3P40A

Crystal structure of neurofascin adhesion complex in space group p3221
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
390
structure length
390
Chain Sequence
LTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Neurofascin
publication title Homophilic adhesion mechanism of neurofascin, a member of the l1 family of neural cell adhesion molecules.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 390
sequence length 390
ec nomenclature
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p40A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p40A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p40A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p40A04
4CVZA 3LH2H 4M48L 4Y4KA 4PRDA 3VXOB 1ZGLM 4OB5L 2EIEA 3KYAA 4R2GD 3CFCL 4PPTA 3S37L 3V5HB 4PJ9A 5IMMA 3NA4A 2OZ4L 2A9NL 1ZSDA 5AAWA 3WBDA 2EICA 3UBXI 1ZHKB 3QPQD 2LV4A 2V2TA 2O5XL 3HI5L 3FQXA 3O6KH 1TENA 5ACZA 3L3OB 2R1XA 1S9WA 3ZO0A 1CTOA 1MCPH 3P30H 5JNYA 4P4KA 3TM6A 3O4LA 4YH6A 3MUGB 4IS6A 1PG7H 4GW5B 3TBTB 4F7CA 3SE3C 3EYOB 2A6JA 1G9NH 2A77L 3QFJA 2JJWA 4S1SL 2PW1A 4U1MA 4PYGA 4QTIL 1JF6A 4O9HH 1KNOA 5DD3L 2ZOKB 4OBRA 1S9VB 2YD3A 1MWAL 2B0SH 1QSED 2V5MA 1GHFL 4H1LG 3EYSH 3SKOB 3MV9B 4KTDL 3BHBA 3CMOL 3EOAB 1UGNA 2H9GB 3BE1H 4FFVD 2X9YA 4ODVL 5DMJB 1I9RH 3V0AC 1NBYA 1G6RL 4DFHA 3QNYB 4ZFGL 5IHZA 3AGVA 1OTSC 2XQBH 1T2QL 1PX3A 2BSSB 3H9SD 4GRWE 4Y5YA 1MRFL 5I18H 4HIHA 2XQYK 3S4SA 3GSNA 1NJ9B 1LD9A 3FQUA 1S7QB 1IC7H 5I1LA 4J8RB 1RZFL 2C26A 2QEJA 3VFSB 5JR1L 1FSKB 3RTQC 3VFWA 2YPVL 4PGBB 1INDL 2O5YH 4PP2B 3GSUB 1QA9B 3L3JB 2R4RL 5BRZE 3OPZL 4DTGL 1TTUA 3RDTC 3LKQA 1P9MC 2R0ZH 3M07A 1K3IA 1P4IL 5BW7C 3HAEG 1G0XA 3MNWA 2JE8A 2N1KA 1KJVA 4GKZB 3N1PC 4QRPD 4NOBA 4XPGH 4AH2A 4JLRA 2ATPA 4YK4B 2V17L 2VR4A 2OX5A 2O26U 4KROD 5GSVA 2CDEB 4JFFA 1CXHA 4DN3H 3GMNB 5FYJD 1V05A 5IFHH 3RIFF 4FTVE 1V3LA 1YEGL 1YY8B 4ODTH 2EDFA 1A47A 3MOBH 4D0BA 3RJQB 4ZQKB 4O2FB 1S7TB 3VXMD 3W2DL 4D3CL 3B43A 2R2BB 2Z35B 3DVNB 4FXKB 5J56B 4J1UB 1CU4L 1NFKA 3CFEB 3NA9L 2GCYB 1G6VK 5T3XH 1AP2A 3KPLA 2ZCLH 4YGVA 4UV7L 4NQVB 4JRWA 1KIQB 3VXRD 2YD2A 1KV3A 4P3DB 1CLYL 1HSBA 3VFGH 4JFXB 2WWMD 2IEPA 5T1LA 3MJ9A 1EO8H 3WIFA 4U6YB 1X5JA 5FECB 3FQNB 4TOYH 3QA3B 3SDXF 1Z3GH 3RZCA 2VITA 4PRBB 4W4OC 4TN9A 1FFPB 1CL7I 3BN9C 3U4BL 4ZYKA 3ARDC 1E6OH 2R0WL 2AJSH 2EIZA 4BUHA 2JJUA 5JUEH 4G43A 3MRQB 5IVXB 3P4OB 2CLZB 1DJSA 3H9HA 1QVOA 1S9YA 1B0RB 1DN0B 2F8OA 5AD0B 3LQMA 3MRIA 5TFSH 5IFAL 4KK9D 4I2XB 5FK9A 4OI9A 4RAUB 3KPOA 4YNYB 1YECH 5DI8A 5LGJA 4DK3A 3D39D 4KV5E 3NZHL 5C6TL 5EBLB 4K8RD 2H2SD 1H8NA 1TCMA 1MCKA 1TVBB 3D6GA 5JPMA 5CD5D 3I6LE 1NBVL 1OF2B 4LSSL 5D5MF 5I73B 3HRPA 4EUPG 1A0QH 4BFGA 5DUML 1LP9A 1YUHA 3AU1A 3EFFA 5AYUH 4OGYH 3HR6A 4JFHE 1GGCL 3BDYL 2C1PB 3RKPA 4JFYB 1RVFL 3KPQB 1QBBA 2Q86A 5BS0A 3KPNA 1U8LB 4QT5B 3BXNA 5JIKA 2X89A 3IETA 3RL1A 2C3HA 2X4QA 5TDOB 3C08L 3P40A 3V8CA 3VRIB 4LARH 2PYED 1BVLA 4FFZH 4PJHA 1CCZA 1NUFA 5I1KL 4JFEB 2GJ6E 2CJUH 3M1BB 4PJIB 1DQLH 2QADC 2NW2A 2D7MA 2EDYA 3HLAA 4PREA 5E94A 5SWSE 4P9MH 2C7UA 3PQYB 1I1AA 1HH6A 5JHDD 1FSKC 4XP6H 1T2JA 4MAYA 5J6GA 4NGHL 4XVTH 1NQBA 4KRNA 2C9AA 3UTQB 5BOPA 4RX4D 2I26N 3QUKA 1TQCC 4PJEF 3QUYC 4EN3C 1DQML 1F4WH 3O3UN 4YHYB 2VXQL 3MLRH 3P73B 4MD0B 3P9LB 3VI3E 3P77B 1XF2B 4YK4C 2CUIA 2IBZY 2WQRA 1I3VA 5DMIL 4POYA 4GRLC 2F5AH 4YUEL 2NTFB 4L4VB 3N50A 1MHEA 3IS0X 2YR3A 2P5WB 4M8VA 5DJXA 3WKMH 2ZPKH 3ZKMC 4N5ED 3S7GA 4PY8I 4LSVH 1YZZA 1K4DA 3DRTB 3MRRB 1YEDB 1NSNL 4HUXA 3HZKA 5HI3C 1YJDL 1CGWA 2J88H 1RK0B 2GI7A 2GY7B 6FABH 5J0BA 3NBNA 2IANB 4NQDA 2YZ1A 4XBGB 2AJXH 5D70H 3BDBA 2P5EE 1FNLA 3D0LB 3WHE1 3EOTH 1T1ZB 5IEKA 1BD2E 2A0LC 1WLHA 5B38B 4NSKB 2AK4A 5LXGH 2BFVH 1JF1B 4H26A 5EH1A 3A67L 3WFDH 4Q2ZA 2B4CH 4MCZA 4WWKA 4S1RH 3I3BA 3ZYOA 4BELD 3GBNH 3MRNB 4M8QB 3LEXA 3L3IB 3BP4A 3MLWL 5FGCE 5FOBB 3QHZH 1F45A 3N85H 1I1FB 4PGDB 5B3JE 4LLVB 5ICYA 4E41E 1T6VN 3JWNC 2X1QA 4YQXL 1SYSA 2HAZA 3HMXL 3TN0A 3V5DB 4LLWB 1KT2B 1WAAA 1YDPB 1F2XK 4OZ4B 5IW1A 1L7IH 1A9BA 1CLZL 1Z5LB 4MJ6A 3NIGE 1OT2A 5GHWH 4JCMA 2FGWL 5C0DB 4ZMAT 4S1DD 4XCCL 3MJGX 3FRPA 4H0HB 4QXWA 4I5BB 5DRZB 4X4XA 4YHIA 2O5ZH 3DETC 5E2VH 4RMTA 4FQCH 3N9GL 1MLCA 1GZPA 1N3NB 4NC2B 1TQBC 4MNGA 2EYRB 4G6FD 4OD3H 2NW3A 3MLUL 4Y2DD 3LAFA 3MV8B 4K07A 4F3FA 4OZHF 4AEIL 1DEEB 5FUZH 1A9EB 1J0YA 2GK0B 4JHAH 4FQPA 4GUPA 4IJ3B 4LPTA 2V7NA 5CGYC 4PIRF 3BKJH 1BFSA 2VLKE 1KPUB 5F1NA 4PY7B 1KLGB 3S5LA 2XZQL 5KSBB 5KSAD 5L2KA 5KVFH 4X7FC 1U8QA 4XNYH 1F02I 5DJCA 4DVRH 2XXMB 1Q0XH 3MNZB 2I60L 3FO2A 4XPHL 1NKOA 3U9PL 1N64H 5BO1L 1J8HB 5TE4H 2FBJL 1HDMB 1J11A 1AR1C 4OZIA 3BIKB 1UWEL 3C60A 3OWEA 4NQCD 3WO3B 3KWWB 4NHUB 25C8L 5H94A 4NQSA 2ILLA 3DMMD 3S88H 3JTTB 1YMME 1MOEA 1JFQL 3IJSA 1HOCA 2FEDC 1RUQH 5D7LD 4HIEA 1M05B 3WJJA 1Q9OA 4JHWL 1QPXA 4OM0L 1FNSH 1KLUA 2F58L 4RBPH 3RWDB 1WFOA 3C2AH 3LKSA 3DI3B 2QTEA 3K0WA 3GSOA 3MCLH 5F89A 2MPAL 3T3PE 3RAJH 5M7QA 4XC1H 3QIBC 4KJWC 1OQOA 3TBSA 2R4SL 1EV2E 3ZDYE 2OK0L 4ZO9A 1FLRH 4V1DA 3QQ3B 4EI5B 3KYOB 4ZSOA 4PFEA 4ALAH 3M8OH 3CXDL 2X4OB 4E5XA 2F9BT 2VLJA 5IOPA 1U8PA 4NDMA 3GHEH 