3B9KD

Crystal structure of cd8alpha-beta in complex with yts 156.7 fab
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
214
structure length
214
Chain Sequence
QVRLQESGPGLVQPSQTLSLTCSVSGFSLISDSVHWVRQPPGKGLEWMGGIWADGSTEYNSALKSRLSISRDTSKSQGFLKMNSLQTDDTAIYFCTSNRESYYFDYWGQGTMVTVSSAQTTAPSVYPLAPGCGDTTSSTVTLGCLVKGYFPEPVTVTWNSGALSSDVHTFPAVLQSGLYTLTSSVTSSTWPSQTVTCNVAHPASSTKVDKAVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab Light Chain
publication title The Crystal Structure of CD8 in Complex with YTS156.7.7 Fab and Interaction with Other CD8 Antibodies Define the Binding Mode of CD8 alphabeta to MHC Class I
pubmed doi rcsb
source organism Mus musculus
total genus 34
structure length 214
sequence length 214
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3b9kD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3b9kD01
4OI8A 1L7IL 2BHUA 3WFDH 5KVEH 1R5VA 2VABA 5DQJB 1PJ9A 4JJHA 5JW5A 4DAGL 1W2KT 4RFOH 4YDIH 4B53A 3BX7C 3OKKA 3FT4B 1K2DA 2X40A 3QUYC 4WENB 4Y16C 5DA4A 3VI3E 3RA7L 2ZOKA 4XCYB 1J12A 2GFBA 3TWCL 3A6BH 4GQPH 1I3UA 5EO0A 3HI1A 3IDUA 4FQIL 1UFUA 1SEQH 3QJHB 4HS3B 2WBKA 3L3KB 2YA1A 4MA3B 2Z31B 2X1WL 3RWIA 4HH9A 5J9PB 2HH0H 2HMIC 2ARWA 4WDIB 2R2CA 4JY6B 1NCBL 2HFGH 2ED8A 3Q0HA 5HDOA 4RGNB 1R6VA 4EI5B 5K9JL 1VCAA 3SDCB 1HHJB 3GSUB 3O2DL 1GOHA 4TN9A 4RISL 3CSPA 1EFXD 1IL1A 1OM3L 2VR4A 2OP4H 3TJHC 2P5WB 4JJ5A 5FGBC 1TQCC 1RV6X 1DBBL 1QA9A 5DRNB 3OX8A 1UZ6F 1A47A 4MMZC 5IFAH 5DJ6A 5IVXF 5FA3A 4IHOB 2J1KA 3CFIC 5F97E 4I2XA 5KANI 5T1MA 2N56A 4U6TA 1D6EB 1VPOL 4G9DA 4JRXA 3VRLF 5TQ0H 1CU4L 4JO4L 2Q76A 1A6WL 2YHGA 3BP7B 2QL1A 1BFOA 3AY4C 2ENSA 5DJDB 5H94A 1EJ6A 4WHYH 3O3BA 1A1OA 4PJFA 4Y5XA 1V7ML 1T4KB 2F19L 4KMTH 1FZKA 2DQIH 1YMME 3PWPB 1TCRB 3KR3L 3O11A 1CDHA 2VDQH 2XXMB 1C5CH 2DQEL 2VQ1B 3OKNA 4YH6A 3QXWA 3S35H 1ERNA 1TTFA 4MWFB 1ADQL 5I1LB 1DZBA 3LKNA 3OG4B 5F7EL 2IGFL 1I1FB 1KCKA 3RGVD 4K94L 3MV8D 1FVDB 2WNGA 3TN0A 1NL0H 3OBAA 4XZUB 5D6DA 5CJ8A 3TVMB 4HX1A 4ONHB 4RGNE 4YJZL 3ZT7A 5F3BA 5J13C 4TVPE 2VDKL 1FVEB 1JGLL 3NCMA 1KEMH 4XMPL 3BP4B 3GHEH 1SMAA 5DWUH 2QQLH 5GZNC 2PO6A 2VWEE 2Y7QB 1NC4B 3QUMA 1K8DA 4U0RC 5DD6B 5CINL 3ILPB 1BQHB 4L4VD 1PQZA 3K2MC 2A6KA 2YUXA 3SJVA 4UQ2B 1VADA 3TZVB 5ISZB 2GEEA 3V0WL 4UQ3B 1TETH 1PVHA 1KCVL 4X4XB 2DWDB 3TO4B 3SGEH 1LE9B 5KN5B 4XNMB 5TE7L 7FABL 1JBJA 1KIPB 5GGTH 1OAUH 4BH8B 4DUVA 1FG2A 4L4JA 5I15L 1G7PB 1ONQB 2IJ0C 2H45A 4G6KH 1WQVT 3NCYP 4DFIA 1NCWH 4PJEB 4Q6IC 4LKCB 5D6CA 4DTGL 2DM3A 3QIUB 5IW3A 4N68A 5GRVL 4RCAA 2C3VB 1G9NH 2E27H 5F1OB 1IM9B 3V4PH 3JV4A 5ADPL 1G6RB 1GGTA 4PUBL 5FB8A 1D5XA 3PWUB 5ICXB 5IQ9A 1HEZB 1H3PH 3RIFK 2X9XA 2R8SL 3TYFA 3O9WB 1NLBH 3BGFC 2FR4A 3BEVB 5HYQB 1JZ5A 5SWQB 4Y8AA 5EOQH 1ZV5A 1LP9A 5IQ7H 2O5ZH 4UT6L 4LSUL 2FH8A 2DQJH 1LO5A 3I9GH 4TSAL 4HXBH 3MLWH 2R1XA 3KPNB 3L1OH 1CFNA 2OZ4H 3P30L 4Z18A 4KXZH 4NO2A 3DRQA 5TF1H 3WFZA 4AENB 4NO5A 4M9PA 4ZAKB 4IRSD 4P9HL 3QEHB 1UT9A 1QZ1A 5IM7A 1ZLVK 1J05A 3WXWH 5DJXB 3FAXA 5EOCH 3G5YB 2VO5A 2HJKB 4KROB 2DIJA 4P5MB 3SKJH 3CH1A 2VLJB 4KY1L 1CGSL 5D1QD 2JB5H 3P4OB 1ZAGA 3FRPA 3MODL 1CFQB 4O2FB 1MJUH 4KAQL 4PJEE 1PZUB 1INQB 2XQBL 1J8HD 4XRCB 5ALBL 4Y4HD 1NBZA 3TIDA 3PHOA 3KPPB 4I5BB 2B1HL 4BSVB 1ED3B 4HULB 5I1GL 2BRRL 3TO2B 1YEEL 4MNGA 1MAKA 4JFZH 2NY6C 3Q5OA 2F8VA 5C0JB 4QRSA 3R0NA 2EDWA 5E8DL 1MIEH 1M05A 3ARRA 3LN5A 4H1LA 1EFQA 2H6PA 3PF2A 3ROOA 5T3ZL 4F58H 4ZOAA 4JO2L 2X4PA 2A9NH 4S1SH 1WC7A 4I3SH 1QPPA 3GGWA 5DQ9B 1FLRL 3IGAA 4DCQA 2HFTA 3HI5H 3OKEA 2C3HA 1E4XL 4EVNA 2NY0B 4NRYA 3QULA 1JTTA 3RJDA 1E6OH 1QYGH 5C08A 4HIXH 3FB5B 1PYWA 4M3KB 3MR9B 3OB0H 1NMAH 2BC4A 4P4RA 1F3JB 3UDWA 4X4YA 4NKOA 3LD8C 4FZ8L 5INCB 4KPHL 5BV7C 2XICA 2BNUA 6CGTA 5CJOH 1W0YT 5HI5D 4RNRB 5B22A 5FV1L 4KZDH 3O0RH 3NGBB 1AD9A 1S5HA 2WK2A 4XXDA 2X4OB 2AJXL 1F2XK 3KYAA 4J4PC 3MBEC 1GJIA 2F74A 2W0FA 4Z0BH 1L7IH 3RHWF 5FCUL 2PTVA 3QZWG 3WUZA 4NQCB 5FYLH 4EUPH 1CTNA 4X7DC 2HLAB 2FWOA 5HHOD 5D93C 1NUGA 4CW1B 3PWVA 3VFWA 2OS7A 4DAGH 3MRLB 2DRUA 4G8EA 1EBAA 2JE8A 1FCCA 2AK1L 3V0AC 3U0PA 2HJFA 5JIHA 3LIZL 5C07B 2DAVA 3RA7H 3FT3B 3NCFB 3UJTH 1WBZB 3W9DB 3S96A 3TWCH 2XIDA 3DGGA 5TH2B 4UT7L 3GDBA 3FFCD 3HUJA 4FQIH 1ZGLM 3T3ME 4NYLB 5E6IC 1N2RA 3EZJB 3K8MA 3HMXA 4NM8L 4JFXA 5DHVH 1MHHA 4CADA 1P7QB 5C0DB 5JHDD 3X14A 1OGAA 3MUY1 3C2AL 1HHIA 5FUOL 5K9JH 4PJGA 4XX1G 3L5IA 5HGBB 1MCPL 2VLRA 2RR3A 3S5LG 2A73A 3O2DH 2VISB 3U36B 2UYLB 5SWZA 1GAFL 4P2RB 1OM3H 1CK0L 3P9LA 4XAKE 3SDDA 5F7DB 3H3BC 5BZDB 3THML 3OXSA 1D6VL 1K3IA 5D1ZC 3CNKA 3EYUL 4ODWA 3I2CH 1DBBH 3T0WA 1J1PH 1V7NL 3RZCA 2OI9B 3ZDXE 1MFNA 4PPTA 2IPTH 5T1KB 4NQCE 1CU4H 4JO4H 1A6WH 1CG9B 1JF6A 3FQUB 2WBJA 4X0KA 1SYVB 1JZ8A 1FC1A 4CNIB 1V7MH 1A64A 5ERWA 3TCLA 1BZ9B 4WTWA 2F19H 4N8VB 5TDNB 2GJ6A 1HKLL 4KKAD 3DETD 3OAYH 2GITB 3QH3A 4TUOA 5DJCA 3BH9B 4K9EL 2XOTA 3FQWB 4CVZA 2MHAA 5MP6L 3GMPB 3GZKA 4YK4B 3O6KL 3L3JA 2VLKB 4Y1AB 3DV4B 2YD2A 1ADQH 1HOCB 4X7TA 2JIXA 4NQVA 5F7EH 2IGFH 1EO5A 4LVNB 4K94H 5IGXL 1Q9KA 1XGRB 3H9SA 4G43B 2EECA 4HV8B 3EHBC 2QR0A 3QA3B 5ANMB 4PJDA 4CBPA 1JHTA 5IVZB 4LLAA 3BGMA 4P2RE 4H8WC 2PTUA 3QUYA 4Y16A 4C56B 5FM4A 