33A 1SYVB 5C3LD 3QCVL 5JHDB 1VESA 1D5MB 4GXVL 3RPKA 4RGMB 3WNKA 2QKIB 4J23A 5MHSD 2X89D 3F7VA 4RAVA 4WW1A 2NLJB 1ZMYA 3IDNA 5GIRB 4OZHB 1KV3A 4PJIA 1HHGA 5FAAA 3RP1A 2OTWB 3H0TB 1BECA 4U6TA 3FCTA 5EOQL 2X4OA 1S9WA 5DO2D 1YJDC 5FB8A 3L3HA 2DD8L 4WVRA 1MHPH 1D6VH 3WV0A 1AIFB 4JN2A 4LIQE 5H37G 5SV4A 1PY9A 1ZOXA 4Z78A 3RWEB 3TWCH 1HEZB 1HQRB 3CK0H 4Y4FC 1U58A 4NQXA 3RI5K 1Q72L 4WTZG 5I8CB 2CUMA 4APQD 4HS8L 2UWEB 4OFIA 5KVDH 4CMHB 2M2DA 5DJ2A 3FFDA 1VSCA 3TV3L 3QJHA 3F6LA 5I66A 3VFVA 1DBKH 2CIIA 4HGMA 4NOBA 4GMSH 2R56L 2BNQE 1G7HA 1WZMA 2PYFA 5F7NC 2YWZA 5I0ZA 2BVOA 5HHOD 4CDHA 1Y18B 4OCYL 5EBGA 1MRDL 4OBSA 1YEFH 3VRLE 1PX4A 4NSKB 1RIUL 1JFQH 1CR9L 3SKMB 4UU9A 3WDHA 1T7WA 1HXYA 2WINA 4PJBF 5CHNA 3KAAA 1JYWA 4MX7A 3WIIH 3CVIH 1ACZA 3LB6D 4ISVA 5GISH 3UTPD 1G0XA 3E6HB 3HE6B 3BSZH 1NFIB 2WLYA 5C09A 4O2EA 1J1PL 2DMCA 3MFFA 4KH2A 1JF1B 2KH2B 5J4MA 3UYOD 4XVTH 1XF5B 3SJVB 2EDNA 4R4NC 3MXWL 4HLZG 3RWFB 5C07A 2GUOB 3GKWH 4RDQF 5ID1A 2WBJC 3U1SL 2CKBL 2GITB 5TE6H 3VXSD 4LVOB 5DMIL 1HOCB 4EN3B 5TPWH 1CCZA 3ULUE 2UYLA 3J7HA 3W0WE 1YQ2A 3U6RA 4W6YB 2AJUH 3C08L 4W4OC 4ZS7H 4EXPX 1DUYB 3MRFB 3RVVD 3MLTB 1LK3L 2X44D 3TM6A 2YK1L 1IGCH 1YEJL 2DYPD 3BN9D 3MRLA 3IJHB 5HHXH 3FFCE 32C2A 1MCOL 2IADB 4ELKA 5IFHL 3WNOA 4YDKH 2N1KA 1YEIH 5GGUA 2VL5A 3E6FB 3TO2B 4ZPTB 5INCB 1QBMH 2ZUUA 2JCCE 1Q0YH 3WN5A 4LDLB 5KSBF 4JJHA 2PXYC 3S35X 3ZKSD 3VXUB 2BSRB 3GMQB 1PFCA 1HWHB 3QIWD 5ADOL 1T0MA 1NCWL 1BAFH 3KWWA 5HHPA 4ZNEA 3JV6B 4GBXC 5KOMC 4QHMA 1OTTC 4JCMA 3MV8A 3SDCD 4AENA 4GG6B 4OCLC 3V0VB 3U4AA 4LHUD 2EDFA 2B1AH 3KR3H 2CGRH 2UZIH 5CBEA 3K7UA 3ARBC 4EIZC 4Y5YA 3LRSA 1CL7L 3OKEB 1N4XL 2M8XA 3G6JF 1IAMA 1FZOA 1CFSA 3PWNA 3D39A 4MSWA 3L3GB 2C3HA 3P40A 1JNNL 2VLKB 4OLUL 2DQTL 1RIHL 4XWGL 3BKJL 1FG9C 4QXUL 5FGCE 4J3UA 3ARDB 3QH3A 4GKSA 4NQCA 5SWZA 5D2LF 5I1GH 2ZUQB 2I26N 2YUZA 1ZLWK 3GMLA 3OBAA 3ABZA 3QIBA 1DQDH 3DWTA 1NMBH 1P9MC 