5IJKA 1CIDA 3KPRE 4MA1C 1AGFA 5BZDB 3KJ6L 3IFNL 4U6XB 2DLFH 4HWZA 4X7CC 2VISB 2XV6B 2FNBA 2W0LA 3UTSA 4AY0A 3W0WD 3JV6B 4RFEB 4ENED 2E7CA 2P1YA 2Y5TA 3GMQB 2E7LC 2GK2A 3CUPA 5AUMB 4KMTL 4PJCF 3TNMB 4HHAB 5IK3B 4D8PA 1E0OB 3BP7A 5FA3B 1JTOA 4FQXA 1EH9A 3Q5OA 5D7IE 2BOCB 3OKKA 3SKNB 1R0AL 2APBA 5E1AB 5J3HC 3MYJB 3ULVE 3LZFH 1INQB 5AEAA 3WLWC 4LLDB 1FV1B 4OKVB 1M1SA 1C5DB 1FVCB 4WW1A 5LBSH 3OGCB 5EZIH 3GB7B 4M6NL 4QRQA 4BH8A 5B8CC 2FD6H 1KJ2H 3NAAL 3VCLB 4M6MH 3WL9B 5DJ6A 3EYQC 3KYNA 1F3DH 2JIXB 2F8VA 3IT8D 2ENYA 2AS5M 4Y8DC 1F3DJ 3FZUD 4L3CB 1ZLWK 4QYOB 4RRPG 1I7UA 3THML 3HC3L 2Q3AA 2BVQA 2BVUA 5CBEA 3IDGA 1P2CA 2Y4SA 3J8F7 4S10A 3DURA 1CICD 3U36A 5F96L 4Y89A 3LS4L 2GIYA 1T80A 4KFZC 5C0BD 5DFTA 3OJMB 1D6EA 4M48H 5J1TC 3FMGL 4OI8A 2G9HB 3C9NA 1JGEA 4G7VL 4OB5H 4DCQB 3CFCH 3RVVC 5CS7A 3S37H 4Y5XB 3VXQA 1YEKL 2OZ4H 2A9NH 4DEPB 1SHMA 2GITB 4C83A 4OV6F 3TEUA 5INCA 4MJIE 2O5XH 3HI5H 2DQGH 3QG6A 4PTTA 3ORJA 3HC4L 3QO1A 3V9FA 2HKHL 1KXTB 4I3GA 2Q1EA 4HUWB 3PHQB 2CIIA 3QCTL 4HS6A 4P2CG 3QDME 4H8WL 4XHJD 2A77H 3RHWF 4S1SH 2IWGA 3QNZA 2Y6SC 1IEAA 1XAUA 4QTIH 4QRPA 1L7TL 4YLQT 2FH8A 5DD3H 2CDFB 3DXAD 1MWAH 3IJYA 4R4ND 1GHFH 1XGUB 3L3GA 1JV5B 4KTDH 5C07D 3CMOH 3KAAA 4Z7QE 3L5JA 4JFQA 3QR2A 5D1XA 1RUKH 3BD3A 2JF1A 1G6RH 4LHUG 4N90E 2D03L 4UAOC 2ESVD 4EI5C 4ZFGH 4NC1E 3RBSA 1WT5A 3FT3B 1J18A 1TXKA 2AEQL 5AZEL 1PAMA 2Q3ZA 3VXMA 4ODSL 1U3YA 2YEZB 1MRFH 1FZOA 1RV6X 2EC9T 5JORA 1YEEL 3T04D 3MBXL 1GOGA 1LK2B 2P7TB 4GRMB 2J8OA 1ORQA 1RZFH 3UP1A 5JR1H 5T1KA 3INUL 2YPVH 1INDH 3DROB 3VXRA 1VGKB 2R4RH 1AE6L 3OPZH 4G8GD 4DTGH 4ONFL 2HN7B 1QLFA 5HSFA 3TCLA 3WIIL 4NUGL 5A2IH 1G7JA 4HJGA 1P4IH 2I25N 5F9DC 1VKXA 1DE4A 1Q8MA 4KC3B 5GGRY 2X9XA 3OKEA 4NUJB 2MWCA 1OSPL 2EXYD 4PRIE 4HUNB 4KXZI 1CXLA 2ZUQB 2V17H 3DPBA 5IEHB 3EGSB 3OGOE 2DKSA 5HHOB 2ATKB 3MBEA 2WBJD 1LNUB 4M5YL 2EDRA 4EDXB 5E1HB 1RZKC 3RFZC 3QXAA 1KCSL 2WUBL 4HDIA 1LO4L 3W2DH 4D3CH 3MJ7A 3SDXB 5J8OA 5E7BA 2AKRB 1CU4H 2X1OA 2F53D 3EOBB 3NA9H 3QH3A 4UV7H 2CMRL 4YPGA 2DKUA 4KI5C 1FZKB 3R8QA 1C08B 1CLYH 3T0EB 3DV4B 4PRAA 4I18B 4OIIL 1EGJL 4WNQB 4OQTA 3WO4B 4FQ2L 2YOCA 1ZHNB 3ARWA 1F13A 1GCFA 1Y6MR 3ARED 2YD4A 2IPUK 1JWSB 4ODXB 4DGYL 5EZLB 5B21A 1BZ7A 4JVWA 3MV9E 3U4BH 3NFPB 4XAWL 3HZVB 3VE0B 2R0WH 5CJXA 3VDBA 5SWQA 1D5BA 5FKPB 4LSPL 3G5ZB 5KZCD 4X98A 4LVHC 5CMAB 2HA1A 3DV6A 2AEWA 1AHWC 5EO0B 5IFAH 4F8TA 4CUCA 3HZYB 8CGTA 1ZLVH 2JKXA 2EEDA 2MQCA 3NZHH 5C6TH 5KSUB 4RX4A 2FRGP 4NYLB 3TESA 1NBVH 1YEHL 1FZMA 4LSSH 3DLQR 3EHBC 4DAGL 3HE7A 4ZPVA 1YN7A 5HDBE 5C0EA 3W9DB 5DUMH 1ZA6A 5JW3L 1XF1A 5CIPB 4XXDA 4PJHF 4D9QD 1XT5A 3QWRD 5EDXA 2BY2A 4LPUA 4TTDC 5FDWA 5JMOC 4ZG1A 5IM7A 1GGCH 3BDYH 3FFDA 1AY1L 4APQD 4Z7WA 1IBGL 4LNRB 3SGEI 4YDKL 3U6RA 5HPMA 3QIUB 2XFXB 1U92B 2GSIA 4M3JA 3VMOA 1G7PB 3C08H 1S7VB 4YDJA 3CVHB 4PGEB 5KAQF 1U36A 3CPLA 3MC0A 4OZGB 5CLWA 5I1KH 1ETZA 1QRKA 3MZTA 5IW3A 1XH3A 2EDHA 1UJ3B 4PYHA 1ORSA 5EA0L 5L0QB 4BA8A 5EBMB 1YMHB 2IAMA 3FOMA 3OJ2C 4PD4J 2PO6B 4K3EL 3JV5A 2MQ3A 2BNQB 4NGHH 1OAQL 2X7LB 1M7IA 3B9EA 2D31A 3B2UD 3SY0A 2AXHA 2FIRT 3IKCB 3QEQD 1SJEB 1DQMH 3GSWB 3GSVA 5D71L 3GIVA 2Z31C 2CQVA 1R3KA 4V2BA 5D2LA 5GGTL 3VXUB 5DMIH 4FA8A 4YUEH 1W0WA 3EJYD 4HWEL 1KEGH 4HIIA 4KHXL 2BOBA 4JFDD 4RA0C 1NEZG 5IHBA 1ZANL 3FONA 1NSNH 5IF0B 1II4E 1X9QA 2UY7A 5IKCB 1YJDH 3H3BC 3VGAC 3E0GA 2JJSC 3Q48A 4DKDC 1V3MA 1KTLA 5FM8A 2BNUA 5DVOA 4Z0BL 4DFIA 1D9KA 4N0YL 5IVXE 4FN0A 5FGRA 2IG2L 1RK1A 2PW2A 4F33A 3O41B 1A7QL 4KJYA 4I2XE 4Y2DA 3JBG7 1T66C 3A67H 2Q8AL 4P3CL 3GK8L 1K3ZA 3MRGB 2HTKC 3OSKA 4RMQA 3BP5B 4I18C 3MLWH 1KXQE 2EE2A 3GRWL 1MJJA 4K3JL 2OLDA 4NKMA 4EDWL 4F57H 4X8JB 4WFED 3VFNB 3BW9A 4DUVA 4YQXH 1RUML 2NY6C 3HMXH 4E0RA 1KUMA 2VLMD 1MRDL 1TZIA 4RQQA 2JJTA 3EZ8A 3MRKA 4Q7DA 5CBAA 15C8L 1CLZH 1EVUA 3BIBX 3BWAB 5DJYA 2H6PB 3P0YL 3DMMA 5GGSB 2FGWH 3Q1SL 4JY6A 1WWBX 4WFGE 5EC2A 1FDLL 4JFEE 3OKNB 4OUUB 5TF1L 3ZDXE 4PJIE 3IFLL 5GS1C 4NN6C 5K9QI 2VXUL 2YC1A 4N8VG 1AQKL 4U7SA 5JO5A 4GLRH 3N9GH 5D72L 4YHLL 1KIRA 5E03A 2UVFA 3PQYE 1D5XB 1L0YA 1AH1A 2UUDK 1KJ2A 3ZHLA 2AP2A 5D6DA 1U0QA 3MLUH 5HHQA 3GM0A 4X6EB 3NPSC 3VWKA 3BKML 4AEIH 1T1YB 3SGKC 3G6AA 2BRQA 3MGOB 4LVEA 5GXBB 4OZIF 5GGRA 1OTUC 4I1NB 3QIUC 5C70A 1VESA 4OF7A 3WFHB 1FAKT 5FB8A 2QR0B 4R97C 4CNIA 4LGPB 4KRPB 4PLJC 4QNPF 5T1MB 1JRHL 4HEME 1RZGA 2I60H 4L4VE 4XPHH 2ADJB 5E5RB 3U9PH 1BIIB 5BO1H 2P5WE 3I6GB 4KDTC 2APVA 4MS8C 2FBJH 4M6OL 3IJHB 2BY0A 1UWEH 1ZLUK 3GMMB 3AS2A 2X70A 25C8H 4Y4FC 2PO6C 4XGZA 1HHIA 3CFDB 3FOLB 2IANE 3NTCL 4XCNA 3WDJA 3W0WA 4E42B 5TQ0L 4P46D 3CFKB 4ONGL 4U7MA 1QLEL 4PJDA 1DQQA 3QRGL 4JHWH 1IGYB 2X44D 5DD6B 3QHFL 4OM0H 5E8EB 2F58H 1ERNA 2BERA 3BI9X 2AI0L 3GMLA 3SGJA 2FX9H 1FFQA 2P46B 1ZVHA 2CLRA 1HHKB 3LEYL 4ZUVB 4A6YB 4CU6A 2WM0A 1G1YA 1YYLL 2MPAH 3MMEB 4IMLA 1HCVA 2R4SH 1IQWL 2NY0D 3DGGA 3QUXB 3HZMA 2OK0H 1NC4D 5DK2A 4JGUA 5D1QC 1EEYB 5J57B 4ZNEE 3O3AB 2QLVB 5JZ7D 4UBDC 5I6XC 1MWAA 3B9AA 3MRMB 3DX9B 1UXSA 4PJBA 1UH3A 2UV3A 5IBUG 5IFJB 3CXDH 4GKSA 5T33L 5ID0B 5EWIL 1XIWD 2V5SA 1QKZL 3KJ6H 5F88A 4Y5VB 2NY1C 3IFNH 1DZBA 1ZAGA 5J12B 4LAJH 1MCRA 