4XRCB

Antibody hemagglutinin complexes
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
223
structure length
215
Chain Sequence
QVQLQESGPGLVKPSGTVSLTCAVSGGSISSSYWWSWVRQPPGKGLEWIGEIYHSGNTNYNPSLKSRVTISVDKSKNLFSLKLSSVTAADTAVYYCARVALFDILTGGWFDPWGQGTLVTVSSASTKGPSVFPLAPSAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords H5.3 Fab light chain
publication title Vaccine-elicited antibody that neutralizes H5N1 influenza and variants binds the receptor site and polymorphic sites.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 215
sequence length 223
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xrcB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xrcB01
1MLCA 1IGJA 1F3JA 3FQNA 2EO1A 4RGOL 4ODBD 4P57B 3RWDA 4JQIH 4N0UE 5ESAA 1HI6A 4HUVB 1JPFA 5F96L 3TBVB 1E4WL 5BMFL 4P3DB 1RUAH 2XA8L 1HE7A 2IPTL 3UTTB 3U36B 3OJVC 4ZTPH 4U1KB 1OPGL 4FZEH 5JO5B 3U4AA 3BGMB 3KPMA 4KDTC 4PV9B 4Z78A 2EKSB 1QHPA 1J1XL 1JPSH 4GXUM 5D2NC 5JOEA 3PGCB 4YHIB 1JGLH 5C9JA 2ZPKH 3WFCH 1FO0B 4KJQD 4JFZH 5HYQA 2DLFL 4HWEL 3MLYL 4HV8B 3MNZA 1T1XA 5E4EC 1MCNA 4U3CA 4D0BA 5D7SL 5EUOA 2YMXH 2F9BT 4EDXA 3Q3GA 2DQFA 4MNHB 1M71A 1A7PL 4LKCA 1Q9KA 5TE4H 5GS3A 4NRXB 2F74A 2YA1A 5T1LA 1WZKA 4P57A 1PG7L 3DSFL 4P23D 5C09B 3VWJD 4X99B 3TBVA 4P2RE 4LAQH 3RDTC 2MHAA 4XP5H 4P3DA 5KSAC 4OTXL 5C9KA 4WW1B 2ZJSH 1SEQL 5D2NB 1T83C 1XF3A 1JMXA 1KLGB 3DVGB 5JO5A 4PV9A 1GIGL 4UAOB 2EKSA 1P5UA 5JXAL 3PGDB 1KSRA 1AFVL 3HUJB 1V05A 1V3KA 4ZUVB 3PGCA 4YHIA 1DFBL 5E4EB 3W81A 1RMFL 1DP0A 2VUOA 4HV8A 2V9QA 4RMRA 2XKSA 5JHDD 2ARJB 2VLKB 4L29A 4YDKL 4QXUH 4KC3B 1KN2H 1PG7X 1C5CH 3GSRB 1IAOB 3O4LD 4ZUSB 2A6JB 1FL5B 4FABL 4UBDC 1OGTB 1K8DB 4NRXA 4OD1L 5DQJB 3RDTB 4RMVA 1Z3GH 4H25B 5F1NB 1RUQL 5KSAB 5C09A 4ETQB 1CLOH 3L3OB 2OR8A 4FQIH 4X99A 1J05B 2HKHH 2F53B 3RVXC 1I9RL 2VERN 4OLZH 1IAIL 5D2NA 5FO8B 3C2AH 3DVGA 1CE1L 3K46A 1YPZF 2W91A 1HOCA 1VCAA 4ENED 1YMHB 3HUJA 2BJML 4MXWL 5GGVL 3ZTJH 4ZUVA 1F6LL 5ALCH 1X5YA 1X44A 4OGZA 4NFDA 3CVHL 2DS4A 4Z7OE 1V3MA 2L0DA 4EI6B 4I0PC 2C5DC 3ZT6A 3BWUC 2VLKA 3IU4L 4Z95H 3CDYA 4YHML 3GSRA 1IAOA 3ABZA 4Q0XL 2P8MA 1IAIM 5T1LD 3O3BB 2HKFL 1OGTA 3IDJB 4FQCH 4P5TC 1XR9B 1CBVH 4H25A 5F1NA 1DLFH 3BE1L 1PY4A 4APQC 1QD0A 5E8OB 3L3OA 4JRYB 1J05A 1T83A 3WS3B 1S7WB 4RDQF 2F53A 4JRXA 4J7RA 4H88H 4XCEB 1CDBA 4JVWA 2Z35B 5FO8A 4Z77B 3LAFA 1SJEA 5KG9B 1NEZG 1YMHA 4I0PB 2R15A 1Z9LA 3OTTA 1DSFH 3O0RH 1I9JH 3QXDB 1ITCA 5I8KL 4EI6A 4TULH 4XP9H 5CGTA 4LGSB 1J18A 5DFVC 4G6MH 4P5TB 2VZ1A 5T3XH 4APQB 3O3BA 4KQ3H 5C09D 1XR9A 4LHUG 1FIGH 4K3DH 4GKZA 4K8RH 3LKRB 1RZJC 4X5XA 4ZO6A 4XCEA 1CGXA 1K2DA 4XWOC 5DR5H 2Z35A 4LU5H 3R1GH 4Z77A 4LARL 4NQCE 4XBGB 1C5DA 1K8IB 5KG9A 3IRPX 4I0PA 4M1GH 3RHWF 3WIIL 4RDQG 1LK3H 2OL3L 3KLAB 3QULA 1ZGLA 2BNRA 2YKLH 3EHBC 4YGVB 3Q6GH 2VLKD 3BP7B 4CRPA 3CJJA 4KTDL 1WBZA 4ZS7H 2HJFA 3TBSB 1CIDA 5FECB 1TTUA 4NHCH 4KMTH 2KQMA 1HXMB 1NANI 1UC6A 1YNKH 4KUZL 4Q9BA 5E2TL 1H3XA 3AAZB 2F53D 4JRXD 3U1SL 1CFVL 2ID5A 5HHME 3FTGA 3T2PA 1QFWL 3TCLB 3VD3A 3OKLB 3BSZL 3WFZA 1NGQH 2DBJA 4XBGA 3TH3T 3VI3E 1KACB 1K8IA 3FQRB 2HFGH 1D6VH 2XNAB 3EYOA 4WNQA 3KLAA 1BP3B 3SE8L 4AEFA 3MLSL 4PLKC 4YGVA 4OCNC 3BP7A 1AD0B 4KZEL 2PYEB 2HP4A 3AVEA 4GQ9L 4MAUL 1QFWM 4Y7MA 3WHE0 5FECA 3FB6A 5DVOA 4OLEA 1HXMA 3TBTA 4JKKA 4WW2C 3UYRL 1NCCH 4ISVA 3L3IB 4MCZB 2CKBH 5EZLA 5KANG 2BSTB 3QCUL 2XQBL 3MRMA 3SDCB 3CX2A 3QIBA 3VXME 3GO1L 2DQTL 4I0PD 1C16B 1S3KH 2X4SB 2XPGA 1I8LA 3BKCH 3FQRA 1KC5H 2BNRD 4AEHL 3QXUA 2WINB 4PRHB 1FAKT 1L9MA 2R56L 3ZKXB 3N50A 3KPSB 2PYEA 4HBCL 5IQ7L 3ARZA 4WW2B 4BZ2L 5I19L 3LKPB 3TP4A 3DI2B 4LSRL 4WFGE 1T21A 2PXYA 5INDB 3TT1L 5I30H 4A2LA 2BY2A 3ZKMD 1MCHA 3TPUB 3VFWA 1JGEA 3RIAF 4UT7H 4P3WA 2AGJH 2BSTA 4XCFH 3SDCA 2UVFA 1H3TA 5IQ9B 4XB7A 4JO4L 4OZHF 4P4RB 3NAAH 5CMAB 4YXKH 3GHBH 1C16A 3R8QA 2X4SA 1HYRC 1I3RB 2D03L 5DFVD 3LS5H 4LEOB 4YFLF 3FCTB 2WINA 5FYKU 2X7LB 4M8QB 1FAIL 4OM0L 5FYLH 5I15H 4R4ND 3ULVC 5IFAL 5TFSL 3O6LH 1HHGB 3KPSA 1ZA3A 3DNKA 4HXBL 1DBKH 5FCUL 3T08A 3F62A 3KPLB 3GSOB 1OQOA 4ZXBC 2W9EH 1QLRB 3SQOL 1TVHB 3ZYOA 4C56B 3I3EA 4PJ7F 4XWOD 3V0WL 5EC1B 2PN5A 3GSUA 3NFPB 4OFYA 1DEEA 4YBLC 2G9HB 3QIBD 4JREC 4BZ1L 1PX4A 1TJHH 2R1WB 5IQ9A 1A6AB 1CDCA 4YHOH 2BVYA 4P4RA 2QR0A 3EHBD 1MVFA 2YD1A 3C2SA 5CMAA 2GTWB 3QWQB 3TCXA 3BKYL 1I3RA 4M6NL 2YD9A 4LEOA 3FCTA 4M8QA 4EQ2A 2PYED 2JE8A 5I1JH 5AZEL 2F19H 4ZXBB 5JUEL 3G6JE 5EU4A 3V6OE 3AMKA 2P5EB 3GBMH 2HJLB 1KELH 2APWA 3GSOA 3P0YH 2PXYD 1MWAL 5LG1A 4OM1L 2EYTB 2FLBT 4OT1L 3RIFK 1MUJB 4I48B 1TVHA 5F3HB 3NIGE 3WD5H 1QSZA 2FWOA 3FN0H 4C56A 1QA9B 4YBLB 1UWGL 2C1PB 2X9YA 3RNQB 4I18C 5GRWA 3WO4C 5EC1A 2X09A 4X7SL 1BIIA 1SVZA 3SDCD 2DLEA 3U9PL 4TSCL 2G9HA 1JGUL 5J57B 1F2QA 3MBEA 4TOYL 2EIDA 4PLKD 2GTWA 1HHIB 1IEAB 2RJMA 1Q9OA 3BDYH 3A0OA 4F9LC 2PO6A 3WNLA 1RUKL 5IB2A 1RVFL 1T80A 3KPSD 4G9FE 1KUMA 5E5MA 4I3GA 3FRUA 5IW6A 1F8TL 1RPQA 3HMWL 4ZXBA 1N59B 5J4MA 3M07A 3MJ9H 5BJTA 4RRPA 2P5EA 4UT9H 2HJLA 2BXZA 1CU4L 3MLZH 4FQXB 1EXUB 3T04D 3VRIB 3OKNB 1M1SA 1MUJA 5ACZB 4I48A 2FHCA 5EOCL 4O2FB 1UZ8A 5DHXB 4AIZB 1QA9A 2GFBA 4JZNA 2C1PA 4ONFL 