3P40A

Crystal structure of neurofascin adhesion complex in space group p3221
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
390
structure length
390
Chain Sequence
LTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Homophilic adhesion mechanism of neurofascin, a member of the l1 family of neural cell adhesion molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Neurofascin
total genus 64
structure length 390
sequence length 390
ec nomenclature
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p40A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p40A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p40A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p40A04
4MQXC 4PJFA 4EEEA 3GMLB 2CK0H 3K4DA 2P8MA 1ZLSH 3RY6C 1EO8H 3SDXF 4MA7L 5EO0B 1QFHA 2BOCA 1DTUA 1GOGA 3IJYA 4FQIH 1FPTH 4LAQL 2D0HA 5DLML 4BH8A 1PY4A 4G42A 3UTPE 4X4XB 2Z8WC 1OD7A 4LAJH 4PRNA 5IK3B 3WEXA 3HG1A 2YA0A 2VLRB 1RVFH 3HE6D 4NYLA 2DQCL 3F7PC 3QO0B 1A6ZA 5IB2A 4HWNA 4L5FL 1XR9B 4ODWA 5B8CB 1OAQH 4P23B 2YSSA 5EUOE 4MAUL 2BNUA 3MV9E 3SGJC 2AV7B 3W9EA 3UTSB 5FK9A 3WCYA 1GXEA 1CF8H 1WZMA 1Q72H 3MJ9A 3MREA 4YDJB 1ZT1B 5D4QA 2VLME 5CJXC 1CXFA 1AJ7H 1G9ML 3MODL 5D6DA 2F5BH 1MJUH 1YJDL 4YC2B 4X4ME 4XP5H 5KTEL 1LO3L 4GQPH 4LPTA 5IEHB 4HMCA 4PB0H 2W65B 5C0CB 2AGJL 1R24A 3QXDA 2FEEL 3AY4C 5DVNA 4WV1C 5CWSB 1OTTC 4P2OA 4F7TB 3UTQA 1F58H 1G9NC 4RAHA 1I7ZA 3PL6C 4JFXB 3KYKL 4X8JB 1OSZA 5I2IB 5GS0C 2JCCB 3S5LA 3PQYE 1EDQA 2OXGA 4PG2A 4NZJA 3T09A 4HIJA 3GI9L 4K3JL 1F90L 4LLVA 1RUQL 4IRSA 5IMOA 4J3UA 2NY3B 5DJCA 5ACZA 4MVBC 3FT4A 4U1MB 4Y16A 4M7KH 2MHAB 2VKXA 1S78C 4YHPA 2QEJA 3N85H 2DJ4A 4PS4L 5EC1A 1L9MA 1DANT 2DQDL 5CP3A 4HAFA 4OD2B 4PJCA 5IMKB 1WFNA 4DTGL 2VXVL 3UTSA 4W6WB 1CLOH 3B3IA 1BFVH 3FN0H 2K7PA 2LAAA 4L1DA 2YR3A 5DURB 3QSKB 4OIAA 3CSYB 4P2QE 4N5UA 4E0RB 2YRLA 1OAKH 4F7PA 1ZWIA 4OM1H 3WFBH 5C0CA 4RGOL 4MQ7B 3R06B 1MJJA 4FFYL 3CFJB 4I8DA 3C08H 3GSUB 2EDEA 4I3RL 3L3OB 4G80A 4YZFF 2DQJL 4ORGB 4YC2C 3EJZD 2CLZB 1N6VA 3PHQB 3PL6B 4P3DA 1HCFX 1CDHA 4MB4A 1HDMB 4PR5B 4W4NA 4J1UA 5D2NC 3CC5B 3O3EB 2YD3A 3OPZL 5JORA 2R1XB 3PGFL 4X7TB 4PP1D 1F6FB 1I8MA 4YDVB 1ITCA 1G9MC 4MZ3A 1G6RL 3DSFL 4DGVL 1KGCD 1DLHB 3F58L 1CDYA 1KUMA 3O6FC 2BFVH 4JEGB 2LVCA 4JB9H 2GUOB 1RK1A 2VDPH 5EZJA 3JTSA 5T1DL 2NY3C 2VABB 1B88A 2JELL 1UT9A 1T0NA 3BZEA 4KTEH 3S88H 1A5FL 3MOAH 3VXUB 4HX1B 1FCCA 1DFBH 3SDCD 2GJ6B 4UDTB 5FGBA 5ADOH 3B2UC 4MAYA 1B3JA 2MKWA 4P5TA 4J2XA 2JF1A 1F2QA 3QPQC 2CRYA 5CD3B 5I76A 3HHRB 2VXSH 4ZNCD 4X6BA 2VDLH 2W60B 4P2RE 5KOMC 5IHUH 1TMCB 3S8WA 4RGNB 3QRGL 2AEPL 3ILQD 3L3JA 2XFXA 4AG4H 3T0AA 2NW3A 5I0ZA 2H45A 3H9SE 4PJBA 1HHJA 2G9HB 3RNKB 1NDGA 4KDVA 3FJTA 5D7KE 4EVNA 3O3EA 3EYOB 4HPOL 1K4DB 3H9SB 3HNSL 1I1AC 3LQAL 3FB6A 3B2VL 4ZTOL 4DK3A 2VO5A 4FP8L 1OARH 2HH0L 5KSUB 1F4AA 3UDWA 4WFGD 1CLOL 5K9JL 3D85D 4S10A 2VZ1A 1A1NA 4L8CA 4WI5A 2H6PA 1YMMD 3IXTA 2R0LH 4ODUB 1NMAL 2VABA 5FO9A 4BSWB 4LHQB 3C2AL 1I3RB 2NXZB 4FQCH 3O2WH 4OLXL 1T03H 3QISA 2A6KA 3OJVC 1S7XA 3MR9B 4HPOH 2FD6L 3MO1A 1XGTB 2QADC 3MACH 5DA0B 4EBQL 7CGTA 1ZHLB 1S9YA 3EKCA 4GUPB 1CWVA 3GSOA 3PV6A 3FN9A 4C56B 4HSQA 1KEGH 3ZL4L 4MA1B 4PJBF 2GITA 5DZLA 4EQ3A 3WDHA 3QXUA 3O8XB 1OB1B 1J0ZA 5CP7A 3TJHD 3ULVC 4Y19B 5F9WC 4S1RH 4JFQB 1X5ZA 4AENB 1PGRB 1WZ1H 1ZGLA 4ZFOA 5CKGA 5T3XD 1Z9SA 5IW6A 3WIFA 4YAQA 3Q0HA 6CGTA 3S97C 2O61A 1KV3A 1EEYA 2NR6D 5B21A 3OKOB 4MNGE 5MENB 5GRUH 2AI0H 1KTKE 1JNLH 4N0UA 3VXTA 3QUYD 4NT6B 1KELL 3SPVB 5IV2A 2LTQC 1WBYA 4QGTA 1A7QL 2Q7YA 2E7HA 1A1NB 3I9GL 3F7VB 1Q9KA 2D7QA 1IZJA 1S8DA 1QFWI 2VN4A 2W9DL 4KRPD 2NNAA 3VRLF 1IGML 3MFGB 4H25A 4HQQH 3GM0A 3PQYA 4X5WB 3DSFH 1CGSL 1YNTA 2JIXA 3FO2A 3D85B 3ELAT 5I6XB 1RK0A 4LP4A 3MLUL 2FBJH 4KRNA 1AY1L 1SYSA 2PTTB 1L4IA 4IS6B 1MCJA 1F4XH 4DTGH 3BXNA 4NN6C 4ZSOA 2HFFB 1NC4B 3RFZC 2Q87A 1BVKB 1KPRA 5ESQB 3IS1X 4HG4K 3LMJL 3FQRA 4XBEH 1TZIA 1OGAA 2X4SA 1OAKL 5F3BA 3DX6B 5JMRA 1UZ6F 3IXAB 5K33A 4LSQL 4NHUB 2ZKHL 4JY6B 1OVZA 4PJ5B 5I1DB 5IW6B 4YDKH 3ALXA 3BJ91 1MFDL 2DBJA 4GRLD 3LKNA 5CGYC 3O2WL 4OLXH 1OAYL 5DHYB 4PJAE 3FQTB 2OTUA 3ZKSD 2DLTA 2C26A 5EBLB 4RZCB 4PJGE 1RIUH 1RIHL 4GRWB 5D1QB 1UB5B 5C0AA 3TESA 3QNXB 1CGXA 4TUOB 4NKOB 5C07D 3UEZA 5C70A 2NTFA 3QP3A 3VXSA 2XWJA 4KI1A 5C6TH 5JDSB 3LS5H 2JELH 1F8TL 5CINL 3RL2A 3TO4C 5F44A 3QFJB 3OG4B 3W39A 3LRHA 4KI5C 1FAIH 1I1FB 5F7DA 1DQMH 2GJZA 3SKJL 1VCAA 5H2BB 1DQDL 4X4YB 1FP5A 2X1PA 2YD9A 3OAZK 4K3DH 1IFHL 3NIFF 4QRPA 1Y18B 1UM4H 4PUBL 4OLUL 2I9LA 4FRWA 2XT1B 3TBTA 3S96B 3VFRA 3C5ZC 2ZOLA 4OZGA 3S37L 3NCJH 3AAZB 5I1IL 1QLRB 2NTSP 1KYOJ 3V7AG 4PY7B 1T1ZB 4NHUA 1MAMH 4I0PB 3EO1A 2DDQH 4EI5C 4I2XB 3V4PL 4MA7H 3LV3A 1HQ4A 2YD6A 3KLAB 4P2OB 3ZTJG 3L7FB 3QUYA 2XZAH 2YPLA 3KXFD 5J1SC 5BW7A 5MP6L 1FNSH 5D2LE 5I73B 4PLJC 1N5AA 3C6LD 4Z7WE 1R3JB 3IKCA 5E4IA 3QWOB 5KS9B 1ADQL 4CNIA 5IGXL 1M05B 2CO7B 4TUOA 3L3IA 4Y88A 1B6UA 4NKOA 3TZVB 4MNGA 1OAZL 2YUZA 4O58H 5CBEA 1BEYL 1AO7A 5CIPH 2OCFD 1HN1A 4Y16B 3ULSA 1KNOA 4DN4L 3I75B 1OOAA 3EAKA 3KPSD 2EXWC 1XGPB 4J8RA 4DCQA 5JOEA 3AY4A 3HRZA 2VISA 1FZOB 4PJEF 2HJKB 1UENA 