1QRNB 1T7XA 4OCWL 4YR6A 2G5BB 4S11A 2CH8A 3QUZC 4KMTH 5JTWA 3KJ4C 3Q6FB 3HG1B 1R3LA 5FXCH 4U0RC 1OP3K 1FNEB 3CLFL 2EKSB 4HUKB 2VQUA 5EIIA 3SJVD 1UQSA 5EZOL 3MV8E 3DX8B 3IGAB 4H0IA 1BLNB 3WCYA 4CVZB 5TQ2L 1R0AH 5F72S 3M45A 1IAKB 2AJVL 3F12A 4Y4KB 4UDTA 2C1OB 5BQ7B 4NQEB 5KSBE 3LB6C 2X42A 3HHRB 3NACL 4JQVC 1FGNL 5ITFB 3NAAH 1J8HE 1IGJA 1U3HB 2V2TB 2B7DT 4XVJL 3RGVD 5ACZB 3QUMA 2A6IA 4K9EC 4MMXC 3THMH 3HC3H 3TT3L 3UX9B 1DLFL 1WCBB 2YA1A 4DUXA 2ZSVA 5CINL 2E7BA 1A5FL 2A6JB 3DXAA 2PW1B 3IXTA 2J2ZA 2YD9A 3Q6GH 1DL7L 4L4TD 5C07A 4Z8FL 1E4WL 5F96H 3LS4H 2YPLD 4HW6A 2APWA 3BPLB 1J88A 2Z8RA 5T3ZL 4N8PA 3JTSB 3QHTC 4I0PB 2ESVA 1X5HA 3BHBB 4KRPC 4OLYL 2F54D 5JQ6L 5CWSA 5GJTL 3FMGH 4P2QB 4TUJB 3P4NA 4G7VH 4LLUB 1OTSD 5CILL 1B4JL 4MB5A 5BRZA 1YEKH 3LPFA 2WP3T 2ZCKL 4UNUA 5IHZB 4R90L 1JZ7A 5CJ5A 2GFBA 3QQNA 2UWEB 3HC4H 4Y5YB 5C3TA 2HKHH 4U1SA 3BGAA 5CSBA 4U6VL 1OLZA 5FV1L 5LWYL 3FQUB 3RTQD 2OR7A 2EDNA 2C3VA 2M1KA 3QCTH 3PG2A 1QZ1A 3OG6B 1J87A 1CXFA 4H8WH 3VFWB 2DJ4A 5MI0B 3RDTD 1IL1A 4HG4K 2CUMA 3A6BL 3NCJL 3HR5A 3MLSL 3RWIA 1DANU 1WC7A 1L7TH 1WISA 3LKQB 4BSVB 4XPFL 1LWRA 2DJUA 1KACB 2FECI 4B7LA 4FTVA 5AWNL 3U0PA 3MNWB 5E99L 2E9BA 1NCBL 4L8DB 3GFUA 3DUUA 3UXFA 2LQRA 2WBJA 3TBWA 4JLRB 2B2XL 1S78C 3F7YB 2D03H 1N6VA 4N0RA 1SVCP 2BHYA 4WW2A 1ZHBA 2FEEI 5GSVB 1DUYA 4JFFB 5F6IB 2AEQH 5I8EA 5AZEH 5C0NC 1YEEH 3MBXH 1W0YT 5CJQL 3ECBB 3VG0L 4K23L 4W81A 4M6AA 2F53A 2FR4A 4D0BB 4Y5VC 1RJLA 5A2JH 1AQDA 3INUH 1ED3A 1ZVSA 1NAMA 5J13B 3B8YA 5DA4A 1AE6H 1A21A 1S8DA 4Q58C 4ONFH 4GXUM 4F9LA 3JV4A 5IESL 5E5UB 3WIIH 4NUGH 3RU8L 2PR4L 2WWKO 2ZSWB 5E6YA 1D7FA 3ISWA 2YPKA 1OSPH 3TA3B 3T0AA 4JFZL 5T1LB 2IADB 1P84K 3AAZA 1Z6JT 1RHHA 3IDXL 2DIAA 4R6UA 3BN9D 2Z0BA 3ARDD 4D0CB 5BV7L 2ITDA 2H1PL 2IGFL 1HSAA 1VPOL 5FYLE 1HK6A 2R29L 4N0FA 1EAJA 4M5YH 4WDIA 4RGOL 4X4YB 4G43B 3TYFA 5EO9A 4XPAL 2XOTA 3KPMB 1RHFA 3U46B 1U3HC 1KCSH 3H9HB 2WUBH 3VFTB 1LO4H 1QVOB 1S9YB 3KDMB 3LRHA 3P4MA 1NANI 1E27A 1VACA 1ZHLB 5FK9B 3T77B 3KPOB 5TDPA 5LGJB 5CEYB 5JA8B 5ICXA 3ULUC 4XBPA 3ZHKA 3NFNB 3ZDZE 4GG8B 4XXCA 3OZ9L 3QWRA 1KF9B 2CMRH 4APQA 1RZKL 4IRSC 3WUWA 2VQTA 1LP9B 4QHKJ 2HJFB 1EGJH 2XN9D 3EFFB 4OIIH 5LAXB 4FQ2H 4UT7L 4BQ6A 4I0PC 5SWSA 2DLEA 3RY6A 5MHSE 5CKGA 4DGYH 4WTZA 2Q86B 5BS0B 4LCYA 5DEGA 2B1HL 2NZ9C 4XAWH 3H7LA 3RL1B 5HYJB 5FAAA 1BVLB 5GGUB 1WBYA 2QADD 5MENB 3OB8A 4PJHB 3FJTA 1G7MB 2ZNXA 5JIHA 2OTPA 4U3XA 1BJMA 3HLAB 4O5LL 4PREB 3FTGA 1XCTB 5C6WH 4Q9RL 2VZUA 3ALWA 3X12B 5A43C 4KPHL 4RMWA 4Z7WF 1I1AB 1OQXA 1HH6B 4MAYB 1EHLL 1ACYL 1T89C 3QEQA 5J6GB 1YEHH 2OL3L 1CIUA 1BVKB 4HS3B 4DAGH 4BFIA 1EX0A 1LGVA 1NEZB 4XRCA 5I8CB 3C6SA 3QUYD 4EN3D 3CLEL 5JW3H 5HHPA 3TBYA 1UXWA 5B4MC 4HLJA 1AY1H 4GRLD 3LN4A 1A7RL 1IBGH 2LU3A 3FRUA 4YDKH 5F7YC 1AD9B 2EH8L 5DJXB 1OAXL 5HDLA 1BM3L 3VFMA 5HI3D 1E6JL 1YNLL 5F6IC 4U31A 5CP7A 4LOUC 1BQHA 4UOW0 1RIUL 3BIAX 5HHOE 5EA0H 2D9CA 1R3JA 5ISZD 4NQDB 4FS0A 3CFJA 4ODWB 3SDDB 4YZFF 4F80A 1GL4B 1MCHA 3DO7B 2A0LD 1JTPA 3PWPD 4K3EH 4KH2A 1PZ5A 2I9TA 2H2PC 2NXZB 3C5ZA 5J13C 2VOTA 1OAQH 5IEKB 2KKQA 1IVLA 5HDQH 1K2DA 5F8QC 5FDYA 3RPIA 5JOPD 3PWVB 3O0RL 4JO4L 2AK4B 1JN6A 2HJLA 3SDXE 4H26B 1KYOK 4X5XA 1V7NL 3R4DA 2Z8VC 4IOIA 5D71H 4L8SC 1ND0A 5A3IC 3K74B 4MJ5B 1SM3L 5LVEA 5EOCL 3LEXB 3BP4B 5GGTH 1ZA3A 4DJMA 1JF5A 4XPTL 1XFPA 5ILTH 3T0EE 4HWEH 4CN4A 3LKRB 1IM3B 4KHXH 5B39A 3OJVC 2X4PA 4M4PA 4N8VB 1SYSB 1ZANH 3VFVA 3TN0B 1NGYA 5I75B 2AJZA 1WTGT 3BSZL 5D7KE 4Z0BH 4MJ6B 4N0YH 5F7DA 2C3WA 1JGVH 3DETD 1A7QH 5HYSA 2DL2A 1RZIA 5D93B 2VLKA 4X4XB 4YHIB 2X4SA 4RMSA 2OI9C 4JFPA 4X8XA 3OAZH 2Q8AH 3ZE0E 1WWCA 1MLCB 4P3CH 3GK8H 1V5JA 4MNGB 1G84A 1LE5A 4M9PA 4HZLA 3VRJA 3GRWH 4F3FB 4K3JH 5CGYD 4DN4L 1MLBB 2JELL 4EDWH 1WK0A 2R1WA 3IAQA 1LDPL 2DQJL 1RUMH 3W11C 3N0PB 5HGDB 1YMMA 4P4RA 5F1NB 2CRMA 1MRDH 5ADPL 5ICZA 5IBLC 5CFHA 5L2KB 3DYMA 4RGND 1OY3B 2J1KA 5KVGL 1MFAL 2FJFA 15C8H 1AR1D 5DJCB 3U48A 4HSQA 4URTB 3S9DB 3P0YH 1PD6A 4LDLB 5I76B 1OD7A 3Q1SH 4OZGE 4OZIB 4AL8L 4ZFFA 2OR8A 5TF1H 2H45A 3MYZA 3IFLH 4JDTL 5H94B 2FEDD 2VXUH 1AQKH 4I8DA 5EUOA 1G7LB 5D72H 4YHLH 1SJHA 1I8KA 1NPUA 3SBWA 3QNXB 4UIMA 5FCSH 4NM8L 4HZAA 2DQHL 1WZ1L 2BNQE 4N1CA 3TO2B 4IIQC 1EXUA 3BKMH 5SV3A 1Z9LA 3LKSB 3QI9D 5I1IL 1NC4A 4HXAL 3QIBD 4KJWD 8FABA 2D7NA 2YK1L 4Z78B 4M5ZL 5F89B 5CSZA 1A6ZB 5L9DL 4ZXBB 3TBSB 3VXUE 1ONQA 3RUGB 1JRHH 3MA7B 4ISVB 1KB5A 4JKKA 2DI8A 1A14L 2DDQL 4M6OH 3CH1A 4P99A 3RBGA 2EDJA 4BKLA 1I3RA 2YUXA 3HI6L 2ADIA 3SDDC 1CDJA 3H7BA 1H5BC 3QZWG 1F11A 2DTSA 1ZK9A 4G9FB 3NTCH 4E5XB 5DMYA 4KKBC 4KRMB 5IOPB 1U8PB 3V0WL 3NZ8B 5TQ0H 4NCC1 4IOSD 1AXTL 4FQIL 4ONGH 1QLEH 3BWUC 1RU9L 4MDIA 5D7IA 1SMOA 2ZKHL 3QRGH 5ALCL 3QHFH 4HWZB 3FB5A 2IJ0C 3UTSB 2DQFA 3EZJB 2AI0H 2VL5B 3OKMA 1U9KA 5FO8A 1JYXA 4QOKD 3SJVA 2V5RA 3LEYH 4X6BA 4PJBF 4D8PB 1YYLH 3BP7B 2EDBA 2DYPD 1L9NA 1MCWM 1IQWH 3UEZA 1ES0A 3EDEA 5J3HD 4R2GB 3OKKB 4LPVA 4X6DA 2EEAA 1X5KA 2Q76A 4IRJC 1JTTA 4M02A 4UT6L 4X6CA 1DCLA 2JCCA 3I3DA 2P48B 1E4JA 1N6QL 1ADQA 2CSPA 1IKFH 4IRZL 2YUWA 3EYQD 5T33H 4QRQB 2IALA 3SE3A 1W2KT 5EWIH 5T3ZD 3GJFK 5HI5C 3MRFB 1MHHA 1RJZA 