3RNQA 2V9TA 4OFYD 4UILH 1ZSDA 3RVUC 1WSST 4FQ1H 1KFAH 4Y19A 4PY7B 5DRWA 5EBMB 3ARDC 5FYKL 4IDJH 5KVFL 1G6RH 3UTZB 5BVPH 1HHIA 5F93C 3V79C 4W6YB 4POZC 1MOEA 3BPLC 1G9NL 4PGCA 2W0FB 3VG0L 1QO3B 1GHFL 5HGDB 4HK3N 3FFCB 2I25N 2R0ZH 2J88H 1KPVA 1MIML 2CO6B 4ZO7A 3D0LB 5DVLA 5HGHA 1J10A 1N59A 1LO2H 4M1DH 1O7SA 3NCMA 2DLHA 2DQCL 2Q3ZA 4BFBD 2CGRH 5E6ZA 3DV6A 1CDGA 2R0WL 4FQXA 4QTIH 4C56D 3V2AR 3OKNA 2DQHL 5JOPE 3TO2A 1KTDB 3D87B 3PGFL 1JF1A 4NNYB 4O2FA 5DTFB 4OFVA 1CE6B 1MPAH 3MBED 2JK5A 3EYFA 4LLUB 4DN3L 5DD1H 4Z0BL 4PY7A 5DC9B 4WTXA 3SEPA 3BPLB 5E9DE 3CDFA 5C08A 4EZMA 3WFDL 4LNRB 1P6FA 2PO6D 4NNPL 1FNGB 4PPTA 1OAZL 5JW4N 4PJCA 1QQDA 2UZIH 1QO3A 1VHPA 1NGPH 3AS0A 4LQ1A 5HGDA 3FFCA 3UJTL 4ZXBD 2C26A 4LIQL 5E5UB 4NN7C 1QBAA 2P5ED 3D0LA 4LDLB 2VWEC 1ZEAL 2MMXA 3EYQD 3PHOB 5HGGS 5LGHL 2W9DL 3JUZA 1AI1L 1IKFH 1GYAA 1QBMH 1S7XB 5D5ME 3FB8B 5DXWA 3QDJA 1EHNA 2BSRA 4ZNCD 4XP6L 4MLIA 5F8QC 2EE2A 3V52L 5GJTL 1R5WB 4Y19D 1HXYB 4PFEA 3QUMB 4LLUA 4ZFOA 4HGWB 3O41A 1IT9L 1MFBH 4I3SH 3H7BB 5IJKA 4LNRA 4Y8DC 4N0YH 2XTLA 4C54A 3GSWB 5BV7C 4NN7B 4EVNB 3FRPG 1YA5A 5DS8A 3LPFA 5ICXB 2XY2A 4JPIB 2DQUL 1S9YA 4O58L 5D70L 1GPOH 3TF7C 4FQXD 3PHOA 1YQVH 1BGXL 1GVIA 4G8IA 2Z92B 1MSPA 1OCWH 5FIEA 2IFGA 2B0SL 4UTAL 1B90A 4LHJB 3NA9H 3UDWC 3QUYC 4QXGL 4PB0H 2BXYA 3MUHL 1MCCA 2OXHA 4JGMA 3MCKB 1MCKA 5DUPH 2FJFB 3PXHA 4U6VH 3OBAA 5C08D 1YNLL 4HGWA 5BV7B 4PBXA 4M00A 3H7BA 4XNZC 3LMJH 5IHUL 5D7KD 3IFLL 4OV6F 3KJ6H 3L1OL 3GSWA 4TUKL 4JM4H 5J9PB 1DQMH 3FFCD 1AJ7H 3PWLA 1YC8A 5TPWL 5E95B 4Q6YA 5HVHB 1FC2D 3NBNA 1U6AH 1F2XK 3A6BH 5HYSG 1T2QL 3V5KA 4CW1B 3RVUD 4ZTOL 1RIHH 2DIJA 3QDJD 3O6FA 2FATH 3SDAC 1P9MA 1WBXB 3CU1A 5DWUH 1JNLH 4EEEA 5BQ7B 1DZBA 4WY7L 5I1AB 2FD6H 1NGZB 4DGVH 4XNZB 2OYPA 1KPUB 3H0TA 3O2WH 4Y4FB 2JJSC 1KCUH 5C0CA 1RUAL 3PHSA 4LSQL 3TO4B 2B4CL 4H1LA 4CAGA 1TITA 4XAWH 4WDIA 3S35H 3S97C 4N0UB 43CAB 4DN4H 3ARWA 1T6VN 3HR5B 3LH2L 1JGLL 4WHTA 1MHEB 4EN3C 3W39A 2LV4A 3WUWG 1RZKH 4XMLH 5FA4B 2P24B 3SDAB 3FB5B 1YEHH 4CW1A 4LL9A 1QVOB 3QEUA 2J1KA 3UDWA 1EVUA 1LP9E 1RD6A 2BMKB 2WIIA 5TE4L 5ADPL 1NDMB 3TT3H 4XVTH 5I1AA 3MLRH 2VZUA 1MI5E 4LHQB 5GRZA 3O3UN 3NABL 2LE9A 4Y5VC 4LAQL 2A77H 4Y4FA 4XI5C 3QA3B 4PJHE 1S9VB 3BDXA 4X4MA 2FJHB 3CK0L 1JGVH 3TO4A 4J8RB 5HHOE 5KSBA 2YSSB 3ZDXE 3EW3B 4OB5H 2QHLA 3VGAC 3EFFB 4HIJB 1Y6KR 4EN3B 1NAMH 3LKQA 2GHWB 1FBIL 3VJ6B 43CAA 4P2RB 5JW4M 4NM4H 1CWVA 1MHEA 1OAXH 1EO5A 4HS6B 5FF6B 2EYRB 4XHJC 2FGWH 1WISA 5HI5D 2P24A 3FB5A 2VAAA 4QXUL 3O6FD 1QVOA 1I7RB 4HF5H 3WJJC 4RISH 5DHVB 4ZFFB 4MXQD 2BMKA 4GAGL 1S78C 3V6FB 2NY5C 1FFNB 1NDMA 4PJAF 3S5LG 4NGHH 4F80A 4Y5VB 5FKAB 2WANA 1UCTA 1AR2A 3K81A 1CLOL 5GQBA 5C0CD 4RWYL 3MROB 1EEYA 2HKHL 2AK1H 1UJTA 3D2UB 3X14A 1S9VA 5DZOA 3NFSL 2A6KB 2ZSVB 2A2QT 1PYWA 1NCWH 3QT2A 2YSSA 3CAFA 1C7TA 4NT6B 4U0RC 2OP4L 3EFFA 4V2BA 4EN3A 1FPTH 1NGWB 1MRFL 4J3WA 5EU6E 3DPBA 4P2RA 5CP3A 5ALCL 5C8JB 2HMID 2JKXA 3HE7B 1JYNA 1VSCA 1OP3K 3DX9B 5IW1B 2EYRA 4A6YA 4I3RL 1IBGL 2V2WB 2FBJL 4JR9L 4R2GC 4Q6IA 5JR1H 5EU3A 4S1SH 5K93A 5DHVA 4ZFFA 3P73B 4ZUUA 3V6FA 1FFNA 3BHBB 5TQ0H 4GG6E 3BP4A 4Y5VA 5FKAA 1CBVL 4NQUA 1IFHL 4O51B 1ZS8B 4L1DA 4Y4FD 5D1XB 2NZ9D 3MROA 5J3HD 4NKOB 3TO4D 4U0RB 3D2UA 3VFTA 4H88L 4JHZA 4ZUWB 2A6KA 1AKJB 5JPMB 4NWTH 3SN6N 3OKKB 3ZSSA 3HHRB 4NT6A 5F7FA 1EFQA 1FSKC 6FABH 3LHPH 3WIHH 1B0GB 1UKTA 1TTGA 5C8JA 2A38A 3HE7A 4HWZB 3JV5A 4ODHH 4TULL 3VD5A 3DX9A 4XP9L 4R2GB 3WJJA 5IW1A 2VKXA 1W72H 5DF0A 4IOFC 1MNUL 4HFUH 2V2WA 4B50A 4G6ML 3RGHA 1KIRB 3HNTH 4F57L 1JYVA 4NQXB 1NCAL 5E5RB 5I1HH 3VFSB 5CSZA 3P73A 3P3YA 2JB6B 4QWWD 1P4BH 4K3DL 2QBWA 4GOSA 1RJLA 3MA7B 4HEME 5D1XA 5E2WH 3L5HA 5TF0A 2C1OB 2RAMA 4FOMA 5CEXB 1F3RB 1FSKB 4JQVA 5C2UB 2CSPA 3T8XA 1S7RB 1DN2A 1S7SB 1UZ6F 4EN3D 4P48A 4P2RD 3PG2A 3F7QA 3NA4A 4AM0B 4M1GL 3RUGF 1B0GA 1LK3L 4Q9RH 3Q6GL 1NCDH 1QUNA 3N9GL 2YRLA 1NLDH 3QR2A 4LLAA 4Z7VE 3D69B 4NQCB 1MCEA 3GMQB 1MREH 4TSBH 4JKPH 1U8HB 2EECA 3VFSA 4KMTL 3PIQB 2FECL 1CQYA 1P6AB 2WNGA 2JB6A 4JO1H 3D2UD 1JZ2A 4GW5A 2J6EH 2C1OA 1CL7I 25C8L 3WFEL 2JB5L 4EUPH 5GS2H 4AT6A 2V2TA 4K23L 3OAUH 4X0KB 1NGYA 3C6LA 1S7RA 2HG5A 1BWMA 5MEQA 3GRWH 4I9WE 1DN0B 4HGKC 2HFGL 1MCBA 3HE7D 3W9DB 3SKJH 2AXJA 5GGSB 1X9QA 3EZJB 1OTTC 4U6HA 5DVNA 2A74A 5FAAA 2R9HC 1U8KB 3PDDA 5A3ID 5C0AE 2ICWB 2QQLL 4HJ0C 4JFQA 3D69A 4NQCA 2NY2C 5B8CC 4PBVC 2VOTA 4X7TB 5D6DC 2GUOB 4XGZB 4XNXL 1U8HA 1OSPL 3LPWA 3IAQA 5D1XD 4MJ6A 5IWLC 4YIQA 1DANU 1UM5H 3D9AL 2YN5A 3L5XL 3RBGA 5DQDH 4I5BB 1PQZB 1I1FB 2F54E 5AG8A 1XCQB 3C08L 1IARB 1MH5B 2VXVH 4HWUA 5GRJH 3OR6A 1S3KL 2MTPA 1DN0A 3GNML 2VXUH 3BKCL 4PJ7A 5FDWB 3W9DA 1KC5L 3GKWH 5E1HB 4EI5A 4CNIB 3BEVB 2VAJA 3EDJA 5B8CB 3EGSB 4NQDE 4UIKH 4HUKB 3VXMB 5LXGH 2ICWA 4JY5H 2NY7H 3SDYH 1I75A 4QRUB 1IGIH 4OKVB 1ZXQA 2VB5A 3OKDB 1HK6A 5I30L 3F8UB 4XX1G 4C4KT 2JCCE 4YHPA 3W0WA 5C07E 1MCQA 1YEDB 4Y2DC 3C6LD 2AGJL 4CMMA 1INQB 4XCFL 1OTUC 1JTTA 4HMEA 5I1KH 1XCQA 3IXAA 1A2YB 4LLMB 2CRIA 4DVBB 4YUEH 1WLHA 2YPVH 2X5PA 5D7IA 2H41A 4IOFD 3LS5L 1GC1H 5FYLL 3QWRA 5I15L 3BEVA 1I8IB 4GXVH 3EGSA 3O6LL 4NQCD 2EDQA 1K5NA 1I7ZB 1MFEL 4M4PA 1DBKL 