3G6JA 3HI1A 1ZAGA 4XNMA 5C07A 3RWHB 4JKKA 4WW2F 2H9GB 2HP4A 3T8XA 1T5XA 4MNQE 4MJIB 4OZGE 4RISH 4H1LA 5J12B 3NZ8A 5BMFH 1IC7L 1QBMH 3MNWB 3FOMA 4GLRI 5HY9A 3U0PA 1GRWA 3CIQA 3DSNA 4OZGB 3DUSA 4LKCA 3OAUL 1MHPL 7FABH 3UPRB 4IRJA 4Y19E 3ROOB 1HE7A 1BQSA 1B0WA 1HHHA 1RHHA 1CE6A 1NGQH 2CIKB 3O6LH 3PWNB 1YPZF 4KVCH 4ORGA 1HQ4B 4NO3B 1UJTA 3C5ZD 2ENSA 5D5ME 2B7DT 1T22B 3WDJA 2XKNB 4OLWH 1DDHA 2V2XB 2QTEA 5CHNA 1E4XI 4M7KL 3NPSB 1JGDB 4G7YH 1PX3A 4KUCF 3PABA 5J56B 3GMOA 3R0MA 3RTQA 3TF7C 4NHCL 2QQKL 2PW2A 2BSSA 4PJAA 4Z5RA 5SWZB 4YWGL 5DD6A 1UM6L 3PWPA 4X6DB 1OLLA 2AXGB 4G43B 4QXWA 3E6FB 4LSUL 3AS0A 2VR9A 3QG6B 2DQTH 1RK1B 1TJGL 4U6HA 4GMTH 4NQDA 4J12A 1BLNA 2BVPB 2F5AH 1KBGH 2W38A 1VB9A 1FNSL 1WCBA 2EO9A 2ICES 2ITDA 4UT9H 1U8JB 2DF3A 4PRPB 1MHEB 3RUGE 4MXQC 5DD3L 1KIRB 5F7UA 2Y06H 2FHFA 3C60C 3RIAF 1AGEA 4MAYB 2E8YA 4FXKB 1RZGB 4ODSH 1D5IH 3MRDA 4XP5L 4QCIA 5KTEH 3TWCH 2VR5A 3VXOA 3WJLA 4IRJB 3C8HA 4ONGL 3ROOA 1HHHB 4H0IA 4HS6A 1FLRL 1TJGH 1J9CT 4LVEA 5IIEB 4YFLF 5FYLL 1VGEH 4PJIF 3TO2B 3MRLB 4KFZC 2X4OA 3NFSL 1GGYA 2XFXB 1NGWB 2VZOA 3AUVA 4OZ4A 4ZUSA 2OTWA 3FHAA 5MHSE 4CMHB 2FJFA 5E5MB 3B8SA 2Q8AH 1NBYB 1PYWA 1V3LA 2R0ZH 1QBAA 2X9XA 3FMGL 3WLWD 5GIRB 5A2LH 3P77A 5GJSL 3DUUA 3QDGD 3D39A 4GRWH 3AM8C 3RTQB 1T20A 4H8WC 3IDGA 5IBLD 4JFHE 2DM3A 4RFNB 1AQKL 2YEZB 3Q1SH 4D9QD 2OMBA 4LHJB 4TTDC 2GHWB 2Z9TA 2EDWA 2BVPA 4X83A 4DZ8A 3PNWA 4DVBB 4NQVA 2CLRB 1RJYB 1CT8A 3TT1L 2KH2B 5JIPA 2XA3A 4KTYA 4G3YL 1V7NH 3BSZL 5F9DC 1YNKH 4KVCL 5JHDE 4XX1E 3S36X 1IM9B 3OKDA 3OX8A 3MRDB 3MRBA 2BSTB 1WITA 3BMVA 3G9AB 2YPKB 4PJHF 4I18A 4U2YA 3C60B 2D7PA 3QDHA 5KG9A 5C0BB 1VEPA 1Z6JT 4MD4A 1IAOB 3TC9A 3G5YA 3ZL4H 2IADB 1FZKA 1NGWA 2A73B 4HHAA 1R5VA 5F88B 3WUZA 4Z0XA 5HJ3A 1RUPL 3NZHL 3VFPA 5F6HJ 2MQCA 5GIRA 2UY7A 1AO7D 2HT3D 4EXPX 1PKQE 5ETUB 2NQCA 5D6CB 5MP6H 3TPUB 4CMHC 1UXSA 1XF3B 5B38B 1ZHNB 1U8IA 4IMKC 2V2WA 5IVXB 1KGCE 5IG7B 3MV11 3EZJB 5AYUH 3C2AH 5DVOA 2QHLA 1MFDH 3H9HA 3HC0B 3BDXA 4RIRA 4S1QL 5EU5A 3I84A 1WBYB 4KI5F 1CDGA 2AXFB 4PLOB 3F12B 4OF6A 2DTMH 1AD0A 2E9JA 2BVQA 1NEUA 4ETQB 1FCGA 4BFBD 1QD0A 5LXGH 5C86A 4PV8B 2EEBA 3Q6GL 4I1NB 4PLKC 4D9LH 1CXKA 2DQEH 5D2LB 2X89A 4HUVA 4LVNB 1G7JA 5TH2A 4NKIL 3MRBB 5MEPA 1T1XB 3SE4C 2E7CA 4RBPK 1LD9B 1F4XL 5AWNH 2IC2A 3BXNB 4Q6YA 4P4RA 4ZSOB 1P69B 3HC4H 3QRGH 3G9VA 3PXHA 3ZMRA 3OKEB 1B9ZA 3C60A 1KIQA 4UQ3A 3F65A 4NN5C 4L8SB 3WO3B 5KG9B 4K8RL 3BEVA 1EXUB 3V6BR 4HDIB 4HIIB 5IMLA 4HXBL 5IVOA 4X99A 2V5RA 3T1FB 5F88A 2BSRA 2A83A 2V5MA 2F54E 3CDYA 1YEHL 1MFEL 5I17B 4PJ5A 3HAEG 4UNTA 3NFPB 2EDTA 4KK8C 1A4JA 4LCYA 4GXVL 5E08L 3GMMB 5IG7A 1MI5B 3FQTA 3DRTA 4K3HA 4Q9QL 1JZ3A 4WFGE 3U9PH 2YN3A 5KW9H 3RX7A 1CFTA 3VD7A 3FAXA 3QNXA 1AY1H 4Y4FB 5EUKA 1KCKA 1VESA 2ZSVB 3G5XA 1ONQA 1P7KA 4JRYD 2F53D 1GGTA 1MCFA 4OGYL 1CL7L 5ENWA 1EFQA 1H3GA 5I8EA 3DMMA 3H9SD 3MPCA 3QXAB 1F45A 1JV5A 1FG2A 1U3YA 5F7DB 2AS5M 4PGEA 5DJ2A 3MUGB 3OKEA 3FB7A 4QNPF 3EYFA 1U3JA 1LE5A 2AK1L 1ZHKA 4QRPB 2B20A 4APQD 3FT3B 3DWTA 5FB8A 1KACB 4M1DL 1G7MB 5KVEH 4UBDD 5JHDA 3UJIL 1RJZA 5ISZE 2BZDA 2W9EH 4P48A 5TQ2H 3ZKNC 5HD8C 4ZUWB 1ES0B 2VQUA 1NCWH 5EBWA 3MUY1 3WJLC 4I2XA 2C1PB 1BBJB 2C3WA 5LKNA 5F7EL 1ZT7B 3IDYC 5I1CH 4M5YH 1MI5A 5C9KA 2VLMD 2VB5A 5E4EC 3NCYS 4IOIA 1T4KA 3HNTL 1VEOA 1QSVA 4JJ5B 4BM7A 5E2VH 4PJ5D 2Y5TB 1H5BA 25C8H 5LVEA 3GSWB 1R3JA 4UT6H 1JHLL 2WMPA 3TVMC 4U6XA 2VLKA 4NUGH 5L0QC 3WD5L 3VRJB 4YHLH 1IEBB 1TJIL 3BPOB 5ENWB 1IM3B 4Z76A 5C0JA 1MNUL 2HTKC 2ICWB 2OXHA 5ELIA 5TDOB 4P46A 3I75A 1GGIH 3LQAC 2D7TH 5A16B 1JHKL 2VISB 2X4UA 1WC7B 3VXMA 3WL9B 4ELMB 1BJ8A 3B9KC 1OP5K 2J88L 1ZHKB 2N7BA 4H1LB 5D6DC 2F53B 3RZCD 4WJ5A 4XPGH 1A2YB 1G7MA 4C59B 4KZEH 3U48A 2P7TA 5EOCL 3U30C 3WD5H 2DIJA 4R3SA 4OAWA 2BC4B 1JWSA 4BK5A 1JFQH 3QULB 3UTTE 2DWDA 2FCBA 1AH1A 1RHHB 1A7BA 3TIDB 1X5KA 4L4TA 4PJDF 2GSIA 1E6OH 4F3FA 2XTJC 5C0FB 5FUZL 5TFSH 5C0ND 4XCCL 3B9KB 3VWJB 3WXWL 1MQ8A 2HTLC 4JVPA 3IRPX 4UQ2B 4EI6A 2OL3B 4IOIB 4Y7MA 1T4KB 4WTZA 1NCDH 3KHQA 4HBCL 3V4VL 3U7WL 4OSUH 1GPOH 4P2RD 4WHDA 4BZ2L 1T5WB 2W9EL 3BKJH 1OGTB 3O2VH 1CDBA 3GMOB 1LQSR 1HXMB 3VRJA 1WWAX 2HRPH 4HPYH 3EJYC 1TTUA 5ECJE 2ZZUT 4Z76B 4DJMA 1NQBA 3S4SG 4I9WD 3ESVF 4XBEL 2F74B 3TA3C 2JJSA 2AJZB 4MGXA 4F15B 3PP4L 1A0QH 5J06A 3H42L 5I1EH 5GS3A 4QO1A 3VXMB 3E8UL 1FRGL 4YX2H 1AQKH 1TXKA 4M7LT 4OGXL 2XWTB 2B4CH 2FECI 5D7JC 4ZFGL 4PJ5E 3SDDD 4ZG1A 1T03L 4XAKD 5KSAC 4J7RA 4XNXL 3T4YB 4F33A 3OPZH 4D8PB 4MQXD 1H8SA 2CH8A 4ZTPL 5FUCE 2YS4A 5BCAA 5DUPH 2FX7H 3MROA 5TPWH 2BCKA 3NFSH 2X4OB 1FYTD 3OF6A 5DFVC 3E8UH 3WO4C 4PJAF 5GSVB 4X8JA 4JFDA 2OTWB 4KK9C 5JZ7C 4ACPA 2VXQL 5D8JH 4RAVB 2NW2B 1OQXA 5F9WB 3IFOB 3FFCA 3ZHLA 4MA8L 2VAAA 3VA2C 5DJDB 4NC0B 2ED7A 1DLFL 2MHAA 2XN9E 3QEQE 2XI9A 5DJ8B 4UZGA 4U1GB 1SVZA 3SCMB 1U8KA 1ED3A 3QIUC 4X7CC 4PJ7F 1CGWA 2COQA 3ISWA 1FJ1A 4WO4B 3VE0B 4Y1AE 1HHKA 1KF9B 4Y89A 2PTVA 1XF4A 2WIIA 4GMSH 4FQLL 2FLRT 4XAKE 4WHYH 1T2XA 4MJ6B 1PG7H 1YC8A 1TCRB 4R4ND 3SDDB 1KPUA 4Y2DA 5E2WH 4LSRH 2DQIH 5T1DH 2A6DA 2BMKB 2QSTA 1F4WH 1DSFL 4HV8A 3G6JF 2CJUH 4OLYL 1E0OB 3QQNA 3LB6C 1UB6B 2Q8AL 1ORQB 4X98A 