3B9KD

Crystal structure of cd8alpha-beta in complex with yts 156.7 fab
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
214
structure length
214
Chain Sequence
QVRLQESGPGLVQPSQTLSLTCSVSGFSLISDSVHWVRQPPGKGLEWMGGIWADGSTEYNSALKSRLSISRDTSKSQGFLKMNSLQTDDTAIYFCTSNRESYYFDYWGQGTMVTVSSAQTTAPSVYPLAPGCGDTTSSTVTLGCLVKGYFPEPVTVTWNSGALSSDVHTFPAVLQSGLYTLTSSVTSSTWPSQTVTCNVAHPASSTKVDKAVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Light Chain
publication title The Crystal Structure of CD8 in Complex with YTS156.7.7 Fab and Interaction with Other CD8 Antibodies Define the Binding Mode of CD8 alphabeta to MHC Class I
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 34
structure length 214
sequence length 214
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3b9kD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3b9kD01
3EYSL 2ID5A 2LU3A 5C0BB 5HVHB 3QZWA 4HIIA 4HX1A 4P2OC 1KCSH 4Z7WB 1RZJL 1KCVH 2DKUA 1TPXC 3W39B 5AUMA 4I0PC 4FQCH 5D7SL 4XAKD 4PV9A 3QDGB 4FS0A 1ZA6A 3QPXL 3GK8L 1N6VA 4PP1C 3L3KA 5F9DC 5GS2H 2YPLD 3MJGX 3MV8A 4G7VL 1V3KA 5JR1L 2XKNA 1Q9OB 3EYOB 5BZDA 6FABL 3G5ZA 3WS6C 3FN9A 4FQJL 4OGAD 3SE9H 2NY1C 2WM0A 3GGWA 4V2CB 4CVZA 3RHWK 1MCOH 3LEXB 1LO4H 3ZSSA 5CEXB 4PJDE 2XTJC 2NY0C 4JE4B 1MRDH 4AENB 2BSSB 3GO1L 4M48L 1I9RH 3FTGA 3MLTA 5HYJD 2COQA 1WWWX 4MJ6B 3K4DA 4M93C 4QGTA 1DANU 3LD8C 1X4XA 4MNHA 4XP9L 1HKFA 2ADFL 1B2WH 5AZ2H 5DO2C 4WFEE 3CFKB 1T04B 1XZ0A 2ICEB 3BGFC 1JPFA 4GG8B 3TVMA 5KVDH 5I8EB 4XMLH 3VWJB 2K9UA 4ZFFA 2FX7L 3C60B 1XGQB 4PY7A 3HG1A 3V9FA 4R7NA 4XNUL 3HC0A 1B4JL 3ME0A 3PIQA 2FGZA 1OVZA 5FO7A 3OR7B 4GOSA 5I1CH 1MRFL 2EE3A 4OLZH 2Z35B 2YC1B 5GGRY 4U6HA 3RGVA 3OJMB 2VQUA 5DS8B 5K9QG 2H2PD 2M2DA 4JZOA 2R23A 4X4XB 1GGTA 4JFDD 1WIOA 4TULL 1P1ZB 3Q3GA 4NUGH 3MJ6A 2I5YH 1LE9A 5LAXB 1LDPH 3KS0J 2R2EA 4L29B 4PJAA 3D2UA 4A6YL 3AB0C 1IARB 2GFBA 4AT6B 2X2YA 2J7LA 4M6OL 1JBJA 3RVVD 4P9MH 4JZNA 4R0LB 1CN4A 4Y8AA 1WQVT 1XH3B 3PGFL 4OGXH 5C0AE 4X6DE 3GHBH 4WW1A 3VE0A 5HYFA 3MCLH 2JELH 1MCPH 4OF7A 1NANH 1IGJB 3TNNA 2WIMA 1XIWD 1JJUA 1FVCA 4M7LT 1CDJA 2XY1A 3DROB 1AHWB 3HZMB 1ZHLA 4JFHE 1GAFL 4G9FA 3RA7L 8FABB 4NN6B 3LHPL 3VFSA 1RAMA 4FFVD 1TVHB 3EOTH 1NFDF 3O2DL 4K8RD 2WMPA 3PWPB 3GJFH 2H9GB 1JF1B 4MNGA 5GGTL 1FFPB 3QISA 4M9OA 4MA3B 1M4KA 1EZVY 1OM3H 3ULSB 4P57A 4ZUSB 5GS0D 4K2UL 2FCBA 1F6LL 4PRAB 3LKNA 1RUPH 4MXQD 4ZUWA 1RU9L 1T03H 1MJUL 1JWSA 5TF1H 2DQFA 1KCUL 3OKLA 4MVBD 1BX2A 2EXYD 3KS0H 2KKQA 1U93B 2FD6H 2XQYK 5F7YC 1HH6A 2XKUA 2B2XH 1CD1B 1FE8L 3VFWB 1QLFA 3WJLC 4BSVB 1YUHA 4YHPB 4A6YB 3BQUB 4MMXC 1S5IH 4KMTH 4G42B 3WFCH 4FZEL 2HJKB 3VGFA 2YK1H 5FKPA 3K46A 3HG1D 1WC7B 3GEWB 1NH6A 1FL3B 1TVBA 1LEGA 3V52H 4RNRA 4L4VA 4JB9L 5I1JL 3TA3C 3FFCB 1ACYH 2CKBL 3QCTH 2GHWB 4JQVC 1KB5A 5EPMB 2EH7H 1F4XL 1JIBA 1EHXA 1U8OA 1FIGH 4P48A 3IDXH 1RZGB 3MRMB 1EO8L 3WFDH 3JWDC 4OZGA 5BOZG 4S0SD 5HGBA 3CMOL 1JZ5A 2H2SC 5J6HA 4JO4L 3ZT7A 1FZKA 1K6QL 4F3FA 3WNPA 3RDTC 4G8GA 3WXWH 4QNPF 4OLUH 2BVQB 4JRXA 5T5NF 4JQXC 4DFHA 1K4CA 4ALAL 5IMLA 1UB5B 4YHKH 1F8TL 5FF6A 1OAQH 3DXAB 1CFVL 4JRYE 5T3ZL 1IT9L 4NJAL 1YPZE 1H5BC 2BJML 4GLRH 1YNKL 3WS6A 3UJTH 3MLXH 4OZIE 2AXFA 2HVJB 3RPKA 4KPHH 1W8OA 2J6EL 4UT6H 4B7LA 3G5XB 3O4OB 5AG9A 1U95A 1CGWA 5IESH 3C6LD 2J8UF 2AK1H 2IG2H 5D1QA 5D1XB 5D5ME 5L9DL 1OP9A 1AO7A 4RAUB 4ODXB 2KBGA 1A47A 2X41A 2XYCA 1G6RL 5FA4B 5CEXA 2DBLL 1GIGH 1CE6A 4ESKA 4Z76A 1VADB 2R4SL 5JLZB 4OLVL 1HILA 3DURB 1IAIL 2X70A 4M3JA 5IIEB 3MCG1 3WE6B 2EDNA 2CKBB 1SBSH 2PYEB 4CMMB 4KDVA 1C5BH 1KLGA 5ISZB 5IF0A 1A6UH 5IB3B 1HIMH 5BXFB 4F9PA 4O9HH 5DHVB 4IOFC 2PN5A 1VFBA 3ISWA 1LO2L 5JQHC 1Q0YL 4ODUB 4UDUA 4F7TA 5C0EA 4X7SL 5EO0B 5SWZB 3C60A 2Q7YB 1P7HL 1IEBA 4TNWF 4Z7VE 5TF0A 5FHBL 2YD7A 2NX5E 5C6TL 4Z8FL 4ISVB 4W68A 4XCEB 3CJJA 2VXSH 2DQCH 1LO0L 1A3LL 2Z35A 2OTWA 1I7TA 5JMOC 1JK8A 1CDCA 5I71C 3E0GA 4X4XA 2BOCB 3PWJA 3W2DL 2YPKB 3W81A 3LV3A 4AG4L 4UV4L 1EHAA 5FYKE 4PBXA 2EEDA 1MPAH 4L29A 2VO5A 3P73A 4XCNB 5JHDE 3OXSA 2NNAA 1DFBL 4ZOCA 2OJZH 3SBWA 1T7YA 1RIHH 1CZ8L 3OKMA 4R7DB 4TRPH 4F7EB 3QI9B 2BY3A 1AD9A 1TLKA 3FRPA 4P46D 3K3QA 4UU9B 1MCIA 5DK2A 2V5YA 2MMXA 3WO3B 5EZJB 3ARDB 3QQNA 5ACZA 2DIAA 1EXUA 3FQUA 2R69H 4NO5B 5I16A 5FYKH 1G6RB 2K7PA 2WBJC 3PJSA 1YEGH 1IGJA 1V7NH 4GFTB 2PTTB 4U6TA 4DGYL 5C0BD 4GMTL 4HKZA 1ZGLA 3EYQD 3EDEA 2OZ4L 5EG6C 1FNSH 3BP5A 3WDHA 4GRLC 1FQ9C 1ZAGA 3WXVH 4S1DD 3MYJB 1I9IL 1NC4B 3ULVL 3QDGD 4MCZB 4YHOL 4UIKH 1FFPA 1RIUL 3ZO0A 2J3SA 3EFFB 2YKLH 3QYCA 1NDGA 4RZCB 1YEJH 2NZ9C 1P4IL 2Y06H 3GNML 2BSRB 4UTBL 5F1IB 3U4AA 4MX7A 3OKNA 2GJZA 3L9RA 1A6WL 4ZUVA 1HHHB 3Q5YA 5KSAC 2F5BL 5F7EL 1MVUA 1I3GH 4NSKA 1RJYB 3BRFA 2GI7A 1OF2A 3SOBH 2F54B 1PY9A 2LE9A 2R1WA 1YYLH 4FTVE 3GUTA 1U93A 1ZLUK 1A6VH 1KTLB 4RQQB 2VE6A 5FGRA 3DSFL 3MLPA 1GGIL 4KY1H 4YHIB 1A9EB 2E9IA 3HS0A 5DJ2A 4ZQKB 1G0DA 2F8VA 1CU4H 1G9MH 4DZBB 3DARA 3BRGC 1N6UA 4K3GA 3TA3A 3PWUB 3A6CL 4OF8A 3P4NA 1J0YA 5T3XD 4CDHA 4HCRA 1MQKL 1NDMB 1X5YA 2UVFA 3A6BH 2ZZUT 3MQIA 5GISH 3VWJD 3NAAL 2ZUTA 3O6LL 3C60D 4ZTOH 4S1QH 5F89A 3GBNH 1NGYB 3EGSA 4NQDA 3T0AA 1NFDA 3MPCA 5GRUL 1ZHNA 3JV6B 2JJSC 1D5MB 