3P40A

Crystal structure of neurofascin adhesion complex in space group p3221
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
390
structure length
390
Chain Sequence
LTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurofascin
publication title Homophilic adhesion mechanism of neurofascin, a member of the l1 family of neural cell adhesion molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 64
structure length 390
sequence length 390
ec nomenclature
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p40A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p40A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p40A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p40A04
2G9HB 4D9RD 4X6CB 4GXUM 4JPKH 1D3CA 4GRWF 2Y25A 3BPOB 4D9QD 3MUY1 2FX7H 4XTRC 2AJZB 3B9AA 1E4KA 3IB4A 3V5HB 5GRVK 1UH3A 4HULB 4WFED 1NGQL 3BP4B 3RWEB 5I8KL 3SGJA 4N90E 4XC3H 4OCNC 4IHOA 1LO5A 1YZZA 5KAQG 1FZKB 1PY9A 1FAKT 4J3UA 4ODHL 4FABH 5JXAL 1WV7T 5EFIB 4CKVX 3EZJB 4GO6B 4NO3A 5JLZB 5DVLA 2OTUB 4ODVL 3IF1A 3QIUD 3D25B 4Z7QE 5LQBH 3IFPA 5BRZA 4N0YH 2VKWA 3LPWA 3KPLA 2BNQB 2CIKB 1F13A 3HTLX 3WNMA 3QZWG 3CSBA 1G7QA 3DGGA 1NEZA 2E9WA 1KIPB 5E9DB 3VXPB 1MRFH 1T2QL 1KPUA 5KW9H 3ZE1E 2VIRA 1AGBB 4KK9C 1KJVB 3MJ9A 3P2TA 3MSPA 4NYLB 3ZLQC 2GITA 4X5XA 1ADQL 3LN4B 25C8H 3RP1A 4ODTH 5L2KE 1N2RA 5HJ3B 4E0RA 3GO1L 1JWMB 4KK9D 2JKXA 4Z7OF 3FQRA 4YHKL 5L2JA 4AIOA 3EFFB 5E70A 3GRWL 4WRLA 5D6CB 3MOQA 3SGDH 1ETZB 5HHQA 4J2XA 4MAYC 1LE5B 3KPSE 2ATKB 5JORB 1N59B 1Q0XL 5AAMA 3U79A 1AI1H 1YPZA 1CQKA 4JHAL 2QQQA 3LH2L 4JDTH 3IDXL 2DWEA 5D5MB 3HC4L 1D9KC 1RIHL 3LKPA 5F6IB 2NY4C 2Y5TA 4QRUB 2FNBA 4KGLA 4MAYD 4YXKH 5C0CD 4IMKC 3PWVB 5DI8A 4LL9A 3RZCB 4MX7A 3PDOA 1BVKB 3Q3GA 2R8SL 5I1CL 1D9KD 5D1QA 3E6HB 1HILA 2EYTA 2NY4D 4BSWB 2FO1A 4JFFA 4IDLA 3NCFB 2PXYB 1ZLUK 3DXAD 3FT4B 2P5EE 3K4DA 5JW4M 4P48A 3FQXB 4HQQL 2DDQH 3PL6B 2Q7YB 1UJTA 1I8LA 3H9SD 2DQIL 2F53E 4KK6C 5DA0B 5CP3H 4DVRL 2R23A 4OCMC 4PYHA 4FTVD 3R1GH 4NQEE 3QUYC 3PQYA 3OKKA 4LCUA 3HI5H 4AT6A 5H37G 4NN5B 3SE8L 4PRPD 4KUZH 3MCLH 4KK6D 2NW2B 4OTXH 1Q94B 3L6FA 5GGRA 4ELMB 3ISWA 3SCMC 4HFWA 4R8WL 2I26N 3M45A 2HJKB 2Q6WB 4WCYH 2H1PL 4NSKA 5F9OH 3QUYD 3OPZL 1J8HB 1BQSA 2MKLC 2FECL 4HKXB 3DGCR 2AS5M 5LGHL 4XMPL 1F11A 3SCMD 2OXHA 4KPHL 3RVWC 4NQTA 4KZEH 3NZ8B 4MCYB 3MRPA 5EU4A 3P4NA 4HIXL 4K3DL 1LP9A 5D7KD 4HKZB 2WQRA 2R0ZL 5I66A 1CDYA 1M7DB 1ZTXL 4JZOA 1U95B 4HGWB 2IANB 4NM4H 3I6GA 1I1AA 3G6DH 5FYKL 4TVPH 2YD9A 3FCTA 5IJKA 5GS1A 4DKDC 3V4PH 2JB6B 4Y0GA 2KZWA 1IGCL 2X9XA 4HWEH 2VC2H 3PNWA 3CDGB 1ERNA 1CLZH 2V5SA 4QF1B 2DTMH 4JQIL 4X6EA 4MDIB 1A4KB 4ODSH 1VFAA 1CFTA 3CXDH 3KR3H 3MODH 4I48B 3HPJA 3EOYG 1IGJA 4HMDA 3VGEA 3KHQA 1KB5L 1R5IB 1EVUA 4AIZA 5IIEA 4Z0XB 1GGCL 2FB4H 3S9DB 1DN2A 1NDGA 3AM8C 5T3XE 1LWRA 3UP1A 3N50A 4C55A 1FVCA 3N85L 4NUJA 1WZ1H 5ICYA 4R97B 1T1WB 3IFNL 4U33A 3WJJA 4RFNB 4JFHE 1FG2B 1FNSH 4ZUUA 3HG1B 4JY4B 1CFSB 3OXRB 2ADJA 1F4XL 3S34L 1BQLL 4XPTL 4A6YH 3WJLC 5BCAA 1QFPA 4U6TA 5JNYA 1K5NB 3NTCH 3QUKB 4AZ8A 2BSED 5BVPL 3BEWB 4XP9L 5C0RL 4FRWA 3LKSB 3HC0B 4QHKI 1A2YB 3MA7A 3BD5A 1T22B 3ROLB 1ED3B 4GQ9H 3CFEA 3RTQA 1OCWH 1N0XH 4QTHB 3UBXA 4U2YA 2J6EH 4EUPB 2QV2A 1U36A 2R1XB 2FX8L 5L9DH 2OZ4H 5ETUB 2V2XB 1UFUA 1KJ3L 1MCRA 5EDXA 1FHGA 3GJEB 5K9QG 4LSUH 3GSUB 1QRNA 2E9JA 1U8LA 3AVEA 3BPCA 2LAAA 2BVOA 3AU1A 3LEVH 4AG4H 5CEXA 2FBOJ 2DQGH 4HEPG 1GSMA 3KPQB 5IVXE 1T1XA 3RGHA 2KDGA 2OR8A 4PJEF 2X05A 3VFGL 5EOTA 1FC2D 1D6EA 2D31A 1U3YA 2E7HA 2CPCA 4D3CL 3FB6A 3VI3F 1Z9LA 4EKXA 3DUUB 2GUOA 4CVWA 5JPNB 4C54A 4R90H 4QRRA 4Y8AA 4JFQA 3K80A 1W0YT 1YEGL 3JV4B 3OKEB 3UTZA 4XH2B 2R2HB 4HC1L 1HE7A 4LDEB 2EO1A 3BKCH 1JBJA 1JPTL 3VFWA 3TZVD 4D0CB 4XBEH 1B88A 3P4MB 5HDOA 4JKKA 1HNFA 5FYLL 2VABA 4XXCA 1KJ2L 3FN0H 1N5AA 2R2BB 3NN8A 3AC0A 1EMTH 3D5OF 1P2CA 3MLWL 3TV3H 1R3JB 1CZ8H 1CF8H 4S1SH 5FYJL 1REIA 3ILPA 1UADC 4HDIB 2VWEC 1OAXL 4HS8L 4C56A 3U2SA 2D3VA 5KSUA 3K46A 1KTDB 3P73A 4KH2A 1CS6A 1U58B 2VNCA 4I2XA 3ZE0E 2QKIB 4LLMA 1YYLL 3BDYH 4H26B 5I1LB 2UZYB 3QA3A 2GAZA 1WQVT 1OF2A 1MRFL 1Q1JH 2MWCA 1N4XH 5KW9L 5EZJB 3VG0L 4AL8L 3WMSA 2QEJA 1S3KL 1QSEE 1Y6NR 3C60B 4JKWA 5HGDB 4FHBD 1Q9KB 2XN9A 4XCFL 3SHSA 1QVOB 1QLRB 2XOTA 4OFVA 3DVFA 4LRIC 4ODTL 3K7UA 3P4OB 4OF5A 4JJ5A 3STBA 1RUKH 1RZKH 1GGIL 3Q1SL 4FXGB 1P6FA 2AV1A 1PSKL 3NH7H 4PJHA 5C09A 3RNKA 4MCZA 4Z7UE 2P43B 3B2VH 1MCNA 1ODAA 4R7DB 1RJYB 3T0VA 1BWWA 4JDTL 1HQRB 1UXSA 4XP4L 5EWIL 3T0BA 4G9FA 2Z8VC 4JAMA 1KIRA 4P4RA 1I9JH 3MLXH 4MSWA 3L1OH 3IGAB 4WO4B 4JM2C 3HA0A 3GMMA 5JDSA 2XRAH 2R4RH 2FD6L 1F3DH 2PTUA 4PB0L 5IVNA 2R1WB 1LP9F 3VG9B 1TZIB 1JWSA 3V8OA 4KMTL 2B1HL 3IDUA 2W07A 1YY9C 4FXLA 5DHYB 4JM2D 2BRQA 2SEBA 3N1GC 3MRHA 4UB0H 3TN0A 3NPZB 3QIWB 3O3UN 2MNUA 3ROOB 1IGIH 1DSFH 3FB5B 2F5BL 4O9HH 1IGMH 4DKEL 3AGVA 4F2MA 1DBBH 5MEPA 4AIXA 1A02N 4JRXE 3G5YB 1YY9D 4OD2A 1F90L 1MY5A 2BRRH 2XPGB 2FO4B 3P9MA 3HPLA 5FM8A 1FLRH 1GPOH 5FKAA 3MLUH 1MCPL 1JPSH 1XR8A 1ZSDB 1MCSA 2FIKB 3GBMH 1JFQH 1QNZL 3OKNB 4X5WA 2J8UE 5KG9A 3DSFL 1KN4L 4P2OB 1PDKA 4ZSOA 1S5HB 3CNKA 1QTYT 3EYVA 5E0QA 3S3SA 