1ZGLP 3J7HA 3KYNB 4ZAKA 1QKZH 4G7YL 4HPYL 4L4TA 4POUB 4OCWH 1I7UB 2VQ1A 4WI3A 2YPLA 2K7PA 2BVQB 2M26A 3F7VA 2ARWA 4MHHI 4RCAA 1KCUL 1P2CB 1QSEB 2F19L 3CLFH 3LIZL 3HE6D 3U36B 4WEBL 4HKXA 3IDYC 3L5WA 5EZOH 4MJIA 5CSGA 4OFVA 5TQ2H 3C8KA 4L9LC 5E8PA 1D6EB 2AJVH 1F97A 4WO4C 3RVVD 1QFPA 3MCKB 3FO1B 1TVHA 1JGEB 2AXGA 3H9SB 2R39A 3D1MC 3U1SL 3NACH 1FGNH 4Y7MA 2YMXL 2E8YA 3T0WA 3OX8A 4ERSL 1JNJA 1B0GA 3Q3GA 4XVJH 5INCB 3V6ZA 2IH3A 4PTTB 2Q20A 5E2JA 2ZUSA 3RDTA 1P9MA 3QO1B 2G5RA 3WFCL 1B90A 3TT3H 5BW7A 3DSFL 2Y25A 1DLFH 2CIIB 2NY4D 5CINH 3TZVB 3NCFB 1DQDL 1A5FH 3RNQB 1A3LL 3QNZB 2E9WA 1DL7H 4Z8FH 3GSQA 1E4WH 1IEAB 1BQLL 1TJHL 2A38A 4QRPB 5I74B 5L2JA 4ZNCD 1EMTL 4QHUA 4JPIB 1DQJA 5T3ZH 2KPNA 4P2OC 3IJYB 4KROB 3F5WB 1RUAL 1P6AB 1AGEA 4K9EL 4OLYH 5JQ6H 1QR1B 5GJTH 4ZXBC 4HBCL 4OLXL 3ZE2E 1Z0NA 4H20L 4YFEA 4JG1L 4U05A 1B4JH 2HRPL 5CILH 2RB8A 4C4KT 1GGTA 1EGJA 1GGBL 2OJZL 2ZCKH 4R90H 2FJGA 1HI6A 4HWNA 3BUYA 2DWDA 3VXMB 5JORB 4U6VH 5LWYH 4XAKD 5DK0A 2BMKA 4PRIA 1ORQB 4LEOB 2YSSA 1JUFA 1H9VA 1XR9A 4HCRL 3A6BH 3VXRB 3NCJH 3MLSH 3LQAL 2ZUUA 1SJXA 4WW2F 5LGKA 5GZNC 1LILA 1QRNE 4XPFH 5K33A 4HJGB 5H2BA 4W4OA 5AWNH 5I15L 3GMOB 1VKXB 5E99H 3QEGL 3ARDA 3OKEB 3V5HA 3HG1E 1UACL 2ADFL 2SEBA 2B2XH 1B4RA 4R2GC 1S5HB 3VI4E 5DURD 4NJAL 1SMAA 3CX2A 5FM5M 5DLML 3L3OA 4ZDHA 1KELL 4GW5A 4M7LL 3V4VL 1FZJA 5C1MB 3KNBB 2AJUL 3EYOA 5CJQH 4S0SD 3VG0H 4NQEE 3D39B 3QXAB 4K23H 4PJ5D 1PG7X 3C2SA 2GAZB 4FHBD 5CP3H 3C8HA 4HBQA 1UEYA 4PJ7A 1MFDL 3A0OA 3EKCA 3MJ7B 1QACA 2ZOKA 1BHGA 4JM2C 3SKOA 4U4BA 3MV9A 4KV5F 4KI5D 3TCXA 5IESH 3EOAA 3RU8H 2XN9A 2PR4H 1D3CA 4YPGB 4W70A 3ULUE 5SWZD 3K8MA 5A2LH 4PRAB 3U7AA 4JFZH 3TVMC 2NR6C 4ZUUB 3IDXH 5EN2B 3B83A 1LK3L 2PYEB 1JPFB 3HC0A 3ARGC 1MY5A 5BV7H 4AT6B 1NJ9A 2H1PH 2IGFH 3D0VA 1QYGL 1VPOH 2R29H 3SOBL 5BJTB 3VD7A 4P2QE 3VFSA 1A02N 5SWQB 1P4BL 4RGOH 2HVKA 2PTVA 4PGBA 4XPAH 3T0BA 2IMMA 3MTRA 3IRZA 1T3FA 5E4IA 5JHDB 5DZLA 2DM3A 3B5HA 3PXJA 3QDHA 1GAFL 4WV1C 3F65A 1F6AB 3I6KB 1I1YA 3WV0A 3MXVL 2UWEE 4R9HA 1G1CA 4GKNA 4BSWB 3TZVC 4GKZA 3EHBD 4QHMB 3OZ9H 1G9ML 3N1MC 1FZMB 5ETUB 3QDJD 4GRLA 1JYVA 1URLA 3UTPE 4TTDD 1VCAA 4O2EA 1RZKH 4ZPVB 1YN7B 5C0EB 1ZA6B 1WQVT 4UT7H 4HMCA 4KROC 3MRLB 5IM7B 3GMNA 5L8JB 3FFDB 5EU4A 4CJ0A 4Z7WB 1QEWA 5IMKB 4QTHB 3WSQL 5HPMB 1YY8A 2B1HH 2GSIB 3VI3F 1F6FB 5J1AB 4W6WB 1BVZA 1DBAL 4HV8A 5CGMA 3REVA 5F9AC 1ETZB 1X4ZA 1Y6KR 3PWPA 4DWHA 4JFFE 1XH3B 2AK1L 4KDWA 2GCYA 4MVBD 3C09B 1ORSB 5HVHB 5JQHC 3D2UD 4OZFA 4O5LH 4KI1A 4NQVA 4Q9RH 4KPHH 4W6YB 4P3DA 3WIHA 1UKSA 2Z91A 1HZHL 1EHLH 4OM1L 1ACYH 2YD6A 4JFXA 2OL3H 3IDIA 4KKNA 1M7IB 3C6LC 4U6YA 4JHZA 3SY0B 4LSRL 2W92A 3QA3A 2A6KA 2ORBL 4PRBA 1FN4A 3HAEH 2Z31D 1FFPA 2J3SA 5IV2A 4YHMH 3GSVB 1R3IL 3GIVB 1A7RH 5HYFA 1DR9A 4KTYA 5D2LB 2EH8H 1A6AB 1W0WB 5E5MB 5B3JF 1BZQK 1DN0A 4HIIB 1OAXH 5GS2H 1E6JH 1YNLH 2BOBB 4I2XA 1WEJL 5T5NF 1IGIL 5EBLA 3CDYA 1RIUH 4XNZB 5ESVA 4JGJA 1TVBA 2VXSL 1KTLB 3SPVB 4G6KL 2D2OA 2RHEA 5BZWA 4N8CL 4XMLL 5KVDL 3JVGC 5CD5C 3TC9A 5F7EL 5HD8C 1RK1B 3S96A 4MGXA 1T66D 4F33B 2DRUA 3GUTB 2VDRL 3O0RH 4JO4H 4KJYB 4G6FB 1CT8A 2JK5A 4Y2DB 2FO1A 2HTKD 3Q2CA 1V7NH 3QRFM 1U8LA 4QT5A 5C0AD 1KCKA 4X99B 4G3YH 1SM3H 4ZO6A 5TDOA 3NABL 4R3SB 5EOQL 5JDSA 5EOCH 4ODUA 1EFXD 1INEL 5EOCJ 1EUUA 4NZDA 1DBJL 1QP1A 1FVEA 2NY6D 5KSAB 3OTTA 5EORL 1LP9E 1NCAL 4PJIA 3TPKA 3BW9B 2QSCL 3BVNA 4MNQD 4X83A 3ZYJA 1S9KC 3L5XL 5BMFL 1TZIB 4U2ZA 1W72L 4RQQB 3MRKB 5BS0E 3BSZH 1KB9J 2EZ0C 4NQCB 5CBAB 5HYJE 5GIRB 1J05A 5DJYB 3VA2C 3DMMB 1E4KC 3NOIA 5DRWB 5MENE 4PJHE 4PRPD 5GGVY 3GZKA 1ZLWH 1FLTX 5EC2B 4PV9A 5D7LB 1GYAA 5DHVH 4MX7B 3P73A 4MD0A 3P9LA 5K9QG 4AEFA 5JO5B 3WN5C 2NTFA 4L4VA 1KJ2B 4EUPH 1FPTL 1GPOL 4JQIL 1IJ9A 4NP4L 3DRTA 4MLSA 4H5SA 2UYLA 4DN4H 1YEDA 2JELH 1T4KA 4X9BA 4L1DA 2FZ3A 3G6AB 1J7VR 1LDPH 3QZWB 2DQJH 4W6XB 2ICWJ 4XZUB 1RK0A 3U4EB 5FB8B 4XBGA 2LFGA 3ZE1F 2LVCA 5ADPH 5EUOF 4MS8D 1A7PL 5KVGH 1MFAH 3D0LA 1T1ZA 1RZGB 3VD9A 5D1ZD 3ESUF 1Q1JL 4BJLA 2WINA 2ZNWA 1JF1A 2PO6D 4Y4FD 1AJ7L 2A73A 4R0LC 4AL8H 1BJ8A 3K2MC 2V7HB 2VN7A 2X70B 2DI7A 3MV01 4JDTH 1RIHL 2AW2A 3RX7A 1QSFD 4XGZB 1HHIB 4EEEA 1XGTB 4NQDE 2E7LA 4LU5L 4LIQL 3W0WB 3V6OC 4QO1A 4NM8H 4PJDB 1DQQB 2DQHH 1WZ1H 2HLAB 4ZNEA 2AQ1A 2B1AL 5C86A 2I5YL 1G7IA 3GMLB 2AK4E 3V5DA 1OAUL 2YD1A 5I1IH 4D9RD 1AIFA 2CLRB 5F97E 4D0DB 2YK1H 2DB8A 4JKPL 2NY7L 3EJJX 3H9YA 5D1QD 4IMLB 1TDQA 5KS9A 3DGGB 4UBDD 1KCVL 1OARH 4PLOB 3HZMB 2MCG1 3I9GL 5CUSL 4K7FA 1A14H 2DDQH 1BBDL 5D7IF 3RHWK 4Y2OA 1MWAB 3C5SA 3HI6H 4P5TD 2Q87A 3ULVF 1UXSB 3GI9L 2XZAL 4PJBB 1WAAE 4ZFOA 2OM5A 1PW3A 2EYRA 1G6RB 3V0WH 1EUTA 2NY1D 1BJ1H 1AXTH 4FQIH 1BBJA 5D2NC 1RU9H 2KH2B 1A9EA 2RCSL 2ZKHH 2GK0A 3MRDB 5ALCH 4PRHD 3O6FB 2CXGA 4BUGA 5I19L 1CICB 3QUZD 1OW0C 4X6DF 5HYQB 3BZ4A 3MRHB 5F7LB 4ESKA 4X6CF 5KSBA 4Z77A 4DZBA 3LKNB 2JCCF 1MI5D 4L3ED 5C0BB 3KHOA 4JZOA 1R3LB 4MNGE 1F42A 2P44B 1J8HA 5KSAC 5EIIB 1HDMA 2ED9A 3RRQA 5BVJB 2CRIA 4YBQC 3RVWC 5KSVB 1QO3A 4NHUA 1ZOXA 3R0MA 4UT6H 3F12B 4KWUA 4UDTB 3JTTA 1I4FB 3TWCL 4RGMC 4X0KB 1N6QH 4IRZH 1M05A 5L2KE 3P0VL 3V6BR 5TH2B 1XCQB 3AS1A 1GOFA 4X5LA 1D5MA 