2W07A 1J8HA 4QRUA 5IWLA 1CLYH 1B0RA 3QDAA 4OKVA 4JE4B 3CFCL 4M9PA 4NHUB 1G7PB 4Y2DB 4NZUL 5D96C 1A6TB 4CKVX 3RWIA 1XZ0B 1MRCL 1AQKH 1YEDA 3NN8B 1INQA 3NPZB 4HUWB 4NM8H 5E0QA 2XY1A 5EUKB 1TJHL 4LLMA 5I0ZA 4YHOL 3V6OC 1CLZH 3C8KA 5AYUL 4FHBD 5F1SA 1AXSB 5F1IB 4EI5D 1FFQA 4WO4C 1XCTB 5B3JE 3I2CH 2OZ4H 5JLZB 4B7IA 4ODVH 1HZHL 5E70A 2VQ1B 4WV1C 5GISH 2F19L 3ECBB 3EYSH 5GIRB 1G1CA 4TPRH 1U8LA 5MI0C 3GBML 1OSZB 2FL5B 1KELL 1EMTL 3P0YL 1ZLUK 1EHLL 3MRGB 1BVLA 1JNNH 4NHUA 1T5XB 4JFPB 3WD5L 1FLTX 4J3XA 3W0WD 4F7CB 2JELL 1A6TA 4JG0L 4OQ1A 1XZ0A 1ZTXL 3G6JB 1N5YH 1E28B 3BAEH 3NN8A 4FNLH 2NLJB 4ZO9A 2BOBB 4HUWA 5C0ND 4OZGF 1BJ1J 5EUKA 1G1YA 3F7VA 4WO4B 4FFWD 4MAYA 5CD5D 2ZCLH 3LS4H 3UEZA 1AXSA 3BDYL 4PJGF 3QWRD 1ZVYA 5JLZA 3EOAB 2ESVE 2FSEA 5D7LE 3X12B 5MI0B 2H6PB 2VQ1A 5T3ZH 4LLDB 5GIRA 1F5WA 1J8HD 4JLRA 4YGAB 3QQ9D 4BJLA 3MSPA 1OSZA 2FL5A 4U2ZA 4WI6A 1UCBL 4L8SC 2CK0L 4HIHB 2VXSL 3MRGA 1T5XA 2AXHA 4G9FB 1F3DJ 3NCJL 5J7CC 5DRNB 3W82A 5DA0B 2CO7B 4PJ8A 4OBRA 5GHWL 3G6JA 2CRZA 3WS6A 4D3CL 1C08B 5K9QG 3BRFA 2YHGA 3LIZH 2VZ3A 2EDYA 4W4OC 4YBQC 2CMRH 1KCVH 1RHHA 4K3JH 1AHWC 1G6RL 1AO7E 5BVPL 4ORGB 5F3BA 3SY0B 1QFUH 3RPKA 2RQ8A 5FB8A 2XZCL 5ALBH 3LQZB 4L9DA 4H0GA 3EOAA 3MLVH 4GG8B 1I1CA 3STBA 3RL2A 4MA8H 2AJXH 1ZLWK 1L9NA 5E8NB 2ICWI 1KN4L 4LK4A 4L8SB 4LLDA 1G0XA 2B1HL 5IVZB 3AFLA 5F7EH 4M1DL 2E9IA 4BA8A 4MVBD 4M61B 2X05A 4R4FL 1MF2H 4G6KL 2R69H 3HNSL 3QAZC 3SKOB 4JFFA 3KJ4C 3FT2A 5ETUA 1MLBB 4MNGE 3EDDA 1T1YB 3ARYA 3VRJB 1PLGH 5B38G 1MPAL 4HPOL 1AHWB 5T33L 4ZUTB 4MQ7B 4MAYD 3RP1A 5DD1L 3ULUL 3GIVB 5IG7A 2NY3C 2Y6SC 2A73A 1YEFH 1N5AB 4ORGA 2ZUSA 5DT1L 4D9LH 5L2JB 3LQZA 1YMME 2UZIL 3DV4B 4PGEA 4GG8A 4PJ9A 4PUBH 3VFOB 4GMSH 4JANA 4LLYB 3CFKB 3QJHA 5E9DB 1J0ZA 5IGXH 4X98B 4K3HA 4PRNB 2IGFH 3QAZB 4LQFH 5CEYB 4HK0B 5DJXA 3KJ4B 1OWRM 1NC4B 2N1KA 5IMOB 3EYUH 3FQXB 3QNXB 3SKOA 5F9DC 3GSNH 1QBML 1WWCA 4PJ8D 2QADD 1G9MH 1MLBA 4N68A 5BOPA 2H8PA 3S98A 4LCIL 4KI5F 2NY3B 1T0NB 2Y7QB 4L4VE 1MFDH 4MQ7A 3GIVA 1Z9MA 4XMPL 4I3SL 5C7XH 1I3GL 4XCYB 3ZYJA 5D5MB 1WTLA 3MUGB 2CXKA 3DV4A 3P9MB 1WAAE 4OLVL 3VFOA 1DQJB 1D5BB 1FORL 1YEIH 4LLYA 4JY4B 5I6XB 3W5MA 4N9GB 5MP6L 4KHXL 5E9DA 3F58H 1GPOL 3BKML 4X98A 5FYJH 5LVEA 1YQVL 5CEYA 1IGMH 2BZDA 2NTFA 2IAMA 1NC4A 3ZSTA 1IGTB 2FX7H 4OZFB 3QPQD 3FQXA 1DANT 3KDMA 4QHLB 4OQTA 2AK4E 2CR6A 1QLEH 4OLXL 1JWMB 3NA9L 4KXZI 3MODL 4PB0L 4K3EH 35C8H 5J8OA 1T0NA 2Y7QA 2DN7A 5DUMH 5DUPL 3VD9A 4U6VL 1TVBA 5JORB 3L3HB 3EJYC 1PSKH 3QXWA 3RHWK 3F7RA 3HZKB 3C5ZA 4OCYH 5IB3B 4PJ9D 3RA7H 2XG5A 1H3UA 2F5BL 2WP3O 1PGRB 3VGFA 3P9MA 1JRHL 3MRJB 3B5GA 1J12A 3OPZH 5K33A 3CZFA 1D5BA 2R2HA 4JY4A 4XC1H 3ZE2F 3QWOB 4JFEE 3A6BL 1HNGA 3H3KA 2A9NL 3UZQA 2FR4B 3MRCB 3QDHA 3Q2CA 4PJIF 3BPNC 3KPNB 3T3MF 3SCMC 4QHLA 2FIKA 4OF6A 4ZOBA 1ZMYA 1JNLL 1JWMA 3HZMA 5DJAB 2ENYA 1NBZA 2Y06L 4DGVL 4R4BB 2E7LA 2Z31A 5MEPB 5AZ2L 1QR4A 5JOPD 5AD0B 1WK0A 1MFAH 4HH9B 4WHCA 4QYOB 1MJUH 5J6HB 5FYKE 3DLQR 1FZMA 1TVDA 3IJSB 4JVUA 3IU3B 3EOTH 2FNBA 3FONB 1WWAX 4PJAA 3S35L 4PREB 3MRJA 5EO1A 3MCLL 4DN4L 3CC5B 1XGUA 5E9DD 5CIPH 4HJJH 4CL7A 1F6AB 3CH1B 3M1BA 1J0JA 2VDMH 3ULSB 4KKBC 3BPNB 1BIHA 2EDRA 1RZKL 4AMKH 2R1YA 3QWOA 4XMLL 2IAMD 1NC4D 3OKMB 4Q58C 3SCMB 5EBWB 2QHRL 3QEQE 3MRCA 2Y36H 3K2UH 5DLML 4P2OC 2IG2H 1HHKB 3LEXA 4L3CA 5DMJB 3TT3L 2NY3D 2Y6SD 3HPJB 5DJAA 3MRRA 1FG2B 4RSVA 2BP3A 3UYOD 2ICEA 1D7FA 4EQ3A 1BF2A 1MCWW 2A77L 2RCSH 5AD0A 3E8UH 4PLNC 3B5TA 3S35X 4HH9A 1N0LA 1LP9B 3SOBH 4QYOA 5CJ5A 5I1IL 1X5KA 3C5ZD 4FQ2H 5AWNH 1MJ7L 3MRHA 1MI5B 3CC5A 5EPMB 1GOFA 4PJHB 4LIQE 3HCVB 1OAXL 1RZGB 4KTEL 2IEPA 4DOHE 5TE6L 2UWEE 4P2OB 5F1KC 5HHOB 2EDTA 3S36H 3OJDA 3VDBA 4P5MB 3KYKL 1HHKA 1SHMA 2ED7A 3RIAK 2IQ9L 4JJHA 3V5HA 3S34L 1BREA 2Z31D 1D9KC 4QHKJ 1OAKH 3ILPA 5SWZE 2FHFA 1OF2B 2YUZA 1XGQB 2AK1L 1FNHA 1V3JA 4NFBA 1LP9A 2D31A 2VDNH 5CILH 3BMWA 1HHJA 4P5KA 2VLLA 1Q72L 1F11A 5DJ8B 4P46C 5IHLB 4JHWL 4XAKE 3ZDYF 1UWXH 1MI5A 3VE0B 4J2XA 1UXSB 3VCLA 1MY5A 3INUH 3BGFC 43C9B 4E41E 1RZGA 1LNUB 2GI7A 4YXHH 3U82B 4CVUA 2LVEA 2OR9H 4P2OA 5HHOA 2EYSB 1QOKA 5FUZH 3JV6B 1I8KB 1EAPB 4M3KB 1Y0LA 1SM3L 1D9KB 5EU6B 4S1QH 4P5MA 5C0BA 5HI3C 4P9ML 4G43B 5TQ0L 2WIMA 1PDKA 2KL6A 1YYMH 1OF2A 3DUHA 1U9KA 1G7HB 4P46B 3JWDC 3ARRA 5FA3B 2QSVA 3VRLE 4HCRL 1JHLH 2AV7B 4FXGA 3SO3C 4GG6B 3BGFB 4LLQB 3QXTA 5BCAA 2BNQE 4Z18A 4ZG1A 1UXSA 3WIHL 4HLZG 4QHMB 2RGSA 1ES0A 1KNOB 43C9A 1LNUA 5H94A 2I60L 3P4OA 4ONGL 2EYSA 3BXNB 1W72L 1I8KA 4HFUL 4YQXH 1JFQH 4L3EE 1UADC 5IMLB 3MLXL 4OGAD 1D9KA 5EULV 2R4RH 2BOCB 2D3VA 4NC0B 2ADGA 1H8OA 4NPYA 4X6FB 1CZ8H 1ADQL 1VGEH 1QFHA 2QLVB 5FKPA 1N3NA 4OKDA 1A3RH 5E2WL 4DCQB 3AS3A 1IQWH 3SO3B 2ZKHL 1G7HA 4HPYH 4O02L 1QTYT 5FA3A 1MI5D 4GG6A 1NMAH 2AV7A 4KKBD 4EUPG 3TVMA 3VFNB 1YEGH 5EORL 3TV3H 3RVTD 1RZIB 2NXYB 3F5WA 3QUKB 1KNOA 1M05B 1MCRA 3QZWB 4P2OD 5HHOD 4Q9RL 1BPVA 1DBMH 3KNBB 2CLVA 5JZ7D 4HDIA 1NLDL 2AJUH 4HWBL 1R3HA 5C0BD 5IMLA 1LO0H 4KKLC 1E6OL 3DUSB 1OQXA 4FFZH 4X6FA 5IVXE 4JO1L 1XMWA 3WLWC 4Z7VB 1FC1A 4BKLB 5GGTH 3OAUL 4HJGB 2V7NB 1NKOA 3DX8B 4KU1A 5HD8D 4PJFE 5D71H 3HAEA 3U4EB 1CIUA 4JM2C 3QDMA 4QGYA 