1UT9A 3AU1B 5HHQA 4X98B 3QXWA 1P2CA 2V2XB 4O5LL 4MD0A 1EEZA 5JXEC 5D7SH 1HINH 4ZNCD 3LKPA 2DTSA 2V17H 2FX9H 3KLAB 1OM3H 5CP3H 3TBTA 4ONOA 3HI6L 1JNLH 1ACYH 3FO1A 4FQIH 4JM2A 2AS5M 1IAOA 3FB5B 4HPYL 5I18L 1WGOA 5E9DE 4QRUA 1L4IA 3RL1B 2R2EA 4YXLH 2DAVA 3F8UB 3ETBF 4OD1H 4CL7A 5K9QG 4HDIA 4QHKI 4XCFH 5DT1L 1PZ5A 5TDPB 5JPMB 4YE4L 35C8L 5J56B 4DZ8A 1V3KA 1KBGL 2OI9C 2E27L 4UQ2A 5D7IA 1V5JA 4XB7A 5I8KH 2ITCB 1G9NH 3MCKB 3S7GA 1HI6B 2VJXA 5B8CB 1A7PL 1JPSH 2VTFA 3BP6A 3P0VL 4ZXBB 4L3CA 4YBQD 1P7QB 5ICYB 1BLNB 2ENYA 1NBZB 4HF5L 4YK4B 4BA8A 3EHBC 5AWNH 1CE1H 1UM6H 3CDCA 1JWSA 4NBYB 1YY8B 4JG1L 3T2OA 1BVKA 1CL7I 1IKFH 1CU4H 1SEQL 4JPKH 4X7FC 4U1IB 3UO1H 1CD1A 2BSED 2VLJD 1DQMH 5IB4A 3ROOA 4NUJB 3S3JA 1KENH 5DA4A 1BQHG 1UA6H 4G5ZL 4OTXL 3WLBB 1OD7A 4ZOEA 4C4KT 3MA9H 5A2KH 3OAYK 1U3HD 1FYTD 4F58L 4BZ2L 4GLRI 4KHXL 5D1QB 1DBMH 5F96H 3CLEH 5C6PB 1T1WB 5JW4N 1UKTA 4WUUE 5D4QA 2A74B 4IMLA 4IOIA 4FFZH 3DUSA 2X5PA 1KIRA 4CN4A 3EYOA 4E9LA 5EUOE 4Z7UB 4R96B 5FOBA 4MCYA 3BPLB 1ZS8A 2A6KA 3A6BL 4U33A 5KG9B 2NY6B 3AY4C 1U8LB 1T7XA 3QEQA 2CH8A 2GSIA 1FFOA 5A2FA 4AH2A 3DYOA 4LGRB 3VJ6B 1IEAB 3ZE2E 1WTGT 3BE1H 2QR0B 4PJAA 2YA2A 4R3SB 3VE0A 2XY1A 1X5IA 2QQNH 4ZDHB 5I17A 2NY1B 3TA3A 1Z2KA 5HY9B 3RJQB 4KK8D 5CLWA 3QUYA 3OZ9H 4HLJA 2Z31B 12E8H 4F7TB 2AKRB 2BY0A 4N0CD 1K4DB 1T6WA 2EXWC 5INDB 1S9KC 4HKZA 4GKOA 1ZGLB 4H26B 3I3BA 1YQVH 2GJZB 3T8XB 1T3FA 1KIPB 1S7SB 4UIKH 2GAZA 1C7TA 1ZVSA 4I0PB 4AJ0A 2R23B 3ARUA 5KS9B 2OK0H 4LCUA 3RTQD 2YBRB 3WUWB 2KL6A 5DJZA 4YDIL 3QDAA 3QXUA 5TQ2H 1AGEA 3IFLL 1Z0MA 3ROLB 2W9DL 4L1HA 1I9RL 3MLXL 2GK0B 4I4WB 4G8IA 1JZ6A 1V8HA 2YD9A 4OGAD 2YPVL 3TZVA 4C83B 5I1KL 1V3JA 1QPPA 4KQ3H 3T4YB 3D0LB 1JGEB 2MFNA 1Z3GH 3G6AA 3QEGL 5E1HB 4F7CA 5BV7C 3U0TA 1L7TL 1LP9A 4LQ1A 5IKCB 2DQEH 5CD5C 3ORJA 1T1ZB 3GO1H 4HIXL 5F1NB 1GL4B 4K8RL 1U95B 3KS0J 2YMXH 2CLVB 3SKOA 4O58L 3MMEA 4WWID 1QSEA 4KDWA 4PYHA 4M9OA 2QJDA 