3RJDA 3EOTH 2PCPB 4JDVB 4XMPL 2ICWI 5EU7E 4MD4B 1XCQB 3MLYH 1FZKB 4FFWC 3BIKA 3TBWA 1I8KA 2OR9L 2R1XA 1OWRM 3AB0C 1I3VA 1XGYL 3ZT5A 2A77H 2W0PA 2D7OA 5D6CA 2FZ3A 3JVGA 3RTQC 4ZNEA 4NGHL 2VDMH 1UH3A 2NY4C 5JXAL 1QRNA 3T3MF 4RGNC 2B0SH 4U05A 5GS1A 5D72H 2AXFA 1MCSA 4HUKB 5CIPA 1G7QB 4KKAC 4O51B 5A2KH 3T0BA 1C5BL 5CCKL 4ODTL 5KVDH 4HUWA 2X40A 3QFDB 3MRKA 4RFEA 2BERA 4NWUL 4YHKH 4IJ3B 1G1CA 3GMPA 4HH8A 4TSBH 5C08B 4PRPD 3B8YA 5D2LA 1FE8L 5KSAA 1BQHA 4DN3H 3H7LA 5MEPB 4JFPB 5TH2B 4OZIE 5KANG 4HV8B 5GSRB 3NFNA 1RUAH 1XIWB 1UWEL 4MAYC 3U2SB 3IF1A 3VW3H 1AI1H 1AO7E 4BZ1H 5ESAB 2K9UA 5HDOA 2X4RB 5JIHA 1NSNH 1I8KB 1NMBH 3MLZH 1NGZB 1DL7H 3MV8A 1B4JL 3VXRD 4I5BB 1A7RL 4JQIH 4R6UA 2NY1C 2DLHA 4M7ZB 4JN2B 4ORZC 4PJEB 1WBXA 3L9RA 5C71A 1P7QB 4WI3A 5JR1L 4KMTH 2I24N 1XR8A 4NNYB 2PKDA 1F6AB 3MZGB 1SY6A 5C0GB 4XXCC 3DECA 3BWAB 1IBGL 4Y4HA 4L8CB 4LSSL 5GGQH 1U58A 3GBNH 4TVPL 2MPAL 5FO9B 4Q58C 3UAJC 2NY2D 5HHMB 4K3EL 1URLA 2FGWH 5INDA 1CFTB 5GGSB 2IGFL 4HJJH 1JTPA 1DBKH 3N06B 3AS2A 1N64H 1K3ZA 3I02B 4YIQA 4CVWA 5ERWB 4R7DA 3MRQA 1JI2A 1K5NB 3SBWC 1NAMH 3DROB 3IJHA 2FEDC 1VPOH 4WW1A 1DE4A 3EYVB 1HEZA 4OD3H 2D3VA 3DMMB 3QDJB 1DN0A 4JKPL 4P0DA 4XXDA 4GAGL 5ESVA 5J8OA 5FYKH 4Y16D 1CGVA 1GOFA 5GS0L 2P8LB 5FHBL 4JFOB 4E41D 4Y19A 5J6GA 5FYJE 3NZHH 3KDMA 4WNQA 5HHME 5MI0C 5GGVY 3L9RB 4QT5B 1MIEL 2RJMA 3CXHJ 4N0UB 1INEH 1U8OB 4KH2A 1YQVH 5KJRH 1ZT7A 4TNWK 1I9RL 5CEYA 1MSPA 2P8MB 4G6FB 1JN6B 1G0DA 4P5KB 3BZDA 4LBEA 3QWQB 1RZFL 3QJFB 1MWAH 1DL7L 4LDOB 4E42B 2B1AH 4LPWA 3EHBD 1FLTX 2DQEL 3Q48A 1N0XL 5DYOA 3MODH 4DZBA 4POZD 1K5NA 1NCTA 5CJBA 2FATH 4P4KD 3DROA 4Y5YA 3S3SA 3IJHB 4LSTH 1IM3A 3KWWA 1A6ZB 1F2XK 4GXUM 1NLDH 1KLGB 4YPJA 3CK0L 1W2KT 3AS3A 4JO4L 5F7YC 1BVKA 2L7JA 2X4UB 3GHBL 3UXFA 3X17A 3DRQA 2YD1A 3NPZB 5IJVB 4MNQB 3LD8C 4N0YL 3EZ8A 1CQYA 1X44A 4DAGH 4XHJD 4JFOA 3K0WA 4NKQB 5FA4B 2L7UA 2A6JA 3L3DB 5FYLE 4R3SB 5HHPA 2EE6A 3L6FB 1OQOA 4HZLB 4QOKB 5IUSA 4GXVH 2AK4E 5EFIB 5F89B 4AT6B 2BNRA 2E9IA 4EOWH 4ZS7H 1FGNL 5C0FA 1IEHA 3UTQB 1T6WA 2R2BA 3VFSB 2AW2A 1HH9A 3CX5K 4QRPE 5SWSB 3VXMD 3LN4B 4QXUH 4XXCA 5D71L 2J3SA 2OL3A 2BOBB 4OFPA 2JCCA 3O3DA 1T1YB 1CLCA 4WHTB 3KJ4C 4HC1L 4PGZA 2DDQL 3QJFA 3NTCL 5BVJA 1II4E 2VXVH 5SX5K 3VFVB 3VXSB 2EKSB 3QUZB 5TDPA 5I0DA 3BKJL 2A9ML 3TJEH 2DL2A 2YRPA 1JZ6A 5CJQL 1QOKA 4Q0XL 4PLJD 4P2YA 1YN7A 5EIVA 1UWXK 2HT2D 3D69B 3MNVB 4E41E 4OCRH 4V2BA 1RJLB 4X7EC 3S6CA 3UTTA 5LAXB 5DMYA 1EO5A 1NBVH 1A7OL 1OLZA 3DRQB 2I9LB 4Y5VA 1P84K 3TBTB 2R2HB 1QHOA 2EECA 3KNBA 4AIOA 1CDIA 1ZVYA 2EE2A 3B3IB 5DD1H 4LNVA 1NAML 1QR1A 1AGCB 1I85C 2HJLA 2ZG3A 3BKYL 5T1LD 3T04D 3P73B 1ZGLM 1U3HC 4OZFG 1JWMB 3EO1B 4ODTH 1QFUH 3U79A 4JQXC 3VH8B 3KYMA 2CIIA 5AAWA 1EEZB 3V5KA 1YMMA 3IFNH 4D9QE 3OKYA 4LIQE 2B1AL 4JVWA 3TH4T 3RZCB 4WEBL 4AG4L 3MROB 3BPNB 2VXTH 4JHAL 2D4DA 3S34L 3TCXA 4U1KA 4WDIB 3C6SB 4L3AA 2PO6D 4OD1L 3JVGC 3TO4D 3IJSB 4HIXH 3IKCB 3IDIB 5IM7A 2E7MA 1GAFL 1MHHA 4HH9B 1U3HB 5I30L 1JK8B 1S7WB 2APXA 3BP7A 3W5MA 4L9LA 4IOSD 1QLFA 3ET9F 3QUZD 4KHTL 4HWBA 5SWQB 5DJDA 2BNQD 4KDTC 1LEKA 4WFHE 4DCQB 2DQFB 1FNLA 3HC3H 5K9KA 4N9GB 4H1LG 1EA9C 1G6VK 2WAHA 1Z3GH 4I0PC 2CDFA 2ZUXA 1BM3L 5BVPH 4WO4A 3VE0A 1WAAF 1H0DA 3VRIB 4WW2C 4FNLH 2AV1A 3H9ZA 1YEEH 4KZDL 4YBLB 3SO3C 3BX7C 4U0RC 5HPMB 3O45B 1OP5H 1FNFA 4ELMF 2V5TA 1KN2L 3V52H 1L6ZA 3PWNA 2AJUH 3WSQL 4MCZA 3EOYG 1P7HL 3S5LG 2UV3A 4MNQD 3RWJB 4G8EB 1ZTXH 4XAWL 3QIUA 3Q2CA 1XCQA 1UYWL 1DDHB 4M8QB 4U1SB 2D0GA 2IAMC 4WDIA 4MA8H 5ITBH 1G6RA 1JF1B 2K1MA 5HHXL 4EVNB 3ZHKA 3ULUC 4QWWC 2XZAL 1JK8A 3ZE1F 5JPNA 4XPBH 4AEHL 4ONFL 3TFKD 1LP9F 4NJAL 2BSSB 5SWZA 2X1OA 3OG6B 1ADQH 5IGXH 1FVCB 3QI9C 4TNVF 43C9B 1PLGL 2DQFA 1QYGL 1HWHB 1KCSL 1L7IL 4I9WE 3ARSA 3QI9A 3NCYP 4LP5A 3THML 3LOWA 4JQXA 4GBXB 4HK0A 4K94H 5DTFA 3LN9A 5DVKA 5EO9B 3VG9C 4C55A 4HK3N 1FHGA 4FFVD 5DDHB 4BFEA 1ZEAL 3UJJL 4W4OA 1L9NA 5C08A 2VZSA 4FXKA 3QFJE 5D9SB 4ALAL 5HPMA 4G8GE 4QHUB 5C3LD 4OZIA 1KPVB 2CDGA 4BFIA 1E4XL 1A9BB 4OD1H 3OB8A 4JY5H 3OV6A 1NUDA 1CD9B 4LHUG 3GI8L 1ZANL 1XIWA 4HFWB 5DGQA 4JO1H 2OP4L 1T80A 4JVUA 5FGRA 4HS8L 3HCVA 5E5MA 3O8XA 1OTSD 3K80A 5DK2B 3MV8B 3UJJH 4FP8H 4DFIA 4NGHH 5JXAH 3OB0K 5J0BA 3KYNB 1D9KC 2EDJA 1OARL 5HDQH 3NCJL 1FL5B 1ZKAA 3PWVB 3OWEA 3OKOA 5L9DL 4KVNH 4MHHG 1DEDA 1U95A 2IFGA 3V4UL 2V2TB 4N8CL 1XR8B 3AREA 1NCWL 4YZFE 3WN5C 1FVEA 3D3VE 2Y07H 5FYKE 4P49A 1CDJA 1BQLH 3ULVL 4ZFZB 5D7IE 3BDBA 3S3JA 4DVBA 2DTSA 4K7PL 4XNXH 2CKBH 4MD0B 4YBQD 1K8DB 2CPCA 4X5WA 3QR2A 1DBKL 3P9LB 2D03H 5EC2B 3T2OA 3GKWL 5K59E 2YWZA 3OKKA 2Y6SD 3K8KA 4LGSB 4FQXD 2O26U 5DS8B 3V95A 1UYWH 1FPTL 4CDHA 2GCYA 2OR8A 2YMXH 3BGMA 2IANA 2AK4B 2X4TA 3C09C 4AEIL 4YE4H 1UCTA 3OR6B 1KEML 5BV7B 1RZKH 2VDOL 4KJQD 4WU5A 5LGKA 4LVNC 2VLKD 2DQCH 3QFJD 4ZFOL 5ABDE 4TVPE 5F8RC 4Z18A 1HSBB 4IOFD 5F3BB 1CFNB 1X6NA 4HHAB 3LIZH 1DBAL 3KDMB 5KSAD 4KKLD 4NN5B 1DLFH 1BX2B 4OT1L 4M7ZC 5E8EB 1A5FH 3MOAL 1Y6MR 3OHXA 2QQLH 1A4KA 2H1PH 4WU7A 4KJQC 3K74B 4LSDA 1KEMH 3ES6A 3WN5A 5E7FA 3OJMB 3GSXB 4YGVB 5C2UB 1CG9B 3LMJH 4EJ1C 1QSFD 1P53A 2GAZA 5C0CD 4XI5C 3QUYC 1JYNA 1AD0B 2GY5A 1CTNA 