3BKML 1T4KB 1XCQA 1DBMH 4XP5L 4OZHF 2DQIH 2DLFL 5F9OL 5J6GB 5BV7L 1HKLH 4NM8L 3ARVA 2WIIB 3BMVA 4KU1A 3S35H 1A8JH 4F80A 5BS0A 2BVTA 3CH1B 4D2NA 2R4RL 2I25N 1MLBB 4D0DA 1YEKH 1T2QL 2BNRA 3OTTA 3O3EA 3RWJB 2Z8RA 1IGIL 3ESVF 4JZJB 1RJCA 1FL5A 3DWTA 5HHNA 1J05B 3STLA 4BELD 4FFYH 4YHYC 3ZT6A 4Y19A 4UI2A 2NCMA 1FL6A 2CDEA 3G5XA 3MOBL 3NZ8A 1IFHL 3T1WA 4X6BA 1HWHB 2C5DC 4PGCB 5JTWA 1T3FA 3PWPD 3JUYA 4XAWL 1Y6MR 3G5VB 4Q6IC 1OB1A 3VFMB 1FAIH 5AZEL 3I6LD 2HMIC 4ZO7A 3L7EB 1BQUA 1MFBL 3VXNA 3DVFA 4QRTB 3MROA 1DEEB 3BE1H 4U31A 4TUJB 1IKFH 2WINA 1B0WA 2HWZH 3FN0H 5C2UB 1VA9A 5ISZA 1QYGL 2QQNH 2IQ9H 5C0GB 4Z7QE 3IDNA 4TTDD 2H32B 3ARFB 3DYMA 25C8H 4H8WL 3H9SB 2EE2A 3VRIA 1QEWB 1U8KA 1X5KA 4I0CC 3VXPB 4FQXC 3BQUD 1BIHA 1R3KA 4Y5VB 2OSLB 5CGYC 2OR7A 3MBEA 3PWVB 4PRPA 4J6RH 2C4FT 1DDHB 4DAGH 1FZOB 2G5RA 1JNLL 5ID0A 3GMLB 2VDKL 3CVHA 4PRIE 2HRPL 2BOCA 3FFCD 4EN3B 4U7MA 4AQ1B 2J8UA 1MSPA 1EEYB 1UJ3B 1UZ6F 1YJDC 5DRZB 1VFAA 3LAFA 4H20L 1QOKA 3MXWH 2K1MA 2AV1A 1WAAE 2F74A 4XC3H 4YX2H 2ZJSL 3MRGB 4XBGA 3AREC 1OL0A 3REWB 2N4IA 1JRHH 1CDYA 3QDMB 1G7QA 1KB9K 2MHAA 3L95A 4OJFL 4Y4FC 5CGMA 4TVPH 3EO0B 3I75B 4NQVB 4KHTL 4RFOL 3L5WA 1L0XA 3V4VL 4Z0BH 3DUSB 5KSVA 4LFHD 5CILL 2BNQA 4BKLA 3ZYZA 3ARQA 4OCRH 3DXAD 3CPLB 3PHSA 2PETA 3OHXA 5HHMB 2VDOL 2QV2A 1T83A 5JO5A 1NC4A 1E4XI 3VXTA 5KSAA 3DVNA 2YD5A 4G6KH 4Y19D 1OPGH 1FVDA 3I50H 3B9DA 3BOVA 5CWSA 3O81A 4NRXA 3EFFA 1C16A 3IVKB 4PB0L 3SE9L 1FIEA 4PJ9B 4ZOBA 35C8L 1UCTA 5CSGA 5CLTA 1MCOL 3Q0HA 2Y36L 3S96B 3MRLA 4CJ1A 1JGLL 3VI3F 5D1XD 3KXFB 4PRDB 1MRDL 5GS1A 1SJHB 3HB3C 1I9RL 3ROOB 1J18A 4PRNA 5E1AA 4PB9L 1JYVA 1UKQA 4PGEA 4KROB 5ICZB 5D6DC 2WNGA 1RVFL 2PYED 5DD1L 4FFWD 4DQOH 4X4ZA 5IMOA 5ISZD 4WTZG 2Q87A 4ZXBC 2X42A 2O26U 3DMMA 3LRHA 4JANA 3WHE0 4R8WL 1NCBH 2UWEF 4YEEA 4QY8B 2VDLL 1MWAL 2JJSA 2VLJB 1NSNL 1B88A 1HCVA 5SWZD 3BYTA 4B5EA 2MPAH 4XNYH 1HXYB 2ICWJ 4FN0A 3SGEI 5I1CL 3VXRE 2NLJA 1M1SA 3DGGB 3MRKB 5C09E 3SQBA 4GS7C 1EGJL 3GMOA 4KKNA 1G6VK 1MHHA 4WFFE 3RX8A 4Y2DB 1QRNA 4U1NA 1T4KA 2CDFA 1NL0H 5T3ZD 2M8XA 4RMVA 3OMZA 3RWCA 3DRQB 2XT1B 5FUOL 1ZVSA 5BQ7A 3GSWB 4WTZA 4AH2A 1RZFL 3HMWL 3P0VL 2H3NB 2AEPH 2NYYC 4WCYL 2GAZB 1T0NA 3VXUE 3FQNA 2DTML 1LP9F 1BOYA 5JW3H 1ZEAH 5AYQA 4G9DA 4KJYB 5JUEH 5EOCJ 1IAKB 1X5HA 5E94B 5HJ3B 3ARDD 4JZJA 4OFYA 3NGBC 2CRYA 4GW5B 4U1IB 2AEQH 3NCBB 1XAUA 5BO1L 3TO4B 5EU3A 3MTRA 4NIKB 5KVGH 2A0LD 2FO4A 1DQDH 4HIEB 1RUKL 3FB7A 3QDJA 4ODVH 2CUIA 3O3DB 1ADQA 1FNFA 4PJDB 4D8PA 3C2AH 2PR4L 1VERA 4GKSA 5GGRA 1NC4D 4JFXB 1J87A 3TT3H 4LSQL 4G3YH 1MWAB 4XPFH 4WJ5A 2CIKB 3I02A 5IQ9A 3ZKMC 4Z7OE 5LJYH 2XQBL 3LB6C 5F70A 4O02H 4NN7B 4UDTB 1ETZA 1SVCP 3L1OL 3EYUL 4Y4KA 1CXKA 2F5AH 4X98A 2F54D 4P0DA 4XPAL 3T1FB 4MJ2A 4QHNB 1Q9KA 4GW4B 4P5TC 3GMRB 4KDTA 1X5IA 2ZOLB 2X1XR 2UVEA 3ZDZF 2IBZX 4EUPB 4U1JA 4C56E 4NKDB 3VDAA 4HAFA 4XB8A 3OAZH 3WFCL 5DD5L 3DMMD 1R5WB 2X4SB 4HWBL 3QJFB 5EOCH 4QRUA 4LVOC 3K0WA 1JZ4A 3OPZL 4J23A 2OK0L 5CZVL 4LSUH 2HLAB 4DKFL 1LEKA 4F7PA 3EDKA 1XMWA 2G5BA 4UILL 5A16B 3SE8H 2EH7L 1OSZA 4XH2B 3AREA 1ITBB 3MJ7A 2OI9B 5IW1B 1QBAA 2D4DA 3UDWA 3RTQA 3U6RA 3IU4H 1LO3L 3O3AA 5DRZA 5C0AB 4X6DB 2XNAB 4PG2C 5BVPL 4OTXH 3IDUA 4RMQA 2XG5A 4HWUA 3VFGH 5AAWA 4K7PX 2FBOJ 4YIQA 4EXKA 2C1PA 3KR3H 3WXWL 4HWEH 3ULVD 3EBAA 4PBVC 4UAOC 2XZCL 1T1ZB 2KZ1B 5DQ9B 1VACA 1HDMB 2BHZA 1NPUA 1I1AB 3MRDA 4TSAL 1WLHA 4Z7UE 4UNTA 4YBHA 5E8DL 1KJVB 2PTVA 5EZOH 1PYWB 3QRFM 1ZV5A 5JW4Q 4NPYB 2J88H 4QXTB 3NZHH 3DX6B 4GRWH 2HKFH 3MNZA 1I8IB 4PJ7E 2I9LB 3V5KB 1GC1C 1KTRL 3L3IB 4PJHF 1TFHA 3IFNL 4HXAL 4P9HL 3QAZC 5D70H 3LQAH 4H88H 5D6DA 4HIHB 1AFVL 4MA1B 3TYGL 3ZE2F 1GIGL 3P4OA 2ORBH 4LHQB 1HINH 5EO1A 5FHAH 3HC4L 2JK5A 1MELA 3KHOA 1C08A 1C5BL 4JKPH 5KN5A 2V5SA 4ELKB 3SDCB 4N1EA 4HUWA 5ICZA 4HC1A 1IGMH 5IB5A 3O2WL 1U8MB 1INQA 4FZ8H 3B5HA 3IDIA 1XIWC 4OM0H 3RVUD 1KIRB 4DVBA 4IDJL 2OM5A 4JPWL 3D3VA 4J3OC 3ARFD 2WUCL 1CK0H 2P8LA 3H9SD 4K94H 2OQJB 5IVZB 4FFVC 2VZTA 4K8RC 1QBMH 2B4CH 3WIHL 3I3DA 5JDJA 4UOW1 4MXWH 5GS0C 1R3JA 4N0CD 4JDTH 3BD3A 4MXQC 1MOEA 1WISA 3G6JF 3VGAC 5CUSH 3CFDB 2P5EE 2ZG3A 4WEUD 1KCRH 3G04B 5DFWH 1ZTXH 1KENH 1P9MA 1WWAX 4MAYB 3SQOL 4X7CC 3TGXA 4EN3D 1YDPA 4IMKC 4NQCE 1FORH 2OJZL 1RIHL 4O51B 4TRPL 3GSWA 4DZ8B 1Z2KA 4QWWD 2EXYC 1U8LB 4JRYB 1BVLA 4OAWA 2AI0L 1BAFH 1YPZB 3WN5B 5IK3B 4NFDA 4H0HB 1MEXH 4G6JL 3MJ9H 1QO3A 4OZIB 5FYKL 1ZS8A 3BPCB 3QDMD 4TYUA 3KPRA 5CJQL 2BC4A 2J5LC 2NQCA 4PLOB 5HJ3A 1PZUB 5GGQH 2IH3A 1V7NL 2X09A 4K71C 4U1IA 2QJDA 3OG4B 1HZHH 2C3VA 3EDDA 1M7DA 5J1AB 1RI8A 3UMTA 4BZ1H 3KGRA 4Q97A 2HVKA 1FNSL 2UYLA 4HIEA 3TF7C 3T04D 2UWEA 3MGOA 3QEUB 5D5MB 2DTSA 5GJSL 3VA6A 4LCCC 3S3SA 2VIRA 3ARGB 2VR9A 5HHMD 4CVXA 2ZKHH 2QSCH 3LDBC 2YKLL 5KTEH 4HUVA 3TJEH 4NHUB 1HYSD 3FL7A 1ITCA 4DUVA 3BP6A 4NC1E 3T0EE 4MNQE 3F12B 2EDYA 4OGYL 1TETL 1I9JH 4PJ9D 4P5TA 4K3JH 3LKOA 3VMNA 1WFOA 3OAYK 4UDTA 1K8DA 4YBLB 5DUBA 1YYLL 4M7KH 3FCTA 1BLNB 3RKDD 4AL8H 2AVGA 3MACL 3U4BH 2WANA 4NM4H 3KXFD 2FDBP 3IDMA 1INDH 4JG0L 4Z7VB 4PJ5E 2LU7A 4K9EL 2ZOLA 1OD9A 2NX5B 4KROD 2VZOA 5C07A 4XHJD 2IPTL 3BZ4A 1CTNA 1PKQE 3JVGA 5FCUL 1E6OH 3OJ2C 3S4SG 1NLDH 3C8HA 