3P40A

Crystal structure of neurofascin adhesion complex in space group p3221
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
390
structure length
390
Chain Sequence
LTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurofascin
publication title Homophilic adhesion mechanism of neurofascin, a member of the l1 family of neural cell adhesion molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 64
structure length 390
sequence length 390
ec nomenclature
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p40A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p40A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p40A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p40A04
3SKJL 4ZMAT 3UX9B 3ZSTA 1BGXL 3IT8D 4PJFE 1KFAH 5JO5A 2X4QA 2ITDA 1GGTA 3FQUB 4GXUN 2GTZB 2X4RB 5IVXE 1UZ6E 2LU4A 4U1IB 4NZUH 3LS5L 4EXPX 3D0VA 2RGSA 1KJ3L 4WO4D 3QT2A 4PRHD 3T1WA 4KJWD 8FABA 2ID5A 1CD0A 2C7UA 1YY8A 1J1XH 1X7QB 1HIMH 3F12B 2YN3A 4K71C 4OZHA 1M6OA 1T7XA 4IOFD 5L8JB 1WFNA 3Q3GA 3LKOB 5TE4L 5AWNL 3QUKA 2NY3D 4HX1B 3EHBD 5HYIA 3MRQA 4JFDB 2NXYB 2EDOA 1UA6L 3L3DA 5CSBA 2EXWD 4NOBA 4NWUL 4J3WA 1AGCA 2MCPL 4KRPC 2ZWLT 3BDBA 4UQ3A 2JJWA 4NKQB 4X83A 4KZEH 3OAUH 1AKJA 3VRJB 1ZEAH 4GRWB 2V7NB 3QG6B 1AO7D 4J3UA 4DZBB 1A5FH 1R5VA 4MXVE 4D9QD 2XZCL 4XB8A 2R4RL 2XA3A 1FLRL 2A6DA 3K7UA 5FCUL 4KU1A 3BHBB 1H3GA 2A1WH 2ZPKH 4UU9A 4EI5C 1BGXH 4UV7L 5J11B 3ETBF 3UYPA 1U0QA 2A83A 3WIHA 4UILL 4H8WC 4P9HC 1GAFL 5IB1A 5CAYB 4QRTB 4Y1AB 4IMKC 1KIPB 3MGOB 3G5ZA 4QEGA 5TE7L 2Z4QA 1MFBL 3OJ2C 3WFHB 4FXGB 4WWKA 4FS0A 2VR9A 3ULVE 3SGJC 1FNEA 1KEMH 1S9WB 2OL3B 4PJ9C 5K33A 5DTFB 4EUPA 2VLJD 3QI9D 2FX8L 4ONHA 1IEAB 4OFPA 5I74C 1N8ZA 2FX7L 4NRYA 1N6QH 2BSRA 2ZOKB 5I1GL 3QUMB 4K3HA 3T0ED 4PS4L 3MV9E 5I18H 5MI0B 4TSCH 3BP6B 5B4MC 4FQLH 3K3QA 5IJKC 2OR9H 4F7CA 3TVMA 2F8OA 1YEJH 4OZ4B 4YHLH 5T3ZL 5HYSB 4KAQL 2EYSA 4G7VH 3IAQA 3GHBL 3B9EA 5FA3A 3C87A 3QXTA 2OTPA 3BMVA 3M17B 4O4YH 5C0BE 3T2PA 1J0ZA 4PG2C 4JGJA 4GRLA 5EFIA 3H7LA 3TGXA 1MLBB 5T3ZD 1D9KD 2W0KA 5E8EA 4UV7H 1SEQH 5E6ZA 1ZHNB 3BI9X 5C0GB 1TVDA 4CU8A 4JY4A 1HWHB 5DDHB 3OJVC 3V6FB 2Q76A 1GOHA 1F3JA 2GT9B 3SDAB 2X4NB 1T0NA 5J0BA 3WLWD 2D9CA 5TE7H 