4AQ1B 1JTPA 2Z8RA 3MCLL 4XCEA 4J1UB 3GSRA 3HI6L 1EJOH 2D9QB 4KRMB 2VAAA 4GKSB 4OT1H 1KCVH 2J8UB 3N1MC 1G7IB 3BH8A 4BQ9A 4HHAA 4Y89A 1VESA 4ODXA 4HKBA 5TE7H 7FABH 1ZVYA 3T8XA 1IAKA 5CHNB 2ZCKL 5I15H 2AABL 2ITCA 5TFSH 3U9UA 3X11A 4JREB 3C2SA 3BPCB 2AQ2A 3OKLB 4HKXA 4DTGH 5A2LH 2IG2L 1I1AB 2QKIB 1VEMA 1EO8H 3G04A 3MRQB 2VLKE 5ADPH 4Y1AE 3SGKC 4ODHH 1CVSC 3SPVA 4P46D 4EN3D 5HHPA 2Z31C 5T1LD 4U2YA 2AJUL 4XNZC 3AY4A 4LSUH 5C0NC 2Z93A 5ANME 4EI5C 5GXBB 4E41B 4TSAH 3S34L 2WWMC 2ENYA 2EDBA 3K7UA 1A6AB 2OTWB 1QHPA 1TTGA 4QY8B 3SE4C 4C56E 1AJ7L 3B2UD 4Z5RA 3P30H 1I9EA 3NPSC 3SO3C 1KB9K 3L9RA 5J3HC 5KOVC 2W9LA 3EYOA 1ZANL 3CVHB 2J8UE 2Q20A 1HILB 2BSTB 2RQ8A 5D1XB 2WW8A 4NRXA 2DWEB 4ZSOA 1OPGL 4HJ0D 1MRCL 1NGZA 2GQHA 1DBKL 1SBBA 3HS0B 5D7LA 2XWJA 3QG7L 3SCMB 4OM1L 2BSRB 3MODH 1RD6A 4KAQH 2R0WH 1Y6NR 5CEZE 2XQBH 4OD2A 4LCYB 1UXWB 3GJFB 3GMMA 4MNQA 1A6TB 1CIUA 3REWA 3GMRA 12E8L 3SN6N 2R69L 5B4MC 4KK8C 4YHPA 3MLXL 4P99A 5I1GH 1FFPA 2ICCA 4PD4J 1YEEH 3HNTL 2DN7A 5BS0A 1LK3L 5JNYA 4J3XA 1H15A 3MGOA 4Z7QF 4YWGH 3ULVC 4GXUM 4G8GB 4YEEA 1U8MB 5E8DH 1QNZL 3WN5B 5FYJU 4HWBL 1VA9A 1KACB 1AR1C 3RPIA 5T3ZH 1XF1A 3IFOB 1Z9OA 4JO2H 3SDAA 1NC2B 2EH8L 4U05A 5IVOA 3TVMC 1EHAA 5I19L 5DJYA 4E41E 1WBXA 3AU1B 4GUPA 2ZUTA 1FLRH 5DURB 3C8KA 5CIPA 2Y9RT 4PGDB 1A2YB 4F8QA 1FFRA 4Q6IA 3ARBB 5HI4C 2BVOA 1HI6A 4HCRL 4XHQA 5DZNA 4PJIF 5JO5B 5FGRA 4LARH 1T7VA 5C8JA 3NN8B 3FTGA 1AO7A 4K8RH 1KJVB 4W6YB 5E6ZA 4XVTL 3EDEA 5BRZB 2FCBA 3MFGB 4KTEL 5J11B 2XZAH 1LE5B 5C0AB 1ZEAH 4LPXA 1OF2B 4NZUL 3ARQA 3RBGA 5E99L 2X1PA 2P8LA 3PWJA 5C7XL 3DX9A 4FZ8H 3CJJA 2QQQA 4I4WB 5I9QB 5CD3A 5ICZB 5HDQL 4NDMA 1N5AB 5I8OL 5JXEC 4JRXD 3QIUC 1S7TB 3G6DL 2AJXH 4MXQD 4PG2C 3RWDB 2DI9A 1N6QL 3WLWD 5FCUH 3V5HB 4BYHA 4LQFH 4YHNB 5EUOB 1YQ2A 4LP4A 4S2SA 1U8OA 4G8GE 1INEH 3IRPX 3FB8A 4QOKB 4RQQB 2OTUB 2R23B 1G7JA 3VA2C 5IW6A 3SOBH 1NFDF 3CDGA 3W2DH 4R7NB 4URTB 3CZFB 4G42B 4UT7H 1WV7T 2ZUVA 2G5RA 3TN0D 1ZA3B 2P24B 3MC0A 2HWZH 4K3HA 4CAGA 1CXLA 2FJHA 3DVIA 2CKNA 1U91A 3OF6D 1M7DB 3MCKB 1BWWA 3VH8A 1QVOA 4HUUB 5DFTA 4JN2A 1CBVH 4ZS6C 4J3TA 1KXVC 3DYMA 4ZAKC 3RVTC 1VERA 1Y0LA 2PO6D 5C0AE 1MCPH 3TBWB 4XPFL 4X6FA 3RKDD 1GAFH 1F4HA 3SJVD 1CK0H 5FYJL 3NIGF 4KROC 4OIBA 4KK6C 1TXKA 3GMQB 3ARUA 1IFHL 2D9CA 2ZUXA 3EYUH 4HKZA 2HT3D 2R1YB 2J6EA 5FXCH 1V7NH 2VZUA 2NX5A 4P23C 3CFCL 1Z9MA 3IDYC 1FORH 3TBSB 3LOWA 3NBNA 5E4IA 4JHAH 5JOEA 5ADOL 1I8IA 1FIGL 3UBXA 2JJVA 3DROA 2YPLA 2AV7B 4MJ6B 2EDNA 3DMMA 3HB3C 4QOKE 1BBDL 1NLDL 4QHMA 32C2A 4K9EH 2XTJC 2NY3D 2P45B 1QRNE 3JVGA 4YHIB 3BKJL 4GAYA 1T5WB 1HCFX 3O6KH 5BJTB 2CJUL 1U8IA 1N0LA 4Y7MA 1RZKL 2G2RB 2IADB 1W72B 4KKNA 4WU5A 2NY0C 2WLZA 4J4PA 4MA8L 3MBEA 5IGXH 2FO4B 4PP1C 4FQPA 1A7NH 4UBDC 3AB0B 4RA3A 3ZO0A 3VRLE 5D5MF 3TA3B 1MCNA 2H26B 3T0XA 1XIWC 3T2OA 2H8PB 1UQSB 3VD7A 5DTFB 4YFLF 4MD0B 5HDBF 3MOBL 1XR9A 1KJ2B 3UTTA 4NZJA 3G9AB 1HINL 3MCLH 4JGUA 4IRJB 2H3NB 4FA8A 3Q1SH 3PG2A 2KDGA 4JRYA 1A14L 3NGBC 1XGYH 3PWNB 2IANB 1X6LA 4KU1A 2PKDA 1U9KA 1S78C 5E7BA 3OR6A 1P6AB 2AABH 2O26U 3MUGA 3IFLL 1D3CA 1EUTA 1MWAL 4GW1B 1A6ZB 1CFSB 3H0TA 1D5MB 5IMLB 1ZHKB 2ICWJ 5MEQA 4A6YA 3QWOA 4K7PX 3WHE1 4XBEL 4PD4K 2IG2H 4PJBB 1IKFH 4LKXB 5D1ZA 3SGDH 1WFUA 2HTKC 4P59L 3UJJL 3DXAA 1U36A 1R5WA 1ZT1B 1YJDH 2BSSB 4WUKL 2GUOA 2AJUH 2A2QT 3FQRA 1BBJB 3E6FA 2W1NA 4LGRB 1NGXB 3PP4L 3DSNA 5DJ0A 3S34H 4HUNB 2OX5A 5TE6L 3O4LB 2CXGA 5HDLA 1MY5A 1AJ7H 2I5YL 4OGAD 3HPLA 2XXCB 1EHNA 3F6LA 3CFKA 5F9AC 4JFEB 3MXWL 5D9SA 1P1ZA 3RWEA 1S9VB 2ADGB 3ME0A 4OF0A 2FSEA 2EDTA 4JR9L 2P8MB 5DMJB 5CEZD 1NUDA 4MDIA 4OCXL 1CCZA 1ZANH 4MJ4A 4MCZB 4OIIL 3GK8L 5JPMA 4UZGA 1OQXA 2IANE 1OPGH 2DF3A 3BDYL 3QRGL 1MRCH 3FO9A 3KPOB 3CCHB 1OAZL 1OL0A 1DBKH 3UTSB 4FQJL 2QEJA 3M1BA 2YEZA 5DJ2B 4B7IA 1J0IA 4LLVA 2E5EA 5DD0L 1JUFB 4QXTA 4KJPC 4FQQA 4MQ7B 5DHYA 2C3GA 5CCKH 1S9KC 3TH2T 3O81A 2QSVA 1ETZB 4LF3B 3L95A 1F11B 1ACYL 4PJBE 5HTSA 12E8H 4OZGA 3ARGD 4D0BB 2R69H 3G08B 4YK4C 5F88A 2IBZX 3MLXH 1OB1B 1DDHB 5FYKE 5JOPE 1AXTL 1S7SB 3HNTH 1LK3H 2F5BL 1HXYB 4HWBH 2A6DB 4LCCB 3LKPB 1IGJB 2ESVA 1AKJB 4HDIB 4OLYH 1JMXA 4LGSB 5I19H 1RQ5A 2B1AL 3HCVB 2FJGB 4HUMB 4QHNB 1XT5A 4WFGE 4CVUA 4XPHL 5JLZA 3U2SB 4OFVA 2R39A 5I1HL 3V7AG 3L7FB 4JFEE 3U82B 5B21A 4HCRH 1OGAD 2ADFH 4PRHB 4XCYA 1AIFB 4MQXD 5F6IC 2NTFB 3SGKA 4L3CA 3VFRB 2MTPA 4XVTH 1LO0H 2X7LB 4WUUB 5SWZD 3RVWC 5DDHB 4RRPG 4JVPA 3QJHA 4Z78A 3SDDD 4MA3A 2Z31A 1LEIB 4V1DA 4NZUH 3O6ML 3PGFL 5D7KE 1IC4H 2YZ8A 3UTSE 2CRZA 4JY6A 3VE0A 3ZYIA 1NAMH 4Z7UB 5C7XH 4GKOA 3TP4A 1PY4A 1Q0XL 3RZCD 4EI5A 2EZ0C 5HDQH 3W0WA 5I8OH 5ACZB 5EO1B 3GSUA 1QFOA 1LDPH 3G6DH 4MSWB 2CIKA 4XC1L 2WBJD 1I1AC 1N6QH 4FQXB 2C4FU 2P5WA 3GSQB 1Y6MR 2GJ6D 1UH4A 4ZPTB 3CPLB 1TQBB 4HJJL 4GQ9L 3L3HA 3MRMB 2HVKA 1D6EA 2BCKB 3BP7A 1GZPB 4K3DH 5DJDA 4ZUTB 4XPAL 1D9KC 4WJ5B 2XFXA 1AQDB 4HWEH 3SE3C 3H9SD 4M43L 1TNNA 2IMNA 5LXGL 3PWPA 1TCRA 4GG6B 5C2BL 3WFHA 2DQFB 4G8FA 3QDGA 3VXQA 3EOAA 2FH6A 1YEFL 4MWFA 1F3DH 5I1LA 1T0NA 3LCYA 2QSTA 4HLJA 1I1FA 2ZG2A 4PFEA 1KV3A 1FVDA 5GRYA 4FFZL 3VDCA 4ERSL 5IMKB 4PJHF 35C8L 4ONHA 4XPTL 3T65B 4ISVA 4HIIA 1IFHH 2ARJB 15C8H 2PN5A 2AS5M 