4OZIE 4Z18A 4HPYH 4AIOA 1KN4L 4Z7NE 5F9WB 4YDIL 2VZ3A 4L5FL 2D7OA 2L0DA 3DXAB 1KCUH 2NY3C 2F19H 3IXTB 4O51A 3LIZH 1TTFA 5C07B 3UMTA 5JDJA 4WEBH 3QQ3A 4M1DL 5F3BB 4EI5A 3KYOA 3OHXA 4KRPD 2BCKA 1A1MB 3OJDA 3PNWA 2ESVB 2N56A 2DBJA 5FYKE 3WFBL 4OCMC 4Z7QF 3KPTA 2DM2A 5DQ9B 3P4NB 5L88L 1DBML 3STZA 1RZ7H 4O58L 3U1SH 4TSCL 1Y6NR 1NL0L 2YMXH 1FYHB 2XZZA 4U6XA 3RUGE 1WV7T 4ERSH 3JV6A 4RFEA 3DTXA 2GFBB 2DN7A 3B8SA 4LCUB 1VFUA 5AUMA 4U1SB 4ENEC 1BF2A 4HMEA 3TNMA 3WFCH 3ZTNL 2J6EA 4G8GB 3DSFH 4G9FE 2IBGA 1JHTB 5ENWA 1DQDH 1IL1B 3RNKA 3EYVA 1A3LH 4OLUL 3HR5B 1LHZA 4HWBA 3RWIB 3MRBB 4PJ8C 1TJHH 1WC7B 5I2IA 4GW1B 4QRTA 3UTSE 1B0WA 3MYJA 3QULA 4U49A 1EMTH 4M03A 1INQA 5D7JC 1RUAH 4L29A 3U0PB 4OKVA 4K9EH 5IB2B 4Q97A 3GB7A 4CADA 1QBML 4HBCH 2X1XR 4OLXH 4RISL 4OLWL 3VCLA 4H20H 2WBJB 3TBWB 4JG1H 1T22A 2HRPH 4B0MM 5E9DD 1GGBH 1UFUA 2OJZH 3PV7A 4H1LA 5C0ND 2KZ1B 12E8L 2R9HC 3GHBL 1JNHA 3NCMA 2CD0A 1CF8L 2JB5L 4NO0D 4YC2C 2DIJA 1MPAL 1QRND 2XZCL 1GZQA 2F53B 2FR4B 5EBWA 3O6FC 1RJLB 3PL6C 5AG8A 1AQDB 5A40E 1ED3B 4WGVB 2O93L 4CMMA 1NAMB 1CICC 5E2TL 5SWZA 3LQAH 5C0GA 3X3GL 3SGDI 5K9KA 3SCMD 1MCOL 1XGQA 5I15H 4R96B 3AY4C 3AREB 3OR7B 3QEGH 2OL3A 1VFMA 4Y5XA 3BH9A 2YPKB 1QSEE 1UACH 1UH2A 2ADFH 2DM4A 1TJIL 3L1OL 3O2DL 4KQ4L 2NMSA 5HTSA 4GQ9L 4NJAH 4QHKI 2QQKL 3S37X 2GHWB 4JN2B 4LPYA 3HAEA 2A83A 5DLMH 2X1WL 3W81A 1AHWA 3NFSL 2A6DA 2ITDB 1W0VA 3X13B 5KZCB 3M17B 2DI9A 1HSAB 3PHQA 4M7LH 3V4VH 4RWYL 2AJUH 4N0FB 2W0KA 3B4NA 3P2TA 3B9KC 1OVZA 3TYFB 5EO9B 4NKDB 3H9SE 1AGDB 5IJVB 3O2WL 3VXTB 1MFDH 4LHUD 1E27B 1S7SB 1VACB 2CDFA 5IMOB 3QDJA 5GRYA 1JV5A 2EDXA 5ICXB 4QRSA 4XBPB 4KTEL 1UZ8A 5HHNA 1QFUL 4GAYB 3BT2L 1K9TA 5HVWA 4IRSD 1H3TA 3MGAA 4APQB 5ANMB 3MROA 5HDBF 3R0NA 3QAZB 3FT3A 1QFWM 1J1XL 4NIKB 1Q0YL 5GGSY 4QRPE 4RMVA 2VUOA 1JZ2A 2NZ9D 1LK3H 5GS0L 5E95B 5IR1B 5I16A 4LK4A 4P4KC 1TLKA 4L3AA 5FM4A 1QYGH 2NX5B 2P7TA 4LCYB 5DEGB 3PUCA 3V79C 3SOBH 1HE7A 4MQTB 1P4BH 2H3NB 5C0CD 3D2UA 1HKFA 2IF7A 2AEIT 1WBYB 5FYJE 2VDLL 1MCQA 3HS0A 2Q7YA 3I02B 1P69B 1JHLL 2HN7A 4NO3A 3D48R 1YA5A 1GAFH 3VXME 3PWUA 3FTGB 3MXVH 3ZKXC 2UUDH 1DP0A 3IS1X 3O81A 4J4PC 3BGFB 2VDOL 1G9MH 1P7QD 2Z31A 5IW6A 3QEQB 2O61A 4YFDB 3FB7A 5B4MD 4XRCB 4LRIA 3VXRE 3TBYB 1UXWB 5J11B 2PNDA 1MEXL 2XACC 3G6JA 4DKAA 3H2WA 3MZGB 3DSNA 5IMLB 1CFNA 4JFDB 1JL8A 4G8EB 4U1JB 2JJSA 2R15A 4EUPA 1U8IA 4P3WA 1NAKL 4KVCL 1XGYL 4LOUD 3V8OA 3ZT7A 3GMRB 1ZLUH 2ICWA 1QG3A 2OS7A 4Q74A 1BQHB 1CXEA 1I9EA 2AK1H 3EOBA 4PBVC 5ADOL 1T7WA 2MSPA 3BZFA 3FQRB 3LRGA 1BX2B 3ZSSA 4KZDL 5ACLA 1FZKA 2QSTA 3C8DA 1C08A 1HZHH 4OM1H 1PZ5B 3D39E 4LVOB 3DV4A 3V2AR 3T0EA 2I9TB 4I18A 4WNQA 1RPQA 1ZHNA 5DEZA 3RPIB 3K46A 4HC1L 4LSRH 4XX1G 3LKOA 3W39B 4IM8A 4M7ZB 2ORBH 4OIAA 5EZLA 3AREC 3NFPA 4IOIB 1JIBA 4UT9L 1ND0B 3HZVA 1R3IH 4OGXL 4MNQA 3TV3L 3G5ZA 3UTTD 4JE4B 5J4MA 1ZA3B 3BQUC 1U91B 4L1HA 5T1DL 1Q9LA 5EO0A 5B39B 1F8TL 4EQ3A 3HZYA 1WEJH 2PYEE 1JPSL 1CL7L 5KSUA 1IGIH 5JIPA 5GS1A 4PRPA 1HYSC 2AJZB 4WGWB 3B6SA 2VXSH 4I0KA 2G60L 4G6KH 1U8OA 2J8HA 1BMGA 4N8CH 4XMLH 5F7DB 5HBBA 5KVDH 3HNTL 4EI6B 1MCWW 2PYFA 1CD1A 1YJDC 3QXTA 5JHDE 2V2XA 2VDRH 5HYSB 1P5UA 4NWUL 3SGKA 3ZDXF 3ILPA 4MDJB 4PJIF 3W5NA 3AC0A 4JZJC 3BZEB 4QGYA 3RZCC 3QIUA 1J12A 2NY2C 4PG9B 1OP3H 3P9MB 4WUUD 1G7PA 3NABH 5EOQH 1A1NB 3CVHA 4PGCA 3WFEL 1INEH 4BH7B 3TGXA 4OZGA 3ROLA 1XEDA 3BX7C 2DMCA 1DBJH 2OJEB 3FB6A 2ZUTA 5EORH 1NCAH 2R1WB 2W9DL 3ZYZA 1BOGA 2IQ9L 2QSCH 1CFSA 1KIPB 5IBLD 2CDGA 1YMHA 2P42B 3E1F1 3L5XH 5BMFH 1VGEL 4Z7WE 2XTJD 4Y4FA 2PO6A 2QV2A 1W72H 4GKOA 5FM5O 1PY4A 1CFTA 3DYOA 4MD4B 2GT9A 2BVTA 1QSFA 3EYFA 1WJ3A 4NCC2 1DUZB 4QRRD 1H3PL 4MWFB 4P46B 4EVNA 3RKDC 4YXKL 3PDGA 2DLIA 3CJJA 4R26L 2ZJSL 5GISL 1YC7A 1VA9A 5EUOB 1I8KB 3EW3B 4Q0XL 1FPTH 1GPOH 4JQIH 4K7PL 4NP4H 4Q9QL 5GZOC 1X3DA 5J11C 1UZ6E 3ZHDA 4CMHC 5IF0A 4M1GL 5D1QA 1MCNA 4GBXD 2L4OA 1J1OL 2NY0B 2YXFA 1XF5A 4PTUA 3VH8G 3FKUS 1NC4B 1JI2A 2AJ3A 4NZRH 5GS3A 5E2WL 1PKOA 2I9LA 1QFWI 3V52L 4J7RA 3IU4L 1A6WL 4K94C 5D2LE 2DLHA 3O41A 5DJ0A 1Q1JH 1OL0A 3CH1B 2EDLA 4BKLB 1I3RB 2OQJA 1AJ7H 5F71A 1JNLL 4XH2A 2ADIB 1XIWB 2DQUL 2KL6A 2N7AA 3H7BB 4KKBD 3EO0B 4IHOA 2E5EA 4NKOB 1RIHH 4NOFA 5MERA 4J2XA 3MRGA 4LU5H 4LIQH 4UOJA 3QUZA 1PZUB 3KLAA 2W0PA 3CX5K 3NH7L 4MDIB 2BDNL 4HG4J 2Q8BL 3NMEA 2VWEE 1MI5A 4MXVE 3FB5B 4M7ZC 3UYOD 2I5YH 3OKMB 4FQJL 1LE9B 5FO8B 1OAUH 2MNUA 4XNUL 4DQOL 1N59A 2IBBA 3MGTA 3BWAA 2NY7H 1S7RA 2VKWA 5F7MC 3WNOA 2H6PA 3CD4A 2EIBA 1I8MA 3WEXA 4TUOB 3UROR 4IRJD 1KCVH 3NIFE 4Z7VA 1LO3L 3I9GH 4OUUA 3VFOA 1BBDH 1OWRM 4ELKA 5IB4B 4X6CB 2FLRT 3GI9H 1RZJC 2JCCB 2XT1B 2XZAH 3S97C 1K4CA 2YD8A 3RGVB 2ERJC 4X9IA 5F7UA 5KSBF 4NQCE 5I17B 4X6EA 3S3JA 3BP6B 1MHHB 1T1YA 2RCSH 3KR3H 3ALPA 1LMKA 3QEHA 3MGOA 4MCYB 5I19H 3RVUC 1A8JH 1PY9A 5D7LE 4LKXB 4L4TB 2VQ1B 3MLVL 2QR0A 2YPLB 4C55A 1DFBL 3L3DA 5F44A 3X17A 5T1MA 1A6UL 1MFCL 2ADJA 4LVNC 1AKJD 3I6GA 2F54B 3IJHA 3GMMA 5C2UB 4WO4D 4RMUA 5D9SB 4S1QL 3CFDA 3E2HB 3TWCH 1V3JA 4OCYL 3CFKA 2DS4A 2AXGB 1B88A 3B3IB 3P0VH 4YHKL 3RWJB 3RTQB 5E8EA 3MOAH 3VXSD 3OX8B 4U6HB 2IH3B 4MA3A 3RDTB 2WAHA 3TIDB 2DAVA 2CO7B 4A6YA 