3B8YA 1EK3A 2H41A 3BPNC 2HFGL 4Z5RB 4X6BA 5DJ2A 5CZVL 4QRPD 3ETBF 1M71A 4LCIH 2E27H 2BSSA 4PJIA 3ULVF 1MHPL 5ISZB 3PUCA 3TBWB 1UYWH 4FQ1L 4KZEL 4ZAKC 3ZYJA 2WMPA 5BV7H 3RWJB 4U6HB 2B1AL 2IQ9H 2DBLH 3ARBA 1CGUA 5BRZD 3HZYB 3X14A 1WCQA 5E5MB 3C8KA 2F8XC 3F7YB 5F3HA 4GS7B 4X6DF 5IFAH 2W0FA 2Y9RT 4HT1L 4ZAKD 4NO2B 3ZSSA 1XEDA 4I3SL 2BC4A 3FFCA 4JZJC 2YUWA 2EKSB 1YJDH 4GG6E 4N1CA 5GSVB 3AAZA 2AXFB 4NZRL 1HHIB 3MODL 4KY1H 1P9MA 4F37K 4BFIA 3VXMA 3MGAA 3RVXD 4Y4FA 4APQC 1A4JA 4PGJA 1YEFL 1EHNA 5LWYL 3VGHA 3HUJB 2G9HA 4HLZG 4X6CA 4M61A 1WZ1L 1YNLH 1MI5B 4JFPB 3D9AL 3MNVB 1IAMA 2C3XA 4M3JA 2VR5A 3SDXE 4APQD 5D1QC 3BKYH 4IRJB 1OAYL 3THMH 5CZXD 5DJZB 2AJZA 3KG5A 4XP6H 2VDKH 1D5XB 2Y06L 1T3FB 4MXVF 3V5HA 4NWUL 2IBZX 3BP6B 5DR5H 3BP4A 3RWEA 1EFQA 2X4QB 4KKCC 4WU7B 1PEZA 2ZUXA 5D7JA 3TM6A 1FZKA 2O5YH 2O61B 1I8LC 3MLZL 4DGYH 4UTBL 3HCVB 4JFFD 4OSUL 3MRIB 2J5LB 2D7OA 2W60B 5EFIA 5CKAA 1U9KA 4GXVH 4XRCB 1FFRA 1OWWA 5JLZA 2OTUA 4KKCD 1CFNB 5TDPA 4G6AC 3D25A 3EYFB 4LGSB 5K9KA 4IMLA 5DS8B 3O6FC 2BNQA 1TJGL 2CIKA 1LO2H 2PW2B 1LK3L 1BX2B 5E9DA 1KIPA 4LLVB 3VXPA 2ZSWB 2KPNA 4ZXBC 2V2TB 4G6AD 1DR9A 2NZ9C 1AGBA 3GGWB 3LEVL 3O6FD 1KJVA 3QT2A 2WANA 4NYLA 1QSFB 1UA6H 1KFAL 5SV3A 3LN4A 3C5JB 1WK0A 4GFTB 3WFHA 4ZNCD 4ZXBD 5HJ3A 2EH7L 1JWMA 2NZ9D 3DX7B 1FIGL 2KUTA 4NZUH 4NC2B 4XWOC 3UPCA 3EFFA 5D6CA 1I1AC 4BZ1L 1XGTB 1VFMA 1ETZA 4CAGA 4M7LH 5IJKC 1NCAL 5FM5M 1LE5A 2ATKA 2XI9A 5GS1C 1N59A 5JDJA 3ULUL 1CU4H 15C8H 5D5MA 2ZCHH 1SJHB 2G60L 1J10A 4XWOD 43CAB 4QRUA 3RGVB 4U1JB 1I1AD 4AENB 3WFBL 1BJ1J 4UU9B 2D0HA 3WNKA 2BMKB 3PWVA 3R8BB 4U1NB 3RZCA 4EI5B 5J12C 2BVTA 1X4XA 3D85B 2VKXA 3WIHA 1BVKA 5ACZB 4M6OH 4XBEL 2NY7H 3E6HA 4BSWA 3S97C 1YECH 2PXYA 5DJYB 2CQVA 5J1AB 5ERWB 3HAEH 3TESA 1A6UH 1J0YA 3FN0L 1MSPA 1P6AB 5JR1H 4NJ9L 4GBXB 3HI6H 3HZKB 4P2RD 3FQXA 3QRGH 1DBAL 3PL6A 1YNKH 4M03A 5IB3B 2Q7YA 2H2SC 3GSNB 4JO1L 1FAIH 1JV5B 3CPLB 4BZYA 3GBNL 2N56A 5I1GL 4YHLL 2VL5B 3AREC 4KAQH 2EE6A 4KRPB 2OP4L 3W2DL 3MV7B 3LHPL 3O4LB 5KVFL 4M7LT 1DBJL 5ESQB 3LQAL 2RFXB 2NW2A 1Q94A 4IDJL 4ELMA 4UT9L 2Q6WA 2HJKA 1KCRH 3MFFB 3ARED 4HKJB 1P4IL 4RMWA 1I7ZB 4M00A 1J8HA 5IBUG 3I9GH 1JHTB 4HKXA 3VGFA 3G6AB 4QY8B 4Z7WE 3F7PC 4HUWA 3NZ8A 3PP4L 4MCYA 2YUXA 3KPRD 5E94B 3ZHLA 1IKNC 3NCEB 4HKZA 5I30H 5C7XL 1M7DA 3ALXA 3B2VL 3QUZB 1IM9B 1U95A 4HGWA 4RWHA 2IANA 3BW9B 2EDWA 5JOPE 1UCTA 2VDNH 5TF1H 2R2EB 2JJWA 4G3YL 4OQTL 4E41B 3L3GB 3BSZL 5EZIL 2JB6A 5C0BB 3MA9L 1JP5A 3CDGA 1I7UB 4EXKA 1I3GL 4QF1A 5FDYA 1AY1H 5HYJE 1V3MA 4MDIA 1A4KA 4H88H 1JNLH 4WUKL 3INUH 1J1OH 1OAZH 4LSQH 4YUEH 4I48A 5FCUH 1KEGH 1CICB 2XZAL 3S4SB 1R5IA 4ZTPL 4Z0XA 1EGJA 4PRDB 1V7NH 4UB0L 3FO9B 5BVJA 3KXFD 1B0RB 3GM8A 1IGML 4J6RL 2JELL 4OM0L 4QHUB 1MCOH 1QFUH 1IRAY 5AG8A 3S3PA 2AP2A 4MA3B 4W4NA 3FMGH 5IB2B 1AH1A 1I75A 1W72L 1FG2A 3T0AA 2WM0A 3HG1A 4JY4A 1CFSA 3OXRA 3IS0X 2C3HA 4RGNC 4XXCC 4F58H 2GW5A 1K5NA 4Y1AE 3QUKA 1NBQA 3BEWA 1C5CL 3LKSA 3HC0A 2AXGB 3QEQA 5CKGA 1A2YA 1F58H 3BVNB 4NN6C 4L3EE 4RFOL 3IKKA 4X6CF 4PBVC 3VFTB 4HWBH 4QHMB 4RGND 4EBQL 2E27L 1T22A 3ROLA 1ED3A 1CDIA 1CR9L 3VXQA 1H8OA 2A6IB 4QTHA 5DLML 1CTNA 3O45B 1B6UA 4EI6B 5GRJH 3D1MC 2R1XA 4QHLB 4FG6C 1ZE3C 5ETUA 5GHWL 2V2XA 3UYPA 2J88H 4PRAB 3JTTB 3RWGB 1UH2A 4I5BB 2FYYB 4ACPA 3GJEA 1JZ7A 1XT5A 4PJ9C 3GSUA 5IFAL 1ZA3B 2XNAB 4FZEL 2YPLE 2ZNWA 3GHEH 2MPAH 3UJJH 1WWBX 5HI5C 3FQTB 4FG6D 1CXEA 3QXAB 1IJ9A 1SBBA 4AK1A 5CEZD 5I1HH 3KPQA 1G7LB 4RX4D 5DFWH 3TT3L 4Z9KB 3PF2A 4KI5E 4PJ9D 5I1EH 2PKDA 2FJGB 2OI9C 3PHQB 5D93C 4WW2B 4KC3B 4KY1L 4GH7B 1BM3L 1ONQB 2WBJD 2X4TB 5T5NF 1ZVSB 5ALCL 3ZKXC 4JCMA 5EUKB 2Y36L 5L8JB 3NCYS 1NKRA 4LCCB 1VESA 3NPSB 3DUUA 2AEQL 5JPNA 2DN7A 3TT1H 5C2UB 1TTFA 3JV4A 4KTDH 4KDVA 3VGAB 3IAPA 1YNLL 3OGCB 5J13C 2R2HA 3DJ9A 1GGYA 3VWJB 2C3WA 3MV8E 1AFVH 1IAKB 3QQ4B 5ECJE 5SX5K 1Q9OB 4YBLB 5HD8C 4KTEH 5J06A 4D0CA 3P4MA 4CADB 1FZOB 1HWHB 1YEHH 2VXVH 2R2BA 1EV2E 3IETB 4RAUB 4Y7MA 5GGUB 5D5MF 5E6IB 4YXLH 3M8OL 4Z7NF 1NCWL 4Q0XL 1R3JA 1KLUB 4GXVL 1A6VH 1F8TH 5BW7C 4HDIA 3GKWL 4K9EL 4N1EA 4L9DA 3BDBA 1IEAA 2KH2B 2I07B 1KTDA 1JYXA 4HCRA 1U58A 2ZSVA 1MPAH 5IB4B 3CC5B 2HTLD 2QKIA 1NCCH 2D03L 4H26A 5I1LA 4P4KB 5ADOH 5JUEH 3QIBB 4NN7C 5EZJA 4N8VG 1K8DB 3C60A 4OGAD 4MQTB 4ETQB 4GRWE 4D2NA 4NFCA 1Q9KA 3UAJD 1QVOA 1QLRA 3OX8B 3RU8H 4WV1B 4JKPL 4U1GB 3KPPB 4OAWB 2HVJB 3P4OA 5INDB 1EJ6A 1TZGL 4YBHA 4ZUTA 4NZUL 3KJ4B 4FXGA 2DF3A 2CK0H 2CLZB 4M7LL 5TJWK 4ELMF 2PF6A 2EIDA 5E4EC 1X5IA 2MHAB 4R7DA 4WEBH 3UTSE 1RJYA 2HA1A 3CSYB 2UZIH 4N9OB 1HQRA 5KBNC 1CQYA 2JE8A 3PWPE 2VZ1A 3FFDB 5KSBB 3CH1B 4FNLH 4OZHE 3UTPE 2EE9A 4WO4A 3IGAA 1BAFL 4OF6A 1WFNA 3UPRB 4PB9H 3DV4B 5DMJB 3VFOB 1P9MC 4J1UB 3B2UC 2R1WA 2DIJA 4F57H 3LSOB 1TZIA 5IW3A 1PKOA 5E2VH 2NY0B 3LD8B 5DHYA 1UENA 5JR1L 4NQCB 3QISA 5EA0L 1NGZB 4C4KT 5KTEL 3BZDA 3B2UD 4W4OA 3QIWA 1IM3B 3BE1L 1PBYA 4L29B 3ROOA 3BPOC 3FB5A 4WGWB 5ILTH 1V7MH 3O6LH 3G5YA 4M5YH 1VEPA 4NNXB 1SQ2N 2AJYH 1UM4H 3QXWA 1CXKA 3O6MH 5F9DC 1G0YR 5D7JC 3L5WA 2CK2A 5HYSB 5E24E 1ZSDA 4LQ1A 1RZFL 2FIKA 1KBGH 1JPGB 5EZOH 3OKNA 3FT2B 5ALBH 3I6KB 1OGTB 1J0HA 2A73B 1RZ7H 