3GRWH 2HMID 3BP4A 3D0LA 4PY8J 4HZLB 2V5YA 1NC4A 1LILA 3S97C 5DD6A 3ILPA 1BQHA 4JG0L 3H42L 4JQXC 3SDXB 4PLJC 5GIRB 1P84J 5E1AA 3IVKB 5MHSE 5ISZA 4HIEB 4OKVA 4UQ3A 3BO8B 4ESKA 2JK5B 3BUYB 3QFDB 3IXAA 4XNMA 3TJHD 3ARSA 4Q6YA 1BBDH 1NLDH 4UIMB 1T7ZA 5DFVC 5IESH 4JFHD 1CD1A 1AHWC 1KPVB 1OCWL 3WUWB 1I1YB 5LJYH 3G5XB 4P2QB 4FXGA 2ZG3A 2CJUH 5I75C 5E5MA 5EULV 4LDLB 3VXUD 5JXEA 4LKCA 4TNWF 3BKML 3QIUA 1RZKH 1OT2A 2C3VA 4MA8H 1F90L 3B3IA 4GG6E 4PG2A 2CRMA 1FJ1B 4LSRH 5FCSH 4MGXA 3WIFA 1DQML 3GBNH 4XNYL 4TUKL 3ARTA 5J11C 5DMIH 2WWKO 2EYTA 4WNQA 1CQKA 5BQ7A 1JWSB 1DQJA 5SWQA 2Z8VC 3WIIL 2D4DA 2B4CH 1FBIH 5KSVA 4NN7B 2J8HA 4YGVB 4N1CA 3QIBB 1KTDB 3MO1A 3U30B 5I9QC 2M8XA 2VYRE 4K7PY 5IR1A 2DBLL 1NBVL 4NWUL 2JJSC 2Y72A 5D7LD 1FZMA 1UACH 3MPCA 4AENA 3P11L 4HGWB 2A38A 2I9LB 4JHBA 4LNRB 3IFLH 1X5AA 4ZAKA 1MCFA 5GZND 2UY6A 4MNQD 1NGQL 5F72S 3MGTB 4YC2B 4WI2A 5E9DB 3T08A 2VSCA 5C71A 2EDYA 3G5YA 1G7LA 5BMFH 2HJKA 4P5MA 5BS0D 2VLJA 3MRKB 1AGDB 4LASL 3P4OA 1ZOXA 1CFQA 3LH2L 4MJ5B 4NGHH 4O2FA 3ZKXB 1INQA 5DR5L 2EIBA 3SDAD 4P23A 4WUKH 3DJ9A 5JMOC 4KGJA 1YEGL 4JFDB 1A9EB 4YHLL 4JFFE 3MYJB 3U0TB 5KVFL 3PP4H 4PJ9B 4U4BA 4Y8DC 3S88L 4FG6D 3KPQA 5TE6H 1QP1A 2X09A 1P4BL 1ZLVH 2VXVH 1AO7D 3NCJL 3MNWB 2I5YH 3QXVA 4HFWA 3RL1B 1ITBB 4JGJA 4F7TB 4U6HB 5EU5A 3KJ4C 3UTQB 3FOMA 4B7LA 4AEHH 1YNTA 5DQ9A 3F5WB 2UV3A 2YD9A 4M9OA 3RVXC 2AGJL 4OIIH 3PHSA 2EDXA 5KSUB 3HZKB 2IBZY 4JN1L 3HG1B 4DGIL 2I60L 3HZVB 3QRGH 1CYGA 1OAZH 3LQAL 2VLMD 5DD3H 1RPQA 3AVEA 4MAUL 4R26H 3PGCB 1XIWA 4FQJH 3TBVB 3MR9A 4ZD3L 2X4TB 3CMOL 3D39A 1Q8MA 5I17A 4RBPK 1RZ7L 2XNAB 5B3JF 5J56B 1V3KA 2GTZB 2DDQL 1AXTH 2LVEA 4RNRA 4LSSL 3L7EB 1F4AA 3GNML 4HGMA 2F5BH 3VD4A 3IJSB 1YYLL 1WFOA 1ZHLA 4IS6A 43CAB 2FZ3B 3TGXA 3AB0C 5DSCB 1LQSR 4R9HA 3GBLA 3HRPA 3TA3C 1KTRL 1F6AA 1UYWL 2APXA 4CW1A 1KCUH 4AT6A 2I9TB 5I1HH 4U1IB 4X6BB 4MAYC 3O8XC 3P0VL 4WV1B 2XKNB 4JY5L 1VGKA 3MLSL 5C07A 1UB6A 3FT3A 5C0FB 4GRWH 4IRJC 2NY6D 1QR1A 3W9DA 3QRFM 5TH2A 4UOW1 4HXAL 4X6CB 4XP1L 4AG4L 5F1IB 4LSQH 4Z7QE 1YNKL 4ZDHA 4FABH 3IKKA 3O6MH 4HFUL 3PGFH 2W38A 5L88L 1MRDL 4OLZH 4DKEL 3EYVB 4LSTH 3NMEA 2NX5D 3D18B 5EIIB 1JTOA 4F33B 5HGBA 3KLDA 4MJIB 1T04B 4NKIL 4GG8B 1J1OL 3QUXB 1XGPA 5DVMA 1YECL 1FAIL 5GS2D 4PJIE 1HH9B 1UA6L 3GMLB 2BX5A 3GSVB 5BZDA 3U0WH 5TDPA 1ZHBB 5J12B 3DMMD 1XF4A 4GXUN 4TRPH 1T80A 2J88H 2P5EB 5HSFA 3SHSA 5FK9B 2D7MA 5D7IF 4UILL 4GQ9H 4U1NA 1BQHG 2AVGA 5HYEA 3MOAH 3O3DB 3O6FB 1UEYA 5T1KA 4POYA 2CQVA 1CG9A 4OSUL 3B9KB 1MNUL 5IHZA 1X4XA 1SYVA 4EUPB 5F7UA 3M17B 4XPAH 5JORB 1BZ9A 4O5LH 4J4PD 1BGXH 3MBED 2VIRB 3E6HA 1AY1H 5LXGH 3DBXB 3FQWA 5JW4R 4OBSA 2W91A 2YD4A 4QXGL 2VAJA 3B9DA 1RZGB 3GMPA 4YXKL 1IJ9A 4YLQT 5C2BH 4C57C 4X6CE 2D0HA 3A0OA 4Y1AA 1SJEB 3DV4A 3EDFA 1HOCA 4P5TC 5IMOA 4PB0L 1CD9B 5ESVB 3ZYJA 3UBXI 5E4EB 2XYCA 3LY6A 4UINL 4QEGA 1XGRA 4HT1L 4JRYD 5D7JB 3DVGB 3V4UL 1K3ZA 4ONGL 1I3GL 3HC0A 1GGBH 5I2IB 1NFDE 3KPLA 1KC5L 3QA3A 4HWZA 1DN0B 4MJIE 5IVZA 2QADB 3B5GA 4YHOL 4FMFA 5KVMC 2PTTA 3RTQB 1RZ8A 2VDNH 3NFSL 3SKNA 4JO3H 5GGRY 5IEHA 1YY8B 4C4KO 3KJ6H 3K1KC 1WWAX 1BD2A 3JWDC 4J1UA 5MEPB 1H8OA 4GKSA 1S8DB 5F96L 4CMMA 4WHTB 1EERB 1DLFH 1EHLL 1G7IA 2CDEB 3RNQA 4WU7B 4LCCC 5IB2B 3G5VB 1I3RB 5CHNA 1D5BB 3DXAD 3VXRB 4ZUUA 4CUCA 3FO0L 1MCRA 2ZSWA 4GRMB 3OKLA 5E2WL 1DVFD 3BJLA 3CFEB 1MFCL 3BKYL 5E56A 1F90H 1I1AA 3OHXB 1QLRB 3ZMRA 1CE1L 1DQMH 5H35B 4K3EH 3IAQA 4TUKH 3LS4L 2VDLL 3AM8A 1B4JH 2DYPB 4Y2DD 4YX2L 2AKRA 3WIIH 4Q2ZB 4XC3H 4M1GL 4C83A 5EFIB 4QRPB 4UNVA 4Z7WF 1QFHA 5IWLC 3CU7A 1G7QA 1D9KA 3LQZA 4PGCB 5T33L 2OTWA 4QY8A 1NBVH 3WJLC 4OJFL 3SE3A 4ACPA 4NCC2 4APQB 2NW2B 1FNSL 4X7CC 3MJ8B 3GSNL 5EU3B 3RBSA 3HNVL 2V7NB 4FRWA 3EHBD 2HVJA 5D5ME 3BZFB 4N0FA 3P11H 1A7OL 1JWMA 2HFFB 4PJ8B 3E3QC 1WZKA 1TQBC 3CVHA 1ND0B 4EEEA 4WCYL 5B38B 4MD5B 2HYMA 1FNGA 3U9PH 2DWEA 1BP3B 1EIBA 1U42A 4PTUB 1GGUA 3P9MB 3QFJE 2JTDA 3VXRE 4PY7A 4C59B 2JCCB 5L8LB 3DNKA 1N26A 1F58L 3JWOH 1FL5B 2X4QB 4I3RL 3G6AA 3MMEA 1DEEB 4EI6B 3LH2H 4CU7A 3HE7C 3MFFB 3P4NB 2ESVD 4UAOC 3GJFA 3UCRA 5JW4M 5GRUL 1A6TA 3OQ3B 3O3EB 2IFGA 4ZPVA 1Z3GL 4YHLH 1PAMA 3OGCA 5FO9A 4MDJB 3RJQB 1MLBB 4ETYA 2A6JB 3CC5A 4ZUSB 4EOWL 4G8GA 1U8MA 5KOMC 1P4BH 3BOVA 3WFBL 3NCJH 1YY9C 1RK0B 3VWJB 5H37G 3PNWB 4QRPE 1AHWA 2HP4A 4KQ4L 3E1F1 4R4FL 3AXLA 2Z31D 4V1DD 1CT8B 1A2YA 1BVLA 2AGJH 1RIHL 1BJMA 1A6UL 2I60H 2WSKA 4G5ZL 4Z9KB 4UI2A 5JO5A 3V7MA 4EI5D 2P46B 1KJVA 4H26A 2WWMD 3W0WD 2QBWA 1JGUL 3DV6B 5C0BA 1AGEB 4PJCA 4CRPA 1KCRH 2X6MA 5BRZA 3RWFB 3L3OA 5I1AB 4I48B 3D2UB 3ULUF 3DARA 5IMMB 3TT1H 3RUGF 4PGEA 5J1AB 1HSBB 3VXTA 1OF2A 5J3HD 2YC1B 2P5WD 5DJZA 1KEGH 4W4OC 5L8JB 4TVPL 2JCCE 1RZ7H 2Y23A 2RGSA 3F7VA 5F7FA 4I4WA 2DDQH 1N5AA 1R3HB 4KK9D 4M5YL 1JNHB 1JN6B 2J4WL 1IAII 1U8LB 1RUAL 2CLZA 1YYLH 2JJSA 2XZZA 1NUNB 5I8KL 2DS4A 4PRDB 3B8SA 5EUOA 3BZEB 4NBXB 1YA5A 3HC3H 3BN9C 5DEFB 4JKKA 3PWPD 4D0CA 3P0VH 4HC1A 5B4MD 4KK8D 4JY5H 3V6ZA 3MLSH 2IAMB 2R23A 3QDGD 4NN7C 3VXSB 4OLUH 4ZYKB 3QIBC 3KPMB 1RIVL 3CDFA 2EH7L 3DIFB 3ULVD 3VFTB 1ZK9A 3U30C 4N8VG 1CXKA 3MJ9L 4XP1H 2DQHL 3CZFA 3A6CL 4AG4H 1WFNA 1LNUA 1AR1D 3OXRA 1ZXQA 1YNKH 2DIAA 1ZA3A 