3Q1SL 3O4LA 1L7IH 1MJ8H 2ERJB 1WT5C 4M62H 3F7QA 2R2CA 5HYSG 3GDBA 4LBEA 3QXAA 5TQ2H 3IF1A 3MGTA 2VLJD 5EIIA 1UXSB 4F7CB 2XG4A 1S7VA 3C6LC 3L6FA 4LP4A 4GXUM 1G9NC 1PG7H 5JHDB 4XBEH 5A16A 1UWEL 3TBWA 1B90A 2YD3A 5M94B 1I7RB 2VLKA 5HPMB 4GAGL 4L8DA 4M1DL 1DVFA 2IPKA 5DGRA 2YRLA 1OSPH 2DYPB 3Q2CA 2DWEB 1K8IA 4Y2DD 2XNAA 4O2FA 3BMWA 1TQCC 3GJFA 4ONHA 4ORGB 4WW2C 5H35B 2IBGA 2P24B 2HLFD 3KNBA 5DMYA 3PXJA 3AMKA 4ZFOA 1KCLA 5GS2D 4LQFH 3S4SA 3HZKA 4JDVB 5CHNB 2X4OA 3CXHK 3NABH 2AJYH 1XGYH 3HAEH 5HYSA 3SO3B 2B8OT 2P42B 3ULUE 5DRWA 3MUGA 5FB8A 5J56B 3N1FC 4OV5B 4YXKH 5D7JB 1UA6H 5AWNL 1XR8B 5I9QC 5BZWA 5A3ID 3TO4D 1BPVA 4QXTA 4JO2L 1D6EA 4MD4A 1I8IA 4NQEE 3BP4B 4MB5A 4LLUB 4R6UA 1HWGB 3ULUH 5TDNA 2Y9RT 1I1YB 3UJJL 4ODBD 4FTVB 1YECH 1C5CH 1G9MC 1JV5A 3BE1L 3K2UH 2Z93B 4N5ED 1VGKB 2HP4A 4P46C 4NKIL 4NDMA 3FQTB 3ZDYE 4UT7L 2DB8A 4HSQA 2EDOA 4WFED 2CO6B 1DUZB 1QLRB 1OT2A 5C71A 5F3BB 3N85L 3C8KB 2X4TB 1BF2A 2GT9B 4RGOH 4GG6F 25C8L 5KS9F 4JDZB 3QPQD 2XN9E 3QUYC 1F4WL 5HVHC 5MEQB 1HE7A 3EYQC 3QULA 2XRAH 2B1HH 2BP3A 4S1DC 3SKOB 3FO9A 1MFAH 2M1KA 2P5WA 3WLWD 3P4MA 5A2KH 2W9LA 4PS4H 4OT1H 2H6PB 1G7LB 2YD1A 1A6AB 4XP6H 3DVIA 4PJHA 5IUSA 5KBNC 4RISH 1LGVA 4LNRA 1S9XA 2AJVL 3GSUB 4R3SA 2CQVA 4OFIA 4CUCA 2VAAA 4YDVA 5C0AD 4AEHL 4XMKL 4Z77B 4OD3H 2I07B 5IK3A 5T1DL 3H9YA 3MLSH 3KPPB 2YOCA 1E4KC 2E5EA 3DX8A 3MNWA 1ROWA 2UZXB 4JFHD 4UTAH 3RI5K 1XGRB 3MLRL 2DM4A 1CYGA 12E8H 3H3BC 2L4OA 4OCXH 4PBWD 1FYTE 1I1AD 4KV5E 3VWJC 2VQTA 4DVRL 3A67L 2A6JB 1A22B 5D5MA 4QXGL 2EYTB 4JLRB 4YFDB 3ARGA 1DQMH 2D7QA 4HMCA 4HFWA 1F3RB 4HS3A 2ZSWA 4XMPH 5H94A 4KZEL 1KXVC 3RWFB 4NOFA 4M1CC 2VRAA 2AEIT 3G6JA 1RZJC 4AEFA 4TN9A 3GBMH 4W6YB 5DJXB 5J11B 2ZNWA 5DEZA 3K80A 1YEIL 4FFZH 1BLNA 2GJ6E 1ONQB 3SDYH 3MRBB 1DQLH 1FZJB 3IDGB 4P4RB 4M61A 3NPZB 3NA9H 3VGDA 2X1QA 3VFUB 5C2BH 3MA7B 1AKJB 4GQ9L 3TIDA 4YQXH 4KTEL 3SDCD 2Q7NA 1NAML 3HE7B 2GSIB 3ZKXB 3IU3A 1CFSB 1JVKA 1T0PB 3NIFE 3EW3B 3L3DB 5CJXC 3TH2T 1NCBL 3UPRB 2VISA 1KIQB 2E27L 2KPNA 3EKCA 4PRIB 3CSBA 5GPRA 1AHWC 3U4EA 4NN6C 5HDQH 4JFZH 3LIZH 3U9UB 4GQPH 5E6IB 5FEBA 4KI5F 3VXME 3NN8B 3QQ4A 1I7UA 4XVTH 5IV2A 5JDSB 2J8OA 4S2SA 4K23L 3PHOA 4EI5B 3F7RA 1UJTA 5F9AC 1GPOH 3G6DH 1GHFL 1CXLA 4PGDA 5GIRA 4ORGA 4M7ZB 4OQTH 1Q1JL 4MAYD 1CWVA 3DLQR 1JP5A 4X6FB 3E6FA 5F71A 1R6VA 2CDGA 3C09B 1JHLH 1TTUA 4WUKH 5KVMC 1T1XB 3KWWB 2D31A 3HA0A 1UENA 1PX4A 4TTDC 2V9RA 2JB6B 1OGAA 1QFHA 1YNLH 2NY3B 3BW9B 4UV7L 2AEQL 2DQHH 3BQUC 4PGZA 2HFGL 2OR9H 3SEPA 4GW1A 1FC2D 1EH9A 4U1KA 3CK0H 4G5ZH 4YDJA 5J9PA 4U3CA 5L8JB 3M07A 2YUVA 1QNZH 4OI7A 5FM5M 3VU2A 4ZNCD 3GI8L 3C2AL 5DEFA 1NAMB 4LCWA 1MY7A 3HMXH 3PABB 3ARGD 2AW2A 3T65A 1SBBA 2ITCA 3I9GH 3ES6A 4ODSL 5DJ8B 3UO1H 4NNPL 4X4ME 5F3HA 1FP5A 3GMQB 2NY6B 3UYRH 1Q72H 1DBBL 1H8NA 4JPVH 5AG8A 4NGHL 3QUYA 1U8HA 4KI5C 1PLGL 5F93C 4P5MB 1CDIA 3LPGA 1K9TA 1WEJH 1A2YA 5EBLA 4J3TA 5F3BA 1CXHA 5TE4H 5EBMA 4G7YH 4HQQL 2VABB 3MRIA 5D9SB 5I30H 1JHTB 4JDZA 3C08H 2R1XA 1Q9LA 3CXDH 5INDA 1UXWA 3VXRB 1UM4H 3MFGB 5KAQF 3NMEA 5C09B 2NX5D 2MKWA 4YHZL 4HLJA 1QBBA 3ILPA 5EBWB 3M1BB 1VFMA 3UROR 1XF1A 2W0LA 3MX0A 1H3XA 5EOCL 3SKOA 5E2UH 2CLVA 1R0AH 1IAIM 2CJUH 2Z0BA 5GRJL 4EDWH 1BFVH 1A1OA 2W38A 5FYKD 2XACC 5JNYB 1U91B 1CICA 2ARJQ 2IPUK 2ADGB 3O8XB 5JHDD 5EWIH 2XXMB 4X6CF 3VXUB 5D1XC 4YO0A 4NJ9H 3GSUA 1L7TL 1H8OA 5E8OB 3F5WA 4KXZI 4WWKC 5B8CA 3VFGL 2EECA 3MCKA 2DF3A 3PGDB 1VFUA 4OD2A 1J0IA 4FFWC 5CD3B 2P8MA 1ORQA 2ICWB 3EHBC 3QHTC 4NWTL 2JJTA 4I48A 4R4ND 3UTPE 1KPRB 5L7XH 3HRZB 3BJ91 4W81A 4GG6A 5KS9A 4MQSB 3UTZA 5GRXG 1Z6JT 1A3QA 1DBAL 1V7MH 3ARBB 2A74A 1MNUH 5EZOL 3DBXB 3N9GH 4L9DA 1WZ1H 1A7NH 1FCGA 4U7SA 4HH8A 5D7JD 5CJOL 4P4KB 2R1YA 4GXUN 1EVUA 3HNTH 1MRCH 3I6GA 2VXTH 4JM4H 3G6AA 5IBTH 3RWEA 1H3TA 1JYNA 2R29L 1KC5H 6CGTA 2ARJA 5BVJB 2Q76B 1B4RA 5MERB 4X9IA 4GRWF 4H88L 3U36B 1RIVH 4NZTL 4JFOB 3BSZL 1E4WH 5FECA 4FTVD 5DI8A 2IALA 2ORBL 2HJLA 1OGTA 3V5DB 1NFIB 4MA7L 2DD8L 4MB4A 4WY7H 4C56B 5CEZE 3QI9C 1DN2A 2DS4A 4GMSL 3INUH 3TIEB 4PJIF 3AU1B 2V5RA 3TN0A 3W82A 4BQBA 1P53A 2VNCA 3ARDC 3OB0H 4OM0L 3LPFA 1YNTB 1HCFX 1JNHB 2D03L 5C08A 5I1DA 2FJHA 2LVCA 3PNWA 4I13B 4YDKH 1KFAH 1K3IA 5IB1A 3C5SB 3C9NB 1QFUH 1F6FB 4LIQE 3EYVB 2Q6WB 3VWKA 3U9UA 3F7YB 5IBLD 1SMAA 4MDIB 4JDTL 4HPOH 1S8DB 1F42A 3CDCA 2X4NA 1F11B 4XB7A 4P23B 3E6HB 2Y5TA 1FN4A 1OAZH 5I6XB 3TBVA 5ID1B 2R2BB 1FCCA 5CD5D 4KWUA 4QKXB 1FORL 3DX9B 3MC0A 2ARWA 5C3TA 4X6FA 5ENWA 4XNQB 1Z9LA 4AMKL 5L2JB 4PJGF 2IANA 1ZT4B 1J1XL 5BMFL 4Z7UB 4NHCH 3OXRB 4R9HA 1CLZL 1LILA 4D94A 3FONB 4F2MB 3VI4F 1IZJA 3VH8B 1DBKH 4QHLB 5KG9B 1A9BB 1JYWA 4PJ7B 2ZG2A 3GSVA 1HZHL 5AD0B 4I2XE 4U2ZA 3NCEB 1HSBB 1NCDL 2V2WB 1I1FB 3EOYG 5MEPB 3OAUL 1NGWB 3IGAB 2NTSP 2HT4C 1XT5A 3S34L 4U2YA 1KNOB 3PDDA 4UINH 4LPTA 1U8NA 4IOIA 3BXNA 4KJQD 1TQBB 3T0BA 3DYPA 4B53A 1S7XB 1NBZA 1JPSL 4WNQA 1D7FA 2AXHA 1KN4L 2B39A 1JWUA 4FQLH 3D25B 4QRSA 5FYKU 4H25A 3RZCB 3BWUC 3ULVC 4LVHC 3V4UL 2ZUUA 5EU6E 4JFFA 5DJYB 1NCWH 4TUOA 3AM8C 5E6ZA 2VABA 2A9NH 4F33A 1XF4A 4LEXH 1B9ZA 1A7PH 3UP1A 4RAHA 3KPOB 4APQC 1AKJD 5I15H 3EFDL 2MOVA 3QEHA 3HE7D 2H26B 2P5EB 1JF6A 4BFEA 1YEHL 