4P2OA 3O2VL 1S5HA 1MY7A 3TFKC 5DUPL 4Z5RA 3T08A 5D7JD 3QCVH 2FJFB 5DD1H 1A64A 4XPGH 3I9GL 5ISZA 1P7KA 5AWNH 1QLEH 3TBWA 1SMOA 5B8CB 1LEGB 1WITA 1CFVL 3V6OA 1N6QH 3RWJA 4U6HA 3TFKD 4LHUB 3PIQB 3H3BC 3HZYA 2K3TA 4UQ3B 5E5MA 4LNRB 4Q2ZA 3F7YA 2GFBB 4PPTA 1TJHL 2Q87A 2ZCLL 4NO2A 1RJCA 2VDNL 4L9LB 4PJAF 1DCLA 5GGRY 1G9ML 4F15C 3KDMB 5D96B 1SEBB 2AQ2A 3U4EB 1HHKB 4OD3L 1YY8B 5GGQL 2EKSA 4HW6A 2R29L 1JNNH 2AXFA 1HHIA 3AXLB 3DRTB 1JNLL 2J2ZA 3MRNB 1OL0A 3QEUB 3H6JA 4XZUB 1MWAH 3STZA 1V7NL 4Y88A 2NX5E 3TYGH 4FQJL 5FV1L 1T0MB 3CFIC 3PJSB 3MROB 2G5BA 3LRGA 3HUJA 3RUGB 3OJDB 1YA5A 4WI9A 1EA9C 2GIYA 5CINL 1MI5A 4P9HC 4JFPA 3MNVA 4TTDC 3VXRB 5EU5B 3QHFL 1NANI 4IRJA 4OBSA 1U8QB 4EQ3A 2PXYC 5DJZA 2ORBL 3SQBA 1D5XA 1T3FA 4PV8B 3MLYH 4ZUWB 4XPBL 3BP6A 3OKLA 3MRKB 1Y18B 3QDGD 4LCYB 2X4QA 3E2HC 5BS0E 2Z8RA 4WU7A 2PYEB 5M95B 2O61A 4HXAH 4OCYL 4XVUC 3GK8L 5FYKU 1F58L 3HCVA 3P77B 4GMSL 3UBXI 2GJ6E 2GTWB 3MRIA 2CRYA 4XMLL 2W60A 2Q8AL 1J9CT 4XRCA 4HJGB 1HCVA 3OBAA 1ES0B 3JWDC 1CFNA 1NFDE 4LBEB 3EYFA 3W5NA 2ICWJ 5J3HD 5E95B 1PD6A 2XA8L 5DS8A 4MMZC 1TMCB 2QHRH 1JGLH 1C1EL 1EUUA 2PW2A 2J88L 3O41B 5JW3H 5GJSL 3OAYK 1A3QA 2ZSWA 2V2TA 1RJLB 3DARA 2V5MA 4F3FB 3GGWA 4M93B 3MUHL 2MCPH 3PXHA 2FH6A 4DAGH 3FQNB 1QSFA 2WSKA 5HVHB 3WDIA 5DMIL 4R2GB 4O4YH 3C5JA 3QO1B 1LK2B 4JKMA 1JMZA 4YHOH 3DX7A 3MRCB 3CCHB 5L2KB 2CDFB 1XGTA 3VJ6B 2HRPH 3NZHL 4P23A 1KN2L 3MCG1 5IBLC 2NXZB 1Z9MA 4GAGH 3KPSB 43CAA 4Q9RL 3I84A 3RGVA 5I6XB 3QEHB 1TTGA 5B38G 3UJIL 4AENA 4UU9A 2Z8SA 5MHSD 2BMKA 4U1NA 4EI5A 4Z76B 5C8JB 3D85A 5IBLD 5ACZA 2AQ1A 4N8VA 5D70H 2P47B 2RIKA 3EFDL 3HNVH 4NWTL 4ZOCA 5DJYA 5J1AA 5ERWA 2AK4D 5D1ZB 3BP5B 3C9NB 3HZKA 3EOAB 3QUXD 4GBXA 1SMAA 5IROC 2ZG2A 3O6KL 2QSTA 5IB3A 2P5EB 4RFNC 3LS4L 1A6VL 4LU5H 3S6CA 4NRYB 4PJEE 1JV5A 4Y19A 4FXKA 3HRZA 3UMTA 3CPLA 3HMXH 1OM3H 3KPTA 2VL5A 4AYFA 1BOGB 2F53B 3LKQB 3MV7A 3NFSH 1QBML 4QWWC 3VI3E 2BX5A 3O4LA 4DFHA 1GGBL 1NCCL 3MPCA 3T2QA 5ESQA 2RFXA 4NQEB 1FNHA 1KOAA 1ZV5A 1QFOA 3D39E 4BZ2L 3QNZB 3TPKA 3MFFA 3KLDA 4PGDB 3FN9A 2IADB 4HKJA 1AKJB 4CMHC 1I7ZA 4ZOEA 3U7AA 4XPFL 1J0IA 1JHTA 3DI2B 3QEQD 3G6AA 4QY8A 4UT6H 5JA8B 1QUNA 4CMMB 1H8NA 3QCUH 5E94A 4L1DA 4P57B 1DQTA 4XGZB 5J4MA 1IM9A 1ROWA 4C83B 2FEEL 2UZIL 1WC7B 4LQFL 5E2UL 1K3IA 3QWOA 2R2EA 4E41A 4I9WD 3L3GA 4UNUA 5C0BA 4PLKD 3BUYA 4PB9L 1I7UA 2D0GA 3U9UB 4WEMB 4F57L 3CFJB 3U46A 3UXFA 4K3JL 3TEUA 2R69H 1CICA 3L3OB 1ZANH 3S4SA 3S36H 3HE6B 4PRDA 1NANH 3MOBL 5DGRA 3FO9A 5BO1H 4HFUH 5EORL 4HAFA 1B0RA 2ID5A 5D6DC 5HVWA 1MH5B 2AERT 4QHUA 5SWZD 3PQYE 4MA3A 5IB2A 1NUGA 1BD2D 4YC2C 3TC9A 3UZVB 1NMAL 4WUUE 4M6MH 3H3PH 5JHDB 3VCLB 1JGDB 5I18H 4S1RH 3O8XD 5ALBL 2V9QA 3MV9E 2O5XL 4M7ZB 1FGVL 2AXGA 4EJ1C 3VU2A 1II4E 5CCKH 3BVNA 3JUYA 4JM2F 3VFTA 1CE1L 4KMQA 5GRYA 3QCVL 4QHMA 3SO3B 2D7TL 5DD1L 4XPGL 3CFKB 3QDME 1LP9E 4EIZC 2BVQB 4DTGL 2A6IA 5D9SA 1KXTB 3MLVL 1FP5A 3O45A 4G6MH 3VFNB 4EI6A 4H0HB 5L88H 4QHLA 2R2CA 2JCCB 4CU7A 4PRAA 3JTTA 3RWGA 3C8HA 4U3XA 1INDH 2FYYA 2GTZB 1NMBL 3C60C 4I5BA 3VI4F 4H1LB 1SM3H 3F6IA 3GNMH 3OG6B 5IJVB 3W9EB 1ZA3A 2XNAA 4CUCA 2C1OB 4OZGF 1TQCB 1VFUA 1AR2A 2VDPH 2VZUA 1HKLH 3FQTA 1Y6KR 1WFTA 1KCSH 3QXAA 5DD0H 4KK5D 1A7QH 5T5FL 3VDCA 3QEGL 3GMLA 3OGOE 5GQBA 3HLAB 3JUZA 3WNPA 1X9QA 1T1YB 2FJGA 3O2DA 3PHQA 4LSPL 1U8JB 1T7XA 3CLEH 4UIKL 3FO1B 5IVXB 2OR9H 5GRUH 1NSNH 4LVOB 4UNTA 4AEHL 1ONQA 2X4TA 1ZVSA 1MFCL 4K7FB 1CBVL 5EUKA 3I50L 4LVNB 3L7FB 4LCCA 1H8SA 1NFIB 3ARGA 4NKOB 3RY6C 3WNNA 4CVXB 3FQWB 1NEUA 5D71L 3OGCA 4HIEB 4TVPE 3VWJA 1TCMA 1TVBB 3MRQA 4U7MA 1IAKA 1WBZB 1DBMH 3MGOA 3MX0A 3VG9C 4BQ8A 4EEEA 3C08H 4G9DB 4J7RA 1T83C 4ZODA 3UZQA 5AZEH 5D7LE 1P84K 3CVHH 1DANT 1WFOA 4X6DE 5ELIA 4CADA 4R26H 1UZ6F 3O3AB 3B3IB 1FZOA 2NYYD 4W4OC 5C0JB 4YEFA 1M05B 4DUXA 3IETA 5GGUA 5E6IA 4XP5H 4MJIE 1U2CA 1M7IB 5GISH 1JNHB 1KLUA 5CEZH 1NGPL 1NBZB 2LVCA 5EIQA 3MJ9L 4GRLB 1RZ8B 1L6XA 3L5XH 1I9RH 2Q3ZA 3UTOA 2VLRE 1VFOA 2I07A 4QGTA 3TGXA 3P30L 3QDJE 1T5WB 3QFDB 5IB4A 2CGRH 3CC5A 4YDIH 4ZNEA 4G5ZH 2HTKC 3WFCL 1I1RA 5FHAL 3QIBA 2Z31B 1K8DA 3KGRA 4QRSB 4LEXL 4YK4C 1H3PL 5A40E 4X8JB 4ETQA 1JI2A 1H5BB 3TBVB 3L7EB 4ZUVB 1F4YH 1P4LB 1MJ8H 3OX8A 4WV1A 2NCMA 1JCKA 2HTKD 1X5ZA 5ANME 3S88L 5HDQH 2VZTA 4XCNB 1BBJB 3KPPA 5ID0B 3G9AB 4MXVE 3TWCL 3H42H 2YD4A 2HVJA 3RWFB 4PJ8C 5H37H 4M9PA 5HHME 2QADC 4X7SL 5IVOA 3D69A 5KZCB 2B7DT 2CLZA 2HN7B 4OFDA 4QRRE 4GMTH 2HRPL 1UEMA 4KROB 2MHAA 1K85A 1S7UB 2CUHA 2YD2A 3E8UH 2W9EH 3CSYA 1FPTL 5FUOL 2R0WL 5JW4R 2DQHL 1FC1A 4PJ8D 5BZDB 4Z7UB 3IU4H 1L7IL 5C71A 3FFDA 4KV5F 3IFLH 5KSBA 2QADD 3CH1A 1YEIL 4RGMB 3VMOA 1FN4A 2KL6A 3UPRA 3VFOA 3DV4A 1R5VB 3WN5B 4J1UA 3GRWA 3BI9X 3LSOA 3J8F7 5SWQB 3I3DA 1PYWB 3GKZA 3E3QE 4HWNA 3L95B 4NQCA 3S36X 2EDTA 1NGZA 1KUMA 3H9HB 4MNHB 1IM3A 4M62H 4L29A 5TQ2H 2YA0A 4MNQD 5C0FB 4PJ5E 4WI5A 4IRJC 4BK4A 4G8IB 2JJTA 5HI3C 4NNXA 5DDHB 1G7PB 4BKLB 3GDBA 4M7JH 4PFEA 2CH8A 3DMMD 3SDDB 1I85A 3CFCH 4JRXB 1I8IB 2NNAB 5GGVY 3WD5H 5HYSA 1Z0NA 2XA3A 5CD5C 2NW3A 1JPGA 3FT2A 3IDIA 3RVTC 5HI3D 3I6KA 5B39B 5D72H 2FWOB 1DFBL 2FGZA 4PRIE 4JFYA 4YHMH 3ALPA 3EDDA 3TO4A 3TLRA 