2P24A 4ORGB 5KTEL 1KLUB 2IQ9L 3CLFL 3TNNB 1MRDH 3VD3A 4LSVL 3MCKA 3U83A 4HUUA 1ZSDA 1TVHB 2HRLA 5HI4D 1NC4D 1Q94B 4M62L 1TPXB 1K4DA 2LU4A 4YC2C 5D96C 1J1OH 4QRUA 1YECH 1FAIH 5BZWB 5JDSB 3DVNB 3D0VB 2XZQL 1UA6H 4LLQB 4LRIC 3CSYB 1N4XL 2FGWL 4QRQB 5D4QA 2F54A 5EWIL 5K59E 4ZMAT 1YEDB 2B39A 3DUHA 3VFUA 3ZKXC 4UMGA 1T0MB 4X9IA 4UILH 1IAOB 1RURH 3QDME 1TVBB 4S0TD 1G9NC 1QEWA 3TBSA 4JHWL 4OSUH 1KPRA 4MCYA 4ZNCD 4RA0C 4U1JA 2BY3A 4PJHB 3MROB 3VCLA 1I3VA 3GM0A 5JXED 4PJ9C 3QIUD 1XF2B 1NANI 2BHZA 4DKAA 1A4JB 1UWEL 5HHXL 3VXSE 2H1PL 4QT5B 2J5LB 3RKPA 3OTTA 5TGBB 4R90H 4KVNL 1WUNT 3IB4A 4YHIA 2GHWB 3IDXL 4YXKH 1RHFA 4GKZA 5BJTA 2NY1C 4PJ5B 4LPCA 5AUMA 1KXTB 4DVBB 2G2RA 2IADA 4I77L 3EDDA 3N1PC 3QQ4B 4HS6B 1HCVA 2H2PC 4UINH 4LHUA 3TA3A 5CP7B 2H26A 3V4UH 3GMNB 1UQSA 1I3GH 4ONGH 3SEPA 4HKJA 5DTFA 3UJIL 1EA9C 4YHOH 4MAYA 3O8XA 2APFA 4PJAA 3BUTA 1F5WA 3LEXA 1BAFH 2Q86B 4ZS6D 2EDKA 4JHZA 5C0CB 5SWSE 4IRJA 4ZAKD 3RVTD 2VLLA 5EBWB 2H3NA 2LQRA 1LO4L 5HHMD 3WNKA 5F96H 5D71L 2WP3O 1EHLH 3PWNA 3BN3B 3O3UN 4KK6D 3F6IA 3T4AB 2VLJD 4POZC 3WO3B 4PJHE 5F9JB 5IJKC 1VKXB 2WINB 4RIRA 4FZEH 5CBEB 2DQGL 4YDJB 2MQ3A 5ESAA 3TV3L 4P23D 1K4CB 5C0GA 4BQ8A 1A6ZA 4NJAL 1CFSA 1D5MA 1JI1A 4LLUB 5IMLA 3VXNB 1FN4A 4WV1C 3LS5L 1JNNL 5E8NA 3JTSA 4NO3B 1HNGA 4ELMF 1FZOB 4LKXA 1WCBB 3EOBB 1CE1H 3H2WA 3HB3D 3ZKQD 5I66A 2GI7A 3U6RA 3LS4H 5DUML 3QDJA 2VDLH 1ZT1A 4BK4A 4PS4L 3SGJC 1JPGA 2XTJD 2DI8A 2OL3A 4Y4KB 3EO1B 4IEFB 2BSSA 2YPVL 2Z8SA 1DBAH 2APTA 3IU3B 2DMCA 2MPAH 1DQDH 5IW1A 1UB5A 5A2KH 4M1GH 1BBJA 1V5JA 4J3UA 3ARDB 3BISA 1RULL 2I24N 2UUDH 4WHCA 1A1NA 1PG7W 3O4LA 1LO2H 3QFJD 3H9ZA 4OJFH 4UBDD 3PP3H 3VGAB 4EQ3A 3QUXC 1FNSH 3CSGA 1XIWD 5C0CE 4OLXL 3I3EA 5AAMA 5FUZL 2F8XC 1S9VA 2ADGA 3ZTNH 5IK3B 5J12C 1PW3A 1A7OH 3D39D 4TYUA 1WVZA 4MCZA 2DI7A 1R24A 2EKJA 4GMTH 1NSNL 4ODTL 4P5TA 4OKDA 4WCYH 5I18L 2AV1A 4N0UA 4NHCL 5C9KA 5GHWL 4TOYL 5HYJB 1U8JB 3VW3H 3CCHA 3V6OA 5IT2H 3B9KC 4JB9L 5T3XD 5DEGB 5D70L 1F58H 1JVKA 5DJ2A 1FE8L 4I3RH 3MUHL 4HIHA 4AL8L 3WS6C 5IFJB 1D7FA 3LPFA 1S78D 1MJ7H 4MQ7A 3NCCB 2NXZC 2CDFB 1ETZA 4LF3A 4F8TA 1FP5A 1UXSB 1VFOA 3F12B 3QUML 3BQUA 5B8CB 1KSRA 4EOWH 5C07D 1HXYA 3WFBH 1NDGA 5E4EC 2A6DA 3LKPA 1T2QL 2IQAB 2GSGA 1AKJA 1NGYA 3JWNC 4PJXF 5ENWB 5FDWB 5KSBF 4OZIF 1MFAH 1TJHL 2EYSB 3F7YB 3HCVA 4U1LA 1MFEH 4KQ4H 4OTXL 3CUPA 4R4FH 4Z95H 2NY2B 4PLKC 2N7AA 3BFOA 1D5IL 2GT9B 3L7FA 5IJVB 4JPVH 1D5ZB 1MCBA 1S7XB 5TDOB 4PRHA 3DO3A 3RZWA 1QLEL 1WIOA 5F7HA 1Q38A 4R96A 5B39A 2FIKA 2NTFA 4DKDC 2R1WA 1JGUH 3VFRA 2QHRH 1AGFB 4WUUA 1ZGLB 4R8WL 5FFLA 2PF6A 4P2OC 4ZS7L 4OV6F 1HWHB 1PY9A 2L7UA 2DOCA 4TVPH 5CSGA 4YHKH 4EKXA 4RGOL 4Z7UA 2OJEB 4M7ZC 5DS8A 4FQHA 2VDRL 2EIEA 2I07A 5IWLA 3BGAA 4EBQH 2OR7A 4M1CC 3D69A 4ONFL 3A67L 5IG7B 5EO1A 4RAUB 4YQXL 1E27B 4M5YH 3IDJA 3WJLA 3V52L 2J4WH 5T1KD 1JWUA 4MSWA 2IH3A 5HGHB 4Q74A 5GGQH 3ZTJG 3LDBC 1B0RB 2DM4A 2ICES 4X5WA 4RFEB 3U4BH 2E3VA 3QIWC 1P9MC 4ZPTA 4KJPD 1S9WB 2ATPB 4ENED 4U6YB 3QCUL 4HPYL 1LEKB 1TJGL 3QP3A 3DUSB 4K94C 1JGDB 4F15B 5K9OB 3MV7A 4YIQA 1GZPA 2DIBA 4XBGB 1RIVH 5DC9B 2EH7H 3GI8L 4F80A 5B3JE 1N64L 5KSAA 4R7DB 4GXVH 3MJ9H 3ZLQC 4WJ5A 3A6CH 4CU6A 3K4ZA 3HE7A 4DZBB 5KG9B 2QQKL 2R0ZH 1KGCD 2IQ9H 3CLFH 1U3YA 2BNRA 2CLRA 5E00B 2DMKA 3MXVL 4PRIA 5D2NC 1MJ8H 3C6LB 5KVDH 4HUXA 4HUKB 2YD1A 3L3GA 1XR8B 5HPMB 1VACB 2ZUQB 3CLEL 4GAFB 4KUCD 1BD2D 3QO1A 3PXHA 3VFGL 2CDGB 1OGTB 3L5JA 2FYYB 3NZHL 1P5UA 3T1FB 3FQTA 3DX7B 1N4XH 3ZE1F 5A2JH 2FGWH 3OGOE 4U1KB 2N1KA 5IOPB 5EWIH 4DKFL 5A3IC 1FSKB 5ITFB 2G75B 1IGML 4U49A 3CGTA 5LWYL 4QYOA 1QLFA 4HZLA 5FM5M 3WEXB 3TIEB 2VXTL 1QSFA 4P4KB 3SDXA 3JXAA 5GIRA 2EZ0D 3SKMB 1U3HB 3GIVB 5ESQB 2IFFL 3UTOA 3BO8A 1PGRB 4PG9B 1ODAA 4QXWA 3PUCA 4MVBC 3CX2A 5IFHH 5ETUB 4ZUWA 4JFOA 1MJJB 3I3BA 1I1AD 5HHXH 4W4OA 4ORZC 3BZDA 5F9OL 5MERA 4KVNH 1KPVA 3HLAA 5CEZL 3N06B 1NKOA 1I1YA 2BVPA 4P2QA 2DKSA 4KI5E 1NH6A 1QSEA 4OZHF 4NOFA 2BSED 5D7IE 2MKWA 4BSWA 4PGZA 3HR6A 4I77H 4WI5A 2VC2L 1EAPB 3LKRA 4IMKC 2FB4L 1MCKA 3KXFE 1D9KD 1DCLA 2XKUA 1X7QB 2I25N 4FXLA 3U4AA 3U1SH 2VDOL 1F02I 2W65A 3UJIH 3QXAB 4Q97A 5C1MB 1IGIL 4GAJL 1NMBH 1XGQB 4XMLH 5IV2B 1K6QH 5CGMA 4HWNA 3QIBA 1QBAA 3Q6FA 2VZVA 5GGUB 3MLRL 1MQ8A 5CKGA 5I76B 3MJGX 4BA8A 3H3PL 3IDNB 1BVZA 2DTML 5GS3A 1IAMA 1JK8A 1CIDA 4HGWA 2DQGH 4LNRA 1CXFA 3TV3H 4Z7WB 3BESR 4WFED 3HMXL 5F3HB 4M7JL 3MGTA 4PLJD 1AC6A 4UDUB 4I9WE 2Y1VA 3LS5H 1XEDA 1JNNH 1GIGL 4YAQB 5E9DA 5GGTA 3OMZA 3CFJA 3UZQA 1WIPA 4LRIA 3BP5B 4L29A 1AGDA 4H25B 3LAFA 1U2HA 5LBSH 4MJ5A 3GJEA 4Y5YA 3RWGA 4PS4H 3J7HA 5DFVD 3JBG7 2NPLX 5C0EB 4JFDA 3QUZB 1AI1H 1DQTA 1A9EA 2B5IC 2VZTA 4KTDL 5ITBH 3JZ7A 3HA0A 3JV6B 4K8RC 3U0TA 4XB7A 3VD5A 1B0GB 2V5MA 3C87A 4JDTH 1TPXC 4IJ3B 5JOFA 3MNWA 4ODVH 3RL1A 5CJQL 2WMPA 4U6HA 5C0BD 5TPWL 5FYJE 5BRZD 2ZSVB 5FUZH 3V4VL 1BWMA 4L3EB 3ZKNC 5L2KA 3WL9B 4HZAA 3BPNB 2A1WL 4ODTH 1NSNH 3KYNA 4W68A 4HSQA 5KSUA 5IP4A 3HZKA 2FBJH 4BUGA 3C5SB 3HG1A 4NHCH 1JMZA 3VMNA 5GHWH 4TOYH 2OZ4A 3CXHK 4OUOA 2ICEA 3QNXB 4JB9H 5JHLL 3TBVA 2OTPA 2R56L 4F7EA 4Z7WE 3KPRB 4PJ7F 1FE8H 2YKLH 4AL8H 2F5AL 2PYFB 5I0DA 4GW5B 4LQ1A 3DECA 5FA4B 2J5LC 5AG8A 