2R29H 4KQ4H 1RZIA 3SKJL 1CFSA 3OV6A 2OTPA 2BY0A 4KV5E 2HVKA 3UC0H 5HHNB 4PRAB 2FEEL 2BVQB 1D9KD 5DEFA 2V9RA 1XR8A 3NZHH 5SWSE 2DM4A 5TDNB 4E42B 4ODTL 4G42B 1NLBH 5JTWA 1UM5L 3WKMH 3DX6B 3JTTB 5C0AB 1LK2B 1DDHB 5DSCA 2Q7YB 1PAMA 4AENB 1KJVB 5DD6A 3WFHA 4MWFB 4HJGA 5E24E 1FN4B 4JM2B 2V7NA 3MJ6A 2F5AH 2HRPL 3TVMD 1HKFA 5HPMB 1I4FB 1F42A 3IJHB 1UWEH 3ZKND 3BQUC 4K55A 2VDOH 3GKWL 5JDSB 3CFBB 3QFDA 1ORSB 5HHNA 2NY6D 1EFXB 4X6EA 4UIKL 2KBGA 3T0EE 4GH7B 1S9XB 2BVQA 5LXGL 3LY6A 1Z0NA 2NY7L 1JVKA 3GHEH 4V1DE 1TZIA 3SDYL 4NP4H 2M1KA 2VDLH 5FHAL 1GL4B 3VD4A 3O3AB 3CVHB 4DVRH 5TDNA 4E42A 1I85C 1PVHA 2V17H 4G42A 1B0WA 4NQDB 3GJFA 5EZOL 3X3GH 3OB8A 1CXKA 1LK2A 4HKZB 1DDHA 2Q7YA 2YD3A 1KJVA 2YD5A 1RIUL 1XGRB 1OWWA 4MWFA 4F58H 2EDEA 1X5HA 3BQUB 4QRSB 1NANH 3HTLX 1ZT7B 4YUEL 5J11C 1I4FA 2YPVL 3QDMD 2NXYD 3D48R 2WBJC 4KK9C 5LKNA 3UJJL 2JCCB 3MV9E 3UP1A 2DDQH 3G04B 5C07B 2F58H 3FQUA 2V5SA 1TDQA 3TZVC 4NRYB 3CFBA 5JDSA 3NIFF 1LO5B 2VN7A 4GXVL 1XGTB 4XXDB 4IRSB 4X6CE 4KMLB 2CD0A 3ZZ1A 3BIAX 2VZTA 4H8WH 2DLTA 3BD4A 2VDQH 1CLYL 4M6OL 3GK8H 1F4XH 4PJGA 5E99H 4U1NA 3O3AA 1P5VA 5DRXA 4JPVH 5GS0D 2E6PA 3S3PA 4GKOA 4NQDA 1TJGH 4HKZA 5DURB 1K3ZA 1EJ6A 1FGNH 5J11B 1KJMB 2PR4H 1MJ8H 4NM8L 1IC4H 1XGRA 2QQNL 4QRSA 1ZT7A 1CLZL 4LSTH 1T3FB 5BW7C 5EOQH 4N5UA 3B2VL 4KY1H 5I18H 4G6JH 1ZHNB 3G04A 3VH8A 3I2CL 2OZ4L 3NVQA 5F88A 2G60H 4NRYA 2V2XA 4HC1A 4ODVL 2GW5A 3H9ZA 1XGTA 2Y23A 2FIRT 1NEZB 4IRSA 2XTJD 4Z8FL 3EYSL 4I9WD 1TIUA 4WFHD 4Q97A 4BQBA 5J12C 2ADJA 1ZLVH 4QHNB 4MJ2A 4XNUH 2OL3B 3OL2A 1JNNL 4MJ5B 5DMIH 1R3KA 3PHQA 4U1IB 1OB1B 3ZKSD 1WC7B 4NDMB 3QEGH 1YEKL 3BAEL 1KJMA 4X6DE 4R7NB 3SE3A 2QSQA 4LHUB 3ES6A 4P4KC 2G2RB 3WNMA 1UH3A 1CTOA 1T3FA 1UM4H 3KPTA 3RVVD 1IQDB 5KZCB 3BWAA 3LS4L 4FFVD 4NO2B 2UZXB 4MS8D 4MHHI 4TTDC 3CVIH 4U7SA 3HE6C 2FH8A 5E2VL 3UTSE 3X17A 1NFDE 3HNVH 3AC0A 3G5YB 3V5DB 5I1DB 1H3GA 3RRQA 5D1QA 3ROOB 4O4YH 5I75C 4QHNA 5ITFB 2OL3A 4XPAL 4NQDD 1RJCA 2ESVB 2H45A 5D7LB 5FYJU 3VFGH 3ILQD 1OB1A 4P4KB 5B21A 3P0VH 3MV8A 4NC2B 4JAMB 2CMRL 4IMKA 1JUFB 1KCVL 2VISB 5EZIH 4YXLL 3HLAB 3RVWC 1QFUL 3HE6B 1X5XA 4PJXF 3HFMH 1KCLA 4Q74A 4IRSD 5T1KB 3VI4F 5ID0A 3LN4A 3WHXA 4I2XE 2MFNA 3BD5A 5FXCH 3RUGE 5IMMB 4KK6C 5I75B 3G5YA 1AO7B 2ITCA 3O2VH 3GMPA 4Q7DA 4ZOAA 1A47A 1CT8A 3ROOA 2YBRA 5L2KE 1MF2L 4JVPA 1X5JA 2R69L 3WFBL 4NWUL 5D7LA 1YY8B 3P2TA 1BLNB 4C59B 3ZYZA 5DURD 1P7KB 5DO2C 1JK8B 3FFDB 5FM8A 3UJIL 4KK9D 1F97A 4WU5A 3IFOB 3V9FA 4JAMA 5ACLA 2VL5B 1Q94B 1QEWB 4KKCC 4GRWH 1YEFL 4I1NB 3HLAA 3DVNB 4OIIL 1CGSH 3FT3B 4MNGB 3HE6A 2X9XA 4D9LL 2VLRE 4WI3A 3GGWB 4LBEB 3LKOB 4YR6A 1L7IH 4POUB 5T1KA 5FYLE 2XZZA 4OSUL 5IMMA 4FQLH 3CPLB 3LCYA 4I77H 5D1QD 2VO5A 5IGXL 2XWJB 4P2QA 4XXCA 5JOFB 4XX1E 3UROR 2YWYA 1ED3B 1YMMB 1RJYB 3EYUL 3T77B 3VMNA 5IEHB 2WP3T 7FABH 1YY8A 1U8OB 1BLNA 2GJ6E 1EA9C 2IALB 3MV8D 2EDHA 1P7KA 1L7TL 1JK8A 3FFDA 3G08A 4O2EB 5BO1L 3BW9A 1Q94A 5KZCD 3DXAA 3AROA 1QEWA 3L7FB 3DVNA 3I6LE 2EDFA 4MNGA 4NQTA 4CVZB 1P7HL 4Y1AE 4NZDA 2FH6A 3GGWA 4WRLA 3QCVH 4KI5D 4NOBA 3LKOA 2XZQL 5EU7E 2NR6C 2X70A 1OP3H 4L4VB 3SE9H 2OJEB 3WXWL 1YEIL 2GCYA 1MHCB 4M02A 1I9IL 3H9YA 4K9EH 2XWJA 3O11A 1NCTA 3VXRA 2AQ1A 1ED3A 1YMMA 2W0LA 4IS6B 5D7LD 1CK0H 1RJYA 4OCRH 3S96B 5IEHA 4LVOC 4Z76B 3B6SA 4Z0XA 3S4SA 3VFPB 4ODWB 4KUCD 4K3EL 2W0KA 1H8SA 35C8L 3TYGH 1FG9C 4O2EA 1NSNH 4L3AA 5T5FH 2DQJH 1MWAB 4D0DB 3DJ9A 3HE6D 2GJZA 2AK4B 3OZ9H 3SHSA 1CFQA 4CVZA 4KVCL 2FO4B 4OCYL 3RA7L 5T1KD 3C87A 3RY5A 2OJEA 2W65A 5DJZB 4U1JB 4JFDE 4GBXB 4AYFA 2YK1L 5J56B 3S88L 4PBWD 4P2QD 1A9BA 3AM8A 4QKXB 4B53A 1RAMA 4LVOB 1ZHKB 2DOCA 3D0VA 4M6ML 1F00I 3IDNA 4LSPH 4FP8H 3VXPB 4DTGL 4IS6A 5FO9A 3B8SA 2HFEB 4IRJA 1KIUA 2GY7B 2Q8BH 1CGVA 3VDAA 3CD4A 3VFPA 3RWCA 4RFOH 1BAFH 5A2FA 3U7AA 5JQ6L 4JFEB 2OQJB 1IGFH 4D0DA 2G75B 3AGVA 4WU7B 4Y5XC 4PTUA 3QHFH 5BRZE 4RNRB 2BY3A 2FO4A 2R2BB 4EJ1C 4U6TA 5C2BH 2R1XA 1QFWI 5DJZA 4U1JA 2FLRT 4GBXA 2VDML 4AMKL 3VXRD 5IB4B 4JN1H 3OAYH 2EEBA 2J8UE 1YMMD 5CBAB 3TJHC 2Y36L 5DO2D 3DRQB 3VXPA 4ELME 3O6KH 3WDJA 3L7EA 2HFEA 4M43H 2KUTA 1MEXL 3SDDA 4F37K 1N7MH 5T1DH 1F90L 4HT1H 4KKCD 3QRFM 4JFEA 2IH3A 4Y5XB 4M7LL 4ZSOA 3QEQB 1KBGH 3E8UL 2G75A 3ULUE 5F89B 2F8OA 3SOBL 1OD7A 4WU7A 1QRNE 5HBBA 4P2CG 4GAYA 3D85B 3F6IA 4L4VD 2R2BA 5I73C 2B2XH 1KGCD 4MMXC 1GXEA 3S6CA 1ZA6B 5I16B 4X7EC 5FUOH 1WTGT 2ZUTA 4LOUC 4NN6C 5IB4A 3QRGL 3GRWA 4MD5A 1V3LA 1WFTA 3E6HB 3DRQA 4IRJD 1MELA 5D8JH 1BX2A 1EK3A 1TJIH 4PJDF 1OARH 4P9HL 4GRMB 2AJ3A 2YD7A 5I1GH 3N0PB 2AJSL 3JTSB 4LSSH 1JNHB 4YZFF 3CLEL 4DOHB 1UACL 4LSUH 1F13A 2UWEB 1DBJL 5EIQA 2FX8H 4Y5XA 4N0CD 4HS8H 3BO8B 5FUCE 3QEQA 3RY4A 5E7BA 5I73B 2VDNL 5B39B 3N1QC 4ODUB 4MJIA 3PUCA 1WFNA 3HB3C 4GBXD 5SWZB 1FL6B 1R5VB 3SGJC 4NN6B 1T03L 2Z93A 2P45B 3QXAA 4YK4C 4K7FA 4X9BA 5ID1A 3S36X 2Q76A 2AV1B 4NUJA 3MFFA 5JW4Q 2YPLE 4Y16C 2OR9L 4KK5D 5LWYL 3NCEB 5FUZL 1MCWM 1G7QA 3E6HA 1NUFA 2EIBA 4Z7WF 3SDDD 2I5YL 4HUUB 3VA2C 1EUUA 4GRMA 2DQGH 4BH7B 1RU9H 3GI8L 1JNHA 4E41B 4JFED 3VXQA 4J4PC 4HUXA 1NBVH 1E4KC 4L4JA 1MIEL 1MVUA 3MFGB 4XBEH 3GB7B 1AY1H 2MJWA 1O5DT 4XP4L 5IW3A 5B39A 1UT9A 1JHLL 3BEWB 