4NZTL 3G9VA 1KN4H 4YDIH 3CSYB 1P7KB 3IFOA 3MMEA 3W0WE 4XP4L 4X9GA 4PJDE 1EEYA 1AXIB 4RRPA 2MTPA 4M1DH 4P2OD 4F58L 5L2JB 1IAIM 4S2SB 4QHUB 5F7FA 3MRMA 5ESAA 3DX9A 1IM9B 32C2A 5JZ7C 5E9DA 3WFBH 5K9JH 3U9UA 2FWOB 5FCUL 3H6JA 3Q5TA 5DT1L 5ID0A 4HUVB 2DOCA 5L88H 1JNNL 1DBMH 1R3HA 1OLLA 1X5IA 4HS8L 4IMKC 4O58H 4TSCH 4Y5VA 4ZS7L 4AYFA 1MVUB 3QCVL 2PXYD 1QRNA 1HI6B 2YWYA 2KBGA 3BUYB 3L9RB 4JB9L 5AAMA 2H32H 4PJBE 2VR5A 3LD8B 3ZTNH 3Q6FA 3S3PA 3TFKC 3DNKA 2YSSB 4QKXB 5GZND 3DX8A 4JREC 4OLUH 2HH0L 5DR5L 1KCLA 1IAKA 2KQNA 2C1OA 1A3RL 5BQ7A 1S9XA 5H2BB 4H8WC 2A74A 4NQEA 3ARDB 1QBMH 5ITFA 5C0BE 4RISH 4OLWH 4YHZL 2SEBB 2YA2A 3STBA 4Z7UA 1I7TB 4KI5F 1U3HA 3L95B 4F7MB 4XP5H 5F6HI 3G04B 4ZDHB 3LSOB 3I50L 3RGVC 12E8H 3GHBH 4V2CB 1MFEL 1FZJB 1CF8H 1WCBA 2E8ZA 4JRXD 4LHUA 2JB5H 4Y19D 4UI2A 2D3VA 2G2RB 5I71C 3OR6A 2GUOA 1FNFA 4FXGA 1MPAH 2NY5L 5I1EH 1KJMB 1U2CA 4WU5B 4CJ1A 3BRFA 5DMKA 4JM2D 2IFFH 4PJ7B 4IRSA 4M9OA 4P2RD 1PVHA 5E2TH 3JTSA 2KZWA 4I0PA 4I77L 4PLKC 2AV1A 1FFNA 1A4JB 3X3GH 5K9OA 2ARJB 2BNRD 2XN9B 4P2QA 4TUJA 3ZDZF 1I7ZB 1MCOH 4LLUA 2DMKA 3BPOB 3TVMD 2NR6D 4EIGB 1I8IB 3DXAE 5T3XD 4Q6YA 2VDNL 2RQ8A 4GAGL 1TJIH 2RFXA 3ARGD 2APFA 3FN9A 3L1OH 3IXAB 3O2DH 4KQ4H 4IDJL 4GQ9H 4G8FB 4OGZA 2QQKH 2R56L 2UWEA 3HC0B 3E2HC 4C54A 1WITA 2QADB 3HA0A 3HCVA 1AXSA 2ESVE 3D0VB 3WHE0 2WIIB 1M6OB 3OAUL 3IF1B 3VGEA 1AO7D 2JB6A 1NMBL 3O8XC 2HVKB 1T5XB 1T89A 3BGMA 3O2WH 2VC2L 3KGRA 1T3FB 2YUVA 4ZTOL 3H8NA 4JY4A 4EZMA 4BSVA 1DSFL 1P7QA 4YGAB 4EOWL 3QISA 3TZVD 2PUQT 1I1YB 1TQCB 1MQKL 3QUYB 4KTEH 4EN3B 1N5AA 1QFUH 4GKNB 3UZVB 1MCDA 4FFWD 4L8DA 4RDQG 3BT2H 3ARPA 3LHPL 4G8GE 5JW4N 3LDBC 2R2HB 3F7YA 3VMPA 4GRLB 1T03L 2CPCA 4O2EB 3A6CL 3OF6D 4H0GA 4AJ0A 1HHGA 1J1XH 1Q0YH 2K1MA 2EYTA 4YEFA 1VERA 3OKLA 5EU4B 1M7DA 4FQLL 2R23B 1QEWB 3ECBA 3BMVA 1FG2B 1MIML 2P47B 1MCEA 5H8DA 2VKXA 1FNGB 3QJHA 1RMFL 5FUCE 4HV8B 1VFBA 4PJXA 4HJJL 5ISZB 3QYCA 3REVB 5DQJA 2VDLH 2X4RB 4M7LT 3P9WB 1BWMA 3PWPB 2YWZA 4WTWA 2YRLA 1JHLH 4AEHL 1C1EL 3MV11 1IQDB 4X4MA 3LD8C 2FX8L 1HNFA 1QLRA 4OZFB 4JQXC 4U1NA 4NKQB 3G6JF 1U8MA 4MXQC 2NPLX 2ZSWA 1CN4A 2D7QA 4L8SA 2LU7A 5ITBL 3C6LD 2VDOH 2Z91B 5D1XC 3TA3A 2F53E 1FL6A 3IDIB 2IADA 1T21A 4JFOA 1N0LA 4D0CA 2V6HA 4KJQC 1CDBA 2A6KB 1B6UA 3UTTA 3ARFC 3G08A 4NWTL 1GJIA 1FN4B 5IV2B 1G9EA 1MEXH 1AR2A 1UA6L 4NO2B 1KC5L 2XKSA 4X4YA 3I84A 1ZT4B 4CGTA 2K3TA 1J8KA 1IAII 1NCTA 1UH4A 3KPMA 3SKMA 5CD3B 3U46A 1I85C 4I9WD 3VFTA 1NAKH 4KVCH 3TO4C 1S7XA 3KDMA 5MEOA 3NIDF 5C71A 1ZHLA 3T77A 2VAAB 2VXVH 4WU7B 4LSQL 5CEYA 3MXWL 1C7SA 3P3YA 2FGZA 3NFNA 4GG8A 5ADOH 5ESVB 3KS0H 2DLTA 1YQVL 4KZDH 4WRLA 5HD8D 3STLB 3GSNL 5DFVC 5BZWB 1HEZB 1TQBB 3BH8B 3S96B 2HJFA 4N9OB 5LAXA 1EJOL 4L8CA 5EU6D 4HC1H 2W59A 1IGCL 1CT8B 2JK5B 1MFBL 3ETBF 3K1DA 3MBEC 2FHFA 1FYTD 1WBXA 3QIWD 3ZE0F 4C56D 4UT9H 4Q9CA 3BPOC 3MODL 4JAMA 4LHQB 4MYWB 5HYJA 3FB8B 4D9QE 4OGXH 4K3HA 5JDSB 3LKPB 4HKJA 4ODUB 3D25A 5GGUA 5HGGS 3VDCA 1CXIA 2N4IA 5MENA 5ANME 1FVEB 4LCCC 1G7MA 5T1DH 1JGDB 1F3JB 4RGNB 3FO0L 1F8TH 4C57C 3BVNB 2EZ0D 1JPSH 1XCTA 1CL7H 4BYHA 2ICWI 3X12A 4QRRA 3N1FC 4I4WB 2VTFA 3F58L 4ZO7A 5KVMC 2VSCA 3O9WC 2G60H 3GJFH 3CFBB 4N0UA 1BVKA 1J05B 1U2HA 4HS3A 2BVYA 1NEZA 5I8CA 7FABL 1X44A 4MA7L 4OZGF 2QBWA 4IIQA 4PV9B 4WEUD 3T4YA 4NWUH 1WIUA 2MMXA 5E6IC 1P6FA 1G7QB 5T5NG 1AD9A 3LEVL 1FG9C 1L0XA 2BRRL 4MNHA 1O7VA 3AUVA 5CJXC 3QI9B 4QXTB 4G6JL 3QEQE 3BOVA 3QIBB 4OF6A 4TVPL 2ADGB 2CLVB 4H5SB 2UYLB 3CDCA 2P45B 4NRXA 1T4KB 3QBTB 4PUBL 2FZ3B 4YHPB 3VGDA 2W9DH 1A7OL 4MLIA 3MJ9L 5A2FA 4N9GA 3PXHA 4ODWA 3SDDA 4NQTA 1KG0B 5IWLC 4I48A 1VGEH 4JFDE 5FOJA 3DO7A 1DLHA 2A9ML 1IAOB 4U3HA 3F62A 1FBIL 1QUNA 1BGXL 5IB3A 4MA1B 3PWVA 3T09A 3HE7C 2WINB 1H3PH 4U0QB 3MQIA 1BFVL 2APXA 2VLRD 2A73B 1OB1A 5C92A 2HFEB 2YHGA 4YXKH 4R26H 2ZJSH 4MJ5A 1JPGA 5GISH 3TT1L 1OPGL 5IHLB 4CBPA 4F7PA 2L7JA 4QOKB 4ETYA 4Q0XH 5JW4R 3QCUL 1NC2D 1CFQA 2VN4A 3LKRA 4K7PH 1IM3A 4Q9QH 4NT6B 1G7IB 2AQ2A 4N8VA 4PGZA 4M1GH 2DYPB 1C16A 4GS7C 4BZ1L 1J1OH 4IRJA 4HX1B 1AIFB 2R2CA 4EXPX 4WFEE 5E2WH 3JUYA 1JCKA 5F93C 3V52H 3IU4H 1A6WH 2HKFL 5B8CB 5KS9B 2VLME 5DD1L 1E4XI 4K7FB 7CGTA 3QSKB 3D69A 5EUKA 3PABA 5EU7C 3C5SB 1JNLH 4TRPL 5B22A 1IRAY 3MRJA 2WLZA 4ZFOB 2YS4A 5JPNA 3MV7D 2ZUVA 3FFCD 2LTQB 1BBJB 2NCMA 1JK8A 3EDKA 3NH7H 1MLBA 2BDNH 5TF0A 3ZKSD 4K94L 2Q8BH 1MQ8A 1IGTA 1PYWA 3W9EA 2NXYC 3V6FA 1T2XA 2IPUG 4NN5B 4Z7VF 1CD0A 3HTLX 4FQJH 5HGDA 3HE6B 2YUZA 4XNUH 3F8UB 3BZ4B 4DQOH 4Z77B 3KYKL 4WO4A 4DZBB 3VWJB 3MLYL 4FMKA 1HH9B 4JZOB 2FH6A 3LS5L 4YBQD 3RVWD 1CLOL 2X5PA 4RGNC 5I76A 1R5VB 4LPXA 3KPSD 4NFBA 1T83C 5D7SL 2HLFD 4XC3L 3FAXA 3L3KA 4M3KB 1LO3H 4M93C 4U1HB 3RWFA 1QO3B 2VABA 5DQDL 1XR8A 1K6QL 3QQ9D 2HT3C 1G7LA 1T0PB 4FQ1L 3VXSA 3EFDL 4NNYB 4HFWA 3QNXA 1L4IA 5CCKL 4WFFD 1AC0A 3TO2A 5I30L 2YKLL 4F2MB 2NY4B 1D5MB 4UV4L 4Y16C 4PGJA 3ZL4L 3SDAB 3MLVH 4Z78A 3ZE1E 4I13B 1DFBH 2NY3D 3QI9C 4CVUA 1GXEA 5EUOE 2JJTC 3IB4A 1A6ZA 1D5ZA 1RZJL 2NYYC 4NJ9L 4ZXBA 5JLZA 1I7RA 1MCLA 1NLDL 1A6UH 3RUGA 1MFCH 3MA7A 4ISVA 5CEZL 3B9DA 4O51B 1N8ZA 2C3XA 4UAOB 4XCYB 3P4LA 2VXTL 3ZKQD 4OSUL 1KCRL 3OHXB 