1PX3A 3MRJB 4K55A 2GTZA 3DURA 5EZOL 2CD0A 3QUMH 1BQLH 4HUWA 5KW9L 3L7EA 4NQDA 3U7WL 1FYTD 2V17L 4JE4B 2AXGA 43CAA 5JQ6L 1E6JL 1Q9LA 1KUMA 2X41A 5IJKA 2JB6B 4ODBD 4BKLB 1TJHH 4N0YL 1OARH 4XWOC 2XN9B 3QISA 1KXQE 1T2XA 1IBGL 1D5IH 4WV1A 1UH3A 3T4YB 3P2TA 2K3TA 4U7SA 3H7LA 5C0FA 4U6VL 3HR5B 4L4TB 4X6CA 1T6WA 1M6OA 4R8WH 2Q87A 2Z92B 4NP4H 2Z91A 2ZUSA 5F7WC 3SGJA 1EEZA 3AS3A 2BVQA 3QPXL 3RX5A 4ZS7H 5MEOA 3AS0A 2F54D 4RGOH 4WO4B 1WZMA 3RVXD 2VDRH 3EYVA 3LVEA 3D18A 4ZO8A 2HKHL 2WZPD 2K1MA 5JW4N 1T04A 3V52H 4KDTC 3L6FB 3QUXA 1IGYB 1CF8L 5FM5O 1HH9A 4YPGB 3VFVA 4K9EC 1L6XA 3GMLA 4PGBB 3GSVA 3V5KB 4RWYL 3U4EB 3FONB 1B9ZA 3QQNA 1NDMA 2DLIA 2P5EA 2CK0L 2XI9A 5C6WH 1MI5A 3MQIA 1FL6B 3QCUH 1NMCC 3RUGE 4CDHA 4Z7VB 4XCCL 4HUVB 4IOIA 2M1KA 3O3DA 1RZIB 3EFDH 3B9KA 5AG9A 3QCTL 3ARDC 3GI8H 4EUPA 2XN9E 3WNOA 4HW6A 1MCJA 3PV6A 4XP5L 4X9HA 4LHUD 3C08L 4YXLL 3F62A 1PSKL 5EU6E 2BRQA 3WUWG 4G80A 4G6FD 1MY7A 1RZGA 2B2XL 1SHMA 4WHYG 3MXVH 1I4FB 3N9GH 1DR9A 1SJEA 4KKCD 4ZFZA 1UZ8B 4JAMA 4O51B 4MAYD 3O8XD 3WDHA 1P4LB 5C9JB 3RL2A 5DT1H 4XGZB 3WO4B 3FB7A 3RRQA 4V2CB 3T0EA 3CLEH 4IRJD 3K8KA 1FPTL 3VFGH 3F7QA 2NYYC 3FT2A 4O00A 1IEAB 3DVGA 3OAUL 3NZHH 5DHVA 5I74B 5TE4L 4BQCA 2R0KL 3MNVA 1DN0A 1OLLA 5EPMB 2XZCH 1A7RL 1FZJB 5LWYH 2E9IA 3O2DA 3P4MB 3WNPA 1U8QB 5E2TL 3SE8L 1K5NB 3VFNB 1BEYL 4X9BA 4QTIL 4D0DB 1ORSB 2XTLA 5DK2B 4OCYL 1SBSH 2RCSL 4X99B 2IFFH 4OAWB 1BVKA 5HY9A 1WAAF 1S8DA 5B8CC 4P2OA 4WHTA 2C7UB 1YN6A 4OLVL 2CUIA 4Z7VE 2IH1A 3OKMB 3KXFD 5BO1L 4UIKH 2NR6C 1DBMH 4KH2A 1YJDC 4J12A 5HVGB 3G5VA 3UROR 4IRZL 3MRIB 5F9OH 1I3RA 3X3FL 3QDJD 4ZTOL 5CEZH 4EXKA 2EE6A 2EDOA 4OFIA 3BRFA 4TUJB 5MENA 4GRMA 1T66D 1U8NB 2NY2C 1Q0YH 4JFYB 5CD5C 4UT9L 3RX7A 5GZOC 1SYSB 2V2WB 2GJZB 5IB1B 2G5BB 3QEGL 2FEDD 2VC2H 4QCIB 3OHXA 1QLRA 1TZGL 5INDB 2FIRT 2YA2A 3VFSB 4D9QE 2YD8A 2VN7A 3QIWA 1X5KA 1EV2E 1G0YR 3O4LD 5H35A 4JM2F 3SDYL 4Z0XB 4H20L 1I1RA 4NQXB 1MHEA 1ADQA 1IGIH 1DEDA 3PL6B 4CDGC 1AD0B 2DYPA 4LPYA 4NNYB 1G84A 2HJLA 2NY5L 4ELMB 4Y19B 4P5TD 5IBTL 3MV11 2ARJQ 2NW3B 5CGYC 5F1NB 4GLRI 4WTZA 4PGCA 1A9BB 3C9NB 1YQVL 4HBQA 2GK2A 3OAZK 4ZOEA 3I02B 4U1GB 5E8EB 2DTMH 2XA8L 4PBWD 4Q7DA 3T2NL 2BMKB 4H5SB 2Q7NA 3BZFA 4TVSa 3SY0B 1Y18B 5D2NA 3S4SB 1PBYA 2EDRA 4XVJL 4OFDA 1L0XA 4QO1A 1Q9WB 5MI0B 1OTSC 3E8UL 2MKLC 2OQJB 1G7HA 4G9FB 3WCYA 2KUTA 3DX6A 1GIGH 4F15C 3U7YL 3K3QA 4PRPA 2OYPA 2JCCA 3BQUD 2AK4B 4MA1B 4XCFL 4EI6A 4KI5C 3TBTB 3MFFA 2C9AA 1X5ZA 1ZLUH 1AKJD 5SV4A 4P3DA 4YDLB 1P7KA 4G8IA 1CICB 4CMHB 2J6EL 2VERN 2E8YA 4KTDH 1BQSA 4MDJA 4MB3A 3RWHA 3DUUA 4KJWC 3C6LC 3RNKB 3REVA 2A6JA 1SEBB 4WI4A 3S35X 4BQ6A 4PRHD 3BRGC 3SBWC 1HHKB 4EDWL 2D7TL 5CJQH 1RK0A 3QI9A 5EUKB 1AP2A 5TPWH 2R29L 4ELME 4Y19E 4WUUD 3V4VH 1MLCB 1EXUA 1I7TA 4XPBH 1RK1A 2A1WH 3VRJB 3NFNB 3WS3B 4UV4L 1IC5L 4HMEA 2PYEA 4P48A 1IEBA 3OB8A 4IMKA 1C5BH 1B6DA 5DQDH 2IBBA 5A16B 4N5ED 4EQ2A 1IAIM 2YPKA 3DV6A 3ZKMD 1AGEA 4FP8L 3BAEL 4BFGA 1U0QA 3RWFA 1W0WA 5ID0A 5I1AA 4I48A 3D2UA 1CN4A 2LABA 3H3KA 5AZ2L 4AMKL 1FO0A 5J1AA 4U1HA 3MLYL 1BQUA 2X44D 3QJFA 4R2GC 3W9EA 3ARXA 2WUCL 5ICYA 2VE6B 3B6SA 5J6GB 2HLFC 5EZOH 1ZT7B 4JANB 1JNHA 1JN6A 1U8LA 3AS1A 4PR5B 3MV7D 2V17H 2A9ML 4PJFF 3IJHB 4AIOA 2YN5A 4QRTB 1MH5A 4J3WA 3JV5A 3D85B 5KSAD 5JQ6H 1E6JH 4RDQG 4PRDA 2COQA 3ZSSA 4P5KA 1CGUA 3HE7D 4JKPL 4I3GA 5DRXB 4N0YH 3QAZC 1MHPL 3O45B 1BZQK 3U46B 5C09A 5F6HI 1IBGH 4AZ8A 2BNRD 5I16B 4PRID 4ZYKA 2FHBA 4BZ2H 3MV9A 3DIFA 3VFTA 1AFVL 4Q0XL 5HGDB 1HQ4B 3BHBB 4X4MA 3AMLA 4ORGA 3QPXH 4Y88A 3DWTA 3TNNA 4PJXE 3I6GB 5KSBE 2ZCHL 4OZIE 2EKSB 3ULUD 4XT1C 5FO7A 3CFDB 1RZFL 1TVHA 4YGAB 2HKHH 3DRTA 1BHGA 1Q94A 1QSFD 1UJTA 2VOTA 5IKCA 2ADIA 4UTAH 1CF8H 5BZWA 2AW2A 3DVNA 1GH7A 3D0VA 4XMKH 4FN0A 3DO7A 4GKNB 3QR2A 2R2EB 1FH5L 1FV1B 3KYKL 4M00A 3NOIA 3D9AL 1SMOA 3HPJA 3GJFK 1KCLA 3FRUB 4KRLB 2CK0H 2E9BA 3P4LA 1T0MA 3HN3A 5GISH 4GAGL 4PBVC 5EU4B 3RGVB 4LVHC 4XPGL 3QHFL 3I6KB 1CXEA 5EZLB 1RZKC 3S36L 3MV8B 1C08B 1KJMB 2P4AB 4LLYA 1P2CB 4HAGA 3PQYE 4P2QD 5J6HB 5JZ7C 1QSED 2WIMA 3QCTH 1DQQB 2FEEI 3QEQA 4RMSA 4TNWK 4LAJH 1GPOL 2AEQH 4XP5H 2VJXA 3QXUA 4QF1B 4TULH 4IJ3C 1OAQL 3D25A 2OJZH 2EE9A 2W60A 4IMLB 5GJTH 5TGBA 4L4VB 2B4CC 4OM0L 3BN9D 1QSVA 1V05A 1W72H 4H8WL 3KLAA 4QXUL 1A6VH 1DL7L 1LP9F 4PJ5A 2GCYB 3MYZA 2YRLA 3C60B 2W0LA 3D3VB 4HQQL 4QNPF 1UWGH 1FPTH 1G0XA 4HS6A 2X4SA 3OAUH 5TE4H 5ID1B 3I50L 3IFNL 4NSKB 2AJ3B 1R0AH 1JHKL 1ZWIB 3SE8H 5CIPH 1S3KL 4DN3H 2Q86A 1BEYH 2X9YA 4QTIH 5DVOA 1A3RH 5C2UB 2SEBB 4HF5L 2RCSH 3MRBB 5LVEA 1TNMA 3TPUB 5BOPA 5L7XH 2GSIB 5CZXC 4WFFD 5E9DD 4OLVH 2G60L 2GAZB 3MV8E 3VDAA 1IAIL 5BO1H 4RAHA 1SJXA 3T4AA 1ORQA 4LU5L 4IRZH 1U92B 2WINA 4ZTOH 3HAEG 5BXFB 5B38G 4B50A 3QCVL 3ZE1E 5FF6A 4Z77B 4I18B 3QG6A 4M6OH 4UT9H 1K4CA 3VGFA 3F8UB 4JFDD 4DVRL 4KDTA 3ZE2E 3QEGH 5I8EA 4Z7OE 4OV5A 2RBLA 4L4VE 4G3YL 2YRZA 3PDOB 1J1XL 4LPVA 4W81A 1TZGH 5AYUL 3BVNA 3FO2B 3N1FC 4GW4B 5LGJB 4XP9L 4MNHB 1XGUB 4OIAA 3SDYH 2EDDA 4IRSB 5HHVL 4FFVD 5E70A 5H2BB 3KDMB 4IIQB 2HFEB 3EO1A 4DUWA 3O4OB 2AQ1A 2EIZA 3BI9X 4JPIA 2GTWB 1JFQL 4ZG1A 5L2KD 1OOAA 4WW2B 2D7NA 2NY1D 2NY5H 4WFHD 2K7PA 3ARDA 3BWAB 4I1NB 3IDGA 4IDJL 