3BIBX 5D1QA 4Z7QF 5FECB 4R26L 5E6ZA 2ZJSL 5E2TL 3TN0D 1CGTA 4NWUH 3PGCB 3SE3C 1WEJL 4K9EL 2XWJB 4TTGA 3MJGX 5EU6E 2X4NA 4LLUB 5I19L 1QFOA 1T1XA 4PD4K 5BV7L 5EUOF 4HS8H 2H32H 3M8OH 4C54A 4J3TA 3FQNB 5AZ2L 5BV7C 4K71C 4Q97A 1LK3H 3OR6A 3O3AA 4L8SA 2XTJD 5IEKA 1AFVH 3T2QA 2IJ0C 1ZLSL 5JQ6H 4LQFL 4ZOBA 4WU5B 5F9AC 4HGWA 1DN2A 4YEEA 2P5WD 4IM8A 3FQWB 3T0VA 1F11A 4JFFB 5DRXA 3LCYA 3RWGB 1EHXA 4KK6C 1ZLWH 5CLWA 3FN0L 5MHSD 1QACA 4UB0H 1BM3H 3NFPA 4HFUL 3PDOA 1L7TH 1XCTA 2XA8L 3T0EE 4HZLA 4WU7B 1FO0H 2UUDH 5EO1A 3ES6B 3WN5B 3L7FA 3QUYB 5L2KA 3TCLB 2NY2C 3QHFH 3MBXL 1I7RB 4G8IB 1JPSH 2PF6A 5EOTA 1PZ5A 2YKLH 4WHTA 1JL8A 1LP9E 5GJTH 5HPOA 1EERB 3G5XB 1MFAH 3DYMA 3F8UB 2WK2A 3RAJH 4MMZC 1CE1H 2DRUA 5E94A 2ZOKB 2D2OA 3BPLC 4PJGA 5EOCH 3STZA 1P5VA 1B0GB 3C6LA 3HAEH 3FFDA 3WS6A 4OFYD 3QJHA 1NANH 2D4FA 1ZVSA 1QFWL 3ILQC 3G6JB 4NNXB 2HRLA 5CEZE 5ID0A 4LPYA 2Z92B 3VCLA 3ME0A 4LDEB 4D0CA 3PGDB 1DQJB 1T5XB 3LZFL 5EU4B 2O5YH 5FB8B 1M4KA 4LOUD 3VU2A 5HYIA 5JHDB 5E6IC 2RQ8A 4HKXB 4MDIA 1GJIA 1R5IB 1UA6H 3MA9H 4JFFA 5HHMD 4R4BA 3SQOH 2W9DH 1QO3B 3I6LE 3DARA 2XRAH 1FV1B 5DK3A 2DLGA 4LSVL 4P23C 1T0MA 1JWUB 2KL6A 1XCTB 3V5KB 2FRGP 5FF6B 3WNKA 5GJSH 3ZZ1A 1YEDA 4KHXH 4HC1A 4KKAD 5D70L 1SQ2N 3TJEL 1AXSB 4FQJH 4ODBD 1QBLL 2JB6A 1RUMH 5AD0A 3IGAA 5CEZD 5DSCB 1GC1L 4UOJA 1WBZB 4LRIC 2EYRA 5KAQG 4HWEH 1K8IA 1VFBB 1YA5A 2XNAB 3P4MA 3QQ4B 5IB4A 5SWQA 4RGOH 5DJXB 4FTVD 4PRIE 5GGTL 1FFOA 3QZWB 3C6LB 3JWOH 4PJ9C 3QNYA 4U33A 2YXMA 5GGUB 5CAYB 4O4YH 4FQXB 3CPLB 2XWBA 1RMFL 1EUTA 3BP5B 3HC4L 4ZD3H 3VCLB 2UYLA 4JGJA 1IC5H 1AC6A 3VRIA 1BIHA 2R56L 1A2YA 4Z7QE 2WBJA 4NBYB 2XN9D 1X9QA 4BYHA 3OBAA 1YYLL 1LO5A 3EYSH 2LU4A 4OJFL 4OAWB 1BQLL 3V6OA 5H35B 3W5NA 4K7PH 5J7CC 5IJKA 5E6YA 3SKMA 4DKEH 3L3KA 2H2SD 3MNZA 2QHRL 3MRFB 5D93B 1MWAL 1ZVHA 1BAFH 3UROR 4OZ4B 3P9MB 2R1YA 1HNGA 4GKOA 1NLBH 2LE9A 3NABL 3ULUE 4PTTB 5J12C 2NLJB 3KPSA 2OQJA 5B39B 5HBBA 2NX5D 4HWBL 2ICEB 5ANMB 1WBZA 3MV01 1XIWD 4MLSA 1A1OB 4IDLA 5F97E 1K8IB 3MLTB 2DYPA 3VFGH 3P4NB 5LGHL 4YXLH 5T3XE 5DJXA 3IFLH 3PL6D 1OHQA 4OIBA 1MCPH 5JR1H 1EEQA 3KPMA 1F97A 3NABH 2QKIA 1NLBL 4OV5B 1HYSC 1KTDB 4LLAA 4TPRH 3GNML 4XMLL 2EDKA 1JHTB 4BFGA 2BXZA 3QQ3A 5FUOH 2L0DA 4P9HH 3RDTA 1JP5A 4D8PA 1S7QA 1YYMH 2ATPA 3DURB 5E24E 1KPVA 5DJ6B 1MWAB 3AREC 4PJDE 3Q1SL 2H8PB 1R3IL 3O3BB 1RIVL 4QKXB 5FUCC 5IT2L 4QRPD 4FTVB 1I1RA 3RUGA 1IAOA 4LU5H 1VSCA 3FO9B 1S9WA 4KRPC 3VXQA 1SY6H 1KULA 2QQQA 4XPBL 3SGEH 2P1YA 3SQOL 3IKKA 3KPRE 1R5VB 1X7QA 3PGFH 5IKCA 4JFHD 1I85A 2NLJA 4LARL 1H15A 3VFPB 3HPLA 2CMRH 3KPNA 3IFOA 4AIXA 1TZHA 4FQQA 5F7HA 3HG1D 4PJ7B 1NCCL 3HR6A 1FL5A 5J3HC 4X6CB 3V7AE 2V2WB 3SJVA 4I3RH 2YA2A 1I1YB 2WUCL 1NFDE 1JRHL 3MRRB 4RIRB 2VWEE 3H9HB 1FVEB 1I3GL 3R0NA 3BD5A 3KPSE 1MAML 4NM4H 1U8LB 4QWWD 4Y8AA 1NCNA 3ARBB 4HIEA 2YC1A 4MA3B 4ETQA 2SEBA 4EI5B 1CFQB 1VEMA 3QUMA 5BXFB 3HS0B 4UBDC 4WTZG 5I1AB 4O2FB 4UUJB 3SDCA 4GRWE 2M8XA 5FYLH 3RZWA 2Y7QB 2IFFH 5DS8A 3MV9D 5EWIL 4WIQA 3PWPE 4LLQA 4WUUB 3IDMA 2ATPB 1LD9A 4G6JH 4P4RB 1KT2A 4WWKD 4TUKL 4NBZB 2LTQB 4R2GD 2DQUL 2P5EB 4RAUB 3KJ4B 3PUCA 4PG9B 1AQDB 1ETZA 3HAEA 4AK1A 4ETYA 1FE8H 1DQDH 3KLDA 3OKMB 4CN6A 3TO4B 4L4VB 1X7QB 3C8KB 2HFGH 2NY7L 3HMXL 2XQYG 1IGYA 3C60D 5FO8A 5GGSY 2DD8L 4GRMA 4PJBE 4PJCE 1CGYA 4Y4KC 1MCCA 1ZA3A 4HWUA 3TVMD 1HNFA 3S4SB 4AIZA 2CKBL 3MRRA 5K9QG 3DRTB 2JB5L 4G6MH 5HHNA 4YGVA 1CG9A 1F3JA 3TIEB 1U2CA 1C8PA 1T66D 5E70A 3DYPA 3IU3A 5IESL 2GJJA 3QHFL 4N8PA 4EI5A 1D5MA 3O9WA 3QFDA 1VGEL 1C08A 3RNQB 4QRTB 1WT5A 1NH6A 5IVZA 5LBSH 1IQDB 4JG1L 1CICB 3SDXA 2R4SH 4R0LC 3O6KH 1S9KC 1MJ7H 3ZKND 4NM8H 2X4NB 5KVGL 1K6QH 3CH1B 5KOVC 4PJXE 1C1EH 4LLQB 1JPFA 3NIFE 3MJ8A 4OF7A 2DL9A 2VLKE 1PG7L 4N68A 3VJ6B 4PGEB 2YD7A 3AC0A 2EEDA 1MCOL 1FG9C 4UDUB 1BVZA 1NPUA 3FCTB 1Z9LA 4GW1B 2GK2A 5E2UL 1M71A 1D7FA 3RVVC 1RJZB 2VXSL 1FNHA 4JQVC 4MA1C 3X13B 2ZCLH 3T4AB 4ZFGH 3QIBC 2V9TA 5HHOD 1HSAA 2HYMA 1NCBL 4QHMB 5FM5M 4ZD3L 3GFUA 2CKBB 1RIVH 5SX4I 2X9WA 5JW4R 4MNHB 4PGJA 3CSBA 4POUB 1BBJA 3T2NH 2G5BA 4MAYD 1ZMYA 4OF5A 5IBTL 4LKXB 5IVXF 3TCLA 4S1SH 4XMKH 3TBVB 2OSLA 4JZNA 3U7WH 5DRWA 1I1AB 4M48H 1FFPA 2QQNL 2AQ3A 4P2QA 4WENB 4F9PA 4YHIB 2D03L 1YY9C 2QBWA 1U93B 4QRTA 3T0DA 4P9ML 1T83C 2DYPD 1I7TA 2AP2A 1Q0YH 3STLB 2EYTB 3EGSA 5KVDL 5MENE 1WSST 2ZOKA 5C0JB 5E00A 2E6QA 3VD4A 3MJ8B 3HKFA 1TQBC 5FA3A 5FM4A 2N4IA 1JJUA 1WC7A 2ZG2A 3RVXC 3FRPA 1JTTA 1N0XH 3E3QE 4MJ5A 4LCUA 5DUPL 1EBAA 1MCWW 2NR6C 1JPGA 4FQXC 1TNMA 2Y6SC 3PF2A 4G9FE 3RDTD 5L2JB 2GI7A 4OT1H 3VWKD 1LDPH 2A0LD 3G5VA 3AU1B 3GMQA 3QULA 1SY6L 3BMWA 5B39G 2BJMH 3BQUC 3AGVA 4L4TB 4JPKH 1U8OA 1ZS8B 3ULUF 1JF5A 5DRZA 3F5WB 3FFCE 5FGCE 1KC5H 5A2IH 1IGTA 1A0QL 1N6QL 4L3EA 3U46B 2IH3B 3QCTL 1CE1L 4UTBL 2HLAB 1C1EL 3LKQB 3IS0X 4BH7B 1ULVA 5AEAA 3X14A 4C83A 1A3RH 3CVIL 3DO7B 3STLA 12E8H 4JZJA 4UINH 4TUJA 4RFNC 2CUIA 3PG2A 1BJ1H 3LQZA 3OR7A 4P23A 2YSSB 1BHGA 4XCCH 1FFOB 1OWWA 2ADGB 3IU4L 4YXLL 3O4LB 4GO6B 4I3GA 4PYHA 1WWWX 3GJFA 1UWXH 1J05B 4LPVA 2FO4B 2XACC 4OD3L 1VFAA 4HS3B 4ONHB 2Y36H 5M7QA 3A0OA 1OL0A 32C2A 4ODHH 4U1JA 5FA4A 3ZE0E 3J7HA 1TDQA 3RVWC 4LSRL 