4YK4B 3GJFK 2DKUA 3EIFA 4Y16B 2BSED 1VEMA 3C5JA 1DUYB 4NYLA 3S3JA 1HSAB 4XVSL 2NW2B 3R06B 5A40E 4ERSL 1QPPA 4JG1H 1KCSH 4ODSH 1JFQL 2B4CC 4AL8H 3VXSA 1CFBA 2BNQB 2CIKA 4UINH 4HUUA 4XBPA 7CGTA 4M48L 5ICZB 3RWJB 5HGBA 2CUIA 3QEQD 3SJVA 3R0MA 1A3RL 1A7QH 1BQHG 1IQWL 4L3EB 2YR3A 5F6HJ 4PJBE 1S5HB 5E8PB 4FRWA 4MJID 1KXTB 1HHHB 3EUUA 3TNMB 4WUUE 3CLFL 3MO1B 3SGJA 4LEXH 2DQEL 1NMAL 1KIQB 4Y4KA 4WUKH 1D5IH 1EEZB 3WJLC 3IDUA 4WI2A 1XF5A 5E08H 1BEYL 1DUYA 1N8ZA 4L8DA 4M7JH 4PJEE 5KVDH 1QR1B 1ZLUH 2APVA 3TWCH 2AJUL 2R4SL 3RGVB 4YHNB 3MNVB 2BNQA 4J4PA 1FL3B 1KCRH 3QUZA 4ZNEE 5EUOF 5HYSB 4N8CH 4D2NA 4LVNC 2JTDA 4JHAH 1ZANH 2YEZA 4U1SB 5ADOH 3G5VB 5EWIL 5I2IB 2HTLD 1INDL 1VADB 2QQKH 1KJ2B 4L3EA 4OIAA 3HRPA 5GGTL 4MZ3A 1CD8A 4FXKB 1S5HA 5DRZB 5E8PA 4M7LT 4G7YH 5DEZA 1HHHA 3TNMA 3MR9B 3MO1A 4AG4L 5IVXB 3DRTB 4OLUH 4Y5YC 3DMMA 4KQ4L 4PGZA 1JTOA 4FFYH 4KROD 3PWPE 5KVEL 3NCCB 2EZ0C 1BF8A 4FG6C 2RFXB 2V5TA 1OAUH 4RZCA 2GK0B 3S7GA 4S1RL 3GMOB 1ND0A 1TZHB 4I8DA 4PJFB 4ZD3L 2DYPB 3GMMB 3VXSD 4M3JA 3RGVA 4LVNB 4YHNA 3ZE2E 3WUWB 3IXTB 2BERA 4UDTB 4F33A 5BS0E 1FL3A 4YWGL 4G8GA 5HYSA 4JGUA 4PJIE 4U1SA 4HKXA 3WKML 4F15C 1Z0MA 2NY4C 3G5VA 5I2IA 1AGCA 4OGYL 4G7VL 1KJ2A 5HYEA 1W8NA 3K4AA 5DMKB 2OR7A 5DRZA 3T0EC 4Y5YB 3GMNB 4Y4KD 4XVUD 3ALWA 5GS1A 5SWSB 4ZMAT 3TBYA 1T2XA 3DRTA 1QBLH 3U4BL 3H7LA 5HSFA 2GTZA 5KS9E 5DJYB 1T22B 3HUJF 3X13A 1KULA 2R8SH 4LCWE 2RFXA 3U0WH 4PJFA 2BNQD 4J4PD 1PKQE 2DYPA 3MXWH 1N26A 3QUZD 1NC2A 3GHEL 3IXTA 3RU8L 3QJFB 1A7NL 2VDLL 4F15B 1MY7A 1HCFX 1CICC 1K4CB 5IFJB 1KEML 3O6ML 3T0EB 4L3ED 2JJWA 1IKNC 4XC3L 5E1AB 2X4PB 4R7DA 1KF9B 3OKEB 2A6IB 4V1DB 4HQQL 1NUGA 3GMNA 3C9NA 5SWSA 3DMMD 2E9BA 4HXAL 2Z8WC 1VGKA 2DQIH 1CL7H 4W68A 2F58L 1XF2B 2XWTB 5DJYA 4GMTH 1I9EA 4NO0A 1UGNA 3PV6B 3RGVD 3MRKB 1C5BL 2XXMB 2GSIA 3V6ZA 2HYMA 2XFXB 3K80A 3O8XB 3DTXA 3GMRA 3MV9B 1CICB 1W0VA 2VDQL 3FO1A 3GK8L 1YY9D 5FO7B 1F4XL 3D39E 3PWNB 5JDJA 1M7XA 1KLUB 3IDMB 4X6CB 2HTKC 1K4CA 5IFJA 3E0GA 3MRFA 1UYWL 1A0QH 2NYYC 4F7EA 3PNWB 1FGNL 32C2B 2X4PA 5FV2A 1IC4L 3OX8B 2YPKA 2IFFL 1NEUA 2OXGA 1B9ZA 1U8JB 1C12A 3DURB 2HJKA 5DMGD 4WHDA 3QFJA 2IMMA 5I18L 4G6JL 1J1PH 1RULH 2UY6A 1DQQB 2ZUWA 1XF2A 2R0KH 1JHKH 3P0GB 1RFDL 2QKIB 1H9VA 2FBOJ 3H9HB 1IC7H 4P59H 3CDGB 2DYPD 1FVEB 3MRKA 3HMXL 1NC2D 1ZWIB 5CP3H 2VNCA 5SWQB 3IYLW 1GGTA 1EGJA 3O8XA 1CICA 2ATKB 4LCYB 1SQ2N 3B3IB 5FO7A 4KDVA 1T20A 4GKSB 5I9QC 3PWNA 4A6YH 1IKNA 2ILLA 1NDGB 3PWVB 4LGPB 3IDMA 1UFUA 1BBDL 4X6CA 4TSAH 4Z7NE 1BVKB 4HMCA 4UQ2B 1DQTA 3CSGA 5DHVH 1GGCH 3PNWA 2C7UA 5SWSD 1EEQA 3DOSA 3KPRE 5J1TC 3B9KC 1U8JA 3OKOB 3BIBX 1UM4L 5JPNA 4Z7QF 2H2SC 1A22B 1FIEA 4JDVB 2X4UB 3O3EA 4JGJA 3KYNA 4NO0D 4WEBH 4X6DB 2QKIA 5HY9A 4YDIH 3G5ZB 4F9PA 1MQKH 3D5OF 3VXOB 1X5LA 3HNVL 1T04B 1FZOB 1ZWIA 4KK8C 1Z5LB 5EN2B 3TC9A 2H2PC 2ATKA 4LCYA 4H26B 4X4XA 4MJ4A 2Q6WB 1NDGA 2DD8L 2NY5H 3U0TB 4NJ9H 4HKJB 3UTSB 1BVKA 1NFDB 4UQ2A 1CXLA 3P0VL 4EDWH 4DUXA 3QH3A 2LU4A 1S7QB 3O81A 2IBGA 1AR1D 2W9LA 1CLCA 3GM0A 3QFJD 4U1LB 1MFCH 3OKOA 5CD3B 4DJMA 3TN0A 2XACC 4JDVA 3IDIB 4S2SB 2NX5E 2DQDL 1A6UH 2DLGA 3O8XD 1CICD 4ZOEA 4DGYL 5GGUA 5HDBE 5EN2A 1BD2A 4NKQB 3RI5F 2B8OT 3BP6B 4H26A 4OFIA 5JNYB 4I4WA 4LVHC 2Q6WA 3PQYE 4I2XB 2XN9E 1D5ZA 5DJDA 1ROWA 5DUBA 1CGWA 5ECJE 1HINH 1WT5A 3OGCA 1YJDH 3LSOB 4NFCA 1NQBA 5L2KB 1ULVA 4B0MM 4PYHA 3EJZC 4TN9A 5H2BB 5LJYH 1U3YA 3OXSB 4LLWB 5CD3A 1BHGA 3L6FB 1CGSL 1ZGLM 4UB0L 5BXFB 1DVFA 4NRZA 1L7IL 1VDGA 3IDIA 5EBGA 1E6JH 1KG0B 5HHXH 3O2DA 3SGKC 1MFNA 3MACH 5EA0L 3QIUC 5E8EA 5B4MD 3QSKB 4XPHL 1NPUA 4QRQA 2HTKD 4LVHB 2FZ3B 1NH6A 1OL0A 1AGEA 2VLRB 1G7MB 5JNYA 4YO0B 2IANE 5HDLA 4WW2F 4OZIE 5FFLA 1LEKB 3P11H 3UTQB 3L3KB 3L95B 1LDPH 5EU7C 1J86A 5M7QA 4MQXC 2C3WA 2EEDA 1CD1B 3CH8A 1OHQA 2WWKT 5L2KA 2D0HA 4NUGH 3MRQB 3TN0D 3OXSA 3DIFB 4LLWA 4PIRF 2Q86B 2GJ6B 3QIUB 4MB4A 1UA6H 4YNYA 1QKZL 3P9LA 3SKNB 5CJOH 5A16A 2ADFL 1EO7A 1MCDA 3H3BC 1BD2D 3W11C 4K9EL 4OLWH 4Y1AB 4NZTH 3BUTA 3NIDF 4YO0A 1CK0L 4OCRL 2X4OA 12E8H 3UTQA 3HZVA 3L95A 2YRZA 2X4NB 2K7QA 1HEZB 3BRGC 1YDPA 5C0RH 5L88L 2XYCA 4NZJA 3QP3A 1A3LH 5T5FL 1WICA 2H2SD 2DQJL 3P30H 1G0DA 3KWWB 2CKNA 3MRQA 3DIFA 3LEVH 1DVFD 1WEJL 3G9AB 1ZV5A 2Q86A 1NL0L 3PJSB 4KK8D 1G6VK 1P4IH 1K85A 1VKXA 1QLFB 2XKUA 2M8XA 3DHJA 5F7LB 3M45A 5FV1L 5I8OH 1NGXA 4G9DA 5LQBL 2YD2A 1NBYA 4XMKL 1FNLA 3IETB 4YHKH 4AZ8A 3TM6A 4JFDB 4PGBA 2ZOLB 4FMFA 1NFKA 1CDHA 1A1MB 1BAFL 1G9EA 5JA8B 5IJVB 1F4YL 1K4DB 2DBLH 2EIZB 5L2KD 4OIBA 1RURH 5D72H 3PP3K 4P3CL 1REIA 3QI9B 4F7MB 5KJRL 5CUSH 3QHFL 3ZTNL 3KR3L 3ARGA 1MCJA 4E5XB 2EXWC 1IZJA 3PJSA 5C2BL 3LEYH 4D9QE 4K07A 4U6XB 1QLFA 1FHGA 2BC4A 4O9HL 1G6RB 2X42A 3QBTB 5BRZB 2ZUUA 4DZBA 4PG2C 3EJJX 3ULUC 4H0HB 4MCYB 4AY0A 2VDKH 3IETA 4EXKA 3O6KL 5MENA 4FZ8H 4JZJB 4HZLB 1IE5A 2ZCHH 1JPTH 1YC7A 2E6JA 4HT1L 1A1MA 1S9WA 3ZT7A 5IJVA 4KVNL 1RIVL 5C0JB 2HFFB 2J8UB 2V7HB 4XCNA 4RRPG 1KBGL 5DJ6A 4MA3B 5DZNA 4HD9A 2HLFC 4ELMB 2GSGA 3QI9A 1BWWA 4F7MA 1MHPL 1S5IL 4UOW1 1SJHB 4KXZH 3BN9C 4R0LC 1Q1JH 4J3SA 1W8OA 2NPLX 3PDOB 2XA3A 4PJCF 3RY6A 1AD9A 2DM2A 5FUOL 1TZGH 3I6LD 3CUPB 4Y1AD 5FUCC 1QRNB 5BRZA 