5HGGS 3QP3A 2Y4SA 1Q94A 4PRID 3MO1A 4J8RA 4PD4K 1MFEH 4XBEL 4WWKA 4NQCB 4PTTB 3WNOA 2NW3A 1U91A 5KAQG 4NWUH 5ILTH 5E6ID 1ORSA 4JHAL 3O0RH 2XKSA 3HPLA 1YYMH 1DQQA 1UYWL 2FL5A 4EI5D 1NKRA 2FYYB 3ZL4L 4EIZC 5HHOE 1N6QH 3FHAA 3R06B 4ZUTB 1IC5L 4P5KB 43C9B 4GAJL 1EAPA 3SDXF 3FQRB 1NCAH 1RZKH 5DMJB 1HQ4A 3NABL 5C0ND 2QSQA 4EI6A 2AJYL 2ICWA 1XGYL 3BGMB 3SGJC 5JA8B 3RVUC 1Y0LB 4TPRL 1HXMB 3TPUB 2VDPH 3ZTNL 3TT1L 3ARFC 1HSAB 5I18L 3HTLX 1SJXA 3QFJE 1FLTX 5D8JH 2NY3D 3GRWH 3B83A 1G0XA 32C2A 5GJTL 3T8XB 5BV7C 4M5ZH 4BH8B 3NTCL 3MMEA 4FQQB 5E2WL 1YEFL 2CRMA 5JORB 2DBJA 3DGCR 4P4KA 3T0EB 2W07A 4MNQB 3VFRB 4Y5VC 2NW2B 4N0CC 2GSGA 3S37H 5C0FA 3WUWB 4KVCL 1R3HB 3ULUL 5JW4M 3IS1X 3WKMH 4WFGE 4XNXL 2EDBA 2Q76A 3DOSA 4OCLC 4BQCA 3WFBH 2JB5L 1CTOA 1UACL 4Y1AA 4EN3C 1AY1L 1ZA3B 3CVIH 1ZLSL 1UWGH 1JGUH 1I1CA 4PJ5B 4X6CA 3RUGF 4QWWC 2IEPA 3QUMA 3C6SB 4JY6A 1AXTH 1NFIA 4RIRB 2NY6D 1KELH 1TJHL 3MBXH 3C5ZB 4E42B 4QF1B 1E4XH 1NMBL 1PKQB 2PW1B 2BZDA 2AAVA 1SJEB 5D1ZA 1RK1B 4QLRA 1AXSB 1U3HA 3WD5H 3GIVB 4PY8I 5K9KA 1JNHA 1I85C 1AR1D 1HNGA 5TH2A 2SEBB 5C0RH 4LKXA 4G8EA 2XRAL 1CQYA 3GSRA 2VWEC 5GGSB 3VXRD 2IGFH 1FFOA 4UB0H 4H26A 5C09D 2A6IA 1P4LB 1JPST 4P99A 3WLBB 3VH8G 3JTSA 4RDQF 2Q6WA 2BVOB 4HS6A 4WFFD 5D71H 5LCVL 1FNGA 4WGVB 4YWGL 3MLZL 1CR9H 3JTTB 1HYSC 3QIWC 2D9CA 1K4DB 3B8YA 4HULB 4H8WC 15C8L 1J7VR 4TTGA 5C0JA 4PJ9C 2FSEA 2HKHH 3O8XD 4HKXB 1BFOA 2DN7A 3SCMB 3PGCA 3VXUD 2AKRB 2H8PA 5T1KA 1AGBB 4U1HA 3SGEH 2OMBA 4HHAB 4P59L 3CX2A 3IETB 3P0YH 2OX5A 3MRHB 5CINL 5CBEA 1UCBH 3F6LA 4KROC 1GYAA 1TCRB 4PJIA 3FQXB 1CI5A 3VH8A 1P84K 4UTAL 3CFCH 4Q58C 3UEZA 4NQEB 1W0WA 12E8L 2VQ1B 1RPQA 5JOFA 2OJEB 4BFIA 4X4YA 4P2RE 2P49B 1OAXL 3ARBD 3H2WA 3I84A 5I1KL 3IGAA 5DHYB 3L3OB 4KUZL 1CL7L 1ZHKB 2V17H 1JF5A 4EQ2A 1FH5L 5IHUL 2CGRH 3PHQB 4P4KD 1RHHB 3L5HA 4QHUB 3MV7A 4LAQH 2EKJA 1JGVH 4JHZA 1JPGA 5T33H 4XP4H 4U1MA 2ZUWA 5E8PA 4D0CA 3V7MA 3WFEH 5L6YL 4DTGH 2ZUVA 5ICXA 4YGVB 4BZ2H 4OKVB 3DUHA 3QUXB 3UYPA 2ZPKH 4ACPA 4KHXL 5IR1B 2FHFA 1CFQA 4APQA 4RFEB 1SYSB 2XN9B 4X5XA 5IOPA 1U8QB 3TLRA 1HOCB 3RVXD 1EX0A 5DJCB 1AQDB 3A6OA 4EOWL 1A1NB 5GRYA 4PJGA 4HWZA 5KZCD 3RGHA 3NFSL 4YQXL 1H3GA 4NNXA 2A83A 3DETD 3BD4A 4JFYA 4HZLB 1YA5A 1M71B 2BNUA 1D5ZA 1OLZA 2MTPA 2R15A 1NBQA 1KN2L 3FOLB 3X14A 5SV4A 5A3IC 4L9LB 2AABL 2YD6A 3ILQC 3TO4C 5LQBH 3IDJA 3BT2H 4EIGB 3MJ9A 4ERSH 4F9LC 3E2HB 1JL8A 5ANMA 3HC3H 1FRGH 2A9MH 2X89A 1A7RL 1A4JB 4DOHE 3TYFB 5DUMH 1U8PA 3BP7B 5H8DA 3QNXB 4P23D 4HG4J 1TVDA 2MCPL 2A73B 3WUWG 1M6OA 3KPQB 1QKZH 4K3DL 1RMFH 4M00A 1JHLL 4XNMB 3KPLB 4HDIB 4NZRL 3OKOB 4HH9A 5DRNB 1BZ9B 1FYTB 1OD7A 4J1UB 1L9MA 4LLMB 1P4BH 3AC0A 4RGNE 5JXED 5E7FA 1GGUA 5IFAL 3GSOA 1G0YR 4KRPD 1R5VA 5FK9B 3U7YL 3NCJH 2AV7B 3DVGA 1JTOA 4JM2B 4BH8A 4NKOB 1SY6H 5I1GL 4MXVF 1G7PB 3QNYB 2OL3L 1PW3A 1QNZL 4IMLA 3MV8E 1X5JA 4JG1H 5JHLL 2YSSA 5TE6L 3O2VH 1MCNA 3U2SB 1NGZA 1S7WA 5L2KA 3P4LA 3HMXL 3GMPB 1GZPA 3RAJL 1EFXA 3V4PL 5ESVB 3I9GL 2GJ6B 3SPVA 3UO1L 1YN6B 4MD0B 3HAEG 2WBKA 1ZA3A 5DR5L 3UZQA 3UYRL 1Q72L 1CLOL 1JGDA 4PJ5A 2FZ3A 2IWGA 1F6AA 4FG6D 4KDWA 2O61B 2C9AA 4HJGB 2NPLX 4PJBF 2JIXB 3RZCD 1RUAL 1GZQB 2BERA 1K5NB 4NKMA 2DJ4A 2X05A 3SDXA 1MFDL 5CIPH 3H3PH 4O58H 2DLHA 3BI9X 3N1QC 5C6WH 3V95A 3OKKA 1UH3A 2SEBA 4H1LB 5IKCA 4X7TB 1IEHA 3BEVA 1I1AC 3HG1E 4LLYB 3QIWA 3BRDA 3VXMB 3HZYA 4MMZC 5FM4A 3PUCA 4M02A 3SY0B 1ZSDA 5DK0B 3W5MA 3HAEA 2IF7A 4AEIH 2NY2B 2P5ED 4UIMB 1KIPB 3R4DA 1GGBL 3D85A 2YWYA 3TWCH 3B9KB 3QUZA 1FO0L 1KSRA 3ARUA 5KOMC 4NQCD 4PJAE 4NUJA 5DJZA 2X89D 3DV6A 2OL3B 3WFHB 4MA1C 3NH7H 3SCMA 3NACH 4A2LA 2AKRA 4U05A 5EDXA 3PWNB 3U9PL 5EC2B 3RUGA 1J10A 2DKMA 5EOTB 5JW5B 1FJ1A 1MREH 2WAHA 4RMRA 4GKNA 3ROLB 3NFNB 1S7TA 1QA9A 4MQ7A 1D5BB 4OD1H 1NBYB 1NAKL 5BW7A 3BZFB 4TUKL 4LLAA 1WBYA 5KANI 3PV6B 4NQEA 3WDJA 5C0DB 2AJ3A 3P30L 2YPVH 5B22A 5GHWH 1MNUL 4G9FE 1UWXH 2PW2A 4YJZL 1CFNA 2YXFA 4IIQB 1T6VN 4MD5B 1MJJA 3CSYA 4LCUB 1UZ8A 4WO4A 3BZEB 2D0FA 1IC4H 4U6YA 4ZNEA 4MNGE 1HEZA 2VXTL 3GI9H 3S36L 4UZGA 3QG6A 4S10A 4KRNA 1YEEH 1P84J 3O41B 2XPGB 5I1IH 3NBNA 4MNQD 5DDHB 5HI4D 1BIIA 5ESQB 1MJ7L 2G2RA 3VW3H 2MNUA 5HPOA 4FQ1L 4MAYC 4ZUUA 1Y6NR 2L0DA 3WV0A 1LD9A 1F58L 3KPTA 1W0VB 3VXQB 5IR1A 4Y16B 1DCLA 5DRXA 4R90H 3CNKA 1DZBA 2EC9T 3LRGA 4PJ5D 4E0RA 1N5AB 5M95B 1NBVH 1WBZA 4OLYL 4WU5B 1NUFA 3CCHA 5DSCB 5F9JA 3KPMA 2QADC 4P9HC 3WN5C 3RY4A 3C5ZD 4LHUB 2R0LH 4ZFGL 1DSFL 4FP8L 3U0PA 2DQTH 4WUUA 1RUML 2PCPB 2X7LA 2W0FB 3FO0H 2A77H 1T0MA 2LAGB 2OMNA 2NY7L 5CEZL 3DTXB 2BCKB 5CMAA 3QB7C 4NO2A 1QHOA 1QFUL 1RURH 4L1HA 4L4VE 5JW4N 1IVLA 4XVJH 2GK0A 4HPOL 4YZFE 1S7QA 3UTSE 1BECA 5ADOL 4NNYB 1QSVA 1MCDA 1AQKH 3AXLA 4OZGE 3O3UN 1F97A 4WHTA 3M45A 1Q9WB 4MSWB 3QUZD 3KPQA 4LIQL 2X44D 3T4YB 4RSVA 4ZPTB 4G8GE 5SWQA 3DO7A 4JFQA 4YBLC 1X9QA 4NHCL 4JRXE 1EMTL 4S1RL 3SCMD 2YN3A 4ZD3L 3SKNA 3QQ9D 1PBYA 1G7JA 3ULUD 3GB7A 3J7HA 3MRCA 4G6ML 7FABL 4N0RA 3I6KB 2CLZB 3SDAA 1I8KB 2P7TB 4PG9A 4KK8D 3W9EA 4LSVL 4XXCC 4JM2A 4FXKA 4KJWD 3BN3B 5A2FA 3OZ9L 2W65A 4NQED 3L3JB 4PJCF 2ERJC 2RR3A 3Q6FB 4XXDA 2FWOB 5IB4A 1P5UA 1BVKB 3SDDB 1ZKAA 2PO6B 2D9QB 4NO0B 3T77B 1KBGH 3G08A 1KXTB 3GHEH 