5HHPB 3WS6C 5EZOL 3WFEH 2LU7A 4C57C 4XC3L 1RFDL 4OTXL 4MSWB 4YDIH 1J1PH 4Q9CA 3WIHA 4DEPC 1IGIH 4MJID 2WSKA 1DBMH 1F00I 4OCXH 5BO1H 4G9FD 4NWTL 4KXZH 1MHPH 4JHWH 3VGBA 2VLLB 2IH1A 3HUJA 1N3NB 4MWFB 4M1GL 5D1XD 1FGVL 1A7RH 2EH8H 1HIMH 2Z91B 1FL3B 1XFPA 5GGTA 3ZKQD 1D9KB 1U8QA 2Z4QA 3WFEL 5DMIH 1EO8L 4LEOB 3BE1H 1JGEB 2RR3A 3FB8A 3SDAD 2B8OT 5J9PB 3MUZ1 4MX7B 4RMSA 3NIGE 4WFED 3VXNB 1J05A 4HKZB 4WTWA 4Y5VB 3FB5A 1JFQL 4YHKL 2J8UB 2C7UB 3DHMA 1KTDA 4LL9A 4NQCA 4UV7H 3C08L 4MJ6A 3LSOA 4ZMAT 1IZKA 3QQ3B 4I3SL 3WFDH 1PY9A 4U1NB 4RBPH 5DHVA 4KROD 1A02N 5L88L 2P49B 2APFA 1T7YA 1PJ9A 4RRPA 3MV8E 3RGVA 2CIIB 5E8OB 2P5WA 3K1DA 4QTIH 3BO8A 3HI6H 1NMCC 4NKIH 2X4PB 3LAFA 1YEEL 3N50A 2AJVH 1MCRA 5KSVA 3IU4H 2BNQB 1U92A 4CMMA 4OUOA 5FYJD 2HKFH 1ZLVK 5E6ID 1J5OL 2ESVA 4LOUC 2HVKA 3X12B 2EC9T 5B3NA 4LGRB 4UILH 4KMLB 3ZDZF 4CJ0A 4YK4C 4ZUTB 2C4FT 3HA0A 3LDBC 3P0YH 4R7NA 4GS7C 4ZPTA 1MEXL 4LLMA 3FOLB 2PO6C 1QPPA 1MUJB 1CU4H 4XBPB 5C2BL 4P59H 1HOCB 1D5BA 2BVEA 5IBUB 1YEHH 3KS0H 3FONB 1MQKL 3EOTL 2HT4D 4OLZH 1UQSB 1X4ZA 1E28B 5CINH 2YPLD 2HT4C 4ZDHB 1S5HA 1AR1D 4JE4B 4YGAB 5E2WL 5JLZA 3BQUA 4JN1L 4RGMC 2AQ2A 1UWGH 4YXHL 5KSAB 4RWYH 2F58L 5FCUL 3KLHC 5B4MC 1KLUB 4NSKA 5F1IB 3L3JB 2IMMA 3NFNB 4CU8A 2I27N 4XNQA 4OZHA 3OSKA 3UMTA 4L4VD 4WW2B 3VFUB 4I77H 2FR4A 4PRPE 5KSVB 2G60L 5IB3A 4PJFE 3O8XD 4QRSB 1EUUA 4M8QA 4O9HH 5TGBA 3EYOA 3PJSA 4RMVA 3INUL 2DBLH 3ARBC 3QEQA 5HI3C 3GSNL 2X44D 3U6RA 5GHWH 3H0TB 2VAJA 4P99A 1NC2A 2IAMD 3OXRB 5BW7C 3S36H 3DUHA 4RDQF 1MIML 5C0CE 4X9IA 5CGYD 5I8OH 2QR0B 1PFCA 5C0GA 2ESVE 4CL7A 5LCVL 4EUPA 1U58B 2NXZD 1E28A 3I2CH 4Y2DD 4G8FA 4GAJH 3VFMB 5IW1A 3JWOC 2VH5H 5IVNA 2WBWB 1AR2A 4QHNB 1MY5A 3LKRB 4U6VL 3SDAB 2QQNH 4HBQA 4R96A 4PRHD 1CIDA 3ZDYE 3RWFB 1MRFL 3PV6B 4L1HA 5KVGH 5I9QC 4TSAH 3MZTA 1FH5L 1ZT4A 3QDMB 3QDJA 4C56A 1DBBH 4JO3H 1KLUA 5F1IA 5D1XB 3HE6A 4YFLI 4GW5A 1INEL 2ID5A 1MCOH 1YEIH 5L8KB 2CD0A 4NCDA 2X4QA 4NKMA 1YZZA 2BFVL 1ZSDA 3DMMD 3T65A 3HMXA 5TGBB 5DRNB 3JV4A 1R3KB 4OGAD 1M71B 5C0EA 3MJ9L 5DD5H 3QIWC 3GJFH 3NAAL 4Z95L 4NO5A 2F19H 4OCXL 1RZIB 3OAZH 5HDLA 4NFCA 3O2DH 3O81A 1FO0A 3EJYD 1OP3H 2IF7A 1WTGT 3BHBA 1KXTB 3V2AR 4NM4L 3VGEA 3LKPA 3B9AA 3PQYB 3U30B 4XMKL 4ISVA 3WIHH 3CU1A 4JZNB 4E42A 15C8H 1YPZB 1GOHA 2BHYA 2OLDA 4P2QB 5HI3D 5EOQH 3HG1B 4EKXA 1OTUC 3THMH 4C4KO 4P57A 2UWEB 3ZYOA 3MRHA 3SDAA 3P0VL 4I13B 1NMAH 1YPZE 2P24B 3RIFK 3RWFA 2RBLA 4N5ED 3PP3K 2X70B 4WI9A 2X4TB 4NC1C 3V6FA 1BFTA 3GB7B 1KJ2H 2X4SB 4X80H 1QFUL 5CEZL 1DVFC 5IWLC 4NO0B 2HG5A 2X4QB 3GSRB 3I3EA 1Z3GL 2HT3C 4XZUA 4PRHA 3LDBB 5GRWA 5HVHC 3IXAA 5DRNA 1KIUA 1JHLH 1MCNA 3NCMA 2X7LA 2YUWA 3QXVA 4NZUH 4UNVA 5C0EB 1RULL 4KJPC 1YUHA 3P2TA 5E8EA 2A9NH 1IKNA 3VWKC 1I7UA 2EIDA 4X8XA 5KSBB 1A6UH 1ZHBB 3AFLA 3BI9X 2I25N 4NRXA 4PREA 3ZE2E 5I66B 3F5WA 2R2EB 4LPXA 1EGJH 5C0AB 4GMTL 1JNHB 3WJJC 4MB5A 4IMLA 2BOBA 3O3DB 3N0PB 2ZCHH 2QJDA 3PGCA 4NN7B 2F15A 4XCEB 5IQ7H 3LH2H 5HGHB 3RL2B 2XICA 5FKPB 1OSPH 3G6DL 1ZE3C 5HVWA 3B9EA 1I1FA 1HHGA 4MD5A 4JZJB 3QEUB 3D69A 3MNVA 2J4WL 2EDFA 4MAUH 1P1ZA 2ADGA 4I2XE 4WI6A 4NDMB 2HN7B 4KK5D 2JJTA 1KG0A 4POZC 2Y9RT 1W72L 2XXMB 1WFTA 2WNGA 1LO0L 5EUOA 1X3DA 1QQDB 4HZAA 3M17A 3ARPA 1OSPL 2GSGB 3P73A 5E95B 4LLYB 4A6YH 1OAXL 2XN9B 2E8ZA 4EDXA 3BT2H 3RL1B 3V6ZB 3QB7C 3MXWH 2J4WH 2V7HB 5CZKA 1U8NA 3EDFA 3S35L 5HGAA 1ZHBA 4XH2A 4X6CF 1V3JA 4JM2C 4LAQH 3M07A 4M62L 2RFXA 5J57B 1R3IH 4GOSA 1A6TB 4QF1A 1F4WL 2PYED 5C6PB 3QEQD 4IMLB 1OW0A 1SBSH 1IGFH 3G5ZA 5T3XH 4ODSL 2J6EH 2UVEA 4NC2B 1DLHA 1S7WA 5BS0E 2FECL 4IRSD 4NO2B 1KNOB 1YEKH 3BGFC 2MCG1 1DEEA 2X09A 1RIHH 5KN5B 1U8QB 2Z4QB 4XCYB 5CUSL 4GQ9L 4XP9H 2BY1A 3MSPA 4BUHA 3MLWL 4N9GA 1T0NB 2NXYB 1B2WL 5DMKA 4MJIA 2CDEB 4Q6IC 4X9FA 1W72B 5F3HA 3OJ2C 2HVJA 3VXNA 2HWZL 2Y07L 4P5TB 1OM3L 3L5XL 2D0FA 1YEJH 5EUOB 1QO3A 5SX5H 2GSGA 4J3XA 3IFPA 4LFHD 1UM4L 4PUBH 1O5DT 5BRZB 2V7HA 2FDBP 4OCMC 4QRRB 3SO5A 5E8OA 4DVRL 5AYUL 3LHPL 2F53E 5I1GL 4PV9A 3CH8A 2BSED 1H3XA 1VFUA 4XBGB 1MRDH 3H9SA 2NY1B 3HFMH 1J10A 3PABB 4NQSB 1JF1A 2NY1D 3NPSC 5DSCA 2DMBA 4KI5E 3TH2T 3RIAK 2VWEC 4F58H 1BD2D 3HMXH 5IF0B 2RIKA 5DD6B 5J13C 3QEHB 4X6DA 4LLMB 5E99H 1IAIL 4F7EB 4TSCH 3D2UA 5HGBA 3QG6A 5GJTL 4OFVA 3F6LA 5CZXC 4NQDB 4P5MA 5A2JH 1QR4A 5EU6D 1RVFL 1PZUB 1U8JA 4PRPA 1A6AA 2XWBB 2KZWA 3BP5A 1T7ZA 4F9LA 3LKOA 1T04B 3WFDL 5DGRA 1G7HA 3BD3A 3GGWB 4ODXA 3FT2A 4QRQA 5GGRA 4HWEL 4H88L 4LGPB 2G2RB 4P5TD 2GTZA 1OAUL 5I74C 1UH4A 1GIGL 5D9SA 3L5IA 5C6WH 4QNPE 5DC0A 1BOYA 2NXYD 4QHUA 3TO2A 2ERJB 3VFTA 2CDGB 4BFIB 3RVXD 3P30H 4PLNC 2NY4B 1QPXA 2UUDK 4QTHB 2IWGA 2R56H 1BEYH 3VFUA 2FJFB 5BZWA 3CAFA 2GQHA 2GY7B 3CFEB 1LK3L 1FSKC 1JRHH 2WZPD 5DQJA 4QRSA 5IP4A 4LSTL 3HCVB 4FZ8H 5JHLL 4XBGA 3BP4B 1I3UA 5FCSH 1ACZA 4NQSA 5GS0H 2O61B 5KAQF 1YY9D 3GSNH 3RWEB 1NGYB 3SKOB 4HLZH 3VXME 1CYGA 1N59B 3IAGC 4O2EB 4X80L 1GGCH 2NY0C 2R0KL 3VXTB 2Z8SA 3RAJL 3QEHA 3TN0B 5K9OA 3P4NA 3BISA 3K2UL 5DUMH 3D2UB 5HGBB 1MIMH 2XYCA 4OUUA 2V2TA 5GPRA 1KELH 3K8MA 3SE8L 1OF2A 5FDWA 4QY8A 2GT9B 4PJXB 3WLWC 2JIXB 4K2UH 5E5UB 4OV5A 2ARWA 5GRVK 1XGYH 5IW1B 3VFMA 1K8DA 