3BZEA 1RZFH 1S7XB 2HT2C 1TVHA 2P5WA 1ITBB 4Y2OA 4ZOAA 2NY7L 4XMLL 3X3FH 3TO4B 2HH0L 3IT8D 4FRWA 5JHDE 3G5XA 3HMWH 5JO5B 1F6FB 1KYOJ 1D9KD 1KOAA 5D7KD 2EIDA 5C71A 4PREB 1NGZB 2D03L 3QCUL 2NR6D 3K8KA 2PR4L 5IMLB 3RA7L 4OZHE 3SDXB 5I1EH 4Z9KB 3MC0A 2PUQT 3HR6A 4PGDB 4F9PA 4P57A 2HFFA 4S0TD 2CR3A 3WFEL 1IFHH 1OT2A 3EFDH 3E6HA 1LGVA 2H2SD 5FYKL 2C1PA 3EYUL 5H2BB 1YMMB 1NAMA 4G6JH 4XNZC 4Z7OF 1EO7A 3EO1B 1BZ9A 3RWFA 3NCBB 5F1OB 2OR7A 1MCHA 4XCCL 1GYAA 5ITFB 1JYXA 2Z91A 5BZWA 2UWEE 2DJUA 3DBXA 1DFBH 2ARJB 1MH5B 3KYAA 4Y89A 3SDYH 2J8HA 4OFDA 4CADB 3NN8A 1TCRB 2F5AL 4JRXA 1BQLH 1MI5B 3OKDA 3NA9L 4HZLB 4LSUH 4ERSH 4J6RH 3SY0A 4WFGD 3VFGH 3TYGL 2IPTL 3MRFA 5MEPB 3EZ8A 5I1LA 3UP1A 1T83A 2Y5TA 4PJDB 5DD0L 4ODTL 3IXAA 2V7NA 2AJVH 5CBAA 1DLHB 2DKMA 1G0DA 1S7TA 4R7DB 3TPKA 3SGEI 4PUBH 3WNNA 5BO1H 2V9QA 1GVIA 3ZE1E 1KB5L 3LEVH 3QEHA 4P99A 4GRWH 2N56A 1LWRA 2R1XB 4Y0GA 2VC2H 3A0OA 5EWIL 1TZHA 5HI4C 2IH3A 2NTFB 2D4FA 4WWKA 4XP1L 3SJVE 1AXIB 3F5WB 1MRFL 4PRIB 4GKZB 3NAAL 3D3VB 3VFWA 4NC1C 1C16A 3F7QA 5DJ0A 3LIZL 3V0VA 4Q9CA 2DBLH 3I6GA 2I60H 2ZKHL 1FFPB 1FNGA 3FQXB 3PDDA 4OLVH 2YKLH 2OZ4H 4U1GC 3GMRB 4UTAL 5GZND 1K4CB 3DPBA 3S34H 2FECL 1RFDL 5DJCB 5IFAH 4RMSA 3AC0A 4LP5A 3CCHB 4K9EL 2W0KA 1H9VA 5E1AA 4EKXA 4Y4HD 3FZUC 2ICCA 4NN7C 1V3LA 2WV3A 5F9AC 4ZSOB 2YPKA 1JF6A 3EDKA 3PGFL 5T5FL 1KLGA 2XN9A 1U8HB 2P7TB 5SWSA 1LE9B 1NCBH 1D3CA 4ODVH 3EGSB 2JK5B 2B1HL 4S1RL 3UEZA 4L8CB 3AREA 4YHIA 5EZLB 3VXUE 5CP3A 1S8DA 1TDQA 3ARDA 5A3IC 3VFRA 1DEEB 3F7RA 5IGXH 5ENWB 4RAHA 1A9EB 3M17B 1UWGL 4MXQD 3V4PH 4YPGA 1LILA 1R3HA 1Q9WB 4ELMF 5DWUH 4KRPC 2Y07L 2NXZC 5LAXB 1DEDA 1J5OL 2V2XA 4GG6E 2K7QA 4N0UB 2BSTB 4LF3A 4M7KH 2JJSC 3FO9B 4JQIL 3OV6A 4Q0XL 5C0GA 1NCTA 5FGBA 3FRPA 1P4BL 2YSSA 4RAUB 3QG6A 3DNKA 3DHMA 1AGBA 5CIPA 3LMJH 1FL3B 2E7BA 1AP2B 4XZUB 3BRFA 1JPST 1FYHB 4CGTA 3S36L 5I71C 2HT4C 4Q6IB 5GS1B 1O5DT 3RL2A 3MRNB 2OR8A 1UJ3A