1OAZL 2BCKB 5IQ9B 1OHQA 2KUTA 3OJDB 3PDDA 3PNWB 4UTAL 4S1QH 2YZ8A 3OQ3B 4G9FA 4LPCA 5DRNB 3NZ8A 5J9PA 1T7ZA 2XTLA 4OCYH 3ZE2F 4P57A 3T08A 2PCPB 4RMRA 5TGBA 3STZB 1OGAD 4YHKH 2I27N 1OAKL 2OYPA 2VL5A 4OTXL 3UZEA 3DTXB 5BV7B 3LV3A 3UTOA 5BXFA 4NZTH 4FNLL 2GTZB 1YNKL 1MCFA 2HG5B 5TE7L 4XP4H 5ENWB 4PJ8D 1F90L 5JXEC 2DICA 1TFHA 3RNKB 3EYVB 1WGOA 3EJZC 1QBLL 5D7JD 1ZWIB 3QWOA 2XKNA 5DJDA 4F58H 5I2IB 3SO3C 4QRTB 1A2YA 3QULB 4NO5B 5IVZA 1JI1A 3HPJB 5TPWL 3SJVE 5DURB 2MKWA 3QXDA 4HGWB 4L29B 4LAQL 5FCUH 4CADB 5DT1H 2J12B 1UC6A 3BO8A 4YDLB 1JNNH 2D9QB 3MRFA 4FQQB 4HS8H 1T22B 4JRXA 3VI4F 1HHJB 4Y19A 4ZS7H 2R9HD 1DVFC 4KKLC 3QCVH 4H1LB 4PJ5B 1UADC 2ZZUT 3Q0HA 1KN2L 4X6DE 2FSEA 1JNHB 1AI1L 1PBYA 4X6CE 1NGWB 1Q72L 4P2RA 4JB9H 4UDUB 2JCCE 3WJLC 3O6FD 1HNGA 3PL6D 3GGWA 4WCYL 2LTQC 4LFHG 4RFOL 1QSEA 1GZQB 4EIZC 5EBWB 4JANA 1I1CA 4NN5C 4CMMB 4Z7UF 3KG5A 3HE6C 5C0RL 2HH0H 5SWZB 5DR5H 1TPXC 3ZT5A 1X6LA 2X9WA 5C0GB 4L4TE 1A3RH 3ARGA 3MCKA 3FO1A 3VWJC 5K9KB 3CXHJ 2YPLE 3TJHC 1XGQB 2CRZA 3KXFD 1KGCD 4PB9L 5FYKL 3H9SA 3ULUF 4HIJB 1VB9A 3EOYG 4ZOBA 2OL3B 3BH9B 3CAFA 4UZGA 1G9NL 4YHZH 5D96C 3V7MA 2F54E 1FCGA 1AO7A 1NGQL 2IPKA 3PE9A 3VGFA 4LVHB 3HAEB 4FG6D 2A83B 1AHWB 3UTZB 3SE8L 2A6DB 1W0VB 3B9KD 3I50H 3SDYL 1MFEH 4LP5A 3RIAF 4DZ8A 1C12B 1H15B 3TZVA 3RNQA 3BE1L 2NY5H 4I3SL 2NY4C 4HMDA 3SE9L 1YEJL 3WFZA 3SDAC 4JPIA 5HDOA 3QDJB 5IG7B 3F5WA 4I77H 4HUUA 2X09A 2UWEF 4QRSB 2P24B 1UZ8B 1QR1A 5HHNB 3UPRB 4ODVH 4EKXA 3TH2T 4KK5D 2FJHA 4XTRC 1JYNA 3PJSA 5GRUL 4EJ1C 2GYSA 3MROB 1CVSC 2VDNH 4WVRA 4HC1A 3V4PL 5IB5B 3TJEL 2VE6A 3K4ZA 4IDJH 4P4KD 3O4LD 1T2QH 2R56H 1RSFA 3T4AB 5I16B 1RY7B 1IC1A 3OAUH 1EK3A 4LEOA 5CAYB 1XGPB 4KUCD 1NMBH 5I1CL 3D2UB 2V9TA 2WLYA 3WDIA 4ZTOH 5BV7C 1UVQA 3HS0B 3C6LA 3GJEA 2Q7YB 1DSFH 1RURL 5DGRA 4NO3B 1P4LB 4P48A 4EOWH 1MAML 4J4PD 4OCXL 3KPPA 3PWUB 1MQKH 3GMOA 4OLEA 1ZT7B 3LHPH 4YEEA 1ZXQA 2Z31B 5IW6B 4YHOL 2O61B 4HIXL 1S5HA 4M1CD 4NBXB 1T03H 2GQHA 1QOKA 3ABZA 3AVEA 3FB7B 3A6CH 3QT2A 4GQPH 3QP3A 1S5IL 5C09D 5DHVB 2VJXA 4HAGA 1AGBB 2FECL 4WTXA 3RWGA 5HGAA 3SDCC 3G6JB 4FQLH 1H3GA 1VHPA 3KNBA 1CFNB 5EOTA 3VGAB 4N0CC 4YDLC 4EUPB 3BEWB 1YEGH 1MIMH 3D39A 4F37F 1U8IB 3MFFA 3BPCA 1NGXB 4NBZB 2GAZA 1RMFH 3JVGA 4HJJH 4YWGL 2FEEL 2ICWB 4LDOB 1EO8L 2R0KL 5MEQA 4HPOL 2AXJA 4OFPA 4AEHH 1C1EH 3ME0A 3CH8A 2FX8H 5DC4B 3RL2B 1MREL 3BZFB 5EU6A 5ITBH 4LLYB 3TNNB 4MJ2A 4E9LA 1FORL 1FYTA 2QHRL 3CDGB 4C56A 3BRDA 5C0AB 5DS8B 5EC1A 2VDPL 1XF3B 2PN5A 3D87B 2V5TA 4Y1AD 4PJ7E 4ZUUA 5EN2A 4JJ5A 1MCBA 2PYEA 3BESR 1EFXB 1JPFA 3LKOB 1OP5H 2YRPA 5AYQA 4JCLA 4AT6A 2I07A 2NY6B 1UA6H 3JSSA 1KC5H 5BJTA 3CIQA 2XN9E 9CGTA 4LQFL 3BQUD 4MNQB 4KJPD 1T04A 4KVNL 4XWGL 4KXZH 5JHDA 1HHHB 4JJHA 1Q9LB 1LP9F 1E4KA 3DO3A 5FYJL 4JPWL 1U8NB 1F6AA 3I6KA 1HYSD 4LSQH 2JLLA 3RJDA 3MXWH 1UYWL 3P0GB 4TVPD 3KLDA 3MR9B 5GS1B 4NN6B 4BSWA 4PRPB 2DQDL 1EPFA 4QHMA 3B6SB 1YQVH 4PJAA 2X41A 5ETUA 1U8OB 3GSNH 2HFFB 3QQ4A 4OF8A 3PP4L 2FO4B 3ALXA 4JKWA 2X4TB 3D18A 2PYFB 5I1AB 1CD1B 1EJOH 3SQBA 3RZCD 2OTWB 2V2XB 3NPSB 3MRLA 4PJGB 1MHPL 4ONHA 2UY6A 1IGCH 2NY2D 1I3UA 3ILPB 1MFBH 5IMKA 1DDHB 4QTHA 1RVFH 3MRCB 4DVBA 4P23C 4YAQB 5FHBL 3BD5A 3MODH 5J1AA 4R97B 4ZS6D 4J3SA 4K2UL 4YJZL 4BZ2L 5HGHA 4PGCB 5DSCA 1F4XL 1E28A 1AD0B 3ROLB 4XVTL 2NX5D 3FB6B 1PGRB 2XPGB 4HLZG 1R24B 3FO0H 4OI7A 1BOGB 5E4EC 1CFSB 5D1ZB 2CDGB 4R0LA 3NGBC 2HT2C 1IILE 4MVBC 4Y4FB 4XXCC 1NCWL 3F58H 2VLRA 4WI4A 1CFTB 3V6OA 2GT9B 1QSFB 3RKDD 3EYFB 3L6FB 5ISZE 4PB0L 7FABH 2FCBA 3Q5YA 4K8RL 4MA7H 1QHPA 3CC5B 3FT4A 4LSVL 4EVNB 3PWPE 2YD7A 4PJEA 4PJFB 1NC2A 2J7LA 5DRXB 2VXQH 2BVPB 1QD0A 2NZIA 4XNQB 5JOPE 1NCCL 3LEVH 2BRRH 5GZOD 1SYVA 1NDGB 1A6AA 1BEYL 1IAMA 5E5MA 4G6JH 2NLJA 4TVPH 3D85D 4PUBH 5D1QB 5AG9A 1A7OH 1J0JA 4OQTL 3MJ9H 3NCCB 1LEGB 5I6XB 1XF5B 2EIDA 4PTUB 3WDHA 2AABL 1F00I 3SGEH 1VFOA 1TJGL 3SPVA 2AJ3B 4S1RL 2I9LB 3O6ML 5CGTA 4P5TB 5J1SC 5E24E 2A9MH 3VU2A 1FBIH 1T5WB 2ZUWA 1BGXH 1JPST 3ARBC 3GUTA 3AB0B 5D2NA 5DJ0B 4DK6A 1RULL 1T1WA 1Q9KB 2NY1B 3MV7A 4XCEB 2X4NA 1BFVH 2OQJB 2RJMA 4LP4A 4XH2B 5MP6L 1K5NB 5SX4I 1OW0A 4IHOB 4PRHB 4X99A 2APTA 5MERB 1WAAF 3TT1H 1OPGH 1ZV5A 4R3SA 3RPKA 2EYSA 3QUZB 4IOFC 1HILB 1F4HA 3KJ4B 3KLAB 4U0RB 3QCUH 5GRWA 5KSAA 5ESQA 5FA4B 4F7EB 4J12A 1MI5B 4L3EB 1QTYT 3O3EA 3EO9L 4BZ1H 4HKZB 3KPSA 2FL5B 1N59B 1TMCB 3MREB 4NQCA 5SX5K 3MGTB 1T20A 1S7RB 5GIRA 1FP5A 4OAWA 4F7TA 1I8MB 4DGIL 2HKFH 3GM8A 3WEXB 3PV6B 5DRWA 3VGGA 5DD1H 4Z7VB 4XCCH 5D7LA 3VFOB 4RGNE 4WWKD 2E3VA 4ELKB 4BK4A 4MX7A 4NRYB 5CEZD 5B38G 4TRPH 4BQBA 5M95B 3VJ6A 1K4CB 4QXGL 1J86A 1NUNB 4HKBA 2WK2A 3SKUD 3NPZB 3RVUD 5C0JB 2XA8L 2EO1A 4K94H 1U93A 3QEHB 5D6CB 2W91A 4BSJA 1PKQB 3QZWA 4WHTA 4XBEL 4XZUA 3BJ91 3U4EA 4Z7NF 3L3DB 1DN2A 2XZQH 1A7NL 1ZKAA 3KYKH 1MY7A 3GBML 3MLYH 2ED7A 4F15C 2Z93A 2CKNA 5L8KB 3LS5H 3GNML 1CLOH 5D7SH 5D1ZC 1FJ1A 2V7HA 4X7DC 5DQDH 1C5BL 1K6QH 3C2AL 4YO0B 1HQ4B 1XGTA 4FQ1H 3EFDH 1JFQH 5MEPA 3T1WA 1RI8A 2OZ4A 3VFUA 5CCKH 1JZ3A 1QSVA 4OFKA 2HLAA 4L4JA 3RUGF 5I30H 2YKLH 3SQOL 4HWUA 2QSQA 1SBBA 4UV4H 4DOHB 4PJ8A 4MA3B 3ZL4H 4A2LA 4D0DA 1DQTA 3VRLE 5GPRA 5D7JA 