3S37X 1AO7E 4ZFZB 3WO4B 4NZDA 4WIQA 5I8CB 1BWMA 4MDJA 3RWIA 4X9GA 3QFDA 4HJGA 1S9WA 3WSQH 5HD8D 2QBWA 3CFJA 4I8DA 2AJZA 3QUXD 3VFVB 3QHZL 4M7JH 3LKQB 2VJXA 3FOMA 3T2NL 1KYOK 1NCWL 3TBSB 2XN9D 4NOBA 3QHFH 4TNWK 4ELMF 4JGUA 4FQ2L 1GOGA 4OV6F 1VPOH 3BIKA 4OQTA 2EDRA 4X7EC 4OZFH 3Q48A 3VDCA 5L0QB 4JJ5B 3AY4C 5D7JC 1YY8A 1SYVB 4XPBH 5HGAB 2Z91B 4HIXL 4K7FA 1KIPA 1BEYH 2RCSH 2EIZB 4H5SB 4K9EC 1ZWIB 1MVFA 2FB4L 1H3PL 3EIFA 4ZS7L 4NT6A 1ULVA 2LTQB 3HLAA 4ODTL 5MP6L 3O0RL 3PL6B 3DRTA 3VGHA 3WNNA 5C86A 1YYML 4TOYH 5CSBA 2VDMH 1TZIB 2OLDA 3WEXB 1K2DB 4L3AA 4F57H 4KQ4H 2DIBA 1GGCL 4KK5D 4N0YL 5TDPB 2O5XH 1NCAL 2Y7QB 5DT1L 4PJBA 4I2XB 1NLBL 4HUKB 4I18B 3IKCA 2I9TB 2C4XA 5ALBH 4N9GB 5C0IB 5F88B 2IAMB 1HK6A 1RZ8A 4GSDH 1KG0A 1I1RA 4GKZA 3SHSA 2Z8VC 3P9MA 5LGHH 2VKXA 2EDTA 3R8BB 4L8SB 1WBXA 3RWGB 1ZT1B 5I75B 3O9WA 3C8DA 4LHUG 1NEZG 4PJ8B 1IILE 2QKIB 5FOBB 4JM2D 4X4MA 2R2HA 4QTIH 2YA2A 4E41A 4GH7B 3KYKL 5DDHA 4KJPD 2QHRL 3OKDB 4GAFB 2DL2A 2YD9A 5EU6B 3WIIL 2BDNH 3AMLA 5DD3L 2GJ6D 4OCYL 5GGVL 2Y07H 3T4AA 5JOPE 4RBPK 2V7HA 4QRPA 2P1YA 2W9DH 1V3MA 2QQQA 4P3CH 4WI5A 3KYMA 3TZVB 4EBQH 4POZC 3KAAA 1FFNB 3QEGH 1IC7L 5ACMA 3P77A 1ZE3C 1U2HA 1NEZA 3O3BA 3QO1B 5IMKB 2JIXD 5T5FH 2ZNXA 3WIFA 2ZUXA 5MI0B 1EHLH 5DQDH 2PCPA 4JGMA 4J3VA 4O2CB 2C1OA 1WAAF 4ZS6D 3RVTD 2DQUH 4HGWA 3LS5L 4MLIA 2X4PA 2ESVA 2IGFL 4OUUA 1XF3A 3EAKA 2QR0A 4OCSH 3VXMD 3OB8A 4NQDE 1NFDE 5D71L 1T1WA 1NGQL 1X7QA 1CR9L 5E99H 5JZ7C 2GTZB 3BH8B 3CX5J 4WV1B 4KJQC 4R4FH 2HT3D 5HHOB 4HCRH 5F96L 2NY2D 2XY2A 1J0KA 1T22B 1FV1A 2V2TA 5I74B 4MS8C 1OTUD 4LOUC 1BBDL 5C92A 3PP3H 2VERN 3JWDH 1Q9WA 3B9KD 2C3WA 3RKPA 5H2BA 4DFIA 1S7UB 3BN9C 4FABL 3MJ8B 3T4YA 2GCYA 3HI1B 2I60L 1TMCB 5BS0E 4GRMA 4CDGC 2DWDA 4KTDL 4YHLH 3P0YL 2ZCHH 3QFJB 3QA3B 3WFZA 4R26H 3G5YB 4C55A 4Z5RA 2BNRE 3U0WH 1CFTB 4LEOB 4YBQD 2EKSA 4G43A 3RFZC 4LK4A 1QSEE 3V6OC 3X11A 1VGEL 2R0WL 2G75B 2HT2C 3WJJC 1P7QA 3REVB 3ZKXC 3FQWA 5IB2A 1QBLL 4Y19E 2WV3A 1HQRA 1XCTA 3H42H 3ARWA 1HH9A 1IGFL 3KDMA 3MRFB 4X5WB 3FT4A 4G8IA 5T1LB 2YBRA 1LVEA 2WBWB 4FMFA 5EC1A 1N5YH 5D2NA 2NY5C 5I17A 2V9TA 4X6EA 5IHZA 2V7NA 3DNKA 5E6IC 5FYLH 3KLAA 3U30C 4DW2H 5DJ6A 4ZFZA 5TDOA 3BUYB 4XP4L 4E41D 1ND0A 1S3KH 3MRJA 3NFPB 3D69A 3OF6D 3FB5A 5I8KH 2FJFB 4EI5C 4DTGL 1MIEH 1C7TA 2A1WH 3FHQA 4ZPVB 1PD6A 1WZKA 2CK0H 4CADA 3IXTB 2AXGB 4PTUA 1IAOB 3K81A 4L8BB 5EUKB 4DCQB 5C0NC 3QNZA 4AM0A 4Y16D 3C09C 1T20A 3AY4A 5LGJB 1C1EL 1WWBX 5DLMH 2AK4A 3S5LA 5FXCH 3BKJL 1HHIA 1MFCH 3T0XA 5TFSH 2QQLH 2Z31B 1KLUA 4LHUD 2HTLD 2NY3C 5FIEA 3F58L 1F45A 2A6DA 2BOBB 5ETUB 2W0KA 3R1GH 4NZUH 1JPTL 2AQ2A 5CP3H 4PRPE 1MHEB 4PJCA 2C7UA 2MWCA 5TQ0H 4MCYA 5IFJB 4UT9L 5DD6A 2A9ML 2EIZA 4UQ3B 4NC2B 4RMSA 4PJEA 4M6MH 5DD0L 3VJ6A 5A40E 2J8UE 3PF2A 2XA8L 1XR9A 2DQEL 4M1GH 1B0GB 1RULL 5MHSE 4BH7B 5GGUB 1DL7H 1ZLVK 3QUKB 3LPWA 2G60L 3TNMB 3EOBA 3QH3B 4ODWA 3CSPA 1TZIA 4IRSA 1TIUA 4X80L 4M6AA 3SJVA 1MCFA 3WEXA 5F1NB 3KYOB 1UEMA 4NQXA 3E8UL 1LK2A 1UKTA 3UTPD 1BREA 2ADJB 1U36A 2HG5A 4HXBH 4EVNB 3MA9H 4JN1L 4W4OC 4ONFH 1AR1C 3LQZB 4P2RB 4XGZA 2ADIA 1P4BL 3N50A 4NN5C 4XWGL 2BNQE 3MODL 2F58H 4Y4HB 2IQAA 5IBUB 3RNQA 1S9KC 3V6ZB 1FDLH 2Z4QB 3CGTA 2GY7B 2UZYB 3H7BA 4DN4L 2DQJH 1DQJA 1F90H 2W60B 3UX9B 1N26A 3TJHD 5FOBA 2B0SL 1WCQA 2AGJL 2I26N 1RJZA 4RX4A 3VG0L 2LABA 5KSBF 2NXYB 1GSMA 4DGVL 1BM3H 3FO2A 3SDDD 4NRYA 1J0HA 4PREA 1PG7W 2PO6D 1J1OL 4NO0D 3D0VA 3O8XC 4HS8H 3QXDB 1J9CT 2ZCLH 1IBGH 4XPTL 3L5XH 1NGPH 5CEZD 1LO5A 2OP4H 3F65A 2WQRA 4JO1L 5TE7L 3TBTA 4ENED 2X4UB 4MQTB 1F4YH 1N64H 3RWHB 3DIFB 1WITA 5MENA 5FV2A 5IMKA 5SX4I 4HIJA 3CDGA 4UQ2B 3VFNB 4YAQB 4M43H 5DC4B 3UBXI 1PEWA 1F3DJ 2LU4A 5TGBA 1A1MA 3FFDA 5GZND 1L0QA 3ARBC 4DOHB 3K4AA 4OM1H 4RWYL 1PX3A 4R4BB 1E28A 1IEAB 1A7OH 1TTFA 2P44B 2YUWA 5LBSH 2DLIA 1EVTC 5E0QA 3VMPA 4JY4B 4FQIH 3OJDA 2FATL 1QRNE 4LF3B 3GRWA 4WEBH 1F2QA 3MUJA 4PRHA 3FB6B 1U8IB 3BUTA 2E7LC 1D5XA 2E6PA 2EC8A 3EO9L 3T0WA 4N1HB 3PL6D 2EXWD 2I24N 1UVQA 4JVPA 3V6OA 3QZWB 4HIIB 2VXQL 4HX1B 4LSRL 4RGNB 3LS4H 1MREL 5AUMB 5EU5B 1QLEH 4PV9B 2Q8AH 1ZA6B 3ZDXF 4I5BA 5H37H 1B3JA 5IEHA 1A3RL 3LMJH 3MLVL 1MCWW 3U7WL 3L3KB 2FLBT 3EJJX 1IJ9A 4LASL 3MV8B 1E6JH 5M7QA 2XKNB 5E08H 2K3TA 5BZDB 1E27B 4NP4H 3G5ZB 2XWBA 2CR6A 2VZUA 2H1PH 2IAMD 3QDJE 3GGWB 4CVZB 3UC0H 5JPMA 1F3DH 5F6HI 4PJ8D 1IM9A 3B5TA 3GJFK 3FTGB 3MLTB 1MI5A 4OF0A 4LGSB 3BUYA 4MNHB 4WWID 3KVQA 2XI9A 5I6XC 2GEEA 5HHVL 1ADQH 5J13B 1DLFL 1XZ0B 1I8LC 3BKYL 5EU6D 3IXAA 3TVMB 1IAOA 2EDDA 4KAQH 3RX7A 4IBLT 3QSKB 4ZDHA 4ZFFB 1NBVL 5CEYB 3ZKQD 4PY7B 1JMZA 3HG1B 5IVXF 4R7NB 4BZYA 5B4MD 2JCCF 3HC0B 1OAKH 3TZVD 1FNEA 2N7AA 3PIQB 5JXEC 5FO7B 4LRIC 1KTDA 2GITA 2OTUA 2APXA 1IQDA 4U6HB 3RGVB 5F7UA 4JZOB 1JTTA 2R23B 4D9LH 4C83A 1WK0A 3Q3GB 2J8HA 1BJ8A 1LE9B 4ZTPL 4URTB 2VITA 3M8OH 1MHEA 4MJ5A 2R2EB 4PJAB 2X4QA 4KMQA 3D2UB 5IFJA 5MEOA 2DLTA 5IBUG 5CJ8A 3FT3B 1N4XL 1F4AA 5GSRB 5JXAH 3I3BA 4Q9QH 4JZNB 3RU8H 4YXHH 1DBJL 1C5DA 1B0GA 4U0RC 5HHOD 1TQBC 1WFNA 4UUJB 4WW1B 3VE0B 3O6FA 4FG6C 2D4FA 1JNNH 1YJDH 4ZAKB 5GGUA 3MGAA 2FBJL 2OBGA 3Q6GL 4XPGH 2PXYC 3VDBA 2B20A 3TNNB 2VSCA 3V5HA 1BQHG 1X5LA 1KB5L 4ETQA 