4Z7UA 4RMWA 1VKXB 3WV0A 2F58H 5FCUH 5DK0A 4UOW1 3T3ME 5I8CA 2XZZA 4LHUB 4IDJL 4P9HC 1XIWC 2X10A 1P2CB 1S7RA 3DX9B 3D5OF 5BV7H 2B39A 3ESUF 1XMWA 5CGMA 4B41A 1CIUA 1SM3L 2IANB 4K9EC 1ZT4B 3QDMA 1KJMB 2IADA 4KZEL 3O3BA 1YQ2A 3LEXA 4FMFA 5I1LB 4GKZB 4I48A 4DUXA 1A22B 3DX6A 3VXQB 4QRUA 3BJLA 3KPRD 3JV0A 3KJ6L 5J11B 1CDCA 4BQ9A 1ZSDB 3T65B 4F15C 1CFNA 3MLSH 4WO4C 5I1DA 4P2RA 3PWJA 2EIBA 1TJHH 5ETUA 5IBUG 2X5PA 4JY4B 1ZHNA 1TZHB 4RDQG 4TUKH 1N59A 3D25B 4BKLB 4X7SL 1A4KB 4I0CC 3F12A 1BFSA 2JIXD 1I1YA 4RZCA 1EFXD 3NIDE 4OUUB 4FXLA 4JKPH 2CLVB 4GKNB 5J6HA 1IT9H 2BVQB 1UB5A 3D0VB 5JOFA 4AQOA 2E7LC 2JK5A 4M3JA 3TVMA 2NTFB 2VKWA 4KC3B 5FAAA 2Z93B 2VDNL 3HS0A 3WO4B 3WLBA 4BA8A 2ZPKH 4YPGB 1MH5A 3DYOA 4UUJA 4LHUA 3D9AL 1Q9OB 1FFNB 4D0BA 2UWEA 4LLUA 4PRAA 3MV8D 2HFTA 2XV6B 4APQC 2I26N 3MGOA 4RMTA 1JGLH 3FQNA 1MCBA 2NY3D 2X70A 3I6GB 2XPGB 3FQUA 5ISZB 4WWKC 1G7LA 2IPUG 5KZCB 1H8NA 1FYTA 3OF6D 2F9BT 3KYOA 3MRGB 4UT7H 1OAUH 5BJTA 4ZXBD 4PRHB 1TTFA 4JLRB 3FQXB 1WICA 5DR5H 4LU5L 2R2CA 3D25A 4U49A 4MXVF 1QBLH 3MA7A 1T89A 1NANI 2UZXB 1I75A 4AIZB 1TVDA 3V4PH 3UDWC 2ZJSH 2R2EA 3CFKB 2DI8A 3TIEA 5CFHA 1YMHB 3UYRL 1PZ5B 1RPQA 2YUXA 4MS8D 2O93L 1FNGB 2J8UF 2Z93A 3TBYB 1Q1JL 5C8JB 1AO7B 4S2SB 4TOYL 4ZUVA 2XTJB 4PJEE 3RZCC 4M6AA 3B43A 4W6YB 4Y2OA 1FG2B 4OZFA 1HHGB 4MD5B 1C5CH 2HAZA 3STZB 3MGOB 1RU9H 4K55A 4XHQA 1YDPB 4L29B 5C92A 4Z0BL 1NFDF 4WWKA 3VD9A 1ZVSB 2WINA 3UYPA 3U9UA 4UDUA 1FYTB 2HN7A 3EOAB 1O0VA 2DQJH 3PGDA 3FCTA 2XQBH 2R4SL 2WW8A 1UVQB 4ZNEE 5L7XH 1KJVB 1M6OA 2K3TA 2UWEE 5BJTB 1D5XB 4HKXA 1L7IH 1BAFL 4ESKA 5TE4L 3ULVH 5IJKC 4XGZB 4POYA 1C5CL 4ZO9A 3L5XH 2FHCA 4NPYB 4KV5E 1DVFD 2CKBA 4XVSL 5H94A 3GUTB 4X9BA 2R1WB 1D6EB 3OKNB 1U8NB 5I18L 1JRHI 3GMLA 4XH2B 2FX9L 12E8L 3AMKA 4U3HA 2V2XA 3BKCH 3MLVH 1CR9H 1NEZA 1U91B 2BOCB 4OF8A 4N1EA 3SKNA 2OMNA 4YHLL 5AWNL 1TJHL 1JGDA 1OP3K 4NUJB 2WP3O 2DB8A 2JB6B 5TE4H 4PRNB 5T3XL 4XAWH 2OI9C 1HKLL 5DXWA 1E4WH 1KXQE 5HI5D 2R4RL 4Z5RB 4LVHC 2EYRB 3SDCC 1G7IA 1F3RB 3KPTA 1WTLA 1TQCB 4HXAL 1IC4H 4HJ0C 1KB5H 4JQVA 2PTUA 3JTTB 4U6YB 5FYJL 1F58L 4OI8A 3FRPG 4K7PX 1Q72L 4XB8A 4HCRH 2F53A 4S1QH 3REVA 2HFEB 1QSEB 4LCUB 3DV4A 3LQMA 1LO3H 4D3CL 3D9AH 3G6JE 5F9JB 5MEQA 2N7AA 1S7TA 1SJVA 3G08B 1X5FA 4K94L 3ARDB 4KRPB 4Y5XB 2QSCH 4IHOA 2VITA 5IIEA 4YK4B 4OFIA 4F7TA 1K9TA 4Y5YC 2R1WA 3MBEA 3GO1L 1OCWH 3MCKB 1CL7H 3BAEL 3V5DA 4U3XA 5JO5B 2AEIT 4LCCA 3MGTA 4CKVX 2EDRA 1YN6A 3K8LA 3ZDZE 3O6ML 1R3HA 5FKAA 5BOPA 3D3VB 4N8VB 5J11C 4KRMB 4O9HL 3GEWB 3CSPA 2MNUA 4PJ9B 1AP2B 5E6IB 3LH2L 4NQEB 3ARYA 5FHAH 4C83B 1T20B 2EE9A 4YHPB 1EZVY 3CX2A 4YHNB 1LO4L 4WI2A 3BPNC 4G8GB 3F62A 5DO2D 1Q94B 1SYVB 3QH3B 4HCRA 4JRYE 3TGXA 3VDBA 1YMME 1BZ7A 4DZ8B 3T0XA 1D3CA 2DWEA 2QKIB 1D5ZA 4HWZB 5CS7A 2Y06L 3TJHC 5HVGB 1VADA 3ULVD 4XNZB 4QRQB 2HJFB 4NRZA 5CJXA 2VTFA 5F9JA 5MEQB 2BSTA 5HYJB 4U1JB 1W0VB 3BKYH 3R06A 4NP4L 3QG7L 3QDGA 3N85L 5DJ6A 5C0AE 1C12A 1K6QL 3T0WA 1JMXA 3MMEB 5ICZB 1D9KD 3RUGB 4FNLL 5B4MD 2VZ3A 3HE7C 4KGLA 2XZCH 1F5WA 1AKJB 2VRAA 3DJ9A 5CKAA 4GG6A 3FO1A 4PBWD 1YN6B 5L6YH 3UX9B 1ZA6B 2XQYK 4QOKE 5EULV 1U2HA 3HUJB 5J13B 5GGRY 1N64L 1ZLVH 4LVOC 3RGVD 4HIHA 1AE6L 2VLJB 1RUKH 4O2CA 2YWYA 2Z31D 2GW5A 2DQGL 4UTBH 4X6CA 3MBEC 1DCLA 5K9OB 1JGEA 2YXFA 1ED3B 2MQ3A 4TRPH 2DN7A 1KN4H 3U7YH 5HYJE 1MELA 3RWDB 3BZEB 2FYYA 5F7EH 4RFOH 1RZKC 1FNEB 8CGTA 5CZVH 4HIEB 4OCLC 4JHBA 3EYSL 4PJXA 4A6YA 1RZ7L 4OZFH 2ZG1A 4JQIL 1NL0L 4GBXD 4PJDA 1P9MC 4HWZA 5BXFA 4JANB 1KPUB 2NZ9D 1RZ8B 3OKLB 3X3GL 3SGKA 3S37X 3U0WH 3TP4A 2OTPA 4LRIA 3HLAA 4LSQH 3KPRA 1BFOA 3O6MH 5IB1A 5I1JL 2V5YA 3O6FB 4U1HA 4JDVA 2NW3B 2IQ9H 5TDNB 3MMEA 5E7BA 1SEQH 4NQED 3DX8A 5DJYA 3PE9A 4JDTL 4K7PY 5C0IA 4O58L 2AABL 4CU7A 2YPLE 1SEBB 2KDGA 5LGJB 2I07A 2PYFB 1ZA6A 4S1DD 5I17A 1AGFA 3DXAB 4LLWA 3TN0C 1MHCB 4IJ3C 3JWDC 4HJGA 1EIBA 5KVFL 3O4OC 5E99L 3FOLA 3LZFH 5C08E 5GXBB 4LF3A 1CCZA 1AD9B 1ZA3B 2I9TB 2H6PB 3IXTB 4P2OD 2JJVA 3RQ3A 2NY2B 3EDEA 3IAQA 5CILH 5HHNB 2CRZA 5DEGA 1FSKB 3RVUD 4Z7VF 4JDTH 2A6KB 3D87B 4S1DC 4Y4FA 1IAKB 5L6YL 4HXAH 4OQ1A 3IU3B 2O5ZL 1J1XL 2WWMC 3BUTA 5FGBC 4DUVA 2AVGA 2R8SL 4P9MH 4V1DB 2RAMA 3SDXB 1Y6KR 4JKMA 1V05A 3WNNA 3G04A 1UG9A 3H7BA 1GZQA 4PRAB 2GTWB 3KPRB 5IB1B 4HUXB 5BVPL 4HF5L 4U1HB 4K8RH 3N1PC 3VJ6A 1OAYH 4K71B 3GDBA 3TT1H 3TWCL 3S3PA 2FL5B 3VXUE 5KVMC 1NGZA 3ZDXE 2Z8RA 1SMAA 1U42A 3VFGL 4EQ2A 3ILPB 2DQIL 3ECBB 5D96B 5ALBH 5LGJA 3VD3A 4F58L 2ZUTA 4YAQB 3EO9H 2PYFA 1LILA 3RPIA 2WLZA 3TT3H 1NUNB 5JW4Q 4KDTA 3BP6A 4EBQH 2J7LA 5M95B 4JZOA 5IR1B 3H0TA 5EBWB 3QUXB 5L2KD 5F70A 3QIBB 1Y6NR 2IPTL 3CVHL 4NNYA 3OXRA 3CLFL 2F5AL 2VC2H 3CFIC 3MBED 4JPKL 4NCC1 1RI8A 4L3CB 5EDXA 3MA7B 5E8NB 1G9NL 3M1BB 1EMTL 1CK0H 1S7VA 2PETA 1TZGH 1B90A 4DQOL 4JJ5A 3U4BH 5C0RH 3E0GA 4Y1AB 4JM2D 4BH8B 2YD2A 2BHZA 4P59L 4DAGL 2JTDA 2UZYB 3D0LA 4ZO8A 4BK4A 3I02A 1QNZH 3VA6A 1AE6H 3GIVB 3MRQB 5D8JL 2FNBA 4Z7WA 3MRMA 5DD1L 4S2SA 1DE4B 1OTSC 5CGTA 2HFFA 2OK0H 3MGAA 2FBOJ 4NNPL 4XPAH 1JZ5A 5DC9B 5E00B 4U1LB 5ESQA 3O0RL 2YPVL 5ESVB 2NCMA 2DJSA 4PRHE 3CFCL 4KQ3H 3HE6B 5CJOL 4GG6E 1XAUA 1OTUD 1NCCH 3O6LL 2EXWD 2VH5L 