2VLKB 2H32H 2FJFA 1A7RH 2XWJB 3L3JB 5CD5D 1OOAA 4KVCL 2HYMA 5B8CA 1OP9A 1LEGA 1EO5A 4R4FH 2BNRE 1FNFA 4WHTB 1ZLUH 4MJ4A 1V5JA 3K0WA 4Y5YC 4LHUA 5I1AB 4EOWH 4S1QH 2X4OB 3PIQA 1G6RB 4G9FE 5C9KA 5L6YL 4UQ3A 2V5RA 4LNRA 5E4IA 2LU7A 2GFBA 1HNGA 3PHSA 1DUZB 4L9LA 1QA9B 2DMBA 2AV7B 5FB8B 2Q86B 1SEBA 3K2UL 3U4EA 1SBSL 1HHKA 2GI7A 1YY8A 3ULVL 4X80L 3ORJA 4O2FA 4F33B 1XMWA 3AXLA 4DWHA 1TQBB 2DL2A 4P23C 3G9VA 2LV4A 3MRNA 3QEUA 4GG6B 3WS3B 1MJJB 4XZUA 3BKMH 1CWVA 2VXTL 4NRZB 4G8GD 2BJMH 4WWKB 2UVEA 4HFUL 5E7FA 3IYLW 1T0MA 3WLBB 1UWEL 3BIAX 3MROA 2HRLA 4H1LG 2Y07L 2A6DB 3RUGA 1F02I 5SWSE 3OJDA 5AZ2H 4P23D 1HHHB 1CGSH 1GOFA 1MFBL 4HWZB 3REWB 1MVUB 4TSAL 4PRBB 4QHKJ 5EU5A 4WW2F 2MSPA 4TSBL 4GRMB 1U8QA 4MAUH 4BQCA 4M6ML 4WTZA 3PWUB 3SDXB 1QR4A 4PV8A 4ZSOE 1MCWM 4ZUWA 4GBXC 2IPTH 4PP2B 1XGYL 5EOQH 3QUMH 5HGGS 4OLVL 1A3RH 4AEEA 3U0PB 3P77A 5KSAB 2GTWA 4WY7L 4YZFE 4GBXD 5E08L 4HJGA 4KRPC 1DEEB 2P8LB 2PR4L 1ES0A 4XNYH 4LBEA 3ZDZE 5EU6D 3WFEL 5C86A 3GMPB 3LDBB 4F9PA 3F7RA 4XVTL 4Y19D 1MRCL 1VGKB 1ZLSL 4JJHA 3EDJA 3VW3L 2A2QT 3O41A 1FDLH 4UQ2B 4MS8C 1EFXD 3QG7L 1RJLA 4U0RB 4F3FA 5BOPA 2DIBA 1CD9B 2NMSA 3J7HA 4L4TD 5HHOD 3WSQL 1A7QL 5CHNB 2VLJE 3C09B 3LPFA 3QO1A 3IDJB 4TNWK 4MS8D 1LK2A 3VXSE 5GGVH 4U1IB 1EO7A 4TUOB 4UAOB 2VDOL 2DLHA 4OCXL 4P9HH 1F3JB 4I77H 1MEXL 1NSNL 1QKZH 2XV6B 3CCHA 4KQ4H 4BYHA 5L2KA 2CDFA 4X0KB 4NNPL 5ITFB 3VJ6A 1LNUB 4HBCH 1KNOB 2AJUH 2AEPH 3EOTL 4XPHH 2F54B 4NNYB 4LEOB 5EULV 1H3UA 5CSZB 3Q5TA 3DURB 1WEJL 1RQ5A 1BFOB 5LGKA 3KPSA 1RJZB 2DD8L 3QEHA 3BKJL 1S7XB 5L7XH 5DHVB 3CLFH 4HPOH 1CICC 4Z76A 5IBTL 5C8JA 3U0WH 2PW1B 1GHFH 3D87B 3I6LE 4ODBD 1HINH 3B43A 3JWDH 5FUZL 1JF1B 1JVKA 4L4VD 5KOMC 5D1ZA 4RWYH 1WT5A 1N64L 3BP5A 3C9NA 3EOAA 3TA3B 3QWRA 4MA8L 2QSVA 2W59A 2AJVH 2B2XH 4ORGB 5KSBF 4HC1A 1HOCB 4KMLB 2BFVL 2P5EA 4Y4KC 1BJ8A 4LLDB 1KENL 4NRYA 2UV3A 4TOYH 1MREH 1FYTD 2X44D 4Y2DD 5CAYB 3VFPB 1FO0H 4LFHG 2H26B 5E9DE 1BOGA 2F53A 4U7SA 3LKQA 5IB5B 3EYUH 2EIEA 4YDIL 3BHBB 4Y4KD 1EDQA 4C4KO 2FL5B 4NQEA 2P4AB 3QNZA 2P8MB 2MMXA 4PGDA 2IADA 1AKJA 1M6OB 3FAWA 3RI5F 4WDIB 4Y4HB 5CWSB 3QQ9C 5DFVC 2CKBL 4OB5H 3BPLC 5GRVL 3H42L 1J1PH 4HGKC 4TNVF 3WIIH 3ZYZA 5FECB 4CMMA 3VXOB 4PRHD 3PV6B 3RY5A 4P57A 4Z7WB 1AXTH 1K3ZA 2OS7A 4XGZA 5EUOE 3O9WC 5CSBA 2KQNA 4O58L 3QQ9D 2YKLH 4Z7NE 4PLOB 4C83A 3DX9B 1WIOA 1NDMB 1UM6L 1WC7A 1EGJH 3C2SA 3JXAA 3LEXA 2X1OA 5C92A 2WAHA 1KF9B 5DUBB 2IGFL 4D9RE 4DN3L 5F97E 3O9WD 2GY5A 3PABB 1N5YH 1T2JA 4D9QE 3W0WD 3U9UA 1T4KB 5H35B 3CFJA 2ZWLT 1CGYA 1FSKC 4UV7H 1BJMA 4U6YB 4LCCC 3L3OA 3ARGC 4OIIH 5LCVH 5HYJB 2XQBL 3HE6A 2NXYB 4K7PY 5TQ0H 1DVFD 1MNUL 3OKYA 2FGWL 1X3DA 4M62L 1GXEA 1MH5A 3GMQB 4JKLA 1TVHB 3ARGD 4H8WC 1RUPL 1A3LL 5DJ8B 1I1YB 2QQLL 3TJEL 3LY6A 3MBEB 4KU1A 3O11B 1EXUB 1O7SA 4ELME 3D3VD 1ZAGA 3MLTB 5JHDA 3MOAH 1JGDA 3VCLA 1DLHB 2P8PB 1BQUA 5HDBE 4HJJL 1KPRB 4AEFA 5E1AB 2VDLL 4JG0H 4R0LB 4Y1AB 3WHE1 1S78D 4LDOB 1U2HA 4HLZH 3RUGF 4YHML 1BFVL 3GSWB 4KK8C 5EIIB 3KLAB 1AXIB 3CFKA 3LEYH 3QI9B 1AO7B 5DWUH 4P46B 2BVQA 4L3EB 1Q38A 3EHBC 4DEPC 1YNTB 3P0YH 2F58H 1FORL 1LD9B 2VXQL 5FXCH 3MO1B 4Z0BL 4IS6B 4S1QL 4ONFH 1KCLA 1RURH 4OCWH 4P0DA 2GTZA 1I1FB 4H1LA 2BHYA 5BMFL 2XYCA 3W9EA 5IJVA 2VUYA 2C1OA 3SDYL 1PW3A 3BGMB 4H20H 3RVUD 5DUMH 2BY1A 3GSQB 4XP1L 5C2BH 1FNEB 1QQDB 5C0CE 1QLFB 3HLAA 3H7LA 3HR5A 1T1YA 1U8JA 3WIFA 3FO1A 3IDYC 5IVXA 1TFHA 4FQLL 1MHCB 5DEGB 3NMEA 4KUCD 4K7FA 4DZBB 1N26A 3DXAE 3L7FA 5J9PA 2VXUL 8FABB 3UTQB 1NFIA 4Y89A 4PJXE 4OV5A 2DYPD 4NKOA 4NQDD 3FQWA 3DYPA 4Z78B 3RAJH 4HIEA 2Z4QB 2D7PA 4PYGA 1TVBA 3H9SE 1WBZA 1RU9L 4JO2L 1RVFL 2Y5EA 1P5VA 2K1MA 2FSEB 2DQUH 1CLOL 1NKOA 4G9DA 4FTVE 3MV8B 3LD8C 4PTTB 3I3BA 5E2WH 1H15B 4PRPE 5EBWB 1FGNH 3B3IA 3O3AA 5C0JA 4PJAE 1M05A 2R56H 5HHVH 5FIEA 1A3RL 1IZKA 4HXBH 4B0MM 1M7IA 1JNHA 1JGUL 1NBZA 2O26U 2Y6SC 1YEJL 4GRLA 3N1PC 1RZ8A 4I0PC 3FO2B 1ND0B 3V7AE 4J3OC 4TQEH 1SYVB 1FNAA 2B0SL 4RZCA 2HWZL 2AJ3B 4WGVB 5HGHB 2WWMC 5H2BB 5JMRA 2ADFL 5CSGA 3ZT5A 3PV7A 1T5WA 3QFDA 2WUBH 3B8SA 1S7WB 1TJIL 2CR3A 2Y6SD 2IMMA 3DECA 4H0GA 4K7PH 5D7KE 1ZKAA 4I0PD 2BVYA 2FR4B 3TO4C 1JN6B 2NY1B 2Z31A 3MRRB 3NIFF 5D2NC 1S7RB 3B9VA 4QRSA 2WWMD 4X8JA 1KTRL 1H5BA 4YDVB 3TBVA 3L7EA 3LS5H 4ZUVA 4BFBD 1P4LA 2RCSL 3LKRB 4JLRB 4IRSA 1QSEA 2Q8BH 4XCNA 1BBJA 3L9RB 3QP3A 3RPKA 5ID0A 5KVMC 1RD6A 3TO4D 5GGVL 3RWFA 5T1KD 5JW5B 1HI6A 1OQOA 4KQ4L 2EIBA 3WIHL 1EHLH 1ZEAH 2CMRL 2HN7A 2IG2H 2IFFL 5CBAB 3HFML 1CL7L 4HBCL 4FZ8L 1S7UA 1LO4H 4YHYC 5D96C 1MFEH 1R3HB 4CJ1A 4YDKL 5BZDA 4Z7UA 2I60H 3VD3A 3T8XA 1NJ9A 2W0LA 4JE4B 4R9HA 3GJFB 5DD3L 4YAQB 5GGTL 5CJQL 3PWPB 3BDXA 5J1SC 1R5VA 4DUWA 1IC5H 3WN5A 4OZHB 2GHWB 1T2XA 4HMCA 4HMEA 5JXEA 2W9DH 3LIZH 2WIIB 2XTJC 5SWQA 4JO4L 1PYWA 3SGEH 1B2WH 3L95A 1BZQK 1KB9K 2KZ1B 2GK0B 3H9HA 4MNHA 1VGEL 3ZE2F 1K4DB 4NT6B 4I3GA 5C0FA 1WFUA 3MNWB 5FYKD 2XTJD 1MIML 3KLHC 1U8IB 4HUXB 3RDTA 4G8IA 5DDHA 1G7PA 3I85A 2LE9A 3C6SB 2YEZB 3D0LB 3AB0C 1TNNA 3SDDA 4G6KL 3EYUL 3GBLA 4JRXA 3MNZB 2NNAA 1OTSC 4UINH 4ZTOH 1AC0A 1RK0A 3KLHD 5LKNA 2X4UB 1MLCB 4I0KA 3T0EB 5B39A 3UTTD 3M1BB 3WXVH 1XCQB 2FWOA 1HYSC 5IQ7L 