4ELMB 5FGBA 1TZGL 3MOQA 1S3KL 3MJ8A 1RZJH 3IFOB 4MD5B 4NJ9H 1IGFL 4QOKE 5CEZH 3ARXA 5KANI 4WHYH 3K2UL 4KY1L 2VXTH 4PRNA 4NRZB 3SE4A 4OSUH 1KCRH 3MA9L 4ZUWA 1OAZH 4MQSB 2E27L 5ESAB 4UTAH 1UB6A 32C2B 3V5KA 4P5KA 2NNAA 5E9DB 3BZDA 4P5TC 4QRUB 1T0NA 2YN5A 3U9UB 1G6RA 1AC6A 3PGFL 3SBWC 1JZ8A 2UZXB 3AB0C 3MRDA 1R3HB 1ZEAL 4NO0B 4QF1A 5KS9E 3O6FA 1OAKH 4GW4A 2E6PA 1UENA 5CHNA 4OTXH 1CICA 1UEMA 5HYQA 3MACL 5T3ZE 3MRHA 2WUCL 1T0MB 3LCYA 4OJFL 3LKNA 3TH4T 3TFKD 3MUHL 3PDOA 4FNLH 5HHMD 2P8MB 1CBVL 5C0BA 1QFHA 2W38A 1YNKH 5TE7H 3AY4A 4V1DD 1F90H 1LVEA 2FD6L 3T65B 3SCMB 1KJ2L 2Y36L 3AFLA 3LN9A 5BVJA 2L7UA 2X6MA 2PETA 1CR9L 5KSVA 3OB0K 3VGBA 1QBLH 1MHCB 5F7WC 4X5WB 4WFHD 3ARZA 1Z0MA 1I4FA 2VLJD 5TPWH 1S9XB 4X0KA 1CVRA 2A74B 1BFOA 4LAQH 1V8HA 4M6NH 3B9KA 3U0TA 4Z7UB 5TH2A 1XCQA 4M61A 3UBXG 4XVUD 4MAUL 3ULVC 1YQ2A 5C0FA 1KN2H 2EDTA 3IKKA 1AI1H 1A6PA 4X7SL 1Q72H 4KMQA 2BSRB 4LHUB 3T1FB 5K59E 3OR6B 2GUOB 1OWWA 4FXGB 4TNWF 4FQXD 4RFOH 4WCYH 1NFIB 3CDFA 5DMKB 5F3BA 4NFCA 4PLKD 4IRSB 5F21B 1A1MA 1B9ZA 4X7EC 5C0RH 1CDGA 1WIPA 2AV1B 3IFPB 1FFNB 1UG9A 2DQGL 2J5LC 3E3QC 5CJ8A 4XB7A 5K9OB 2COQA 2W9EL 5DQ9A 4ETQA 1NGPL 3O3BA 2GJZB 4HT1L 1MUJB 1NUGA 4PB9H 5FYKH 2YBRA 5K93A 1RZ8A 4P9HL 3LQAC 2BXZA 2FDBP 2P8PA 1WBZA 3DUSA 2RFXB 3LRSB 1NGQH 1N2RA 4UTBL 4ZAKC 1RJCA 5C0CB 5DF0A 4LCUA 3O8XD 3SE8H 2ITCA 3QJFB 3HCVB 1AXSB 3SDYH 3HPLB 1ZE3C 4G8GA 3CZJA 1IGML 3D3VD 2JB6B 3QDAA 1JHTA 4J4PA 1RUKL 4I3SH 3BGMB 3SE9H 1YEJH 3MRBA 4JDVB 4JY4B 4XAKE 4GW1A 5C3LD 1P7QB 1BF8A 2FX7L 1GGYA 2IH1B 3MLXL 5IB2A 5C09A 1N5AB 2OSLA 3JWOC 3KYMB 4CDGC 1IM9D 2HTLC 2VAJA 4UNVA 3EYUL 5GRUH 1EHXA 4B50A 1T7VA 2BSED 3V4PH 3TJEH 1HHGB 1EEZA 2XNAA 2EYTB 3OKLB 4ODSH 1M7DB 3FO9A 3VFPB 3VDAA 2ZCHL 5HI4C 3B2VL 3SEPA 3QJHB 2JTDA 1CE1L 5I1CH 1VFBB 1WUNT 3PWLA 4PJXB 3UDWC 4NC1C 5DQJB 2D4FA 5IP4A 1Z2KA 3O11A 1RURH 4PJ5E 3LMJL 4MXQD 1MAMH 4RNRA 4OCXH 3BN3B 1QLRB 5D1XD 4Y1AA 1T1XA 4U1NB 1W72B 2ZG1A 3QUML 4R96A 3AREA 3LOWA 1U8MB 3EIFA 3OR7A 3BEVB 4L8SB 1NGZA 5EU5A 1V7ML 3SCMC 2ZOLA 2GJJA 1U58B 1FL6B 4KI5E 4YHOH 1D6VL 4HIXH 1H0DB 4KJQD 3ARFD 1T21B 3W82A 4JFOB 1BQUA 3BQUA 1S5IH 4JN2A 1MIEL 2HWZL 3I75B 3WLBA 3VXPA 5SWZE 3X13A 3UTTB 3G08B 3P11L 3M17A 4NNXA 5EO1A 1G9MC 4RAHA 5LG1A 4O02L 3C5JA 3TO4D 3B5TA 3WXWL 3F6IA 5T1KD 3RQ3A 4NKDA 1R5IB 1AGDA 5IJVA 3SKMB 4Y4HC 4ZFZB 3VXTA 1S7XB 5MEOB 4YWGH 5IMOA 1S7SA 1GRWA 4JO1L 2DL9A 4LKCB 2VR9A 1MAKA 2R0KH 4HPOH 3QG7L 3H3PL 3L7EB 5DFVD 4GAYA 4NBYB 4JZJA 1MREH 2OI9B 1NCDL 4M4RA 1Y0LB 1KTDA 1FL3A 3CX5J 1FORH 5E08L 5ANMA 5KBNC 3ARTA 2QHRH 3WYRA 1CFVL 2VDPH 4WUUB 4EQ2A 4L8CB 3MBED 2PTTA 1NDMB 4JR9L 5IR1A 5J7CC 3QDJE 5CZXC 1FIGL 4NZUL 1WBXB 3U82B 2NX5A 1DBKL 5JMRA 4W4NA 4HH9A 4JAMB 5FF6B 5KOVC 2H3NA 4LQFH 3WNPA 4GJTB 4HKJB 3D25B 4PJAF 2AV7A 2B5IB 4KVNH 4LSPH 4XWGH 4XI5D 2XTJB 1TZHA 3QFDB 1JWUA 3I02A 2GSGA 3HMXA 3QEUA 4GAJL 5FYJH 4JPWH 4Z95L 43C9B 1Q38A 3UPCA 4MZ3A 5HYIA 3O9WD 3OXRA 1UYWH 2EC9U 3WHXB 4QRRB 6CGTA 5GRVK 2DQDH 4RA3A 3VD5A 1IT9L 1VENA 1N0XL 4N0UB 3AM8A 3BMWA 4JKLA 1CE6A 4YDVA 3PP4H 5DMGD 5E6ID 3HI1A 1NANH 5FYKU 1G7HA 5DVLA 3R06A 4IIQB 4LL9A 1MHPH 3T4YB 1NAML 3S8WA 2Q6WA 5EU3B 5IMLA 4JFDA 3D85A 4G8EA 4U1JA 1XGRB 5FHBH 4QXUL 4MNHB 4CDHA 4GBXB 4K2UH 1U3ZA 4BZ2H 2QHLA 1JGUL 1F4XH 3GMRA 3REWB 3QXUA 5HHXL 4NRXB 1UZ6F 2WWKT 4G42A 4J3TA 2HFGL 1ZS8A 3HUJB 5H37H 4HFUL 4QY8B 4WENB 4N9GB 3FQRA 1BX2A 3G6JE 5DO2D 1H5BB 2VNCA 4I48B 4K3GA 4WHCA 4EBQL 1DLHB 1NCWH 3H0TB 3HE7D 5D2LF 5F1IB 4KQ3L 2H8PA 1K85A 4CN6A 5IB3B 4TNVF 3X14A 4PB0H 1KEGL 4K8RH 3W39A 1X7QB 5KN5A 3QDGD 1OAYL 1OB1B 1A6TB 4LCWD 4G8IB 4WI7A 1JPGB 5C08D 4N1EA 1NCCH 4QWWC 2YA0A 4F7PB 4A2MA 1PQZA 1TCRB 3DVGA 3WNKA 3S35L 3MLTA 3N1QC 1BEYH 5GSRA 3NIDE 1U91A 1CFQB 4PBXA 4FQHB 5C0AE 4MXVF 4I3RL 1F2QA 2IAMD 1OSZA 1O7SA 4GH7B 4Z7OE 1C16B 3H42L 4OQTH 4IRJB 4KK6C 2AABH 3GO1L 4LPWA 1TJGH 4Q6IB 3IVKB 3CSPA 5C8JA 3O6MH 3CNKA 4MNQE 1W8NA 3IDNB 4GOSA 4DW2L 4EI6A 2IG2H 3BAEL 1IZJA 3EUUA 3NIFF 2W65A 1RULH 2Y5EA 3E6FB 3D69B 5EUKB 4F57L 4OCLC 2BY3A 3PABB 4MDJA 3BZEA 2X1PA 5D8JL 5MP6H 4B5EA 3QXVA 3MRJB 4PG9A 2IQAB 1IZKA 2BC4A 1YPZA 1JPTL 3P9MA 4PRPE 1SEBB 5JPNB 3K7UA 1A1NA 4POZC 1AFVL 2NXYD 4BH7A 5IROA 1J0HA 1JK8B 2OJEA 4CVXB 2VB5A 4R7NA 4OUOA 1IGTB 1PYWB 3W9EB 5FGSA 43CAA 3V6FB 3IDYB 4J6RL 5JOFA 1KIPA 4PJGE 3EO9H 1AKJB 3GSRA 4GXUN 5CKAA 1J0ZA 1MCIA 2H32B 3EDDA 3EDFA 4JN1L 5H35B 5EZJB 4OF5A 1D9KD 5DYOA 1WFTA 4L9LB 1FRGL 4WO4B 2VDKL 3U79A 2B5IC 2XTJC 5I73C 3S34L 4MD4A 5DD5L 2VZVA 4DGIH 1DUZA 5FKAB 4MWFA 2HT3D 2YRZA 4P46A 3L3KB 1FDLH 3RWFB 4R4FL 2ZUYA 1LEKB 2VABB 3FL7A 1XR8B 4LLQA 3CMGA 3RY4A 3VXSB 1KPRA 4QXGH 4HFWB 1IKNC 3LQZA 3HRZB 4Y16D 2XA8H 1QSFE 2VO5A 2QL1A 3RWCB 3IU3A 2XG4A 1PJ9A 2ICEA 3F7RA 4XBEH 5IBUB 4PV8B 5T5FL 2NYYD 1MCSA 3LPWA 4PJFE 1XF4B 4ZPTB 1UWGL 1VEOA 4P2OB 4GBXC 4LMQI 5FYJU 1A7NH 1D5ZB 3GBMH 5JLZB 1I7RB 4JPKL 1EJ6A 2HJKA 3GNMH 4D9RE 1N8ZB 1HXYA 4PJDF 4IMKA 5DA0B 4YBLB 3MUY1 1JHKL 5DJ8B 1I9IL 1XIWA 1GIGL 1C5BH 3EO0A 2FX9L 2H41A 3PWJA 4NKOA 4YHYC 2PXYB 5CJOL 3U2SA 5J9PB 3F7PC 4P57B 4QCIA 3IRPX 5E7FA 3VWKD 1JWMB 2OXHA 5TGBB 3BRGC