4KK5C 5FKAB 5IBTH 3UTPD 4F7PA 4X6DA 3HG1D 2FLRT 1ULVA 2WUBL 3KWWB 3R1GL 1J8HB 3TM6A 3LV3B 4RMWA 4Y4HB 1T5XA 1BLNA 3BWUC 3T3PF 2FJFA 2E7BA 4PB9L 4AK1A 2PW2B 3E8UH 1J86A 4F57H 4KWUA 4U1SA 3UTZB 3IT8D 3NAAL 1G1YA 1L7TL 5HYJA 2IF7A 3GSOB 1W0VA 2VITB 4NC1E 2I26N 1IVLA 3RWCA 3U7YH 2Y07L 3ULVL 1LD9A 4OGYL 1XGTA 4S1DC 1M7IB 5KS9F 3RPKA 1GC1H 2WANA 4NQDD 4XCFH 4JY4A 2XACC 4OGXH 5ILTH 4POZD 3EDKA 3RDTB 1KYOJ 2CDFA 5LQBL 2YBRB 3MV01 4N5UA 3V5DB 1UXSA 5KAQG 3VGGA 4F7MB 3NZ8B 5B8CA 3SE9L 3RI5F 3WO4C 2BVUA 4EDWH 1MPAH 1X4ZA 5GS2H 5K93A 2D7TH 5F44A 4LLMB 1IZKA 3FZUC 5GGVL 5ENWA 5FDWA 1SY6L 1R3IL 5DLMH 4DJMA 4MXWL 2YOCA 3LEYL 1ZLWH 5AWNH 2FX7H 4O02L 1SVCP 2EXYC 1KNOB 2C5DC 1J8HE 4PV9B 1IM3B 2GT9A 5IJVA 4NWTH 1S7XA 2R15A 4PJGF 1NCDL 2D31B 1J10A 5D72L 3GSNB 4XI5C 1SQ2N 2UZXB 1DE4B 2UVEA 3KPTA 4Y5VC 4AH2B 1AGFA 3LSOB 5HHOB 3QUXD 2ZOLB 3FHAA 3LZFL 3N85L 1NAKL 5AZ2H 4J6RL 4AMKH 4U0QB 5FKPB 3MLYH 4YPJA 1HYSD 2CUMA 1PKQB 1YDPB 3MACL 2IPUK 3B9EA 3I6LD 5EBLB 5FHBH 1MI5D 3K8LA 1RJCA 2AJVL 3MZTA 3FFCB 3DHMA 5IG7A 1KB5L 1P7HL 3K46A 2V5SA 4YO0A 3B9KD 5HGHA 3QEUB 2A9MH 1YUHB 5FYLD 4TTDC 1B0RA 4DGYL 4RFEA 4PBXA 3EO9L 3CK0H 5JHDB 1OTUC 2ICWA 4JKPH 1SJHB 4M8QA 4X7SL 4YE4L 1AE6L 1FL3A 1J8KA 2Y4SA 5JIIA 3DI2B 4PJ7E 1CGYA 2ATPA 3WIHL 4U6YA 3ZE0E 2NXZD 3WV0A 4ZUVA 2OMBA 3VRIA 5J7CC 2X89A 4HWBA 4YNYA 2DJSA 3NIFF 5E6YA 5DVKA 4XBGA 1KG0A 4YBQC 2ZUYA 1CDUA 1AFVH 1YMMB 4R7DA 2ITDB 3T0ED 4QHKJ 4FMKA 3RWJA 1SM3H 2FX8L 4OCSL 4F7CA 1FNAA 3IDIB 1HDMB 3PHQB 4DZBA 1OD9A 1R3JA 4PJDF 4OI7A 1S5IH 1U58B 4PLKD 5C70A 3OKOB 5E00A 3TNMA 2ZCHH 5HHOE 5M7QA 3FN0L 1QQDB 1EMTL 1RHHA 2OK0H 3EO0B 4OCWH 1RZFH 2P8PB 5HPMA 5MI0C 4FTVA 4TSBL 3SBWA 3PQYD 4M03A 1QBML 2YMXL 4LBEB 1PKQE 1X5FA 4J3VA 1A3LL 2CR6A 3Q3GB 3IF1B 1DANU 4P2OD 1NAMA 1FH5H 5I1KL 4MA1C 5IOPA 3FFCE 1P4IL 5ITFA 2G75A 2VZ3A 5L6YL 4M1DH 4YDLC 3LN4B 4XPGH 5DC0A 3QHFH 1FFNA 4CMHC 4OQTA 2OXHA 3QZWA 5MEND 4M1CD 5JHDE 3NFPB 3SKMA 4KI1A 4ZNEA 3GIVA 5ESQA 4AIZA 1UC6A 4PG9A 1VFBB 1BFTA 1X3DA 1HQRB 4UUJB 1GPOH 1UVQA 5ETUA 1S7RA 1OAQH 2XQYG 1BZ7B 1B4RA 2ADJA 3QIWD 2DLEA 1H0DB 3MRGB 1AXSB 4B5EA 1OP3H 1ZTXL 5CKAA 4JO1L 1DL7H 1OAKH 2Y25A 3MRRA 1WJ3A 4ZFFB 3ILQC 4MHHI 1C12B 3V6FA 1CDYA 1TZIB 3BEWB 4Y4FC 5T3XL 2MCPL 1MVUB 4JPWL 3KPSA 5GGSB 1X7QA 4KV5F 5L0QB 4KQ3L 3S5LA 3VXMD 1MFBH 1A7BA 3BZ4A 1Q72L 3BIBX 2XRAH 2CIIB 4FQ2L 1XGQA 3R06B 1S7VB 4K71B 1JHKH 2R4RL 1S3KH 4IOFC 1C16B 3CVIL 5DD5H 3BIAX 1JF5A 3JWOC 3BT2L 5I76A 3IS1X 2G60H 4PRPD 3GRWA 1IAIH 1ES0B 1TITA 3MLPA 1BJ1H 1YEHL 3FL7A 5EOCJ 5HGAB 4JEGB 5A3ID 3HE6B 1S7WB 2Q3AA 4R97C 3QCVH 3T0AA 3STZB 3VWKD 3BD4A 4NO0A 5E8OB 3HZMB 4DVRH 3UZEA 4YAQA 3K4DA 4MVBD 5AYUH 3BP5A 5I71B 1A02N 4XP9H 1EDQA 3GHBL 5IIEB 1QFWH 1WAAE 5IHUL 5HHVH 3LEVL 1MF2L 3MRPA 3QI9D 2DQUL 1FFOA 1NKRA 3EOTL 4AIXA 1HXMA 4PTTB 3M07A 1ZA6B 5F7LB 3PABB 1OHQA 3S9DB 1F4YL 3O3AB 1B0GA 4IDJH 5CJXC 3T2QA 3WJJC 2VN4A 2PYED 2WUBH 5FDYA 1I7UA 1I8MB 3DVFA 4OZ4A 3VXPA 2VABB 1CI5A 2QLVB 2ZSVA 5DYOA 3VMPA 4YHYB 2CSPA 3WMSA 5JW5B 4L3EA 3NA9H 3WL9A 3OKKB 1K2DB 2VUYA 5L8KB 2V9RA 4PB9H 1BIIA 3RGVC 5DJ8A 3C5SA 3NAAH 4OFYA 1ACZA 4AJ0A 4NKMA 2F53A 5L2JA 1NFIA 1CDJA 5EORL 4L8SB 2FLBT 2KBGA 3QO0B 3KPRA 2E7MA 3RWIB 2BFVH 4HH9B 3QT2A 2QJDA 2GYSA 5BVPL 1T1ZB 5FA4A 5LQBH 3X12A 4M5ZH 5EOTA 3MRJA 5EDXA 3G5ZB 4F2MB 5C09D 1G9ML 1IL1B 3C60C 3RGHA 4NQED 4YR6A 4OGZA 5GS0H 5JDJA 5SX5K 2ZUUA 3MV9D 4JJ5B 5F1SA 5GGVH 3HRZA 1H5BC 1SY6H 3OX8B 2JB6A 1U3ZA 3QPQD 4BUHA 3V6BR 2BY1A 1ZT4A 5DJ6B 3LEYH 2CXKA 5FA3B 4FQ1H 4O02H 5T1MB 2AQ3A 4JRXB 3VU2A 4K8RD 3T4YA 3EDJA 1J18A 1NCDH 4PJFB 5D72H 2R2BA 3HR5A 4Z7NE 4NN6B 4L4TA 1FZKB 4DK3A 3UYRL 5I30L 1X5LA 2VUOA 4LCWA 1PG7L 3G6JA 3O11B 3LZFH 1OAYL 2Z92A 3G9VA 1C7TA 4KRPC 1NAKH 2ZZUT 3OR7A 4J6RH 1IC7L 3OKNB 4JQVC 4OUUB 2YS4A 1U8HB 3ZKND 2CR3A 3MACH 4NC1C 3FB6A 1LEGB 3F65A 4M4PA 5J1TC 1U8KA 2VMFA 1GZQB 4I18C 3HC4L 3MLZH 1KB5H 3TN0B 3C5JA 4JVUA 1CXHA 3FKUS 4S1RL 1S7QB 1WBYA 2BERA 4HX1B 3VA6A 1IGYA 3QEQD 4YPGA 1RJZB 4DGYH 3QHZH 4XB8A 5KS9A 4X7SH 4TPRL 1AE6H 4YE4H 3C6SB 2PO6B 2IBGA 3QUMB 3WIHH 1K8DB 1HHGA 4YFEA 3O4OC 1JZ4A 4HUVA 3SJVB 1VADB 3BW9A 1F8TL 4WW2C 4PJ5D 2UWEA 2ID5A 4N8PA 4I2XE 2DJ4A 4JRXE 2FX8H 1BF8A 1FG2B 2BK8A 5HI3D 4J3SA 4U6XB 5I6XC 1FQ9C 3DOSA 4PJFE 1CD8A 3BXNA 3ALPA 3ESUF 2C3XA 4XWOD 4ALAL 2R2HA 1YEJL 3FN0H 5D6CB 1EMTH 4O51A 4EIGB 3C5ZA 1P4LA 5C9JA 1UKSA 3VXOA 4XGZA 4TSBH 1XCQB 1NCBH 4CU8A 3JV4B 5FB8B 1D5XB 2YMXH 5ALCL 2NY3B 5D2LA 1KIUA 3TYFB 4DUXA 3FN3A 4XX1E 1XFPA 2IPKB 4RISH 1A1MA 1JZ3A 3IAGC 1P4IH 3ESVF 1ZKAA 2YD7A 1FZJA 3Q6GL 3RDTC 5L6YH 3P4MA 1R3LB 1K5NA 1EO7A 1AQKL 3Q2CA 3UC0L 5DK2A 4X9GA 5GJSL 4M02A 4KTYA 4Y5VA 3UEZA 1CFNB 2NTSP 1LVEA 3MZGB 3CDCA 4RAVA 4F37K 1VPOH 4P2YA 1IGCL 3Q5TA 4R4BB 4NQSA 4NT6B 3OKMA 3SJVE 2OXGA 3OSKA 3RIAF 3MRIA 2ZPKL 3U79A 2OMNA 3IETB 4TUJA 4M48L 1ZTXH 1J05B 2C4XA 3KG5A 3KR3H 4QGYA 4BFBD 2DQEH 2V2WA 4G7YL 2G5BA 5HVFB 4CKVX 3CH1B 3KHQA 1CLCA 3EYQC 5T3XH 5E5RB 2DBJA 3V0VA 1HYRC 4GS7B 4JPWH 5EN2B 4KQ3H 4NQXA 5CMAB 3MX0A 2AEPL 1EHXA 2FRGP 1E28B 4RGMB 4WWKC 4FQ2H 3BP6A 2V5TA 4X6EB 1AD0A 1MAML 2J8OA 1IT9L 3EGSB 4EIZC 2R4RH 2VDKH 