1ODAA 15C8L 3RZCC 4MCYA 4L4TE 4PV8B 4CGTA 2EC9T 1GZPB 4H5SB 4PB9H 5D8JL 2FX9L 5JW4R 5GZOC 3THMH 4JZJA 4HZLA 3VXUE 4Z7UE 5I1GL 2ORBL 4Q9QL 5CHNB 3L3DA 3VFMA 1KIPA 1RZ8A 3LB6D 3MLWH 3OKYA 3DO7A 4TNWF 5C0JA 2FX8L 1FJ1B 2HFFA 2J8UA 4BELD 4PRIA 1JPGB 4ELMA 4R0LB 3ARGD 4L8CA 1DCLA 1GOHA 1ZHLB 2OMNA 1SJHA 4YHZH 5IIEB 1N6UA 3W11D 3WCYA 4XT1C 1E27B 5ITBH 2IADA 3TIEB 3QHTC 4HFWB 3WNKA 1TETL 4BSWB 2HLAB 4X4YA 3GIZH 3BKJL 1BFTA 3RZCB 5A43C 3CUPA 1DBBH 1QRNA 3I02A 1EAJA 3VGHA 2O5YL 3DYPA 5MEND 1FZJA 3N85H 4PRBA 1U2HA 1BM3L 4H5SA 3FOMB 3JVGC 5E7FA 1AE6L 2DQGL 4TUJA 1HSBB 1RU9L 3T09A 5ABDE 4GUPB 2VITA 2YPLB 4L9LC 1WQVT 1HCVA 4MD4B 1FJ1A 3OB0K 3QI9D 4H20L 4QRRA 1TNNA 3RX5A 4N8VB 4R0LA 4WENB 4MSWB 4QHUB 1AY1L 1G7IB 1ZHLA 4RAHA 3CFDB 5DHYA 4ONOA 4N0RA 1XIWA 5DGQA 1KPRB 3V7MA 1RSFA 4OCWH 3UAJC 2ARWA 1E27A 3VFUA 1N64H 3VW3L 3TIEA 3MLPA 3T1WA 4HFWA 2HLAA 3RZCA 1Z9SA 4U49A 5BRZD 1I3VA 4BQ8A 3MBXH 4G6AC 4K2UH 4HUVA 4N0FB 3LVEA 1YEEH 5CCKH 5HYJE 4JG1L 4ODSL 1HKLH 2KPNA 3UTTA 3U36A 4U1KA 3BGMA 5HHVL 2XKNB 1HSBA 3UYPA 3EDFA 5CP7B 1BOGB 2PKDA 4GUPA 4TYUA 2YPLA 4PRID 2AABH 4MD4A 4DEPC 5F7UA 1IC1A 1A7QL 1D6EB 1FO0A 2EXWD 1FDLL 3NPSC 1OW0C 1RZKC 4N8VA 3HC4H 1B2WH 4QHUA 5I1CL 2CDGB 3CU7A 4MA1C 1U95B 5BZDB 1HQ4B 1D5IL 4MNHA 4ZFOL 4M9OA 3ULUD 1GGBH 1PY9A 5E08L 2VDPH 4Y89A 4XNMB 1U8NB 1QRND 4PJBB 3T2NH 1KTKE 2AVGA 5KVDL 1URLA 3JVGA 4WUUB 4ZOCA 2G5BB 2W0PA 4N5ED 2D4DA 4KDTA 4WW1A 1VB9A 4G8EB 3SBWC 1K3IA 1KLGA 5CGYC 1KCRL 4HHAB 2HLFD 5ILTL 2XKNA 4N8CL 3MQIA 3PGDA 4M1CC 5CP7A 3WE6B 5E8DH 1ZANL 3I3DA 1ZVHA 4PJEB 4LASH 4QRRD 3BRDA 5EH1A 1D6EA 3OAZH 2HN7B 2AJVH 2QQKL 4OQTH 5DFTA 4IOIB 5K9JH 1BOYA 2ARJA 1KB5B 4G7YL 1B88A 1XIWD 2CDGA 1U95A 5C3TA 4ZUSA 5BZDA 3ZHDA 5KSBF 2A6JA 1HQ4A 1TPXC 1FL5A 4LLVB 3RQ3A 1VEPA 2V5YA 3RZCD 1K8DA 2WUCH 5DQJA 1OM3L 4YDLC 3RDTA 1U8NA 5KSAA 4PJBA 4ETQA 2H1PL 3RWHB 4K7PY 1OAUL 2XRAH 3LZFH 1G84A 3QG7H 1YEJL 1OP5H 2G5BA 2YC1B 3UTTD 1BQLH 4H1LG 1ACYH 1R0AL 2KZ1B 2R2EB 3ZHLA 4G8EA 2L7JA 5L9DH 4W6WB 1DBAL 1WWWX 3PWPB 2EDLA 2YPLD 1X5ZA 3B2UC 3BGAA 5IK3B 3T3PE 4NKDB 2VLJE 1Q38A 1N0XH 1E4JA 5F7KC 4KZDL 3MGOB 4K94H 3BP5B 4IOIA 4WI9A 1TPXB 1BFVH 1KB5A 5H35B 5BS0B 3BZ4B 4ZFZB 3FHAA 4UV4H 2AEPH 4PJIB 2VUYA 2PYFB 5IESH 3LQAH 4YDLB 1QBLL 4LLVA 2AXFB 4KI1A 3IDJA 3JSSA 2VH5H 5EO0B 3L5WB 4RCAA 3GBNH 5E8OA 4GRLC 1ZT1B 4JRYA 3WS3A 1S7WA 2YC1A 5L0QC 3MXWL 1AGDB 4JO2H 4PR5B 3MJ8B 1HIMH 3DX7B 5KS9B 3PWPA 4XPGL 3U46B 1H15B 4JPWH 2Q8AH 3FO0L 5ESVB 4RAUB 1AXTH 4LCWB 2WZPD 4I0CC 4U6YB 1A6ZB 3WN5C 3H3PL 2J5LC 3QXDA 2FB4L 4GSDH 1PKQB 3DETC 4BFGA 3BP5A 3CSYB 5H35A 1K6QH 2NMSA 1RUML 1S8DB 4P5TA 2PYFA 4G6AD 4R6UA 5JW3L 2OTUB 2ATPB 4APQA 3RDTD 2DQIL 4KRPC 3MOAH 5KSAD 4GRLB 1FQ9C 1MCIA 2DM3A 3E3QC 5D2LE 5E6IC 1JNJA 2DTSA 4U7MA 4GMTL 3ZDZE 4R9HA 5L0QB 5LGKA 3DSNA 4LPCA 3LKRA 1FNFA 1ZT1A 1OT1A 3K74B 3VMPA 4RAVB 2ZUVA 1P69B 2XZAH 4ZAKC 1N6QH 3MLUH 4XPFH 1AGDA 4MXVE 2WBKA 5IT2H 4F7TB 4FQJH 1NMBL 5KS9A 1A6WL 2J5LB 1DTUA 3KXFE 4R26H 1H15A 4PY8J 4LCWA 2IQAB 4Z7OF 1WCQA 4TQEH 4U6YA 5CAYB 1A6ZA 1W72B 1DQDH 1QACA 3UXFA 1PKQA 3B8YA 2FEDC 4UBDD 5I1LB 3A6CL 1V7MH 3CSYA 4F2MB 2C3VB 3TBSA 4KRPB 3D39B 1CS6A 5C0FB 3O3DB 5E6IB 2ATPA 1DQLH 3RVXD 1RK0B 5IMKB 3GZKA 2R0KL 4Z9KB 2KZWA 4JRYD 4WJ5B 4ZAKB 4XCCH 2GITB 1IC7L 3AAZA 3WSQL 5EDXA 5AG9A 3ROLB 4RAVA 5L7XL 4HCRA 1JRHI 3NFNB 3TCLA 3PWPD 3QCTL 4F7TA 3OKLA 5DD5H 1QYGH 1VFAB 1OAYH 4UMGA 3QQ4B 1RK1B 3AU1B 1UXWB 2HT4C 5FOBB 4A6YL 4Z7WE 3DARA 5HPOA 2VXQH 4LP5A 3KPQB 5MHSE 4TSAL 3N1FC 2XNAA 4OZ4B 2IQAA 5F9OH 3DUUB 3R0NA 1GGCL 4XPBL 1UWXK 4DGIH 5GGRB 4XTRC 1AD0A 1IZKA 4F2MA 1J5OH 4P5TD 4PD4J 2C3VA 1H3PL 1Q9LB 3VMOA 1ADQA 1R3LB 3O3DA 4APQD 3KPOB 2GIYA 4M7ZC 3ARQA 4GAJL 4UV7H 2MCG1 5IMKA 1I8MB 5E2UH 1A3QA 4EUPB 4YE4H 4WJ5A 5D7JC 1T89C 4YDIL 2GITA 3ZE0E 3L3IA 3KPRB 4MCZA 3ROLA 3B2UD 4IRZL 4PD4K 5CJ8A 1UXWA 2E9WA 2X2YA 5FOBA 1DL7H 4LCWD 1EV2E 3DGCR 3JUYA 4WI8A 2D4FA 4OZ4A 3K0WA 4HWBA 4PRHA 4S0TD 3H8NA 1SY6L 3O4LE 3M8OL 2AQ2A 4Z5RB 5DZLA 4M7ZB 1MFCL 3DBXB 1R3LA 3KPOA 4WW2A 3QISA 4O2CB 5J1AB 3LKPA 5IOPB 1I8MA 4A2MA 3QHZL 5INDA 4G5ZH 1L4IA 2YOCA 1B4JH 1JV5B 3TPUA 3GM8A 2GEEA 3FO9B 1R5IB 2X4QB 2D0FA 2X6MA 2VDRH 1INEL 4Q2ZB 3VI3F 3DETD 3U2SB 4XWGL 3ARSA 1TCRB 3RX7A 3MZGB 2NX5B 1GAFH 1HILB 3W2DL 5JPMA 5IHZB 1R6VA 2X7LA 1HINL 2P8LB 3T0XA 4FQHB 1YJDL 3UO1L 2R23B 2MWCA 4KRPD 1HHGA 4R3SB 4QRTB 5C0GB 2MCPL 2VE6B 3VGBA 1W0YT 1MCSA 3GI9L 3DBXA 1A5FL 3PQYB 4ALAL 5HGAB 2XN9B 3KPLA 5J1AA 1T89A 5IOPA 3ARFC 1QLRA 2GAZB 3T0WA 5D7IF 3V4PH 1RZ7H 1E6JL 4R97C 4DAGH 4JREB 5EBLB 3D3VE 5IBTL 1XH3B 1TCMA 1HH6B 3HAEH 3TFKC 2AW2A 1A7OH 2VC2H 3FO9A 3NFPA 4PYGA 2DKSA 3O4OC 5GRYA 4PGDB 5BMFH 2R1WA 1U3HC 1A6AA 4LCUB 4Q2ZA 2XA8H 4CN1A 4OUUB 2FEDD 4G3YL 2MQ0A 3U2SA 1EERB 5J06A 1KENL 2Z8SA 1FE8H 4PRHD 1LDPL 3X3FL 1J1XH 4HAGA 1I1AC 4FQHA 1EJOH 2R23A 2DLFH 4QRTA 4HWEH 4NSKB 3ARFB 2IANB 4QGTA 3PQYA 4OZIB 5GS0H 5HGAA 2XN9A 4R97B 1KEGH 4F7PB 2EYTA 1T7VA 5D7SH 1L0QA 4I18B 3WO4B 2GAZA 4QY8B 5F3HA 5FDYA 5F7NC 4HX1B 1HWHB 3O4OB 1UA6L 5DJCB 1VPOH 1HH6A 2HT4D 5CJOL 3NCFB 3DSFH 1QRKA 2R0LH 3V4VL 4YPGB 4PGJA 1QHOA 