4CNIA 1ZHLB 2ICES 3B2VL 4G9FB 2R9HD 3VMOA 3GSNH 3VFSB 2XWTA 3BDYH 5FDWA 2O5ZH 2NTFA 3QFJD 2J4WH 3GKWH 1CD9B 3MRRB 4YE4L 4MNGB 3DUUA 1YQ2A 4P57B 4RGMB 5HYEA 1QTYT 4OFPA 3MREA 3FZUC 4NCDA 4PY8J 3HNSH 1HHGB 4OFDA 1JWSB 4WFGD 1BGXH 4U6VL 4YUEL 1A4KA 2DQFB 5T1LD 1YEDA 3P9LA 5GZOC 1AP2A 3OKLB 4KKCD 4NBYB 1A6ZA 3GHEL 1BQHA 1RK0A 4BSWA 1BX2B 3ARRA 4ORZC 3MLWL 2ZCKH 3UXFA 1UZ6E 3QXDA 4XZUA 3T2PA 5CBAA 4PJXF 1QLFB 4JFEA 1YUHB 1CVSC 3MXVL 1GL4B 2X4UA 4WFHE 3P11H 3QCVL 4NC0B 4S1SH 5CZKA 2FX8H 5ITBH 2D0HA 1EJ6A 3JV5A 4LCIH 4KZDL 5FKPB 3U0TA 1ZHBA 1TVBB 2HH0H 1LEGB 4RNRB 5EN2A 3IAGC 1X5FA 4L4VB 3D3VE 1MAMH 4N0UA 3QEQA 3EOAA 5E00A 1KB5B 4JHWH 3U1SL 3UTSB 2Z31D 3HHRB 3BWAA 3FO1A 5I8OL 5SX5H 2E7LA 4KK9D 4FNLL 4OZGB 5I1EL 5D96B 3MV9E 5A2JH 4U1GC 5HGBB 4R4BA 1MCWM 4NC1C 3T0EC 5KVFL 2BFVL 4XCCL 5ACLA 4YDIL 4GXVH 3O6ML 3LEYL 1FZKB 4QRQA 4CGTA 4F3FB 4G8GB 2E9WA 4JRXB 1SY6A 1XF5A 3D9AH 5IMLB 4ONGL 4YHML 1AE6L 5FF6B 3UTOA 1I3RA 3H0TA 2VZ1A 5EU5A 5B21A 4CKVX 1A0QH 1BOGA 2AXFB 4JO3H 2IC2A 3KPRE 4LMQE 5D7IF 5ALBL 4O4YL 4JKLA 1WF5A 4V1DA 1L0YA 4TQEL 1Y18A 1U95B 5LGHL 1E27A 4P2RD 5AEAA 1AD0A 2R8SH 4GBXA 1AGFA 1JTPA 1FPTH 2CMRH 2UWEE 4M93B 3IAPA 5D1QB 3BVNA 4Y4HD 4YXLL 1AO7B 5CIPA 4P2QA 3D39A 2VDRH 1CE6B 4Z76B 3NIGF 5LXGH 3W11C 1A7QH 5ITFA 3S6CA 1KEGL 1HILB 2X70B 4Z7NF 4PJFA 2RHEA 2NR6D 5J4MA 2NXYD 4JAMA 1KLGB 1D6VH 2O5YL 4O2EA 1W72H 5IF0B 1EERB 4OLXL 2UY6A 2EIDA 4MA8H 4OSUH 3RIFF 4EXPX 3EJZC 3BGAA 1VFBB 4UDUB 4F7TB 5C0EB 5C8JA 4O00A 3QQ9C 5CEYA 1N59A 3QEGL 1IEBB 4HLZH 2UZIL 2HTKD 3LEVH 1NCCL 4TSCL 1X5ZA 5FGCE 3LKSA 4F15C 5C07E 5B3NA 4M3KB 1MCQA 2R56L 4NCC2 5EU7E 2OTWB 1IL1A 1I7TB 2PUQT 1JK8B 2QL1A 2P45B 4KJWC 3O4LE 3JSSA 4TSBH 2BY2A 2EE6A 2XZAL 4LU5H 1TZGH 3PWJB 2YUXA 3LV3B 4OZ4A 4U49A 4PR5A 1ZANH 3HFMH 3FT2A 3S9DB 3P73B 3JUZA 3OXSB 2NNAB 3OKMB 1FBIH 2PXYA 3FT3A 3HI6H 3MR9A 1MY5A 1AD9B 2VLKE 4HCRL 5GSRA 3BPLB 5E5MA 4ETYA 5I0ZA 5DK2B 2AQ3A 4UUJA 5ACZB 3P40A 4F37F 1EXUB 4ZAKA 3FQUB 5I16B 1KGCE 3S88H 2PF6A 3PJSB 5IJKC 5IGXL 4XX1E 1MCSA 5BJTA 3QIBA 4HKZB 1ZGLB 1RZ7L 2RGSA 2AEWA 5ICYA 4R26L 4RGND 3BP5B 1ACZA 5IVXA 1IQWL 2DQGH 2JCCA 3ZDZE 3MRRA 1G7HA 3THML 4Q2ZA 4JPKH 1NDGB 4MAUH 3HI5L 3MV8D 3I2CH 1D5IH 4JR9H 5CSZA 4L9LC 1HHGA 4MX7B 3V0VA 2GJZB 3L9RB 3OKNB 3I85A 4ZUVB 1A14H 1INEL 2P4AB 1MVUB 4NSKB 3E2HC 1OF2B 3MOAL 4CBPA 1GC1H 1RV6X 2R1WB 4MQXC 1BD2A 3IFLH 5E8EA 4DW2L 3GUTB 3GJEA 1X5GA 5E2VH 2Y5EA 4N90E 3LRSA 2VE6B 2R0KH 2EDWA 1MIEL 3HS0B 5DJ2B 5DQJA 2A1WL 4HFUH 4DKEL 3RL1A 4I4WA 1KJ2H 5IWLA 3TA3B 2FEDD 1MUJA 3B6SA 4PUBL 3X3FL 1UADC 3P4NB 2F8XC 4CAGA 4YH6A 3QIUA 4M4PA 5C0CE 2BXYA 3TVMD 2RJMA 4Z78A 3CUPA 1I7ZA 4HKBA 4L3EA 3KJ6H 1S78D 3SGKA 5TFSL 4KTYA 2YEZA 5F89B 1IC1A 1G9EA 3EGSB 4NQDB 1NFDB 1N3NA 1ZHNB 3RL2A 2IBBA 3UTSA 4NZUL 5D72H 2K7QA 2P5WE 1MIMH 1XCQB 4XCFH 3RGVD 1A6TA 3QG7L 4K8RH 4KQ3H 4IOSD 1EJOH 1QG3A 1R24A 4KJPC 5GS0H 4PJHE 4I77H 4P2OA 1KPVA 3D2UD 5J8OA 2P46B 5BS0B 4M4RA 2EYRA 4I0PA 2RBLA 3HE6C 2VXUH 1F3JB 2ZUSA 3BKCH 3DI2B 3DV4A 4RMWA 4D0DB 1DL7L 1OCWL 2BNRB 3O3EB 4PJXA 4LDEB 1UM5L 3LH2H 1FL5B 4OZFG 1QSEB 1FFRA 1WWCA 2DMKA 4ZAKD 3CVHL 5HHNB 1IE5A 1JHKL 3STLB 5CP7A 4E5XA 1IGCH 3LOWA 4Y19B 2AJUL 3STZA 4X9BA 1FL6B 3RJQB 1T7XA 2CDEB 1FLRH 5DVOA 4DWHA 4G9FD 3NZ8B 5DMIH 4X6BB 2Q20A 5ADPH 3RVTC 2BSTA 1CGSH 4HF5L 4LARH 3OX8A 1Z3GH 1T3FB 2MQ3A 1J5OH 4LSPL 4O5LH 1OB1B 3EYFA 4Z95L 3BAEH 3MNVA 4Q9RH 3X12A 3VXNB 3T0VA 3B5GA 2VXVH 2QQKL 5ESAA 3MROB 2HT3C 1IGYA 5KSUA 4CVUA 2IH1A 1MF2H 4P3DA 4EDXA 2V2XA 4IRJC 3G6JE 1QHPA 4OZFA 2WINB 4DEPB 5IMMA 5D93B 4ODHH 3CU7A 1OTUC 1L9NA 3B9KC 4XP1L 3FRUA 1WUNT 1KEML 3V8CA 3IDNB 4TNVK 3FRPG 4FQHA 3VRIB 5DEGA 1CDUA 4XI5C 3IS0X 5CLWA 3IJSA 1U8KB 4IRZH 4XPHL 4CW1A 1LK3L 5C7XL 4QHMA 4YBQC 1R3KB 43CAA 2Q1EA 3QQ3A 4I3RL 3MBEB 3O6KH 2VC2H 3QXUA 4PRPB 2XIDA 5D7IA 1AI1L 5ID0B 1CLYH 3CVHB 4L4VD 4GKOA 1J8KA 3BIAX 2VDNH 2J8UB 4OBRA 5IFHH 3QXVA 1CCZA 4IIQC 3UTSD 4Y5XC 4K7PH 1VFAB 2AJSL 3QRGH 2AV1B 2F74B 3W0WA 1G9NH 3J8F7 1QFWI 2HFFA 4XBGB 4HPYH 3HR6A 1U2CA 3IAQA 2RIKA 2Z8SA 1G7QB 2MHAB 1D9KC 3F7VA 3L95B 1VKXA 5IT2L 1GOHA 4N8CL 4G8GD 5B3JE 4HGKC 3L5WB 4OIIL 3X13B 1N0XH 4JRXD 5KSVB 4HJJH 3MUZ1 2BNQB 4Y16C 1RUQH 4BKLB 1WV7T 3LZFL 2APBA 3IYLW 3OHXB 1JUFA 2ZG1A 3NIDF 1OGAE 3KLSA 5IM7B 3ET9F 4I3SL 3ARXA 5JO5B 1I3UA 4KVNH 3UJIH 4QHKI 3VXTB 5KSAB 3DVNB 1E6JL 1H3UA 2WUBH 1FVDB 5CWSB 4NRXB 4NP4L 1C16B 5EOQL 3HUJF 4FQPA 4IJ3B 4LKCA 4L5FH 5I76A 3MRLB 2B1AL 3X3GH 1Z5LA 3WJLA 5D1QD 4OF5A 5FO8A 2BRRL 1AO7D 2D7TL 4LCWE 4B7IA 5HVFB 5GS1B 1U0QA 1C12A 4QRRA 5DC9B 1Q0XL 1A7BA 3BIBX 4Y0GA 5DA4A 3CLFL 4PRNB 4MZ2A 1RJLA 5E1AB 3JWOL 4UMGA 4Q0XL 4PGEB 1ZT7A 1P6AB 1ADQL 3O11A 4NQSA 4XWOD 4HUMB 5IMOB 4KUCF 3VRJA 3OKEA 1U6AH 4BQ9A 3DMMB 5EUOF 3RI5F 4JANB 3GBLA 4JQVA 3MLUH 2NMSA 3W5NA 1XGPB 3KPSA 4Y5YC 5IP4A 5HHXL 5B39B 3AAZA 2YMXL 1N7MH 1OARH 2NLJB 3RWDA 1N2RA 3GMOB 1MHHB 3JV4A 4DGIH 4LPVA 3RDTA 3GIZL 1QRNB 2P8PA 3OAZK 4U1NB 3TJHC 1NFKA 2CDFB 4U6XA 3ECBA 4PP2A 4XVSL 3HE6A 3RWCB 4JQXA 1EEZA 2FX9L 3CFEA 4QOKA 1ZVSB 5BQ7B 1QVOA 3SDDC 4AH2B 1XGTA 4L4TA 2CLRA 2PO6C 4CRPA 1H5BA 5L88H 1AJ7H 1T0NB 1JI2A 2C3GA 