2PNDA 4YFDB 4M3KB 4MXVE 5HDBE 1C7SA 4LCWA 4NP4H 4TYUA 2FO1A 1DQQA 5SWSD 5IFJA 1J0IA 1MRFH 3RDTC 2C5DC 1RMFH 1A7NL 3K1KC 1AXIB 2ZCHL 3TA3A 3EFFB 5HHVL 5DO2C 3GKZA 4L8BB 2OTUB 3PWUA 2O5ZH 3OKNA 1D6EA 4TULL 5CEYB 3K4AA 3QI9D 2VDQL 4GRLA 1LEGB 4L3EB 3U46A 4Y1AA 4LLVB 3NH7L 1UGNA 3HZMA 3L5WA 2IPKA 3LS4H 5C09D 3OB0H 2B1HL 4NUJA 1T5WA 3W0WA 3LKQA 4DOHE 2BVUA 3B6SA 3SJVE 3MRMB 4NC1E 3PDDA 3KPPA 3B9DA 3KWWB 3CUPA 3DO7A 5ISZD 2AJZA 3VG9B 4K3DL 3LQZB 3OR7B 2EKJA 5IBLC 5CMAB 3JTTA 3QDJD 4OF0A 5C07E 3EIFA 1INDH 1RFDH 4FQPA 4OTXH 3HRPA 2DLFH 5LWYL 4OI7A 3GJFB 3EHBC 4NO0A 4HIXL 3ALWA 2EC9U 3DV4B 43CAB 5A1AA 5E1AB 1KYOK 3CXDH 3GBNL 4TVPH 4DK6A 5I15H 3PHSA 4Y5XA 1K4CA 2VDKH 4DN4H 1TLKA 3VFOB 3EDJA 3TA3B 3EFFA 3L3OA 4J23A 3KLAA 2FJHB 4MSWA 2MWCA 2R2BB 1T1WA 3VFSA 1Q9WA 1DBJH 4CBPA 1HH9B 2O5XH 1MF2L 4NRXB 3P0YL 3OGOE 3LN4A 4PJFB 2MCPL 2F19L 3V5DB 1N5AB 1T2QL 1T1YA 5AZEH 5CEXA 5JORB 4RAVA 2A6IA 2H2SC 2R4RH 1D6VH 1J5OH 4HEPG 4G5ZL 1TJIH 2A9NL 1AIFB 4MNGB 2VMFA 3FFCB 5FGCB 2PW1B 4OKVA 3WIIH 3DV6A 3HE7A 5HGHA 5FOJA 1QLEH 3QIWD 2A77L 1D9KA 1MCIA 4GKSA 1BMGA 1HXYA 2QL1A 3QEUA 1U8KB 5LAXA 1MQKH 5GQBA 2CK2A 4HGKC 2AERT 4WV1A 4D94A 2BNUB 4NDMA 4LHUD 3W9EB 3WXVH 3ZTNH 5C0AD 3O9WD 1FN4B 4X5XA 5C9JB 3MREB 1TCRA 3SDDA 1VGKA 2FIKB 4PGDB 5CD3A 5I76B 2FJGA 3DETC 1MVFA 4L8DA 3VMOA 4PB9H 1EFXB 2WWMD 1QQDA 1FAIL 3B2UD 2BMKA 5F7NC 4U1NA 4M1DH 1U8HB 5DMJB 4FABH 3BE1L 3V6ZA 3WHE0 3KG5A 4W4OC 2C3VA 5EN2B 5JPMB 1ORQA 4H20L 2XKNA 1NC2D 2IAMA 4PJBB 1BZ9A 2FBJL 2G9HA 3RNKA 1Z9OA 2DLFL 1NDGB 4MS8C 2H32A 5CEXB 2XIDA 2VXUL 3FB6B 5F71A 5BZDB 4ZODA 2WV3A 3DI2B 4YXKH 3X3FH 1FFRA 1HKLH 2DKMA 3IDJB 1QSFE 2PW1A 2XKUA 4OKVB 5C09A 1ZLWK 2P5EE 1MRCH 4RSVA 3PWPB 4H88H 4WUUE 2VLJA 4O2CB 2C1OA 4KK5C 4TN9A 3GK8H 1D5BB 1UM5H 1CDUA 1JVKA 4KPHH 4WEMB 3GSQA 3QYCA 1WJ3A 4HMEA 3S9DB 4G6AD 4PJCB 3ARFB 4UTAH 1WF5A 2E27H 5F3HB 2AV1B 2E9WA 1QBBA 5DA4A 1S5HB 1AGEB 3RY5A 3C6LC 4HPYL 4FQ1L 3ORJA 4ZPVA 4CVUA 1G7PA 2UZIL 1RIUL 1EFXA 3JZ7A 5ADPL 3BD4A 5JHDD 4F7PB 1ZWIB 2HMIC 8FABA 4RQQB 3HLAB 4XVUD 3UTSD 1KEGL 2C3VB 3IF1B 4KY1H 2F54B 5EN2A 4RMQA 3O6FA 4OZHB 4B7LA 2VQ1B 3BESR 4WW2A 3FTGA 4OB5H 2LAGB 1NBYA 3DX8B 2G5RA 5DJYB 2R9HD 1QEWB 4RMRA 2NX5A 4UILL 3CC5A 2AJYL 5GS1C 4ZFOB 1NFIB 3RRQA 4NZRH 2VLRD 1AKJD 1NUGA 4GJTB 5JPNB 5LXGL 3P77B 1N4XH 1WBXB 4K2UL 4O5LL 1M7IB 4JFEA 5C09B 2P5WE 1P7QA 2ITCB 2LQRA 2X89D 1MHCA 4J3OC 5JIIA 2HA1A 4JPVL 3SPVA 2YEZA 5IV2B 4F7CB 4S0TD 3WUWA 3WKML 3V8CA 2J88H 4LDLB 1T89C 2VR4A 5BRZD 4JRWA 4JM4H 4G6KL 3M8OL 4BZ2H 4NRYA 4G7VH 2PXYA 2Q6WA 5T1LA 4NQCD 3V0VB 2J5LC 2D7TL 3UPCA 5DEGB 5T1MA 2OJZL 4NZRL 2P42B 4NQEE 4PIRF 5CUSH 1T04A 2X1QA 3MTRA 1IAKA 1RUPH 4ODXB 2AK1H 4K3EH 1JPST 4X6FA 4ZPVB 4YWGH 4KROC 5F7WC 4JFFD 2H26B 4IS6A 3DX7B 3LKRA 3JWOL 3MLSL 5DD0L 1A9BA 4QHKJ 2XZQL 3Q6FB 1CGUA 8FABB 2ADJB 4ZO7A 1GZQB 1SJHA 3CCHA 5C0BA 2GTWA 4J6RH 2AEPH 3FQRB 1EEUA 1LP9A 2OJZH 2FL5A 2ORBL 3MLXH 5DMIL 3CFEA 4M1CD 1J7VR 5DQJB 3LN5B 3SKUD 3K4ZA 5KW9L 1QVOA 2BX5A 4FQ1H 3BP4A 1K4DA 2PYEB 4WNQB 1YNKL 2DIAA 2OZ4H 3RPIB 1KB9K 3RWEA 3ULUH 2OX5A 3HMWL 4ELKB 3IETA 3DMMC 1M7IA 4J6RL 4ERSH 3QUXA 1T7XA 1RZIA 3N1MC 2NY0B 1XGRB 4L3CA 4PJIE 1B6DA 5EBLA 4KKCC 1PSKL 2E3VA 5HHVH 1FO0B 4QYOA 4UNUA 3WFHA 4FZ8L 1V3KA 3BHBB 1MFNA 4ZFZA 2PXYB 2Q6WB 5T1LB 4LBEB 5FDWB 2IALA 3UBXG 2DQHL 4JAMB 5F1SA 3BIAX 5ANME 2H2PD 2IPUK 4I0KA 2O5YL 3ARGB 4YHML 4EIGB 2ZUWA 4JRXD 2OZ4L 5F7MC 4LNRA 4OFYA 2NY6B 2ERJC 1ZHLA 2B0SL 4P57B 1CN4A 3MRHB 3E2HB 4Y2DC 1MFBH 3VMNA 4CN1A 3Q6FA 2CGRL 4O02L 4P3CH 5D5MF 1UACH 3QPXH 4U1LA 3BEVB 1Y18A 5IMLB 3LEXB 4PB9L 1N4XL 3CVIH 2GITB 2AJ3A 4HJ0D 2ZUQB 2CXKA 4P5TC 1NKRA 2AK4D 2F54D 4Q2ZB 3MRPB 5FUOL 3GSRA 2A83B 4LCWB 4PY7A 4KAQL 2YUVA 1DQQB 1KCUH 2EDNA 2JE8A 5D1ZB 4H5SA 5DI8B 5JW4M 2PYEA 3PWJB 3MLYL 3VI3F 3SHSA 2Q1EA 4KY1L 1QP1A 1RJCA 4LCYB 4UT9L 5EFIA 4AT6A 2ARJA 4BKLA 4XB7A 2BNRB 1FQ9C 3GSXA 5HYFA 1LHZA 2YPLB 1KSRA 1Q9KB 3CU7A 3JSSA 4TSCL 4GKNA 3QIBD 4LRNL 2NNAB 2VXTL 4N1CA 2A1WH 1IGIL 3IJYB 1LEGA 5LGHH 1TVHA 4IRZH 5DVMA 2HLFD 3HR5A 3KR3H 3JUYA 5E9DE 3NGBB 1GAFH 2PXYC 4NOBA 3LRSB 3ARTA 1YN7B 1CZ8L 1QSEE 1LO2L 4NYLB 1MFCH 3A6CH 2E7LA 3O4OB 1RJLA 3QCUH 1B0RB 2YBRB 1JPTH 3IRZA 1J87A 1OAXH 3UTTB 1PEZA 3G6AA 1I9JH 1DQLH 4AEFA 4BJLA 4WUKL 4LRNH 2J5LB 4IDJH 4FXGB 1INDL 3NZ8B 4JFDE 2HWZH 4UOW0 1A7OH 3KNBB 1KG0B 5L9DH 3LEYL 1SM3H 3UPRA 3JWNC 1AJ7L 1G9MH 2BVYA 1JWMA 5I8KL 5DURD 5DEFA 1DVFA 5IWLA 5FFLA 3AB0B 4WFEE 1R24B 1NSNL 3MLZL 2XN9A 4EDXB 3OZ9H 4WCYL 4M61A 5DJZB 3GJEB 3K81A 5FHBH 4XWGH 4B50A 5DUBB 4IRSC 2LABA 2CMRL 1A14L 4QXUL 4NQXA 5D71H 3JWDH 3GIZL 3WE6A 1CVRA 3IDIA 3LEVH 5IM7B 1NGPH 3RA7L 1MHHB 2VNCA 4HH9A 3NTCH 5D7KD 1TVHB 4K7FB 3AS1A 1AIFA 3BWUC 3BP7B 5DVLA 2LFGA 2ZCLL 3HR5B 3ARGC 4YO0A 2VDOH 2QQKH 1ODAA 3HE7B 2A74B 5ALCL 4P46B 3QFJA 4P2OC 3IVKB 5DMGD 4HGMA 4XCYA 1YYML 1HXYB 3O6FD 4KTDL 2YPVH 3CFBB 1VERA 4NNXA 4XWGL 3BRDA 3NBNA 1OD9A 4N0YH 4OZHE 1YDPA 1EHNA 3VGAB 1GYAA 2CDEA 5B22A 5IMKA 3F7RA 4LSVH 2VYRE 1EJ6A 4QCIB 4OLVL 3L95B 1MCLA 1QSFA 1JCKA 4XRCB 1Q0YL 5I1HH 2DKSA 2O5XL 5FM8A 5D7JD 4XGZA 5DEFB 5F1OB 6FABH 