2HRLA 4PGDA 5DK2B 2GK2A 5DD0H 1GJIA 4OTXH 4IMLB 4OUUA 4PP1C 1IEAA 2VN4A 4XTRD 3MRLB 2VR4A 12E8L 3ZL4H 5CJQL 3FN9A 2XT1B 4TNVF 2DMBA 1AFVH 5C0RL 3ARPA 1A3LL 4OF7A 1XT5A 4NSKA 4DKAA 1LE5B 3GJFH 4OZIA 1D5XB 3LEVL 4LPXA 4F7PA 4J6RL 1EXUA 4JRXE 3VRIA 1KT2B 4I18A 3WLBB 4O5LH 5ACZA 4QY8A 2Q3AA 1MHHB 4AIZA 1P4IL 4FABH 4HX1A 4OD1H 5DJCA 1RUQH 3ARDB 2CLZB 3C6SB 3I9GL 4RFNC 5I8OL 4YPGA 1BZQK 1M7DB 3NH7H 5DK2A 4F9LA 3ULVD 5EBMA 4AQ1B 4UUJB 4NBZB 3UBXB 3UTZA 4S1DC 5JHLH 3MRLA 5CEZD 1NBQA 3PP4L 4N1HB 2X44D 2W0FA 2DF3A 4KJPC 3VXTB 2DBLL 2BJMH 4BQ9A 4X5WB 3ZMRA 3DROB 5D72L 3G6JF 3PQYD 2XN9D 3D18B 4LDEB 4JFYB 4KPHL 1D5XA 1A1OB 1X5FA 3IU4H 4YHMH 1WITA 3NIGF 1KT2A 1KTDA 4Q0XH 3TIDB 1MHHA 4NNYA 1R3JB 2HKFH 4RFNB 5DTFA 1JL8A 4HGMA 5A2IH 3FN3A 1CE6A 5JIKA 2O61B 3ARDA 2CLZA 3C6SA 3NACH 4NQVB 3CFEB 4Y0GA 4HC1H 2BNRE 3UBXA 1BZ9B 4FZ8L 3TJEL 1FNGA 1IAKB 4OD3H 2ZCHL 3MMEB 1U8QB 4TVPD 4XH2B 1CXIA 3IFNL 3MRBB 3MRNB 1SYSB 3DROA 2EDJA 1A7RL 5BZWB 3U6RB 3D18A 4GRWE 2BVOB 1A1OA 1TNMA 5I76B 3TFKD 1A4JB 3T0AA 1TENA 5I8CB 1Q1JL 2DMKA 4RFEB 3TIDA 1S7XA 3FB8A 1G9MC 3RWEB 1ZLVK 5HHQB 1S7TB 1WCBB 2Z0BA 2Y25A 5ANME 5C6TL 2MPAL 2VR5A 1R5WA 1HXYA 2F8VA 4JDTL 3AB0C 3HI5H 3PF2A 4NQVA 3QUMA 3STZB 2IPKB 5CZXC 3QEHB 4LNVA 2EKJA 4PB9L 3THML 3QB7C 3MMEA 3Q5TA 3UTPE 1U8QA 1IILE 4WGVB 1GSMA 4XH2A 3MLWL 4EVNA 3KS0J 5EIIB 4LPYA 4E0RB 5ICXA 2OL3H 4JPIA 1SYSA 4L4TB 5BZWA 4ZPTB 2Y72A 3B9VA 3U6RA 5F44A 2EH7L 4NO5B 3VXUB 3SDXE 4Z7UB 2Z92A 3ELAT 3QUYB 5I8CA 3R8BB 4HZAA 2NY1C 1JZ3A 3RWEA 4OCSH 3ARDD 4DQOH 5HHQA 3HS0B 4KUZH 1S7TA 3MCKA 4JQIL 5E2TH 3BZDA 4J3TA 1DBBL 4POZD 3MZTA 2FJFA 1CFVH 3KLDA 1T7XA 5DI8B 3STZA 1J0HA 1A6VH 1QFWH 4ZTPL 2IJ0C 4FZEL 2PYEE 2WWMC 2ZOKB 4D94A 5J9PA 1U8MB 4RGNC 1PX3A 1JPSL 3RTQC 5B22A 1KB9J 5EFIB 2ZPKL 3WFCL 2OTWB 4JFZL 3KYOB 4HKBB 4L4TA 3MLSH 1BMGA 1M7IB 1U58B 4NO5A 3WL9B 4Z7UA 1CR9H 2M26A 1JMZA 2YMXL 3QUYA 4GQ9H 3Q6FB 4MAUH 3S37H 5D5MF 4OCWL 3TLRA 1WBXA 1Z2KA 1N64L 2IPUG 2OSLB 2E7MA 1KYOJ 4WI5A 5BQ7A 1UH4A 1NGZA 2FO1A 1KB9K 1DEDA 5CBEB 1KPUA 4XP5L 5CCKL 4I0KA 5DI8A 1LEGB 3V7AE 1HKLL 4PRPE 2ZJSL 4K3GA 4NCC1 4D9QD 3RTQB 2VABB 1J88A 3EDKA 4YAQB 1U8MA 2DQTH 4CU8A 1SJVA 4N0UA 3BPOC 1JZ8A 2OK0H 5TGBB 3HR5A 2AABL 5EFIA 1MRDH 1KYOK 5HYJB 2OTWA 2NW3B 3C60C 3KYOA 1WBYB 4P99A 2EDNA 2C4FU 1M7IA 3ZTJG 3HC4L 4X9FA 1U58A 5FA4A 3SDAA 5GRVK 3WL9A 3RL1B 1KN2L 1C5CL 1FYHB 5IQ7H 4BZ2H 5I19H 4CN4A 2OSLA 1U8PB 3KGRA 1GGBL 4N1EA 2VDPL 5CSBA 1Z3GL 4PS4H 1U91B 2JJSA 1EUTA 1H8NA 5CJBA 3T2NL 4FTVE 4FQIL 4DKEH 4CU6A 3VGAB 3QA3A 3UBXI 2FJHA 1SEBB 4JY6B 4J8RA 4OLZL 3RTQA 2VABA 1GGUA 3BPOB 3C2AL 4HIJA 5CIPB 1DUZB 4NN5C 3FZUC 2D03H 3VJ6A 4LASL 4L4TD 5TGBA 2Y4SA 4X7CC 4BFIB 2A83B 2Z4QB 5HYJA 2AJVL 4FN0A 2OBGA 2NW3A 5IFAH 1WBYA 4HS6A 4C56E 3LRHA 5FF6A 5TFSH 5K9JL 2APFA 4Z95L 3QUYD 5GSRB 3RL1A 3K1KC 4HXBH 2QQQA 1OP9A 1I7RA 2BRQA 5FCUH 4P9HC 2D7NA 2IC2A 1U8PA 1X5AA 1A4KB 5CZXD 3SQOH 4FQCL 1Y18B 3RJQB 1DLFL 1ZOXA 3V0WH 3OG6B 3RI5K 2XRAL 3LZFL 1KV3A 1BQLL 5F7YC 1T66C 1E4XI 2ZSVA 1SEBA 4BZ1H 2I07B 4BM7A 2CIIB 2UVEA 1DUZA 4TUOB 3BKYH 1NGWA 1N0XL 1DSFL 2A83A 2Z4QA 3O0RL 1I9JL 4K94L 1YNTB 4MQTB 3SDAD 4KJWC 4LFHD 2PNDA 5AZEH 2D0GA 5JUEH 5GSRA 4UV4L 1LP9F 3EKCA 3I6KB 3GSVB 5F7DB 3LQAL 5IESL 2AI0H 4M4RA 1MWAH 5T3XL 4OM1H 4Y19E 1A4KA 3BHBA 4KQ3L 1BZ7B 3IJYB 1Y18A 4RMQA 3HI6H 2YA2A 4O51A 5KW9H 1FIGL 1ZS8A 2E7CA 4K8RL 3TH4T 2WWMD 4PJHF 4X7SH 4NKOA 1JF5A 3J7HA 4NIKB 5CLWA 3RTQD 4ZUWA 4JO2L 3ZDXF 1JGUH 3KLHC 3U0PB 1AKJA 3JV4B 1CFTB 4OFPA 3N1PC 3OKKA 3L3JB 2I07A 3R1GL 3IT8D 3NCYP 4LU5L 4M03A 2CIIA 3OXRB 2B5IC 3KHOA 3RNKB 5JXEC 1CF8H 4TUOA 4JPWL 2Q8AL 5HYJD 3EO1B 2APBA 1RUKH 1JPST 4HWZA 4YFDB 2YKLL 4GSDL 2COQA 5DEGB 1JTPA 4ZS7L 2DWEB 4G80B 1F8TH 1K6QL 1JHTB 1UG9A 1CGTA 3GSVA 5F7DA 1KIRA 1CU4H 3MRPB 3OAYK 4U33A 4NQXA 4NHCL 1U92B 5A1AA 4XI5D 5F7HA 3IJYA 5C08E 1YNKL 5EOCH 1WIOA 1X4YA 3H6JA 4ODXB 3MA7A 4ONFH 4PJCE 1H3WM 5CEXA 3MOBH 1N6QL 3MLUL 4XPFL 3U30C 5EO9B 5ICYB 4WIQA 1CFTA 1DLHB 1KCKA 1S7SA 3L3JA 4FQJL 1NGQL 5KVFH 1NFIB 4UOJA 4GXUN 5D2LB 3RNKA 4XHJD 4AM0A 9CGTA 1D6VL 1WJ3A 1WZLA 1G9NH 5HHMB 3U7WH 4NQEE 1DQDL 1GHFH 1IGYB 4YHYC 2BY1A 3MREB 2QEJA 1KOAA 1MIMH 1Z6JT 4JFOB 4G6FB 1S78D 3QDJE 2DWEA 4JJ5B 4G80A 1JHTA 3GMQA 2D7TH 1RJZB 5F97E 3KXFB 5F7WC 1V7NH 5AYQA 2X1WL 4BZYA 4GG6F 3PIQA 3F12B 1DQLL 2DQHH 2AXGB 3PGFH 5TQ2H 5JA9A 1NCCL 4ODXA 3SE4C 4F37F 4HWNA 2CKBL 1AKJD 5IBUG 5JXEA 1UVQB 2J12B 4X0KA 4OFKA 5EO9A 4CVWA 4HIIB 4Z0BH 4DN3H 2OI9C 1QYGL 1OAYL 1PD6A 5A2LH 3Q0HA 1CCZA 5D2LA 2DKMA 2E9JA 4P23C 4NNPH 3VWJC 4YHYB 2VXQL 1OAZH 5GGSA 3BISA 1IGYA 4R2GD 2NY2B 3UJTH 1U8KA 2CJUH 4GO6B 1IGCH 3O45B 4LIQH 2EDOA 1J5OL 4ESKA 3P9WB 2VL4A 1ZEAH 1BQHB 1RJZA 5D1ZC 4JKLA 4Z7WB 5LGHH 4X7TA 2GUOA 4XGZA 2XI9A 2Q20A 1I7UB 1T66D 2AXGA 3WEXB 3Q5OA 3MRIB 4EOWH 5DC0A 1AI1H 2GYSA 4YE4L 1CDUA 1R24B 4XP6H 4I5BA 1C7SA 1PQZA 2LU3A 3GJEB 1BFSA 3K8MA 4UT7L 4X6BB 3V52H 1I1FA 2WV3A 4UDUB 2Y07H 5L8KB 5AUMB 3VWJB 3EO0B 4HIIA 1MH5A 1IT9H 3NAAL 4JKWA 4YXKL 1DL7L 3SGDI 3GHBL 3V8CA 3CXDH 5TH2B 5FDWA 5DK0B 4RBPK 3PP3H 4CNIA 5B8CA 5D1ZB 2QL1A 4Z7VF 5D6DA 3O45A 1ETZB 