1D6VH 1S9VB 1T04A 3VD5A 2VLKA 1OTSD 4HIJB 2XWJA 3L3JA 1OAUH 4RRPG 5F1IB 4U1MB 4OB5L 2IBBA 3RWDB 4N90D 4NBYB 5FO7B 1J1PL 2P5WB 5K9JL 4JGJA 4OLYL 5IFHH 4WHTA 3SJVE 5IGXL 1HYSD 3SDAC 2CXKA 5CIPB 5I1AA 2X4OA 1G6RA 1GAFH 4JFEB 3S35L 2FBJH 3SBWC 5HVHC 3LAFA 1DUZA 4R2GC 1QA9A 4DW2L 1BBDH 3SDAD 1SJEB 4POUB 2AV7A 4KQ3H 2Q86A 5FB8A 3FQUB 5JHLL 1B4RA 2OJZH 4PUBH 3DHJA 4Z7VF 1MCCA 3EYSL 12E8L 4F33A 4AQOA 2JCCF 3QBTB 1VEMA 1OSZB 4YLQT 5CP7B 4GG6A 4OIIL 5A2KH 3D18B 3WS3A 1MJJA 4JFXB 4GQPH 2CSPA 5DT1H 1B9ZA 5TH2B 3Q48A 4C57C 4ESKA 4MQXD 2VB5A 3WLBA 1OP5K 2D0FA 2A6DA 1HHHA 4KDWA 5IHZB 2DQCH 4HWZA 4JQXC 3REWA 1MVUA 2Q3AA 4PRBA 5CGTA 3OZ9H 4LP5A 1B4JL 1DQLH 2AJSL 4GRMA 4JG1L 5FGCE 5IVXF 1T89C 1K4CB 2LTQC 4LSSH 2OMBA 3PWUA 4N8PA 1ZMYA 5D1ZC 3SDXA 1WT5C 3WLWC 1HH9B 4L8DA 4PP2A 2QQKL 4NJAH 2AGJL 5ISZE 3SDCB 1EEUA 2IJ0C 3U0PA 2WUCH 5KSAA 5BS0B 1XAUA 4HF5H 1MF2L 3ARUA 2CJUL 3WLWD 3ZKNC 4FQCL 1DEEA 2P8LA 5J6GB 3KNBB 3QDHA 2GJ6B 5D1XB 2R1YB 3TF7C 3RVVC 2ILLA 4X7CC 4MQ7B 3WEXB 4UT7H 1VGKA 2XACC 5TE7H 1NFDB 4K7PX 4N68A 3ZKND 2ZUUA 4UQ2A 5LVEA 3KJ6L 4Q9BA 2K9UA 2E7BA 2X42A 5FYLD 1KC5L 3FB7B 4J4PC 3ARSA 5IK3A 3DSNA 5T3ZH 4TYUA 3VA6A 3P11L 5CHNA 4LRNH 3U4BL 4OGYH 1ZVHA 5F96H 3K4AA 5FYJD 3IDJA 1NLDH 4RNRB 5MEND 2ATPB 4U1IA 4TUOA 2AI0L 5E5UB 1VADB 3CFDB 2J3SA 1F3JA 4J4PD 4LIQL 3MV01 4X0KA 4RFEB 5ITFA 1NC4D 1LNUA 3GIZH 1MJ7L 3DVIA 4MB3A 1MAMH 1KNOA 2PO6B 1MI5E 5HI4C 2F54A 4NNYA 4LEOA 3ESVF 1X5JA 5CSZA 3DURA 3ARDC 3CXHJ 1BFOA 4GT7A 1UWGL 4D9LL 1LHZA 1RJZA 2Q76B 1S7XA 1S9XB 2YRLA 2DKMA 3UYRL 5DHVA 5HI4D 5J11B 2PW1A 2A1WL 4FFZH 2FZ3B 3ARDD 4HCRL 4ZFZB 3KLSA 1V3LA 2X1PA 4OZGE 1JF1A 1AQKL 4YNYB 1BQHB 2B8OT 2ADGB 3TA3A 4ORGA 4OM1H 1F3RB 1HOCA 2KBGA 3ARPA 2BVPA 4LLDA 1J1XH 4OCLC 4N9GB 1D5BB 4YFDB 1E6JL 4TQEL 3VFMB 4M8QB 2YK1H 3VFPA 5IWLC 4LSRL 5DEFB 2H26A 3O4OB 4PJEB 3WNLA 5FO9B 1FRGH 5IB5A 3QDAA 4ZD3L 5FHBL 3BHBA 5GIRB 4I18B 5LBSH 4PGEB 2FL5A 1TIUA 2CUMA 2VXSL 5IT2L 4JY6B 3SO3C 2P8MA 4F9LA 3X11B 1M6OA 2DM2A 3GEWB 3LS5L 4KHXL 4WDIA 4Y4HA 4CGTA 3D39B 4RISH 5SX5H 5DQ9A 5J57B 2N1KA 5CWSA 5B4MC 4B7LA 5I15H 1WUNT 2HG5B 3DUSB 2BDNH 2ESVD 2A6KB 2DM4A 5FECA 3VXOA 1FVDB 3FRUB 1UZ6E 1ZEAL 3PV6A 4Z7WA 5I1KH 2OL3H 3L3KA 1TQCC 5B4MD 1UGNA 2A9ML 1JTTA 5LG1A 4XNMB 1O7VA 3DX9A 1NDMA 3BT2L 3VXUB 1MFEL 5F9WB 2P48B 2XZQH 3MLRH 4XX1E 2EICA 5DUBA 2OBGA 4I4WB 3GM0A 5FO8B 3PABA 1U6AH 4FS0A 4HPYH 1UB6B 5CJXA 4FFYH 1T4KA 2W9DL 3OF6D 5H35A 2VMFA 3EO9H 4U6YA 2D7NA 4NC1C 2R15A 4QT5B 5HYJA 1P7QD 3DX6B 2JTDA 4AEIH 2OK0L 3TBTB 4WJ5B 1EVTC 3OB0K 1K9TA 2DTSA 1NAMH 4O02L 2P49B 3GMQA 1IBGH 1PLGH 1TVHA 2IALB 1I1YA 3QNYB 1RULL 3MBEA 5E8PB 4H5SA 3O11A 1EXUA 4KI1A 3UO1L 3MLTA 3WS6A 1DLHA 2P8PA 1ZLVH 4NKMB 4P59H 1KPRA 4WUUB 4KV5E 1MQKL 5E1AA 3BO8B 4R0LA 4R6UA 4Y1AA 4DGVH 2ERJB 1YMHB 1DBKH 3GSWA 3C5ZC 3MV9B 3O2WL 2J12B 1LDSA 4IEFB 3KLAA 5C07D 2ARJQ 2CR6A 3VH8G 5DXWA 3QI9A 1AO7A 4P46A 4L3EA 1IC7H 4YWGH 3FRPA 4BUHA 1YNTA 2IPKB 3JTSB 3SDXF 1LD9A 1AXSB 3MO1A 3QDMB 3HNSL 3C5ZD 6CGTA 4IS6A 4M1GH 3AS0A 5E00B 2XT1B 1I1FA 1IMHC 2NY5L 2AJXL 4YJZL 5DRXB 5CBEB 1FH5H 3REVB 1UACH 4IRSC 3ARRA 2OYPA 2OJEB 3GSQA 3QB7C 2J4WL 4MJ5B 1FNEA 4PJGF 3NACH 5TDOB 1G7HB 1QQDA 1XIWB 1QLFA 3T2NH 4Q6IC 4LPWA 1F4WH 1LDPH 1IAOB 4IRSD 4H8WH 1QSED 1GC1L 1DE4B 4UTAL 1S5IL 1MHCA 5DEGA 3U7WL 4AJ0A 5CGYC 4KDTA 1FE8H 4DZBA 2QTEA 4XHQA 1S7QB 8FABA 3UTQA 1U8OB 2V5TA 1ZHNB 1GZQB 4FMKA 4P2RE 3GB7B 4OF8A 1FLTX 4Q9QH 4Z78A 3B5HA 5CGYD 4B7IA 2DQDL 3UEZA 4HG4K 5T1LD 1SY6A 1A14H 3HMWL 4OLUL 2E7CA 2FSEA 3TPUB 3V52L 4ZG1A 1FVEA 4JN1L 5DJ6B 4LFHD 3ULUC 3MV8A 2NY2B 4LK4A 4PTTA 2CRZA 4XAKD 2R4SH 4PRNA 1H15A 1NGQH 5I8KH 5EBWA 3PWNA 1JRHL 2YWZA 5D7LB 4ODHH 3KWWB 4X6FB 4X6DB 3RDTC 4HF5L 3ULUD 3DV6B 5JXAH 1C8PA 3T3PE 4FFVC 4ZPTB 4JFOB 3BAEL 4MJIB 4XCCL 4JRYD 4ODVH 1ND0A 5KVEL 1G84A 1U93B 1PG7W 1SYVA 2AJ3A 1OAQL 5HGHA 3BJ91 5H2BA 3KPRE 5IW6B 4XBGB 4YGVB 3RDTD 4L8CA 3H0TB 1N7ML 5CJ8A 1S7WA 1BP3B 3FO0H 2VLRB 4FFVD 4QCIB 2AK1L 5JOEA 1U91B 2FR4A 3QDJB 1T2QH 3WDHA 1JN6A 3MRRA 1S7RA 2ICWI 4L5FL 4A6YB 2V17L 4YDVA 5T3ZL 4JO3L 1NUFA 3MLPA 4OGYL 3LKRA 5JIHA 4JLRA 5GZNC 1ADQH 5I75C 3L9RA 4HS6B 1WVZA 3LQAC 5A3ID 5J6HB 3GO1H 4P2QD 1NGWB 1PQZB 5JW5A 2APWA 3X3GL 3OKDB 2C4XA 2FRGP 4GAJL 4YHKH 5ANMB 3GRWH 3CVIL 1RIVL 1LEKB 1MCBA 5GRXG 5GZND 5CBAA 1I9IL 1MAML 5HHMB 1Q0XH 5FF6B 4K71C 3PG2A 4JHAH 3LH2H 5J0BA 3IDXH 3F7QA 4P3WA 3KXFE 3HC4H 2APFA 1CDBA 1HH6B 3GJFA 3HZMB 1V8HA 3GSNL 4YAQA 2QHLA 2DIAA 3WFDL 3PWPA 5EU7C 4MWFB 5I1IL 1IKFL 4OZHA 4BK5A 3OAYH 2R8SH 5I1CH 5I9QC 1Y0LB 2WIIA 4U31A 3PDDA 4NP4L 2OX5A 3NCJL 3VRIB 5FFLA 3MJGX 2BY3A 2UUDK 2GK0A 4HQQH 1K4DA 4NT6A 4WFGD 4RGNE 3MNWA 5C0EB 2YA1A 2DQIH 1U8IA 4HUXA 4DVRH 3CMGA 3C6SA 4V1DB 4OKVB 5I0DA 2YEZA 3D0LA 3MBXL 3MNZA 4KHTL 3SE8H 2XZZA 1JYNA 4NO0B 2JIXD 1MLCA 3M1BA 4TUKL 1OSPL 1XCQA 3ZTNL 3NAAL 1H3TA 2H1PH 3DX8B 1S9VA 3CZFB 4RISL 3OPZH 2CIIB 1NC2B 2NTFB 4HIJA 4U1MA 1AHWB 5CEZE 4PRIB 4XMPH 3RWDA 2BDNL 5ACLA 1QBAA 5FO7A 4KPHH 2P5WA 1T7WA 4N0CC 4HIXH 3CD4A 4QOKB 4K3DH 5CIPA 2R0ZH 3CK0L 1L0YA 3MMEB 1ZTXH 2D2OA 3PWLB 1XF5B 5KSBE 1CGWA 4HH9B 5FYKH 