2Q20A 2MSPA 1A6VH 4F57H 1CLYH 2AJXL 4U0QB 5BRZA 5FF6A 3QCUL 3LV3B 1GGBL 4M61B 5DJZA 5GZOC 1DQLL 2Q86A 4EI6B 2IAMB 3GZKA 3KLHD 2EDBA 3GSVB 1QNZL 4G8GD 1PYWB 1BWWA 5EU3A 1PAMA 3MOQA 4PRBA 4XPGL 3VXRB 5K59F 3QWOA 1UADC 4CNIB 3RY6A 4YDVA 3PHOB 5T33L 4YO0B 4FQLH 4JRYA 3F7YA 1TITA 2FWOA 3BPCB 3R1GL 4OI9A 5IROA 5AYQA 4HXBH 4NN7C 3SE3A 6FABL 1NBVL 3IVKA 3QZWA 1JPSL 2OYPA 3ROLB 3QNYB 4XNUL 5EZJB 5SV3A 5C07B 1A14H 4HX1A 5FHAL 4JRXA 5HYEA 1J8KA 1CVSC 3GGWA 2WUBL 2BVOA 3QHZL 2Y25A 3VWKB 4XNYL 4JO2L 4ZFFA 1F4HA 5H35A 4XRCA 2BDNH 2FX8L 4X5LA 3SKMB 2CIKA 4MJ2A 2HKHH 3GM8A 2QSQA 4IHOB 4XNUH 3RI5F 4Z7UF 3S34H 3VFTB 1Q38A 3I50L 3G5YB 1M1SA 3I85A 4NO3A 4BSVA 4YUEH 3P9MA 5B3JE 3GSVA 2EICA 4KJYA 4PB0L 5DK2A 4EDWH 5CHNB 2IQAA 1QEWA 1C5BH 2YK1H 4ZUUA 3CFDB 4HULB 1TTGA 3TZVC 2C3GA 2W0KA 3DTXB 3MLUH 1A1OA 1WGOA 3HN3A 1NGYA 1MREH 3A67H 2J12B 3WNOA 3I50H 2FWOB 3BPCA 1ZOXA 5KSUA 5BQ7A 3RP1A 1OY3B 4HC1H 3TBSA 4Z95H 5EU5B 1CICD 4YHNA 1HZHH 3MJ9H 4Y1AD 4MMXC 5EBMB 3GIZH 3ROLA 4MCYA 2NPLX 4PP2B 1XGUB 1BZ7B 1KLFA 3H3KA 3AVEA 4BSWA 1WCBB 1I3RA 1WLHA 1AI1L 2GT9A 1YNLL 4KKBC 1S7XB 3W81A 2DBLL 1GGBH 4Z7UB 5TF0A 1I9JL 1G7JB 2AJSH 2WM0A 4M1GH 4F37F 1BBDL 4PTUA 1W0VA 4PPTA 2CJUL 2MFNA 3RHWF 3B9VA 3O41B 3DURA 1S9YB 2FH8A 1W8NA 3PP3H 4QLRA 3QDGB 3N1FC 1FL6A 5E9DB 3CCHB 1HYSD 4FTVA 4APQA 3KR3L 2YMXL 3O0RH 4XC1L 4I48B 3MV7E 1MLBA 3H3PL 1LP9B 4KXZI 4CVXB 5EPMA 4KJYB 3VXSD 4GG6B 3LN5A 1QVOB 1H15B 4C56D 2NXZC 4KV5F 3RVVD 3SBWA 2NY6D 1LNUB 4NN6B 5D93C 4WUUD 4HMDA 1WIUA 2FZ3B 2PR4H 3EO0B 3T0EB 1KTLA 5MEOB 3DVIA 5C2BH 4NT6A 1I4FB 1L0QA 1N2RA 1L7TL 1XGRA 1CFSB 2GAZB 3WXVL 5EBMA 3SKJH 3ZTNL 4QOKD 4BQBA 3BVNA 3LD8B 1S8DB 4QYOB 2SEBB 4HK3J 3D0VA 3ARBD 5EUKB 1FNEA 4H25B 1JNNL 4YQXL 3R8QA 3TVMB 3BKCL 3MLVL 3QUZC 5GRJL 1YNTB 2W91A 2KQMA 3FO2B 3HB3D 4U1IB 2YD5A 1EHAA 4H0HB 4M6OL 3C9NB 5DD5L 5CBAA 1SVCP 2E5EA 2A1WL 3UTZB 3BUYA 3OKDB 1CBVH 5AG9A 3CDFA 2VOTA 1VFMA 2GJ6E 4FG6D 5E03A 1S7SB 4HKJA 1KT2B 1BFOB 2ZSWA 3FB7B 4ZYKB 3U2SA 4NIKB 3WNPA 3Q5YA 1CZ8H 2XPGA 2A9MH 4PG9A 4XP4H 2X4RA 3ZKMC 1C7TA 4PJCF 5A40E 2AJ3B 4ODVH 3V9FA 5FXCH 4L4VA 4CADA 4RGNE 5EPMB 5FYLD 4XVUC 1UXWA 4H8WL 4XPFH 1PBYA 1EV2E 2G75A 4JLRA 3E3QC 4H1LH 2HMID 1AGFB 5D1ZA 2D7MA 4KTEL 3S88L 1LNUA 3L5HA 4FZEL 1CXLA 1WWCA 5GISL 1DFBL 3TYGL 1E6JH 4XWOD 3VI4F 1F6AA 3ZKXC 3IDUA 2X1XR 1RUAL 1MAKA 2NYYC 3SN6N 4AY0A 4A6YL 1FIEA 1RU9L 2Y5TA 1HIML 3ARFD 3MXWL 1J0YA 3RI5K 3WDIA 2CO6B 2OZ4A 3AXLB 5D70H 5D2NA 4WTXA 3F58H 4PV8A 2ILLA 1YMHA 4M02A 2Z31B 1MEXH 2AI0L 4R8WH 3QCVH 2EIZA 1TVBB 4XVTL 4MZ2A 2BXYA 1IEBA 1BD2A 3BKML 5T3ZL 1UH2A 3UBXB 1GSMA 3EYVA 7FABL 3MCLL 1HEZB 4K23H 1NBQA 5F1NB 3NACL 5TF1L 5A16A 3SY0B 4OZFB 4S11A 3V6OE 1JGLL 1UZ8B 5EZOH 2GJZB 4R4FH 4XP6L 2ZSWB 4ZYKA 3K3QA 5D7SH 5IFAH 4OB5L 1HHIB 3ARZA 4AQ1B 1AHWB 3EDDA 4UT7L 1IGCH 2WINB 2QSCL 4Z77A 1HCVA 3L5JA 5J3HD 4YHOH 4WGVB 3V0WH 1X5JA 4R8WL 4CADB 5IHZA 2VDLL 5BS0B 2R0LL 1QLRA 4P46C 1T1ZA 3SGEI 3WKMH 5DC4B 2GSIB 4QEGA 4ZQKA 2I5YH 2ZUUA 1IILE 1HI6B 2YZ8A 5LQBH 4DOHB 4BZ1L 1MLCB 1X5HA 3T2PA 1KB5A 1S7UA 1IGCL 3E6HB 3ZKMD 4PS4H 1E27B 3DETD 4WI7A 2FHBA 2VZTA 5CD5D 1AXSA 5D1ZD 3ARRA 4P4KC 3LB6D 3WE6B 1GPOL 4JB9L 3IGAB 5D2NB 5FV1L 2HH0H 2ED8A 3D39D 4M4RA 1A7QH 5AAMA 4DZBB 3E1F1 4KJWC 1RZ7H 3N9GL 4K3JH 1G0YR 4GW4A 1TCMA 1KJ3L 5DFWH 1LO4H 1LMKA 1WAAE 1JV5B 1F02I 5E1HB 4AM0B 3QA3B 1FZOA 2HJKA 5FOBB 2ZNXA 1QFWH 4OZIF 3B5TA 4QTIL 2V17H 4KQ4H 1LE5B 2W59A 4MJ5B 4OKDA 4K07A 1GGCL 5HHQA 1CXEA 3QG7H 1LDPL 3RIFF 2V5SA 4X7SH 5IHUL 3LS5L 1MJUL 3V8OA 3U0PB 3N9GH 4N0CD 1UKSA 5E8PB 5EOQL 2JCCE 5IFJB 5BS0A 3ARDD 2BK8A 3U36A 2VE6B 3H3PH 3RVUC 1WZKA 1QFWM 1DUYB 4GG8A 4F57L 4IRJC 1A6WL 2BY3A 5DRZB 3RKPA 3VI4E 4NJAH 3CDGA 4GSDH 1NFDA 1RZJC 3MCKA 4NQDD 1ADQA 2P44B 4WFHD 4BQ8A 2IBZY 1CI5A 2EDLA 4OLYH 1XF1A 3QXWA 4Q6IB 2NW2A 1KCSH 4TOYH 5BVJB 1R3HB 4IBLT 1PLGH 5EU3B 4PRBB 4UT6L 3VFVA 4UIKH 3VXRA 4OCSL 1WISA 2IPKB 4GRWF 5CJQH 2I60L 2DLIA 4U6XB 1F13A 1MCDA 3PHOA 5E6IA 3CZFA 5IHLB 5DQ9B 4O5LH 5F6HI 2M1KA 5HI4C 5EORL 3NCBB 3N1GC 1BF8A 1ZXQA 1KN2H 3V52L 1D6VL 1FGNH 1GHFH 3QH3A 3EDKA 3GO1H 4U6HB 5DHXB 3VG0L 5DR5L 3C5ZA 4ENEC 1ORSB 3K7UA 3MYJB 5IVXE 2VDPL 4U6VH 1UKQA 1F4YL 2R2HA 5TQ2L 2DWEB 5JIKA 2EYSB 4M6ML 2I60H 2R0WL 4YDJA 3TA3D 1U41A 2FLBT 43CAA 1E4KC 3E2HC 4Y2DB 5CCKH 4NRZB 1WAAA 4XT1C 1CGSH 2BRRH 5E1AA 2DI7A 5D5MB 2VXUH 3EYQC 4JKWA 1OT1A 1YMMB 2VE6A 1P6FA 4WCYH 4ENED 3RZCA 4KU1A 1MJ7L 4R26H 3D48R 4X4MA 3TFKC 1S9WB 3BIKB 3TBWB 3ZE2F 4BSVB 5I8OL 2R23B 2BHUA 3EOBA 5D7IF 4ZUSB 5GISH 2A6IB 5IKCB 4KPHL 1CXHA 2UWEF 2ZUSA 2BRRL 1FC2D 4L9LB 3BZ4B 1IFHH 1DP0A 5IMOB 3GSNB 5HXMA 3X11A 4KQ4L 1QKZH 2VL4A 5CZXD 2ZUYA 2QADD 2DQDH 1BWMA 5DQ9A 1FZMB 2B4CC 1DBAH 4L3ED 1EAPA 1XZ0B 3TBSB 1QRNE 5EC1B 4Y8DC 4OQTA 1G7QA 4GSDL 1OT2A 2CDFB 3B9KD 4PG2C 1ZANH 4Q7DA 3MYJA 3T2NL 5JA9A 2EZ0C 2XWTA 4EI5D 2BJML 2CLRA 5I73C 4RFEB 3ARDC 4LVOB 4YE4L 3ZDYF 4NQCB 5C9JA 5ITFB 5D7IA 3SDCB 4UMGA 2FIKA 1GL4B 1RZ8A 1JZ4A 3OX8B 3HPJB 3RJQB 1P4IL 4E0RA 5A3ID 4WUUA 5D5MA 4OCRL 2K7QA 1NCUA 2YPKA 1R5WA 2P5WB 3BO8B 3CMOL 1UKTA 4L4TE 4G80B 3RWJA 2N56A 5JPMA 4NUGL