1KBGL 4MNGB 3WDIA 5I1JL 3OB0K 4QRSB 1JGLH 4XMPH 5LGKA 4H1LB 1OD7A 2H6PB 4A2MA 1LP9E 3VFOA 3BT2H 3C9NA 1A7QL 5HYJD 3S3PA 5CINH 3ROOB 5SV3A 5KZCB 1QBLL 5IHBA 1WC7B 4ZO7A 3V0WH 3HAEH 3GGWB 4L9DA 1JI2A 3BSZL 1YEHH 2BMKA 4ZFOA 2DM2A 3OKEB 3S4SA 3JUYA 4C55A 2AJYL 1KN4L 2BNQA 3DSFL 1Q9WA 4OZGF 1UWXK 4NRYB 3BD5A 3QULB 2OQJA 3GMOB 4G9FA 5KVGL 2J7LA 5F9DC 2WLYA 2AK4A 3VGDA 2BC4B 4P4RB 1FDLL 3GHBH 2NR6D 5IHUH 4NKOB 3LEVH 1MF2H 1T22A 2DQUH 3EOTH 4K3GA 3LN9A 4PUBH 1WZLA 5FGBA 2BNUB 3QQ3A 5EO9B 2R8SH 3VG0L 4JM2D 2NY2D 3NACL 5CD5D 3WFEL 2DM7A 1F4YH 3RNKA 4L8CA 1SEBA 3IRZA 4E0RA 1MCWW 2W0FB 1MFDL 2ED9A 6FABL 4UT6H 4OB5L 4RGNC 4MNGE 3MNZA 3SDCC 2JJUA 3ARGB 2QHLA 4FXKB 3VFWB 2BOCB 4G8EB 2CLVA 3U0PB 2HJFB 2FECI 2P43B 3VRJA 2VWEC 4JZNA 2CKBL 1JZ2A 2VXSL 4Y4FA 3T77B 3UZVB 5CGYD 5I73B 4P9HH 4HEPG 3HUJB 5EORH 5E2JA 1CFTB 4Q9QL 3NCEB 1N2RB 1JPFB 5C08E 4CADB 4KY1H 4S1QL 5BVPH 1CGSH 1HHIB 1PLGL 3T3PE 3P0YL 1CDGA 4NHUB 3NCYS 5FECA 1JL8A 2VE6A 1OTSD 5J6GA 2A73B 5ALBH 4GRLB 2EYRB 1G9MH 1GGCL 1ZT7A 3B8YA 1E4WL 1M71A 3OAYK 2B1HH 1KTLB 3P9LB 3SDDB 4PR5A 4CVXA 4KHXL 2BRRH 2C26A 3D85A 5AEAA 1KT2A 1A0QL 3RZCB 5L0QC 5CEYB 3FOLA 1KN2L 4PRAB 1YYML 4K71C 1CR9L 4LK4A 2WBJB 4XCNA 4X0KB 3ULVF 2W07A 1P6FA 1RJLA 1UGNA 4FTVD 5GRJL 2GJ6B 5JPNA 3UYRH 3DPBA 1E4XH 1PG7H 1I9JL 5C86A 4TUOB 1GL4B 4X5XA 4CVZB 1OAYH 1DUYB 2ICWI 3HZYB 3R8QA 1IC7H 3TZVC 3OZ9L 1CE6B 1VGEL 5EC1A 1UH2A 3L3JB 2GW5A 1YPZA 2OCFD 4N9GA 3HUJE 2XWTA 3I6GA 5F9WB 3TO4C 4X7TB 2OL3L 3HE6C 1JZ6A 3WJJA 1UEMA 3HC4H 2KZWA 2CMRL 3B2UC 3H9SB 3HKFA 4KPHH 4HG4J 4P57A 1OGAE 4NUGL 4S1RH 1UM5L 1P69B 4PJGE 4D8PA 2QR0B 4GKNA 2VLRE 4PJDB 3T09A 1JHTB 4NZRL 5I71C 1DBJL 1T6VN 2PXYB 5SWZE 2QSQA 2X1OA 3ETBF 1X9QA 3GI9L 3S37L 1UCBL 4R2GD 5CS7A 3I6KA 5EZLA 2F9BT 4XCEB 1FFQA 3L5XL 4L1HA 1UJ3B 1P2CA 2HLFD 2VAAB 1ITCA 3O9WC 1DQQA 2AK1H 4CVWA 3BH8B 3LIZH 4HHAB 2GKIA 4ODXB 4HKBB 3HHRB 4XVSL 1RUPL 4QWWC 5GGRA 1QRNB 1IAKB 2PNDA 3KPSD 1CXIA 5CLTA 2ITCB 1ZS8B 1H8NA 4L4VA 3U9UB 1VHPA 5M95B 1C1EL 2ATKB 2GJ6E 2P7TB 4MB5A 1JYNA 3NABL 2O61A 4RRPA 5IVXB 1YEIL 3MLUL 4FS0A 4P3CL 2YD3A 3C60A 3D3VA 2GK0A 2ED7A 3JWDL 4NM8H 3TYGL 1YEKL 3C2AH 1TQCB 5FUOH 4MD4A 1H5BA 3NIFE 4EXPX 3SPVB 2FL5A 4L8SC 2NXYB 5EIVA 5HVWA 3BKCL 4NSKA 1LO3L 3H9SE 3VXUB 1JHLL 3Q6GH 3THMH 3K81A 1D6VH 1JPSL 2Z93B 2VZ1A 3LKOB 3MCG1 5EBMA 4PJDE 1AQKH 3UC0H 3UPRB 2SEBA 5DGRA 5GJSH 4NO0D 5I1IL 3TPUA 1LHZA 2D7QA 4Z5RB 1CLOL 1U2CA 5E94A 2W9EL 4JQVA 1WICA 3RP1A 5K9QG 2DD8L 1FGVL 5JXAL 4G6AC 3S4SG 1HKLH 2Z0BA 2FNBA 3CU1A 2YXFA 4Z77A 4M48H 4I18A 4ZSOB 3B2VL 5A43C 5IROC 3INUL 1NGZB 5MP6H 2XWJB 3GO1L 1UZ6E 4HK3N 3GIZL 3FO2A 2CGRL 4FFWC 5IVXE 5LGJA 4TSCL 2E8ZA 4OD2B 4S11A 1UM6L 1SJVA 1CQYA 3GMMB 4NNXB 2AEPH 4MNQB 1T21A 4QRRA 3REWB 5FGCE 2GTWA 3EJYD 4YHPB 4L3ED 1P53A 4JFHE 5E08L 1FFPB 1MOEA 4WW2A 1KBGH 5BS0B 1H15B 3MGOB 3ULSB 5I1JH 1JNLL 1NQBA 2H32H 1L6ZA 3EUUA 1N3NA 4L8BA 3VXUE 4OFYD 3QDHA 3KWWA 3RPIB 3TN0C 2F53D 3SDAB 5D6DC 3WFDL 1QBLH 5KVEL 3HI6H 2LFGA 2GJJA 4GUPB 3KPRD 3BSZH 3C8KB 5CIPB 1PD6A 5TQ2L 3TBYB 4RFOL 4YDIL 1J87A 4KV5E 4L5FL 2AJYH 1KN4H 5E6IA 3DSFH 3P9WB 2PW2A 3R0MA 3UTZA 3FTGB 1AO7B 4O2EB 2ZCKH 5JTWA 1K85A 3W81A 1PFCA 5KVGH 3IDMA 4JM4L 5DMKB 3V2AR 5CZXD 5IBLD 3D6GA 4UU9A 1SEQL 1M7IA 4ZSOE 2HT3C 1FDLH 2P8LB 3PWJB 4QLRA 5D7LE 3RDTA 2HFGL 4PREB 4NBYB 2YRPA 5KANG 2YBRA 5CD3B 3ULUL 4O2CB 3VG0H 5LAXA 3NACH 2EEBA 1FAKT 1TVDA 3WFEH 2V9TA 4MNQE 1CDCA 1X5JA 2OP4L 5HYSG 2V2TB 4PY8I 6FABH 3QNYA 4OB5H 4Q58C 4L4TD 1M4KA 5BS0E 4LDOB 4S2SB 4LCWD 4XH2B 2C3WA 2XWBB 3STLB 3FCTB 2Y6SD 5C08D 1KNOA 2X4UB 5TJWK 2GY7B 4PV9A 5HHQA 1IM3A 1G7JB 2CKBH 5TQ0L 5E5UB 3SO5A 4RMVA 4K3JL 1U8PA 4LCUB 5DUPL 2VXSH 4KK5D 5HHNA 1Z9SA 3CDGB 2HAZA 1I8KA 1DE4A 1MCQA 2OI9C 3QNZA 3LSOA 4CJ1A 4Q9QH 2EDJA 2CRYA 1AO7E 4Z76A 2VDQL 2FJHB 5DZOA 4WWKA 2XQYK 3QG7H 5F21B 4S1QH 1DUZB 3VH8B 1YDPA 1PLGH 4OM1H 4WI9A 2C1OA 2DLHA 3P0YH 5EBLA 2UZYB 4X6FB 1GGCH 1G1CA 1E4WH 5BW7C 5DHXB 2NQCA 4R0LB 3QEUA 4KJYA 3DGCR 4PGJA 2VLME 3U7AA 1YUHA 4NFCA 5F7MC 4HKZB 3NA4A 3QQ9C 1QNZH 2VQUA 1SJHA 4LVNC 2DMBA 3ARVA 4RGMC 2EH8H 3LRSB 2YXMA 1X4YA 5DQJA 3M8OL 1I8IB 3OJDB 1RIUL 3UBXB 5C0RL 3O2WL 1GSMA 3C5ZD 3DROB 5GSVB 1HHHB 1GGIL 3FT4A 3DMMB 1YMMA 2DQTL 2VL5B 3WNLA 1QRKA 5GGTL 32C2B 1H3GA 1F3DJ 1L4IA 1BJ8A 4GLRH 3FZUD 3IDIA 1HDMA 3LD8B 2VLRD 3OZ9H 1VGEH 3MJ7B 4GAYB 2B8OT 4CN1A 4KTEH 4D9RD 2EXYD 1U58A 1W8OA 1NCWL 4HS3A 2OL3H 3L3KA 1QQDA 1FIEA 3EO0A 4WU5B 4WW1B 4EJ1C 5J9PA 3TF7C 2E27L 2P8PA 5E99H 4WDIA 4KUCF 1F13A 2CMRH 3BYTA 4OGAC 4NUGH 4U3XA 1UM5H 4JREC 3SDCA 3IF1A 1FRGL 1HHJA 4P49A 3CFBB 4NZRH 1NLBL 3SE4A 2O93L 4M6AA 1XAUA 1XR9B 5EOQL 3OG6B 2C1PB 3TH4T 3U48A 1VDGA 1UCBH 4M7LL 3LN4A 3L5XH 5DRNA 3QSKB 3I9GL 2I27N 3MBXL 4JRYB 4IHOA 5H8DA 2E7LC 1J0KA 2NX5E 2OZ4L 3ARYA 1AXIB 1VFBA 4KVCL 5GS1B 4K23L 4TTDD 4BSJA 2JIXD 1RUKL 2VZOA 1F4XL 1BZ7A 4UDTB 3BD3A 1T4KA 2MOVA 3ARGC 1C1EH 1X5XA 3NABH 3QDAA 4LMQI 4DOHE 1YEIH 3WXWL 5MEQB 3K4AA 5E8PB 2VQ1A 3QWOB 4BJLA 4ZFFA 2Z35B 3TYGH 1MQKL 1UKQA 1C12A 1I7ZB 4YBQD 4KDWA 4LSDA 3QUYD 4Y16D 2BVYA 5CAYB 3DXAB 4EZMA 5D1XC 4KC3B 4XPFH 1RI8A 3QXTA 1A22B 2L0DA 3P77B 