5F1SA 3MLRL 3EGSB 4XWGL 3C6LB 4HK0B 2AXJA 4XMKL 3C09C 2P46B 4IOSD 5EOCL 1SJEA 4MA7H 4WENB 2CKBB 4ODWB 1L0QA 2H45A 1IGCH 3FQUA 4UAOC 2YD3A 3STLB 3HE7B 3TVMD 5CLWA 5IMKB 5E8DL 5FA3B 4JQIH 4FFYL 4UUJA 3ZT6A 4DKFL 4DZ8B 1OSZA 2LABA 3QXVA 5CP7A 5I71C 3D18A 3U9PL 1KB5H 4JFXA 3JV0A 3ARFC 3GHBL 5IW1B 2IC2A 1SYSB 1MCKA 4MB4A 3WUWB 4R7NB 1QHPA 3N85H 3B9KB 4EN3C 5IHZA 4K94L 5F89B 1FL6B 3GSRB 3IFNH 3I02B 4R4BB 1MCEA 3ARFD 4RDQF 4PBWD 2E6QA 1F4XH 1K4CA 1BQLH 3DTXB 4XPTH 3S34H 3ULSB 5I74B 3OG4B 4BQ9A 1HH9A 1G1YA 4EN3D 4U49A 4YFLI 1AD0A 4XP9H 2UZXB 5C0RH 3V4VH 1RUQL 1A0QL 3WDJA 3SDCA 3BQUB 5BS0A 1ZVYA 43C9B 4BQ6A 3MYJB 1QD0A 5KS9E 3KNBA 2GJ6A 1GVIA 3I75B 5D1XA 2R1YA 2FX8H 2MOVA 3O2DL 4MQ7A 3WEXA 1OAKL 1NFDA 5I76B 5J1TC 2EDQA 1KJ3H 4MXQD 4PGBB 4F9LC 5CFHA 1CXLA 4S11A 2WWKT 5ICXB 2ICEB 4KXZI 4UILL 2EEDA 2IEPA 2ZKHL 4K9EC 3FB7A 4Y5XB 4PBXA 4ZS7L 4OFYD 3MV11 4G6FB 3LN5B 4RNRA 2ATPA 3VFGH 2VLJB 3LZFL 1VADA 4NFDA 3KPMB 4K3HA 5EBLB 2JB5L 2DQFB 4J8RB 4UDUA 3MRFB 4RFEA 3VXSB 1H3VA 4D3CH 4M5ZL 3RUGE 1HXMB 2PO6A 5DZLA 1T03L 2HLFC 2NY3B 5BV7B 3VXRE 1OW0A 1YEGH 4Q7DA 3VFVB 3DI3B 4JN2B 4HC1H 2Q76A 3AFLA 3FTGB 5DMKB 4YDJB 1A14L 4LMQI 5GGSY 2VH5L 1JPTH 1YYML 4PS4L 4AY0A 2PYEE 2HLFD 1P4BL 3K74B 1YMMD 4ZFZA 5JOPD 2R4SL 4M7KL 2EDKA 1VKXB 2VE6B 2EE2A 5FYLH 1RK1B 1KJ2H 4YNYA 1BQHA 4G7VL 4U6VL 2QL1A 1P1ZB 2VUOA 4I1NB 5C0AD 2XG4A 2ADGA 4YPJA 3MLWH 1MCHA 4XTRD 5TFSL 4JFDD 3SE4A 3OV6A 5FYJH 2V7NA 1RUAL 5IB1B 4N9GA 2ZPKL 1D5BA 1OAXH 1XGRB 2HJFB 4HS8H 3WCYA 4OZHF 3VFMA 4M8QA 3T1FB 5DEFA 1KCUL 4OIBA 3U82B 4PGCB 5FO9A 4PJEA 4RMRA 2ZG3A 2WLYA 1N6UA 3FO0L 4I18A 2DLEA 1YYLH 4PGEA 4LKXB 4RAVB 2MQ3A 1A6WL 2M26A 5DURB 4JY6A 3VG0H 4AL8H 1G0XA 3B5GA 1S3KH 3HKFA 3X11A 5HYFA 4XCFH 4EVNB 3D39A 5FOBA 4NUGL 4M9OA 3DUSA 4BQBA 2A6KA 4QKXB 1T7VA 2VDQL 2OSLB 1FVDA 3FRUA 5F1NB 1GGIH 2X89D 3Q1SH 1DQML 3D2UB 1PSKH 3OAUH 1UJ3B 4RA0C 1LO3L 2UWEF 1CVRA 4XNMA 1WF5A 4F7MB 3VXUA 5EUOB 5K93A 1BECA 4QXTA 4Z6AT 2OTWB 4XP4H 5EWIH 4YHNB 2WZPD 1WWAX 4I4WA 4E42B 1XF3B 5FO8A 4OJFL 2E9BA 4RCAA 3LCYA 4XCEB 4DUVA 2NY6C 1UB6A 2FD6H 4KI5C 4CVZB 4PB0H 4KDTC 2HKFL 5M94B 1YN7B 2XY1A 2YPLD 2E7LA 4KJYB 3LKNB 4KMTH 2B1HH 3G04B 3NIFE 4QT5A 1G9MC 3QDGE 3DX6A 2X2YA 2DBJA 3QR2A 4S0TD 1E4WH 2NY6D 2X4PB 4KI5D 3TBTA 4WJ5A 4JHBA 5FCSH 4FQIL 2F5BH 4DKEH 1FYHB 2IALA 1OQXA 2DLFL 2X4NB 4OI7A 2PETA 2VITB 3FOLB 1F90H 3QNYA 2ITCB 5E8PA 5M7QA 1WTLA 3EW3B 3P0GB 3V5KB 4FA8A 2BP3A 5JW4Q 1MCPH 3QIUB 1PFCA 4QXGL 1OLLA 4NKMA 1X6LA 1QNZH 4PD4J 3T1WA 4WUUA 1WJ3A 3DSFH 1KN4H 5SX4I 5JIPA 4LCWD 4G6JL 3BO8A 3W82A 4H1LH 5DK0B 1YMHA 5DD6B 2AKRB 2HFGH 5CZVH 3MV9A 4X8XA 5GSRA 1MHPH 2X7LB 4FQHA 4LLWB 3HAEB 2IAMC 3MYZA 4NOBA 4FQ1H 2IPKA 2VLLB 3JTSA 1PY4A 2B1AH 1AXSA 4MJ6B 1JGEB 3QDMA 5TE6L 1CDUA 4DK6A 5GZOC 5FGBC 3C2AL 2NY1C 3F58L 5C08D 5IHLB 2UY7A 5E00A 2IAMD 3P3YA 4NM8L 3ZE2E 3RVWD 5CILL 1GGUA 5DRXA 5CBEA 3VFUB 4HT1H 3REVA 3HNTL 3P0VL 1WGOA 4MA7L 3GI8H 3M07A 2OJEA 2ZJSH 3DNKA 4I3SH 5GZOD 4MJ5A 3IU3A 5TDOA 1G7HA 5I16B 1XIWA 4J12A 4AMKH 2OMNA 2DB8A 4P5TC 3QFJD 4O2CB 5LXGL 4CVUA 3BGFC 5HDLA 4NZRH 1IAOA 3SKMB 1F4HA 1NFDF 5LAXB 5C0CB 4MAYB 1CGXA 1DE4A 4N5UA 3K3QA 5HTSA 1YEFH 1S7QA 2CO7B 4P5TD 1D9KB 1U8OA 1ZHNA 1GZQA 2NY4B 5LWYH 3GB7A 2R0KH 1TETL 5CMAB 4KGJA 3DXAB 1KTLB 4PJXB 3D9AH 3AS3A 5JHDE 3VA2C 1Z3GL 4FOMA 1ACZA 3TPUA 1OAYH 3UTSD 3H9SB 5DJ6A 2I9TB 4OF3A 5CJOL 3RX5A 2Y06H 4ODXB 4NWUH 4W6XB 4FTVB 1U8HB 3UTPD 4BELD 3V4VL 1RFDH 1MHHB 2RR3A 5D7LA 3MLZH 4D8PB 1AE6L 4UTBH 4X6FA 4OSUH 4X6DA 5IOPB 4PRPB 1IAIL 3DV6A 3O3BB 5D7IB 4PJAB 4PR5B 4JDVB 4D0DB 4PLNC 4Z7VE 4ZPTA 4JFOA 2YD1A 4MJIA 2JCCE 1U93A 3KVQA 3QUYB 3H9YA 1JGVL 1KCKA 3QAZB 5IW6A 1A6PA 1GIGL 1TJGH 4XBGA 4NOFA 4YGVA 3H0TA 1VPOH 1LK3H 3SCMB 3FB8B 1BZ7B 2VLRA 1KLGA 2YPKB 2BXZA 4P99A 5FEBA 4R3SA 4YBQC 1AD9B 1U91A 3QDJA 2WIMA 5JOFB 3QWQB 4A6YA 3LRHA 4W81A 4HK3J 4GG8B 1AQDB 1KFAH 5ESVA 1NAKL 3HI1B 4YBQD 4HS6A 4Y5VB 1CT8B 5J6HA 2EH7H 1FV1B 1E27B 1NGWA 1PQZA 5ADPH 2DOCA 1FIGH 5DZNA 3OKDA 3RWIB 5ANMA 4F80A 4BZ1H 1BVLB 1LEKA 1J87A 5CGMA 2PYFB 2E9IA 1NCAH 4CJ0A 3GI9H 3ULUH 2J6EA 5FF6A 4PY8I 4Z8FL 4QYOB 4Y2OA 3EUUA 1OLZA 3N0PB 3G5VB 5T5NG 1X5AA 1I3UA 4PD4K 2B39A 2G60H 2OZ4A 1X5HA 3DVGB 1HH6A 1QACA 5SWZE 3HZMA 4D94A 3WFBH 1T0NB 1BD2E 2VL4A 3B6SA 4MWFA 4FQXC 3JWNC 3OQ3B 1Y0LA 4PG9B 1A9BB 3V6FB 4NHCL 3VRIA 4NJ9H 4FQXD 2EH8H 4ONGL 1DBAH 4K3EL 1U3HC 1WAAF 5EIVA 5C0EA 3O0RL 3A6OA 4JO1H 4QO1A 1DLFL 3EYQC 4U1LB 5SX4H 4HKBB 3GBNH 4PJ5A 4YHLH 5I1GH 4OKVA 3QNXB 2NX5D 2OP4H 3W2DH 1U3HD 4X4YB 3LHPH 3NGBC 2Q1EA 5KJRL 5KVFH 4JQVA 1DBJH 4NO0A 3LQAH 5C6TH 4IDJH 2V2WB 3EYQD 2WINB 4U4BA 4UT9H 2W1NA 3QSKB 1P4IH 3DX8A 6FABL 3ZHKA 4EDWL 4FMFA 3CZFA 3QXUA 2CIIA 3Q2CA 2NTFA 2EZ0C 5LJYH 1AHWA 1EHAA 4PRIA 5DQJB 1I9EA 3PP4H 5I1JL 3SGKC 4FP8L 2D9CA 1Z9SA 3OAUL 5DRZB 5C7XH 1W0VB 2BNRA 3MMEA 1CG9B 2EZ0D 3SJVB 3PWLA 2DQTL 1XF5A 4HH9A 1NMCC 4YGAB 3EGSA 3U7YH 3C6LA 4HK0A 5H8DA 4FN0A 4G42B 1EEYB 4G3YH 4OQTH 2CKBA 4U1HB 3BSZH 4ODWA 4M4RA 5EZIH 1IFHL 2AW2A 3STLA 3HE7A 3MA9H 1UG9A 5IMKA 1B3JA 5T3XL 1I3GH 5FA3A 4CNIB 3UROR 4NDMB 4OUOA 5DD5L 2DI7A 4DZ8A 