3VXMA 4O58H 2YUWA 1BQHA 1KXVC 5IFHH 5SV3A 3GSXB 2W9EL 5C0CE 1I7UA 3WEXA 3OKDA 2B0SH 5KOVC 4UTAH 1RUPH 3O4LB 2B1AH 1IGJB 2ARJQ 4AIXA 1B4JL 1YN7B 3FQNB 1M6OB 4QXGH 4CUCA 3RWDB 5JXED 5JIIA 5ESAB 4D9RE 4UDUA 2Y5TB 5AUMA 1A2YA 3HAEG 3EO0A 3MGAA 4DVBA 3IKCB 5IHUH 3IFLH 4TNWK 5HHMD 5TH2A 4J1UB 3LRSB 4MHHG 4Z78B 5FEBA 2Q87A 4LPTA 2WW8A 1YPZE 4NOFA 1I8IA 1T1WB 5TPWH 5D1ZA 5C9JB 5I1JL 3OG4B 1ETZA 1I7ZA 2X4TB 2ZNXA 5ERWB 1T1XB 3DWTA 3MA9H 4JM2F 5F1OB 4H8WC 5E94B 1RI8A 1GCFA 5D96B 4C57C 4D0BB 1ORQB 4ZTOH 3Q3GB 3A6OA 4B7LA 2BHZA 3V4PL 1Q9KB 1G7PA 1RZ7L 2EDWA 3FN0L 4Y2DA 4DAGL 5KSBE 3V6BR 2F74B 1YN7A 1H5BC 4WY7H 5T1LB 1M6OA 1A7OL 2VC2L 5TE7H 2Y5TA 3FJTA 2MHAB 1OTTD 2Y1VA 4LSQH 3WMSA 3IKCA 2B4CH 2R9HD 1XF3B 4Q9CA 1Q0YH 5F1IA 3D3VB 3GFUA 4J1UA 3BH8B 3LRSA 1FE8L 4HJ0D 4WV1B 1XCTA 2NY2D 4KGLA 3OMZA 4BH8B 1FZKB 2PUQT 1T1WA 3VXMD 3LH2H 1EJOL 4UAOC 4URTB 3P4LA 3ECBA 5C71A 3GEWB 1XF1A 3WKNA 2X4TA 3MJ9L 5ERWA 5MHSD 4UT9L 5GS0L 4L29B 3MLZL 5E94A 1KEGL 4PLOB 1KJ2H 1DJSA 1ORQA 1H5BB 2PETA 4JFPA 2JCCF 4DFIA 4OFDA 4S11A 4F7CA 5ADPH 2Z8RA 1VPOL 3A67H 2P1YA 1KJ3H 3CX5J 3ARXA 4UILL 3MLTB 3V6OA 1E28A 2ZZUT 2R0LL 2NLJA 2BOBA 4LP4A 3NABH 8FABB 4WFGD 4FQ1L 1KFAL 4EXPX 5DD0L 2LTQC 2ZWLT 3CK0H 4WO4A 4IDJL 4GLRI 4EKXA 4PP2B 2A6DB 3ZL4L 3D3VA 4BUGA 3BH8A 3OB0H 4WV1A 5E2JA 1PEZA 2DJ4A 4LSVH 1HOCB 5D1ZD 1UKSA 4BH8A 1FBIH 1FZKA 2R0ZL 3X12A 2J88L 4C58B 3JXAA 2H6PA 5C6PB 3CX5K 1LO2L 4WVRA 2CGRL 4HIHA 4QTIL 4Y2DD 5C0EB 1H5BA 4O5LL 5EC2B 1OTUD 2P8MB 4JCLA 4G9FA 1O0VA 2WM0A 5DRNA 4GAGH 5I1EH 2JJUA 1WIUA 4WTZG 4XP1H 2LTQB 3MLTA 5F72S 1P1ZB 1C08A 4RWYH 8FABA 3NH7L 3DHMA 4JRXB 2HT2C 3NFSH 4WGWB 2IMNA 4S0SD 4PP2A 2A6DA 3SY0A 3VH8G 5I0DA 5JHLL 5B3JF 2OP4H 2B39A 1SJEB 3JWOH 2P42B 3FQWB 5DK3A 2OLDA 1A02N 1NGPL 1U42A 3HMXA 1MRFH 3V8OA 5E8NA 1PW3A 3OR7B 4L8SA 5IVZA 4I3RH 1IBGH 3H9SE 4M61A 2FBJH 5TDPB 4WTWA 5C0EA 4JR9H 4RMTA 1AC6A 5EC2A 1G7LB 1IKFL 5HVWA 1T1YA 1F02I 4W4OA 3VRJA 1IFHH 5FGBC 1P1ZA 4GKZB 1AHWA 3NACL 4ZUTA 4WO4D 1IAMA 4GT7A 4X5XB 5I8EB 4HC1L 1MFBL 1VFOA 3LPGA 1K2DB 3D3VD 1N5AA 4N0YL 4UI2A 2DL2A 3ZKMC 4OD3L 1MQ8A 3F65A 4ZS6C 5L2JA 3IAGC 3FAWA 2OM5A 1C5DB 3FQWA 5DVMA 1EGJH 5CFHA 2GQHA 5CKAA 1EZVY 1BQSA 1PZ5B 1IJ9A 3CFKA 3PL6C 3QULB 3OR7A 2BNRB 4GS7C 4KUCF 1ZGLB 1WBZB 4PRNA 2HJFB 4HK0A 2AERT 4QF1B 1MNUH 5GGQH 5TDPA 4G9FD 3PWUB 1VEOA 5IMOA 1OCWL 4F57H 4R4NC 4K7PH 1NCAH 1G7LA 3QNXA 2QSCH 3BPCB 2P7TB 5MEOB 5I66B 4N90E 4ZDHB 3GUTB 3MNWB 1YECH 3LOWA 2ZP0T 4GRWB 2GJJA 3HI5L 4MX7B 1FNEB 5I8EA 3FTGB 1D5MB 3BX7C 3LMJL 3LKSB 4XCYA 5D5MA 3KJ6L 4RMWA 5DGRA 4JM4L 3MUGA 1DQML 3PL6B 1AJ7L 4OZHE 3KLSA 5ANMB 4GS7B 4OGXH 2IBZX 3ESVF 3QIBC 4U0QB 4FS0A 1DQJA 1PZ5A 3EYOB 1TXKA 4WNQB 4N9GA 1I8LC 4YEEA 1U6AL 4K9EC 4TVSa 3N9GH 2GY5A 4KKNA 4QF1A 1VFUA 4LPVA 1IGTA 3PWUA 4OZFA 4NC1E 4XRCB 1RIHL 2O26U 2FATL 1RZFH 4YBQD 3FB6B 5FGBA 3BPCA 2P7TA 5DWUL 5MEOA 5I66A 5HDOA 4OCSL 3TBTB 4DQOL 3HKFA 4ZDHA 2FD6L 3GUTA 3MNWA 4ISVB 3UX9B 1JWUB 4PJ7E 2PXYC 3SDXB 3AUVA 5EIVA 25C8H 1D3CA 3O2WL 2JB5H 4MX7A 1FNEA 5EZLB 3WFEH 1KCUL 1OD9A 1D5MA 5JORA 1A6VL 3L3HA 4K23H 3MRMB 4DW2H 3LKSA 3I3BA 3IAPA 3QIBB 3HZKA 3RPIB 5IB3A 4XAWL 3PL6A 3SDCC 5ANMA 2XPGB 2K3TA 1PJ9A 4CBPA 2H3NB 3L9RB 1YQ2A 1LGVA 4JRWA 4MNQE 1LD9B 5EG6C 2WQRA 3W0WE 1YEHL 2QQLH 2FR4A 1CR9L 3ZKXC 3MUY1 1UEYA 1X6NA 2CPCA 3KPNA 3S37L 4YH6A 4AQOA 4XRCA 4XNXH 1OSPH 2HT2D 1T21B 2PXYB 4XVTL 5K59F 3MLRL 1S7UB 3D9AH 5D7IE 4R4BA 3L5XH 1JWUA 5MEPA 3VFWB 1JGEB 3SDXA 1Q9WB 3O2DH 5J6HA 1JGVL 3WHE1 4MGXA 3C08H 5J1SC 3IJSA 4OB5L 1ZGLP 3RPIA 1WAAF 3IU3A 3LV3B 3FONA 4I13B 3GNMH 1J8HE 1NAML 4PREA 2OK0L 2H3NA 2PTTB 1MRDL 2P48B 3L9RA 1YN6B 2D2OA 4NM4L 1F6AA 1F4WH 3CH1A 4RIRB 3S37X 4PRPB 3ULSA 4QNPF 1LD9A 1HDMB 1ZA3B 2FGWL 3OKMA 3SCMA 1CD9B 1KXQE 5EBWA 1XAUA 4HF5L 3S4SG 4RISL 2WK2A 4OCXH 4NGHL 3HPJA 4PS4L 5IP4A 1FG2A 1S7UA 1B6UA 1MAMH 4IHOB 4ZS6D 4DKEL 2DLIA 3GSUB 2XXCB 1Q9WA 1UM6H 2P47B 1DEEB 1JZ4A 1JE6A 1NCWL 4OAWB 3PL6D 2QR0B 2UUDH 3LV3A 2RHEA 4Y2OA 3IF1B 2BFVH 2CDFB 1FPTL 2E8ZA 3MBEC 4FTVB 2ICWJ 2ZCKH 2PTTA 5EPMA 1YN6A 4PJHA 3HCVA 4RIRA 4XB8A 4PRPA 2PO6C 2ZNWA 1HDMA 3UTPD 1I3UA 2X4RB 1A64A 1MFEH 5EU4B 5JR1L 5AEAA 4S1SL 5GGSY 1ZT4B 3CFCH 3FO2B 1CI5A 2LVCA 3EJYD 2FWOB 4NZUH 3EYQC 4IHOA 4N9OB 1MRCH 3MUJA 1BIIB 1XGQA 2ZG2A 2HVJB 3MBEB 4NWTL 4OAWA 1LO4H 1JZ7A 1ZAGA 5AYUH 6FABL 5DJ8A 3IF1A 4OF5A 1Q9OB 2CDFA 3VE0A 4FTVA 3ME0A 2YUXA 3LHPL 2PO6B 4WEMB 5IB2B 4YDVB 1L6ZA 3SCMD 4M93C 4ODHL 4C4KO 1HZHH 2D7OA 5E5MB 1XFPA 1T6WA 3FRUB 4FQQB 4P49A 5IW6B 2YZ1A 3UZVB 2X4RA 1NMCC 4AEIH 3JV6A 2EDDA 5BJTB 1EAPA 4JZOB 3U48A 4Z6AT 3HNTL 2AI0L 2IWGA 1EMTH 5EU6A 3X11B 1EHLH 4X9GA 5I1HL 2BVUA 1ZT4A 3FO2A 4G43A 2H32B 3HI6L 1P4BL 1UZ8B 3U83A 2GFBB 5KW9L 2JELH 4FQXC 4JG0H 4JZNB 1GGIH 1ZTXH 1ZSDB 3ALPA 4P46A 2HVJA 2X41A 4Y19B 5DRWB 1U3JA 1CF8L 1H0DB 1T7ZA 4LLQA 4UZGA 4M93B 4QHMA 4PGCB 4PRPD 1NMCB 4IIQC 4YDVA 2UWEF 4JFFE 2IH1B 1KPVB 3Q1SH 1NCDL 3MV01 1Y6NR 1MCOH 4FQQA 3BXNA 5HGHB 2MNUA 4TSBL 1MREL 4OF8A 4JKPL 4JZOA 4MQSB 1UCBH 3DV6B 5DFWH 2BOCA 2CK0H 3X11A 1CXHA 2VXSH 3TO2B 2H32A 1JF1B 3NCJH 2DICA 1BJ8A 2YXMA 1LHZA 2J6EL