3FQNB 1F3JA 2MFNA 2FECL 3WO4C 1OQOA 4XC1H 3HR5A 4ENEC 1TJIL 4G9DB 3U79A 5K9JL 1QSEA 4JY5H 5JUEL 4HV8A 5EU3B 2FO4B 3FB7B 5I73B 1DUYA 5AYUH 3QDJB 5I1HH 5T5NG 5E9DA 5HSFA 4GG6E 1CD8A 5KS9E 5GZNC 5T3XH 5I19L 4D8PB 2BVPA 4HBCH 4GKSB 3MLYH 2FGWH 4M8QA 1TJGH 5GGRB 3WL9A 5F44A 2F53A 4C57C 1J11A 4QYOA 5IJVA 4QXUH 4WJ5B 3I02B 5IQ9B 3L5JA 5EU4A 2DM7A 1IZKA 1ETZB 1IM3A 4OLWL 4Y4KB 3EYSH 1R3IL 4X98B 5JOPD 2AJXL 2A6KA 2LTQC 3U7AA 1KPUB 1Q9KB 1RZJH 5CP3A 2D7PA 2EXWC 3PL6C 4HUUA 5D7SH 1U3YA 1A5FL 1T6WA 3VGBA 1OHQA 3QPXH 4U1JB 1NEUA 1T7WA 5D6CA 5JW4R 3OBAA 4M9PA 3ALXA 5LWYL 4R2GC 1PAMA 5JR1H 4LPWA 2IBZY 2UUDH 3L7FA 3TA3D 3VXSE 6FABH 4QRUB 2E7MA 5DMKA 3TM6A 3C87A 4LSTL 2HH0L 2PNDA 4I18C 5C08E 1BQLL 1LEKB 1MAML 4F7PB 2G5BB 3CU1A 1EUTA 1OSZB 5A1AA 3AREB 1OAYL 3MJ7B 4L8SC 4HC1L 4NQDD 4TVPE 4M48H 3RTQB 5I75C 5K59F 1D9KA 3U6RB 2FH8A 3WYRA 3O3AB 5DWUL 4PJ8C 2VLRA 4XP9H 3U46A 1FGVL 1Y6KR 2ADFH 3GKZA 2WBJA 5TPWL 1ZVYA 2DQDL 4YIQB 3LCYA 4C4KO 2C1PB 5E8NA 5JQ6L 4BQ6A 4J4PC 1SM3L 3DECA 2FX7H 4GRLA 4K7PY 5BS0D 1VACB 3ARPA 4D3CH 4XNUH 2XFXA 3X13A 2VLLA 3VXOA 3MRDB 4YR6A 1KCSL 2IANE 3VCLA 4ZSOA 3LKRB 2BNRD 1KCVL 1AC6A 1MRFH 5B4MC 4FQCL 3TZVC 4PGBA 1KLFA 1QSED 5FUCE 1OP5H 2NY4B 5IM7A 2P43B 3IDYC 4TULH 1LMKA 1T1YB 3MNZB 5F6IB 4LLQA 3NCMA 3OGCA 4P3WA 2ATKA 2BXZA 3P0GB 1G1YA 4RFNB 2ITDA 5B39G 1LO4L 4M6OH 2VL5A 2X4RA 5FO9A 1HHJA 5D2LF 1P5VA 4OKDA 3P4OB 1BVZA 2JE8A 5EO1B 5FA3A 2EDXA 2JK5B 1EAJA 2YR3A 1C08B 4WV1C 5KN5B 5KJRH 1MAKA 1OP3H 4HUWB 5F21B 1B2WL 4IOFD 5AZ2L 5H37G 1YMMA 5IB5B 1MAJA 5I74C 1INQB 4HK3N 1GAFH 1MCKA 2EEAA 1CFBA 4XVUD 3IDIB 3RA7H 2WWKO 5HBBA 5J12B 3LHPH 3AFLA 4DVBB 1M7IA 1VHPA 1J86A 5KVDL 4AZ8A 3O2DH 4MLSA 4XMLL 3D3VB 4BA8A 2DMBA 2R9HC 2P8LB 4JFFE 1XGPA 3LEVL 5GGTH 5DMGC 4K2UH 4YC2C 2CRIA 1LDSA 5B39A 1RU9H 4Q9BA 4QT5A 4OLZL 3MV9B 1MJUH 1R3JB 4X99A 3CDYA 4TSBL 3MBED 1AGEB 4HKJA 3UZVB 4F8QA 4PRPD 4LU5L 2APTA 2FH6A 1KCUH 4NUGL 2I5YL 2QSVA 3HUJA 5INCB 1LDPL 1O7VA 3HFML 2CSPA 1YDPB 1SEBA 4EQ3A 5JPNA 3HI6L 4BUHA 5MHSD 2FEEL 1BVLB 4OAWB 4P9ML 4OGXL 5GRZA 3GHBL 4G8FB 1QO3B 4FZEH 3MCLL 1ZS8B 1MCPL 2JELL 3CZFA 5E56A 3KPRB 2BC4B 3ZE1F 2IH3B 4K07A 4GJTB 2C3VB 5EUOA 1M7DB 4JB9H 5I1JH 1MCBA 2CKBH 2HVKB 4Q6IA 4R96A 2UYLB 2EDJA 4FXGA 5DVLA 2BNQD 2UWEB 1F4XH 3MGOB 3EOTL 1ZMYA 5JMRA 2VIRB 4CVXB 1EO8H 1OM3L 1VESA 3DX7A 4ZFOL 4HUVB 4R97B 1RUPL 5KSAD 5DHVH 1KV3A 1T03L 4EZMA 1U8JA 1QSFE 4KK9C 4JO4H 4JR9L 3BP6B 1K6QH 4P5TB 1UEYA 5TF1L 1GCFA 3LKOB 5DFTA 4OZHA 1K8DB 5DUBB 1AGCA 2ED8A 4ALAH 3FCTB 4ZMAT 5CJBA 1F8TH 2FD6L 1CFVH 4Y1AE 2DMCA 5T3ZH 1IT9H 4FQXA 3IDMB 2B2XL 4NJAH 3AS1A 4QCIA 1KPUA 2BJMH 1YNKH 4X6CE 4LVOB 5FGCB 1OTSD 1AGDA 3O45A 3RY6C 3WHE1 1S5HA 2XV6B 3RX5A 5C07B 1S5IL 2J6EH 3BZ4B 4KMTL 4XTRD 3OL2A 3O4LB 5HXMA 4Q9CA 2YK1L 5HHPA 1RHFA 5I66A 4LBEB 3QXAB 5F9WB 5IROC 3V52L 3IF1B 3MGTB 5EIIB 3QUMH 1S7VB 3L6FB 1ACYL 3QCTL 1G6RH 4OGAC 3TBWB 2DBLH 2H41A 2R4SH 4LLVB 1P2CA 4Y4HC 2VLKB 4OLVH 1FIGL 3V8OA 4L8DB 5BRZA 3WS3A 3IDXL 1DVFB 2IPKB 3WFDL 3GSNA 4Y4FA 4J4PA 4KQ3L 1K8IB 1QRND 4O2FB 3GJFB 1Z9SA 2MSPA 3L3GA 4ONHB 1WICA 2EYSA 5SX4H 3KNBB 4JVUA 5ERWA 3F62A 2NXYC 2GUOA 4ZFOB 4LDLB 3WBDA 4OB5H 3S4SB 3V6FA 4OLUL 3HZKB 1LO2H 1Q0YH 2X4OB 4X7SH 4GRWE 5F6HJ 4YHKL 1KCKA 5HYSB 1Q8MA 4HWNA 4IHOA 1OAQL 5FHBH 5DRWB 3LH2L 2ENSA 5C6TH 4Z8FH 3MUGB 1BZQK 2YXMA 1OW0C 3EJYD 5FB8B 3LKRA 1LO0H 1A3LH 3UJTL 3MLXL 4OFYD 1WCBA 4KPHL 3PQYE 4PJIE 2MQ0A 4X8JA 5BZWB 1J88A 4PPTA 4UT6L 4OI8A 1FAKT 2AS5M 3W2DH 1VB9A 1D6EB 1T1YA 4JN2A 4MD4B 4AG4H 4UV4H 5HYIA 3QDJD 5IESL 1CGSL 2H2PC 5DTFA 2HMID 4ZO9A 1EHNA 3CFIC 3N06B 5TDNB 1J5OL 1I8MA 1KXQE 1DFBH 5C1MB 1CZ8H 2AK1L 2IG2L 3BH9A 1H0DA 4Q9RL 4KRMB 1RSFA 3SE3C 1JGEA 1JV5B 3VRLE 5GSVA 3MV7E 4ZXBA 4NDMB 3RVVC 4U1LA 1SBSL 5SWSA 4Y4KD 1A6UL 1HIML 5C0CB 4GMTH 3D6GA 2OZ4H 1TNNA 4O9HL 3UZEA 4FQXD 4M03A 1FZMA 5F7KC 3HZVA 4LHJB 3SGDH 1F5WA 2EDLA 1I9IH 1ES0A 3D0LA 4G6AD 3ULVH 1KULA 3VGAB 1KJMA 3VFTA 4N8PA 4PJGE 3QULB 4RGNC 4WHYH 4YHOH 3QWOA 3NPSB 1RIUH 4LPCA 1ERNA 3RP1A 2E9BA 3FO9B 2P5WB 3QJHA 3VI4E 1P4IH 3O6KL 2VXSL 3BX7C 3BEWA 2DQCL 3P4MB 4UTBH 3MV9A 5D7LA 3VFPA 4X8XA 1A6WH 4FXLA 1ZLWH 1AC0A 1AGEA 1MCEA 4KRLB 2F5BH 5F7EH 2XXCB 1JN6A 4PJHB 5INCA 3DI3B 4C59B 1MPAL 5ANME 3ARED 4LNRB 5FKAA 1S9XB 5F7NC 4R3SB 1MH5A 3DSFH 4MVBC 3RTQD 1GGIH 5D2LA 2VAAB 3B3IA 1G9NL 2J5LB 4X9FA 4YDVB 2A2QT 1MCLA 4HLZG 1EO5A 5C9KA 3U82B 3A6CH 4G8FA 1MQKH 3OV6A 2R69L 5LG1A 1JNJA 3TBYA 1FNAA 5F7DA 1N0XL 1TITA 1YEGL 3DX8B 1CDGA 3MNWB 4LCYA 3O6LH 2VZVA 3M17A 1RUQL 3TVMC 2KQMA 4MZ3A 5GRUH 1W72A 1S78C 1VSCA 3NCYP 3WXVL 3BKMH 1PFCA 4WW2F 4HFWB 2NY4D 4UIKL 2BY1A 4HS3B 4DUXA 2FHCA 2YD8A 2ZSWB 2H32H 5H94B 1YEJL 3LKPA 1T5WA 4PRBA 2DLFH 5F9OH 2Y06L 3RGVC 5BV7H 4NM8H 3G6JB 5FM8A 1O5DT 1TTGA 5EBGA 2R4RH 4S0TD 1I3GL 5I1LA 1DJSA 4XNZB 4XRCA 5L2KE 3SOBL 4YHNA 4P49A 1T2QH 1IGIH 1A6VL 1KT2A 4L8CA 4M61B 4K55A 3HKFA 4KY1L 4WFHD 1EK3A 3RNKA 3C5JA 1H8SA 1WGOA 3MRQA 1XGUA 5B38G 1CU4L 2YPLA 3TIDB 1LP9A 1G9ML 3VA2C 5IEKA 1EDQA 2V9QA 3IU3B 2VN4A 4XX1G 4PYHA 4YDLB 3A6BL 1IFHH 4Y88A 3SDXE 2VISB 5GISL 3D3VD 4XAWH 4ZTOL 3U4EB 3ARZA 4Z0XA 5AZEH 4S1QL 1OARL 3GBNL 