4YO0B 4WUKH 4UMGA 1XF4B 4QXUL 4I13B 5EO0B 3T0DA 1IEHA 2XZAH 4ZTPH 3DROB 4I3RH 3TZVB 1PZUB 1E4WL 2DLGA 5IW1A 1SYSA 1L0XA 5HVFB 5HPMB 4TUJB 3H7BB 3WUWA 4R7NA 2WK2A 3SKJL 1EZVY 4LSTL 4XXDB 4WNQB 4J6RH 4OM0H 2JELH 1G1CA 3JVGA 4F7CB 4NKIL 5F89A 1FL6A 3GSRA 3RKDC 3L5IA 2JK5B 1E4KC 3UX9B 4R4BA 1W72H 4XVJL 4F7TB 2V9RA 4MA1C 5SWSA 3SGJC 4GKZB 2CRIA 3DTXA 4WEUD 3ULSA 1CGTA 1EEQA 1EO8L 3KYKL 1CDCA 3T4YB 5FGCB 3WKMH 1Z0MA 2VLKE 1R0AL 3SE4C 3HHRB 1C5CH 1PG7L 5D8JL 4ZFGL 1I4FB 3BQUA 4MD5B 4RFOH 43C9A 4EBQH 3MYJA 2K7QA 1KCVL 1AIFB 2APVA 1CR9H 1VERA 2VZVA 5ITBH 3ALWA 1X5FA 3I75A 1FFOA 4ZO9A 2Z93B 5DLMH 2IMNA 1CD8A 3ARZA 3QHZL 2XXMB 3RL2B 5GHWH 4OZFB 5I76A 1NGXB 1RIUL 4PGBA 4WFFE 5ICXA 2ICEA 4R4NC 2YS4A 3RY4A 4FZEH 4CN1A 1TLKA 3MZGB 2P45B 3JWOL 3GI8L 2P7TB 4Y5XA 2HFFB 2ZJSL 2XKUA 2BNUB 4AMKL 3BD4A 3TT3H 5C0GB 4R4ND 2X5PA 3BYYA 3LN5A 4WW1B 2VLJA 2V7HB 2BCKB 1KXVC 3KPMA 5EBLA 3TP4A 2DQFA 4J8RA 4EUPG 3MRFA 1BM3H 5GPRA 4MZ3A 5F9WC 3VXSA 3Q5OA 1AC6A 5IM7B 2JJVA 5ALCH 4L8SB 4OLZL 2Y36H 1HXMA 1S7SB 1JTPA 4HUVB 3SEPA 2AEQH 2X09A 2R0KL 5F7YC 3AY4A 4HUUB 4MNQE 4JM2B 4JN2A 1KGCD 4RGOL 3QH3B 3ABZA 4BUGA 4YDJA 5EBMB 2E7LC 4LARL 4GKSB 3LB6C 4PJBF 1OARL 1DL7L 1TCRB 2FDBP 1Z2KA 3HRPA 4KKNA 2VE6A 3RA7L 1RK1A 1RFDL 3C8DA 3LB6D 5D1QD 1P1ZA 4PV9B 3M8OH 1NCWH 4OZGB 4PJGE 4Q0XH 4U0QB 7FABL 2EYSB 5IHUL 5IB1A 3HB3C 1MWAB 3GKWH 2HJFA 1XGRA 4LPUA 1NCBL 4K9EH 4NBZB 4OFKA 4EZMA 2FX9L 4QRPB 3T1FA 4QTIL 4PGCA 2ENYA 1VPOL 3GSXB 2D03H 4LKXA 4RAVA 3HB3D 3PQYD 3BPNB 4NO3B 1DUYB 2IPUK 2DICA 1XGQB 4JKPH 4ZAKB 4OGXL 4GAYB 4XPAL 1NEZB 5DGQA 1DQDL 1UM5L 5ADPL 2MKWA 2OSLA 4WI8A 1TZGH 1KPUB 3IJYB 1AJ7L 2OCFD 4LVHC 4GKOA 5F1NA 2F54E 3D2UA 1JHKL 3JSSA 2HT4C 2FHFA 3BEVB 4NRXB 5HHNB 3GI9L 5JORA 2F19L 1TDQA 3SKNB 4G8GE 4F7MA 4HAGA 2HLAB 5EUOA 4YHNA 2OTWA 2B4CC 3Q6FB 2FLBT 1XIWC 4JZJB 4E42A 1XF3A 2C4FT 2YN5A 2HT4D 4LF3B 3HC3L 1NFKA 1BAFH 3EIFA 1NCDL 3N1QC 4XCEA 2BSTB 4CVZA 5GS3A 1UT9A 4B41A 4KJYA 1XIWD 2JJSA 4APQB 5IEKB 4YHZL 3FT4A 1RHFA 5C3LD 4B5EA 5EA0H 5KTEH 2EH8L 2X4PA 2CXGA 3ULVC 3JZ7A 4GW5B 3BE1H 3WJJC 1CVSC 5CS7A 5GGTA 2X4NA 2VITA 3FOLA 4JFFB 4OUUB 2ITCA 1D5ZB 3A6BH 5EU6E 3PGFH 3ULVD 3MRMB 3V5KA 4G7YL 4W70A 1U42A 3QIUA 2H2SD 2VZOA 1RZFH 5C6TL 1G6RL 4HX1B 3PE9A 5C0DB 1HHGB 3O2VH 1WIUA 5CUSH 5DK0A 3CJJA 5DD6A 2H3NB 2VYRE 5DUPH 3RTQC 2AKRA 1UCBH 5E2TL 4L4TE 5HHOE 2X7LA 3ARXA 1OGAE 4LLWA 1A7OL 3HAEA 4M4PA 1F97A 1GOGA 3O6FB 3QHTC 1AGDB 1CFVH 2VLLA 3WXWL 4MJ6A 1JGEA 1KJMB 3RTQD 4OZ4B 2HMIC 4ZXBB 1HIML 2AQ3A 4NCDA 2IPUG 3RRQA 5DMGC 3VFUA 1TJHH 3U7YL 2ZCLH 2FIRT 2VRAA 1G9MH 5F70A 1QRND 4F8QA 2HMID 1CI5A 5DRWB 3ES6B 4OD3H 5I16A 5GGQH 4YZFF 1NLBL 1A7NH 4KKAC 4O2CA 5DZOA 2R29H 2FEEI 3S37L 5DMGD 4BFEA 2VSDA 2X9WA 1DN0B 3PGCB 3BWAB 3SKMA 3ZDXF 3BH8B 5LAXA 5C0CA 4MAYA 2WWKO 5DTFB 3ZDZF 4OCSL 5GS1B 1QBLL 4IJ3B 5C9JB 4L4VE 3UZEA 4I3RL 4K55A 3BMWA 4OZFG 2QSCL 5GS0C 1D9KA 2QQNL 2VLMD 4KKAD 1Q72L 4FQJH 5DEZA 4UV4L 4LPVA 4JY5L 3GMOB 5CMAA 1EIBA 3DXAA 5HHMD 1WZKA 5CINH 1KTLA 4IMKA 1CFTB 1MELA 4PJXA 1T1WA 5J12B 4P2RB 2WQ8A 4QRRD 1IGJB 5HSFA 3X3FL 1FYTE 5DK2B 3QHFH 3VGGA 5B3JF 3ZDYE 3H9SA 2I9TA 2ORBH 5KVGL 1TNMA 4ODXA 3RX8A 4ERSL 4XPBH 1ACYL 4NO5B 3WKML 1KG0B 3D0VB 4FTVA 3E3QC 2XZCL 3BRFA 1MHHA 3O81A 4OCYH 1X6NA 3GK8H 5F7FA 1AO7E 4D8PA 4GMSH 4PRPA 1N6VA 3O3BA 4XMLH 5D7IA 5EO9B 4PJAA 1CCZA 4PR5A 4JDVA 3W39B 4D0DA 2Q8AH 4K2UL 5JNYB 3IDNB 3V0WL 5ITBL 1J7VR 3AREB 2GEEA 3V0VB 2X1QA 1OP3K 3QUYA 4EUPA 1EPFA 4GRWH 1HZHL 2XA8H 3BZFB 1A7PL 4PRHE 5T1DL 3P40A 4LASL 4C56D 1C1EH 1SVZA 5DC9B 3ECBB 3SCMA 3FB8A 1BIHA 2BY2A 2MCG1 1BZ7A 4PJ5D 1U8NB 2YPKA 1OP5H 2YRPA 5GJSH 3KPRB 1AD9A 5JOFA 4WWID 1TZHB 1MIEL 4LAQL 4HV8B 2YD8A 4GG8A 1YDPB 2W92A 1QP1A 4KRLB 5DMIH 3CMOL 3HI1A 2EC9T 3OJVC 2XN9D 4Y5VA 1CT8A 3W0WE 1FV1A 1E27A 1HXYB 1OD9A 3FZUC 3RWIA 5HI5D 4HWBA 3AU1B 1BVLA 2DS4A 2PYFA 3NZHH 2YUVA 3FL7A 1KN2H 4N8CL 4OCRL 4DCQB 1QZ1A 4X4ZA 5C09D 4QYOA 1MFDL 3G5VA 2BNRD 3FZUD 3HE7C 4KRMB 3FHAA 1RPQA 3OKEA 5EOTB 3RIFF 4XH2A 4Q9RH 4LSVL 5TPWL 3VGBA 1BZ9B 3BD3A 3UJIH 5MI0B 1CLYH 1M1SA 1T0NA 2EDFA 3KXFB 4G9FD 3V4UL 3V95A 4X4ME 3LV3B 1F6AB 4JPWL 4U05A 3D3VE 3OKOB 5ESAB 4PG9A 1A9BA 4OZIF 4YDLB 3V6FA 3EFDH 3TN0C 4NWTH 32C2B 1G9NH 5EUOF 3TBYB 2W38A 5IESL 2OTPA 1ULVA 5HD8D 3QZWB 3O6KH 4BJLA 4K23L 1KELH 1QFWL 3LS4H 4JRWA 5EBGA 3MXVL 2VQTA 3TN0D 1JI1A 3MRLB 3ESUF 4U1LA 4HKBA 1RZJL 3G08B 4RGNB 3WJLA 2VDMH 3QNXA 3NN8B 5DJAB 4PJFF 1QBMH 4FQQB 4XX1G 4X4YA 3K8MA 1JZ8A 1GGBH 2A0LC 5SWSD 5AYUL 3BQUC 3GSVB 1JL8A 2V2WA 4H0IA 4BZ2H 4NN6B 1IGFH 5HGDA 4F7PB 5FA4B 5KSUB 2HKHL 1MRDL 3CDFA 5DHXB 3BRGC 3CVHB 4XPFH 5F1KC 7CGTA 4JFZL 3BQUD 5DQJA 1ZGLB 3ARBC 5ID1B 4BM7A 2YN3A 2HJLB 3DETC 4P5KB 5DC0A 2PCPB 5DRZA 4PJ9B 1W0VA 1CG9A 1WWWX 3FOMB 3SJVA 1J5OH 3ARBD 5HDBF 2WBJB 4LQFH 5E2UH 3NABL 5IG7B 5I19L 4NQDE 4JJ5B 4G42A 2I27N 5F7EL 4KVNL 4JM4L 1S9YB 4U1HA 2EIZB 5F7DB 2OI9B 4PJHB 5D93B 4P9ML 1BFSA 4CNIA 4U2ZA 5K59F 4NDMA 1U3ZA 3FFCD 4OD1L 1QRKA 3G5ZB 4Y4FC 4YO0A 1XF4A 4K3JH 3ZKXB 5EO0A 4JR9L 1KEML 4JGUA 3VXTB 8CGTA 4RMSA 3DROA 5JQ6L 3TZVA 5GJTL 3SGDI 3MOBH 3VXMD 5J13B 4PJDE 