4RMUA 2LVCA 5FYJH 1DVFB 3BKCH 4NZDA 2GUOB 1LO3H 4XZUA 3P73B 3TVMA 1JHLH 4JG1L 3AREB 3FQRB 3SCMC 4F3FB 4W4NA 3E6FB 1JPSH 3NVQA 3O2VL 5DJ0B 2BNQD 1FVEA 4MQXC 1C16A 4KFZC 1MIEL 3ZYZA 5I1IH 1RY7B 4N90D 3UTTE 4GRLC 1DTUA 1JF1B 1WWWX 2Y7QA 3CFCH 3HPLB 3MREB 4F58L 2WQRA 4S1SL 1GYAA 3RWEB 4UQ2A 3TZVA 2W9EH 4Y2DB 2AK4D 2FSEB 4MQTB 5ADOH 1FIGH 4JRYE 1FGVH 5JXAH 3K1DA 2MJWA 4X4XA 4MDIB 1PZ5B 2DWDA 3TO4A 1LE9A 5KN5A 4LRNL 3HE6A 3WN5C 5JPMB 1KIPA 4BH8A 3B2VH 3FO9B 5E8OA 5JIKA 5DUBB 1R5IB 4ZOCA 1G7PA 1E6OL 4F9LC 1ONQA 3BKJH 4HIXL 4I13B 2YUWA 3GO1H 4GSDL 2D2OA 3D87B 3FO1B 2CGRH 4PJEA 3ARBC 1QACA 1UM4L 2YZ1A 1KCSL 5IIEA 2UZIL 1UM6H 4AEFA 4FQQB 5HJ3B 4AEIL 1IM9A 1G6RA 3L95B 1J0HA 4OZGB 3JTTB 3PWUA 4JFFB 5ICXA 1WSST 1HEZA 2EC9U 4I0CC 4MJ2A 3DXAE 5E08H 3O9WA 3MUZ1 3B83A 1RZJC 3BEVA 1JNLH 3MOBH 5HYQA 3ILQD 8FABB 5D7SL 4Z0BL 3MOQA 1KPUB 1HINH 4Y4FD 2ESVB 3W82A 3EJJX 1SVZA 1TCMA 1I8MA 4PJCF 3L3DB 5FYLL 3B9VA 4RWHA 2DQDL 3KPNA 1CGVA 2EE2A 1A14H 2JJTC 1BX2B 5JLZB 5TQ2H 1TJIL 2PXYC 4L5FH 1OQOA 3STBA 4WWID 1CGWA 4IOFD 4OZFH 3AGVA 4JKMA 3UJTL 5CP3H 4L3CB 1UJ3C 3VFMB 4JM4H 3QEHA 1MWAH 4L8SA 3QO0A 4Z78B 5DJXA 4V1DB 1CLYL 4XBEH 3D85D 1UENA 3VE0B 4XNZB 5EUOF 5ELIA 1T1ZA 4P59H 3UJJH 3FN9A 3ULUH 5D8JL 3W0WB 1F45A 4XRCA 3G5ZA 4OCMC 4F2MA 4OBRA 3KPPA 4I5BA 2CIKB 4NFDA 1NCTA 1XF3B 3NPSB 3SO3B 4OZGE 4BSVA 5BCAA 2P1YA 1ED3A 1DLHB 3TO2A 3F7PC 1M1SA 3I2CL 5C0JA 3CMGA 4BFEA 1J1PL 1VFMA 3L3HB 3WLBB 2NXYC 1I9RL 5IROA 2HVKB 3MXWH 2ESVE 3A6OA 3WYRA 1O5DT 2EIDA 2IPTL 4JR9H 4WGWB 4K3JH 5DUPH 4NPYB 4OCXH 2N4IA 3GK8H 2XFXB 1T1YB 3MLVL 3BDYH 1VSCA 4CN4A 4XTRC 3ISWA 5SX5H 1CS6A 3FB5A 4OUUA 3WFHB 4G8FB 1U8HA 3QDGB 3VXQB 3EOAB 1FGNL 1LEGA 3WHE0 1F3JA 1T0NB 5DD0H 5ACMA 1GZQA 1AGCB 4V1DE 2LAAA 5C0IB 1G7MB 3MRFB 1ACYH 4PJIB 5INCA 1S7QA 1JIBA 4W70A 4ISVB 4YZFF 4OF7A 4HIIB 3W0WE 1RJZA 2E6PA 3OF6A 3K74B 2X4OA 3FJTA 1JV5B 3D0LB 3C6SA 4U3CA 2WV3A 2EC8A 3BMWA 4NQCA 2P5WE 5E1AB 1BF2A 2B1AH 2HLAA 1EJOL 5EC2B 1JE6A 3M8OH 4OKVB 2VR9A 4XPHH 1RIUH 5C0RH 3MRLA 3ZHLA 3O2WH 4OT1L 2A83B 3C60D 3D3VD 1GGIH 3IXAB 1XZ0B 1QTYT 2DQTH 1F00I 3S8WA 2UY7A 5IBUG 2CUHA 1CLZL 4N1HB 1MRFL 1XH3B 3SDAC 1WBZA 1CD1B 4U6XA 1GCFA 4L9LB 1MVFA 3ZZ1A 5TFSL 4FXGB 4HAFA 4H0GA 1KENL 5E5MB 4NYLA 4PJAF 5DF0A 4FG6C 3PWPE 3KVQA 3B3IB 1G9EA 2VH5L 1XCQA 3ELAT 1P7QA 5F1KC 1EO8L 5C0DA 3ET9F 3QDGE 4O4YL 4R4NC 3WIFB 3ZYOA 1Q0XH 1MCHA 1MCOL 4G6JL 4ODHL 1NFDB 3ULVE 1FRGH 1N7ML 3UPAA 1DP0A 1P84K 2EYTB 1T1XB 4WNQB 2VISA 3BE1L 2UYLA 3U36A 4KRPD 5BQ7B 1YNLL 2IPKA 3P0GB 4HEME 1DQJB 4P2RA 3W5MA 2A74B 4XC1H 1OWRM 2WQ8A 5F7DA 5KSVB 4HIJB 1KB5B 2YPLD 3OJ2C 4M7LH 1R3LA 3MO1B 2H41A 1M7XA 3MBXH 4HJJH 5IR1B 4JDVB 3PXJA 4H88L 4KVCH 1FZMB 4R4BA 3MSPA 4NT6A 4PJBF 1H9VA 1T2JA 4K23H 3FQUA 5ISZE 1RUKH 1F4XH 4CNIA 4PV8B 4N8VA 3UMTA 5TDNA 4X83A 1FO0L 2NY5C 3IETA 2GITA 4QRRD 4M43H 5HHMB 3BPOB 3BH9A 2BVTA 1B3JA 1BFVL 2BJML 5BW7A 1A4KB 2Q8AL 1G7LB 1H3XA 1MQKH 3TFKC 2VLKA 3VDBA 1YEFH 3UTTD 2QSCL 3V79C 1I85C 2R0WL 2AXFB 5EN2A 3GUTB 4P23B 3OL2A 5CMAA 4FFZH 2V2XB 1E28A 4ERSH 4G43A 3IDYB 35C8H 3FMGL 4JG1H 4X6EA 4U33A 4XPTH 1TENA 3EGSA 4HV8A 3O2VH 5ANMA 1I75A 3K0WA 5E6ID 4YWGL 3KPQB 4DK6A 1J88A 3V8OA 4C56A 4HMCA 1GC1C 4YDVB 4HFWB 4JG0H 2EE3A 3H42H 2FD6L 5EU5B 2XTJB 2R0LL 1QG3A 3FOMB 4WIQA 4R0LC 1YNTB 2V7HB 5D5MB 1J0JA 3EJZC 2EDQA 4ZOBA 2J8UA 5E1HB 2YN3A 4LRNH 1QBBA 3RDTD 2R9HC 5D1ZD 4LARL 3QFJB 3NIGE 4K8RL 2ILLA 5I1CL 3GMOA 1HE7A 2IWGA 4J23A 1OCWH 3MRHB 1XIWB 2XT1B 1C5DB 3BPCA 3EAKA 4GSDH 1KB9J 2XZAL 2CH8A 5HHME 3DMMC 3BKMH 3RI5K 3D39B 1UM4H 1ZEAL 3MRCB 5I17B 1KCSH 2UZIH 1N6UA 4AEIH 2QKIA 1T7WA 3MRQA 3JVGC 2VLJE 2Z4QB 4XNYH 5EO9A 5GRZA 2PCPB 1H8SA 5FHAL 3ZDYF 2E7LA 1EEYB 1ZHLB 4IS6B 5D7SH 1UWXH 3W11C 3EYQD 5JIPA 2W9DL 5GPRA 4KJQC 1F6AB 4LQFL 4E41A 4JGMA 2DQDH 1EEUA 3ARGA 4FXKA 2BOCA 3QWQB 2DBLH 2ZWLT 1A6AA 2X05A 1INEL 1TJIH 4NWUH 4AT6B 4WWKD 4D94A 5M94B 1FLTX 2XTJE 1VGKB 4Z7UF 1BOYA 4GFTB 1UB6B 4FQXC 4IBLT 2G9HB 1QR1B 3SOBL 4L1DA 3I3DA 3T77A 3W2DL 3HAEB 4BFIB 1HILA 2BSTA 3ZT6A 5HDBE 5JQHC 5D1XA 1HH6B 3H7BB 1X5YA 1NGQH 4ZDHB 1CFTA 3N1QC 2H2SC 2HWZL 4JZJB 1CLYH 5GS1C 1JPFA 3HS0A 1J9CT 4WHDA 3SCMA 4KKLC 4X4ZA 4LASH 3KHOA 1CBVL 1FVCB 2BSRA 4NHUA 5CWSB 5D8JH 3D39E 4LCYA 2VTFA 5DR5H 1UXWA 4GRLA 2EYRA 3RQ3A 1XGPB 5FV2A 1YEGH 1KTLA 3GKZA 3J8F7 4IM8A 4JQXA 5JW4Q 2OR9L 4O58L 2B20A 5KVFH 5TDPB 2YUVA 1YMMD 3S88H 5IEKB 1XF4B 5T3XE 4X8JB 3WN5A 5CEYA 4U1NB 2PW1B 2RAMA 1I9RH 3IFOA 2M26A 4GG6F 1DVFC 1NC2A 1T83C 1FORL 4PRAA 3AREC 4JHAL 4F9LA 3ZSTA 4HLZG 3AU1A 5IHZB 4PGDA 3ARBA 1A6PA 4JN1H 3E6HB 4DGIH 3MLVH 5C07E 5C0ND 4RGND 3NN8A 2EEAA 3LQAH 1U3JA 1DUYA 3IXTB 3HZYA 1GHFL 4P2CG 3SDCD 1UADC 4MAUH 1NBYB 4TVPD 3KYOB 1CE6A 4Y2DC 4LLWB 4ZD3H 1LE5A 1R3KB 1FGNH 4NKDB 3CMOH 4WI7A 5C0AA 5IMOB 3SDXF 2EO1A 1A7NL 4YFDB 2F15A 4NZTL 1IKNC 1FG9C 3HC0B 5ICZA 3KPLB 4HWZB 4LSSH 2JJTA 3GNMH 2PTTB 1S7TA 2PXYA 1RZ8B 2WIIB 4GJTB 4J2XA 2EXWC 3SKNB 3QDMB 5IEHB 4TQEL 3RWDA 4X7FC 3V5HA 4YHNA 1BD2B 5F6IB 1UYWH 1UJ3A 1WWCA 3Q1SL 4NJ9L 2J2ZA 4CMMB 1QO3B 2Y06L 1XGYL 4QOKA 4RQQA 5EZJB 2OTUA 1MHCB 3RNQB 2YD5A 5F93C 1CLZH 1MRFH 1QRNA 4L3AA 4LEOB 3CZJA