4PG2A 1X6NA 1FVEA 1MFBH 2C4FU 5HYJA 3D18A 1R5IA 3QQ4B 1I7UB 4LLVA 5IV2B 5K9OA 5TJWK 3MV9D 4S2SB 3SKUD 3PHOB 4YFLF 1DBML 1CG9A 2DQIL 4PGDB 3RIAF 5DJDA 1QYGH 5GIRB 5B38A 4WI8A 1U58A 1HKLL 2FJGA 3BO8A 3E6FB 3S35L 4Z7WF 4H8WH 2CDGB 1S7SA 2FIKA 3ZYIA 1JCKA 4BSJA 1H9VA 2D31B 4XC1L 1AXIB 1YEKL 5I9QB 1OGAB 4NO3A 1MCHA 5D4QA 1ZK9A 3RUGE 4BYHA 4NQUA 4FFYL 3ETBF 3KPRD 2WP3O 1TZHA 4GW1B 2XWJA 5HGDA 1JNLH 1UB6B 4U1KB 1BBJA 4YDJB 5J9PB 2HRPH 5DURB 2ATPA 4WTWA 4Q74A 3V7AE 5DEFB 4HBCL 1KJ2A 1I75A 4LCWB 2Z92A 1I4FA 4M5YH 3T65B 1FAIL 2ITCB 3ES6B 2ZJSH 3PWLA 4ZNEE 5F3HB 2OTPA 3B9EA 4OJFH 2C3XA 1NJ9A 1XIWA 2BMKA 1IKFL 4P5TD 3QUYB 1U8HB 4KHTH 3Q5OA 4RFOH 4L1DA 1PY4A 2HWZL 3FN0L 3V4VH 1A2YB 1XFPA 5EBLB 5CILH 1KACB 2VH5H 2QQNL 5EBMB 2IQ9L 5C0CA 4YPGA 4GAYA 3MRIB 4GO6B 4WDIA 3OR6A 1ODAA 1N8ZA 2VDOH 2R1XB 1Q9LB 4KKBD 5INDB 1UXWB 2EDFA 4QGYA 2DLGA 3E3QE 3ILPB 2IADA 2VN7A 3SKMA 5C07D 3MRNA 3B43A 4PB0H 2CLVB 2YHGA 3IFPA 3O4LD 35C8H 4WUUE 2Q86A 1ZGLM 4J6RL 1A1OB 2Y36H 3OB0K 4IMKA 4LLDA 3ZZ1A 4DAGL 4LLWA 3FB8A 1JGLH 5EIQA 5EZLA 3UPAA 3S8WA 1CICB 5KANG 5DJAA 3QXWA 3RQ3A 5D1QC 4YO0B 2VLKD 1HHKA 4PB9H 3MXWL 4ZO6A 3RJDA 1DVFD 3F5WB 1YMHA 1RVFH 4XC3L 5DD1H 2VUYA 5B8CB 2FIRT 2IMNA 4YX2L 1QFOA 2HAZA 3NCFB 5FOJA 4D9RE 3MCKB 5GRVK 1JRHL 4OD2B 1KGCD 3GMNA 4QO1A 4XWOC 2P8MB 4TVPL 3TO2A 1ORQB 1T21B 2HA1A 4R8WH 3MFFA 4I48B 2VDLH 1MWAH 4LGPB 4D3CL 5HDBE 1EUUA 1NSNH 4H0IA 4Z0BL 2ZWLT 4LCCA 5EFIA 2CIIA 4F9PC 1CT8A 3KPNA 4JPIA 4GG6B 3CDFA 5KS9B 2F15A 3UTZB 2PTUA 5JIPA 4OCRL 1QPPA 4PV8A 2A74B 1EGJH 3C60C 5DYOA 2VUOA 4JEGB 4FMKA 2R1YB 2RB8A 4G6KL 3I6GB 2FR4A 1OPGL 3I50L 3G6AB 1QQDA 1S7RA 5GRWA 5FUOH 3RWEB 4EUPH 3L3HB 4E9LA 2ARJB 4MWFA 4CN4A 1RZFH 3HMWH 3P0VH 4X0KA 2VZ3A 1CL7I 4WCYH 5FECB 5E4EB 5DI8B 2IALB 2DTMH 2JJUA 2HJLB 2X9YA 4N90D 1OGTB 2YUZA 3SBWC 4ZODA 5KJRL 3BPLC 3IJYA 4QTHA 4AIOA 1LHZA 1P7KA 1PQZB 4WENB 2HYMA 4R0LC 5BO1H 1WT5A 4KH2A 2JKXA 4X7DC 3TN0B 4DQOL 4IM8A 3VXSB 4OF3A 1RUKH 1DN0B 5T1MA 5C0CD 3C6LA 3HN3A 4HUNB 5C08B 5I1DB 2FJHB 3PNWB 5IW6A 1YN7A 3T09A 1QACA 2PR4H 5IB1B 3PP4H 3P3YA 3I3EA 3LN4B 1DLHA 2MPAL 4XNYL 5HGHA 4LSQH 4H0GA 3VWKB 5F1SA 3WCYA 3CFBB 3IFOA 5JA9A 2P5WD 5J0BA 4WW2A 1ED3A 4U1SA 1I9EA 2X4NB 2XQBH 3NCYS 1PDKA 1CGTA 2Y5TB 1FN4B 3EYUH 3L1OH 3D5OF 3V79C 1NL0L 1NGXA 3K74B 4WVRA 3TBVB 3ZT5A 2H45A 4OBSA 3BD5A 4MXVE 4RAVA 2W9EH 2XZQH 4V2BA 4XPAH 5E70A 5ENWB 1UQSA 2AEPL 2IANB 1DE4A 3UTQA 3UCRA 5JW3L 1WIPA 1ZEAL 5DD5H 3GMMA 3KYAA 3W9DA 4HWBH 5EORH 2FRGP 1AIFA 2ED7A 4JFPA 4IS6A 3OPZH 2OK0H 5CZVH 3GSVB 4DKFH 4PJBE 5I2IA 3QWQB 5KVGL 4D9QE 2ZUQB 1DQDL 4UILH 4ODVL 1UB6A 1T5XA 2BHYA 4Z18A 2X1WL 1LO3H 4GUPA 3ZKSD 1U8NB 4JVWA 4P46A 4IOIB 5BVPH 3TT3L 3BXNB 1N0LA 4G3YL 4XPFL 1NBZB 4WNQB 1JWUB 4DK3A 5I1AA 4E41E 4QRSB 4O02L 2GY5A 4H25B 2XZCH 2O93L 2OS7A 5E4IA 5C0BA 1EFQA 2F5AL 2FNBA 3ZE0F 1SEQH 4TSAH 4HUXB 2MJWA 4Z7WA 4C54A 2EDQA 4JFFB 2APWA 4TUOB 5E8DH 3W39A 4F33B 1XF4B 3QDGA 4DKAA 4QRPE 4UNUA 1CDHA 3DHMA 2VDQH 2YS4A 2X40A 3WNKA 3QEHB 1Q9OA 3EYOA 3DSNA 3OSKA 2P47B 2W91A 3IFNH 4HXAH 4P9HH 5CCKH 1VDGA 4LSUL 3QUML 1Q94B 3LEXA 3MO1B 4J8RB 1CDBA 2E6QA 4BUGA 1AFVH 4WWKB 3TYGH 4AJ0A 3O4OC 5LKNA 3SE8L 3LN5B 5IG7B 2NW3B 2ESVE 2OR8A 4AENA 2BSSA 1ORSB 3HC4H 3T3PF 4MJ6A 3IU4L 4QHKJ 4CN6A 3HPLB 1DQQB 2FL5B 4OTXL 1E4KA 3O2WH 4NBZB 4G6FB 3CFKA 1T04A 1RQ5A 2EDKA 2ICEA 3KR3L 1EAPB 4HWEL 4IDJH 4OB5L 4GG8A 4JPWH 3OWEA 4DEPC 1HQ4B 5I8EA 5D93C 3VWJA 4EI6B 1T21A 1XGQA 4XVUC 2WUCH 2CUHA 2BX5A 3WIHH 3AGVA 1OGAD 3OR7A 1J1PH 2YC1A 32C2B 5DS8A 3MMEB 2YA0A 1QSFB 4IDLA 2J88L 1QFWH 1S9VB 3NZHL 2HKFL 1P1ZA 1GGYA 1Q38A 1K85A 2GSGB 5LAXA 5C0FB 3SQOH 4U7KA 3MBEC 5DURD 3L3HA 5E1HB 4ONOA 5D70L 4AT6A 3LQAL 4LCWD 4Y1AB 4OQ1A 5ALCH 2AI0H 4R0LA 5D2NE 1MFNA 1XH3A 4X6CB 1HINL 4G6JH 3QUMB 5FHAL 4JY6B 4EKXA 3D48R 3MOQA 1CVRA 4JKPL 4AEEA 5CJQH 5KZCB 5CJXA 3B8SA 1NUGA 2ZSVB 1PQZA 1IGML 3QUYD 3DROA 5D1ZB 1AHWA 3HZMA 4FZ8L 5F72S 3VXSA 1E4JA 1U3HB 8FABA 1JFQH 1DN0A 1EZVX 5J1SC 5K9KB 5TH2B 3TCXA 1TVHA 5F7MC 4LKXB 1MLCB 3PWPA 4G8EB 2A0LC 5GJSH 2H9GA 1CK0L 1JF1A 4K94L 4MA3A 3ULSA 3GSRB 3UBXB 4ZUSA 2AK4E 2W92A 1FFOB 4PRAA 4H26B 1QBML 3LN4A 4WI3A 2A6IB 2B4CL 3JTSB 4MXWL 4I0KA 1T83C 3CFBA 4HS6B 4OGYH 1FNGB 1TETH 3ULVF 4J2XA 5CUSL 1UT9A 1KCRL 2D0GA 5C0JB 2E8YA 1ZTXL 1KENL 4IJ3C 4PJCE 2FSEB 1EBAA 3MACH 1VEOA 1CICD 4L4JA 4GRWB 5E03A 4PJEE 1BFOB 1CD1A 4LQ1A 4JG0H 3VFWA 3PGCB 4LDOB 3BPNB 4K9EH 4OCNC 3VFOB 4BSVA 2H8PB 3H8NA 5T1KB 4YHPA 5GS1C 4A6YA 1BAFL 2E7CA 3BQUA 4U1HB 2IPTH 2RQ8A 4P2CG 1MEXL 5FCUH 1OTTD 5CBEB 3MJ9L 4G42A 1T2XA 3Q1SH 1OTSC 4KRPB 4Q6YA 2HJKA 3PQYB 4PJIB 2WK2A 4LFHG 3SJVE 2QSTA 5GGQL 3VD3A 4XTRC 2EZ0D 1WC7A 1FL3A 3MUY1 2EO9A 5FM5O 1W0WB 3DMMC 1UH4A 3FFCA 4BZ1L 5JOFB 1UWEH 4BFIB 5EPMA 4X4YB 2UV3A 4M1CD 4GAGH 4ELME 4M1DH 3ZMRA 1M05B 1RZGA 3MRMA 2ZKHL 2QSCL 5KTEL 4LSSH 3TJEL 2E9JA 3O2DA 3MV7B 4LVHB 1KUMA 5GGTA 1JPGB 1SJVA 5EO9B 3GSQB 4U1MB 5E8PB 1I9JL 4D0CB 4K3JL 2BVQA 1WVZA 5ICXB 4ZG1A 2WWMD 4M7KL 1CFQB 1UB5A 4APQB 4AL8L 5F8QC 3U4BL 3DXAA 4NM4L 4X5XB 5IOPB 4HUXA 1INDL 4PJGB 4HWZB 5D7KE 4HZAA 2HVJA 5AWNH 1A21A 1X44A 3EJYC 4NNXB 1T89C 2A83B 2CXGA