1IT9L 5EORH 5HPMA 4TUJA 3H7BA 4Y4FD 4XXDA 4WNQA 3WE6B 4F7CA 2K7PA 2JK5A 4F7TA 2XPGA 2FO4A 1WIPA 3A6BL 2SEBB 4GKZA 3PGFL 1NMAH 3MC0A 3T0EE 2Z91B 2UWEE 4XNXL 3T4YA 4YQXL 5EG6C 4YR6B 2FATH 4WTXA 2O5XH 1C08B 5EC2B 3IAGC 4KZDL 5CUSL 1FGVH 3S4SG 1I4FA 4ZO7A 1UCBL 4MD5A 2P5WE 1CE1H 2D7TH 4PJXF 5FUCE 1JZ6A 3I6LD 1AIFA 3IAQA 3UPAA 5D2LE 4DTGH 3QRFM 3N9GL 5F7WC 5KS9B 1K8IB 3MLVH 2KQMA 3NFNB 4JFEE 4FQ2L 5D2NE 3K1DA 4W68A 2EDHA 4RQQB 4OZFA 4QNPF 4NN7B 1NGXA 1M71B 4KFZC 1NMBH 4TVSa 3OB0H 3I2CL 2BNQD 1YEDB 3DO7B 5DJ0B 4IM8A 1KLFA 5D7IF 5E9DD 2P7TA 4Z95H 2M8XA 2HFFA 4LRIA 1RMFL 4YHPB 5EC1B 5T5FH 2BNUA 3QEGH 2AAVA 1A7NL 1C16B 5C0GA 3X17A 4WW1A 3X14B 1SY6L 5GSVA 4LSPH 2V7HA 2BCKA 2VO5A 4UIKH 5MEQB 4M3KB 1CN4A 4AEHH 2H32B 1MFCH 1PKQE 1UWXK 1CBVH 5IM7A 4L8SA 4OLXL 3I50H 1S7SA 5F6IC 4HUVA 5D7SL 3MJ6A 3OXSB 3PHOB 3GMNB 1J0KA 1PVHA 2IH1B 4OT1L 4HUUA 5D71H 5DRNB 5FYKE 4JM2A 3RZCC 4WU5B 5GS2D 3QH3A 2E6JA 1S7VB 4K3GA 2WBKA 4P3CL 5EBMA 2IQAB 35C8L 1JUFB 4GKSA 4YXHH 3PXJA 4PJCF 2VTFA 1TCRA 3RZCD 2R39A 4M48H 1U8KB 4TTDD 3PL6C 4M61B 3U1SL 3V2AR 4E5XB 3UTTE 5LGJB 4PV9A 1U8MB 1OTUC 2PXYD 4OZGA 1NGPH 3OAZK 2EYSA 3MJ9H 1JNJA 2I5YL 5F6HI 1MWAA 1TVDA 3PL6D 4HS3B 3RBGA 3CU7A 1JTOA 2YPVL 1KYOK 4JPVL 4NN5C 5SV4A 5D7JB 4QRPA 3QIUC 4XVUD 1MFAH 1A1MB 3RI5K 1OTUD 3WUZA 3P30H 4G8FB 3MACL 4X83A 4NPYB 3GSXA 1BX2A 4XVSL 1ZLWK 3WFCH 4LLVA 5FHAH 4TNVK 5IQ9B 1DUYA 2XQYK 4M6AA 5TDPB 3UC0L 4LEXH 1H3PH 5K9KB 5E7BA 4IMLB 1X5YA 2EXYC 4WHYH 1R5WB 1BVZA 1HCFX 1XGQA 4ZAKA 3S88H 1IQDB 3QUMB 4GAYA 3TWCH 5I8OL 1J8HD 4EDXB 3IJYA 1EJOL 4X7SH 1AGEB 2EXYD 1FQ9C 3A6CL 3BEVA 5I2IB 4TN9A 4NRXA 5HHNA 4ZYKB 2R0LL 3SKNA 1FPTH 2HLAA 5FUOH 2R0WH 4F15B 2DQHH 3WFHB 2YSSB 4UI2A 1SJHA 3Q6FA 4X7EC 1L7IH 2ZCKL 4JZJA 2IAND 1YEIH 4U1JA 2GT9B 1OTTC 4POZC 3EJJX 1CLYL 4LF3A 3SE9L 3ZTJG 2A9NL 2BSTA 5E56A 4M6NL 1HYRC 4APQA 1WISA 1PJ9A 3EDFA 3R0NA 5IEKA 1OTTD 4POZD 1JYVA 2J7LA 1G9NL 2D7QA 1D5IL 1C7SA 1VCAA 4WFHD 4JZNB 4R97C 4GW5A 3QDGB 5F7UA 1KELL 5IMLB 3CH8A 4U6XB 3GSNA 3MJ8B 1LEIB 4R96B 4OUUA 2VDML 2YXMA 1D5ZA 4Q97A 2YMXL 5JPMB 3MRMA 3E2HB 2FHCA 1Z5LB 2EDRA 3Q6GL 3HG1D 5EB9A 4HX1A 1T6VN 2ZNXA 5C0DA 1HHGA 1IGFL 1CE6B 1DFBH 4RIRB 2I24N 5FYLE 2H3NA 4QWWD 3VD4A 5BXFB 4TSCL 4KVCH 1IGTB 1Y6MR 2BHUA 1OPGL 1CTOA 3O6FA 3QAZC 5FYJE 2B4CH 1P84J 2X40A 5MENE 1AGDA 2BSRB 2H8PB 4RMUA 1KJMA 4U3CA 3VXUE 2UUDH 5E6YA 3W5MA 4IRZL 4OZ4A 4YX2L 4ZXBA 3QUZA 1J5OL 5L6YH 2XQYG 4IBLT 1WAAE 3HMXA 5MEOB 5HYSG 3BW9A 1FO0B 2ZP0T 3OWEA 2AVGA 3VE0B 4HUWB 4MYWB 3E6FB 4LAJH 5MP6L 4M1DL 4Y5VC 2LAGB 4O5LL 3K2UH 3VXNB 5A2FA 1SBSH 5DRWA 3ES6A 4KKBC 3ULVH 4MLSA 1A6AB 4X80H 2IBZY 4U3HA 1DN0A 3PGCA 4GJTB 3BWAA 2XTLA 3BH8A 5A2IH 5DTFA 2NQCA 4NQVB 2C1PB 3NCCB 2Z8WC 5C9JA 5IMMB 4LHUG 2VXTH 4KKBD 1OT2A 1INEL 1HN1A 3MXWL 1Z6JT 1UKSA 1UWEH 1LO0L 2Y07H 3GMOA 2AK4B 2GQHA 5F7MC 3QUXB 2QJDA 3R8QA 1MFBH 1E28B 4P2RA 4AQ1B 4TSAH 4ORZC 5DK2A 4DN4L 4TSBH 3AMKA 4BSVB 5BVJB 3TIEB 4PJ7B 3SOBH 4NO5A 1KG0A 3D0VA 2FATL 1TPXB 1XGYH 2HP4A 2A77L 4X5LA 4OLVH 3MJ7B 3L3IB 5GXBB 5GRWA 3VMPA 4ELKB 5EO9A 4WY7H 3W39A 2VQUA 1I1CA 4M43L 3IDNA 5E08H 2P24B 3T65B 2PR4H 3AREA 3V0VA 4HGMA 2UY6A 2ESVE 1A6TB 4Z7VB 3WFEH 1T5XB 3BZFA 4XC1H 4XVTH 3QEQB 1MRCH 1ZLSH 3ECBA 3VW3H 2YXFA 1U8NA 3NA9L 4WTZG 3KPRA 3RHWF 3QG7H 4CMHB 3VXQB 1TZHA 1QEWB 3AS2A 1K2DB 2YD5A 4HV8A 4Z95L 2VJXA 1A5FH 2APTA 1CXIA 3WSQH 1YDPA 5GS0H 3C60D 3CAFA 4NIKB 1G7LA 2F74B 4JEGB 4POYA 1JK8B 1IKNA 1HXYA 1YQVL 4WW2A 2VDOH 1N0LA 3OHXB 4OLWL 4OCXH 2EDLA 5KANI 1MEXH 3HZVB 4PP1C 4Y16B 4NNPH 2NR6C 1K6QL 1FBIL 4K8RL 3EOTH 4DCQA 4V2CB 4WO4C 1WEJH 1CLCA 3UJTL 3SJVD 4PP1D 2DD8H 3BKJH 1BZ9A 4NC1E 2NR6D 3QQ4A 1MFNA 1T6WA 3KXFA 4YXHL 3U36B 1Q9OA 3LV3A 1TTUA 3IDGB 5IBTH 5FDWB 1F6AA 5SWZB 4S10A 4WO4D 3TZVC 1C5BL 3OKOA 5ESAA 1BD2B 2ADIB 5FUZH 1WTGT 2ENSA 4M48L 2X1WL 3QIWC 4JPKL 32C2A 2MFNA 2ZG1A 4RAUA 1N64H 1QBBA 3TBYA 1J0JA 4LMQE 4MA8H 3QZWA 4KJQC 2FX7L 3O8XB 3DBXB 2WNGA 4X9FA 2BFVH 3MRBB 1NH6A 3BN9C 4EQ2A 4X99B 1KENH 5C07E 4HD9A 4YC2B 3MRLA 3QIWD 5BJTB 4XC3L 4WI2A 3G08A 1YPZF 4JCLA 1MFAL 2ZUQB 1ZT7B 2LU3A 2EEBA 5DJAA 1H3WM 1KXQE 4KJQD 4FQQA 4FABL 3T09A 4P2OC 1IL1B 3BN9D 3N1MC 4P4KA 3GSVA 3C87A 1N3NB 3KYAA 5J89A 2UVFA 1WBXB 5LQBL 4F7PA 5FA4A 2ZOLB 1IEAB 4N0YL 3CIQA 4MD0B 4NBXB 4PJBE 5F7KC 3CVHA 4P2OD 3V6OC 2ZSVB 2CKBH 4OAWA 5CEYB 1ZGLA 3CUPB 5ID1A 5INDA 2DLTA 3IS1X 2HJLA 5ISZD 2F9BT 2WP3T 2XKSA 4P5KA 3T3MF 1SHMA 4KTYA 4RX4A 2EDJA 1MOEA 2PCPA 4GS7C 4PJ9A 1LMKA 4O58H 1BHGA 3FOMA 1CYGA 4BFGA 25C8L 3S96B 3K81A 4MDJB 1UM6H 2WBJA 5IG7A 1NPUA 4ZUTB 2IGFH 4KRNA 4UDTB 1S9YA 4DN3H 2EIZA 3OTTA 5F7DA 4Y8DC 1CL7I 1AI1L 3EBAA 4QHNB 2NY5C 4CDGC 3G5ZA 4L8SC 3BMVA 4RMTA 4XAKE 2C3GA 3VXTA 5HGBB 2VAJA 1QPPA 5T33H 2XQBH 4WVRA 4YXKL 1XCTB 4MHHG 1MNUH 2FGWH 4V1DE 3ULUE 3B9DA 3WE6A 4S0SD 4LOUC 2VAAB 1GC1C 1RUPH 1A3LH 4JRYE 3WL9B 4ZFOL 2DM3A 2QQLH 3TJEH 1R24B 1G9EA 2QLVB 1MI5D 3DYOA 5IBUB 2DDQL 2Z91A 4GW4B 4F8TA 4IRJD 4LOUD 4HJJH 4X9GA 4YR6A 1FFNB 1C08A 1OGTA 2J5LC 5EC2A 5AD0B 2A73A 2NZIA 2VDLH 4G43B 4HUKB 1BFVH 5L0QB 4PG2A 3R1GL 5BW7A 2ED8A 3HI5L 4NGHH 3ZKQD 3L5WB 4QOKE