2L7JA 3TO2B 2IH3A 4XP1L 3IVKB 1HNGA 2YPVH 3FFDB 5A3ID 3LKQB 5IEHB 2H45A 5IFHL 4LSTH 3EOTH 2A38A 4JPIB 3V52L 4XBPA 2MPAL 4J4PA 3TYFB 3HR6A 2BDNL 3CFCL 4HGKC 5MEOA 5DUMH 4ZUVA 5E2TL 4PS4H 5F6HI 4LCWB 5JDJA 3JV4B 5F7HA 2HT4C 3PWVB 1XGPB 2AGJH 1CTOA 3QFJE 3X3GH 1HQRA 2MTPA 1KIRA 1J0JA 1RZFL 3OTTA 3ZKND 3U2SB 1DJSA 2HFTA 4LRIC 4G43A 5ETUB 2APBA 4JDVA 1CS6A 4G8GB 1KTDB 3CJJA 4Y2OA 4YHZL 4NN7B 5IMOA 1P69B 5T3ZH 4WW1B 3S96A 4HXBH 1WBZA 4FNLH 2FATH 4YO0A 2DIBA 4PJBE 3F62A 1SVZA 3QIWA 3UYOD 5BZWA 2BRRH 1RJYB 4N1CA 1LP9A 5CBEA 3UTSB 4P5MA 3SKMA 2RFXB 2OR8A 3OB0H 3TEUA 1XCQB 1JZ4A 3TNMB 3BP4A 4G3YH 3T8XB 1DL7H 2YMXH 2G9HB 1EEUA 1JGDB 3Q48A 4ZQKB 4ERSL 5I2IA 4Y16A 3RDTC 1UXSB 2DKMA 2E7LC 3E3QC 3RHWF 3GMPA 3CH1A 3R8QA 1SJHB 4QRUB 1W2KT 5I19H 3DROA 4O02L 1O7SA 3C5JB 3UYRL 4WCYL 3QNZA 1CL7H 3W9DB 5IR1A 3G08A 4UDUA 1K5NB 3V52H 4ODHH 1OGAA 4JFDD 4Z0BL 2NXYD 4LK4A 5FO9B 3VXSB 4L4TB 5HI3D 3DGGA 5E2TH 3FOLB 4AIZA 1C1EL 1RZJL 1NSNL 3MV7A 1QBML 5IKCA 1YDPB 1EUTA 1YECL 3PUCA 5DS8A 2F53A 2H32B 1IAOA 2Q86A 1OTTD 1U8QA 3VGFA 3R0NA 2P48B 1YY9C 3D69B 1JV5B 4HS8H 4M1DL 3LKPB 4KY1L 1Q9LB 4IRZH 3K1KC 3KPNA 3NCJL 2ZCKH 5D6DA 1I9JH 4XP9H 2VRAA 1HI6B 1F2QA 5DI8B 4X4XB 3MBXL 1BFSA 4HZLB 2V5MA 4DGIH 3EFFB 3K80A 3JWDH 3P9LA 1IGFH 4LEOA 3U9PH 4K7PL 2R1WB 4X5WA 1MVUA 1I8LC 5DXWA 1YQVL 3FO9A 4EJ1C 5EU4B 2DD8L 4PGCB 3S34L 2BERA 1AR1C 3ISWA 3PWUA 3PDOB 1J0KA 3BRGC 5H2BB 3MV01 1TDQA 1TZIB 2ICWI 3BKML 4X7TA 1SMOA 3QJHA 5CEZD 3LH2L 4LAJH 2HFFB 4FHBD 4GRWH 5DJXB 4N90D 2BHUA 2O5ZL 5EZIL 3GHEL 2LU3A 1C1EH 1KJ2B 1T89A 3RWHB 1FLTX 5I0ZA 4CN4A 1OAYL 4D0BB 4ODWA 4GW4B 1U8JB 3QEUA 3SDXF 3WDHA 4OCNC 2BSSB 1B4RA 1IEBA 2R0ZH 4F7TB 1HILB 4YDLB 1UB5A 4I3GA 3DYPA 1E6JH 3D39B 3RTQA 3NCYP 4YDKH 4QWWC 3C8DA 4FXLA 3GSUA 1WISA 2GITA 5CINH 4N1EA 4PJCE 1BJ1J 3QUZB 1NGWA 3MLZL 3GRWH 2GFBB 3UJIH 2I07A 5FUOL 4IRJC 1MHHA 4OUOA 1FYTB 2ATPB 1A7OH 4LAQL 4MS8D 2OL3H 2QKIB 3HPJB 4K7PH 3SEPA 3REVB 2DQDH 5HHOB 1P84K 4PY7B 3ULVC 2JCCE 3SDAD 1HSBB 1JUFB 2Z31C 4QNPF 3A6BH 5HXMA 1YQVH 5J1AA 3LV3A 3GKZA 1F4XH 5CLTA 5CEZH 4AY0A 1T1WB 3RDTB 2CDEB 2Z8SA 3ES6A 1T3FB 4YGAB 1OP3H 4JRXA 5HYEA 3L7EB 1N3NA 3AREC 5I8EB 3VGAB 1MRCL 4HZAA 5E7FA 1XF4A 3RU8L 1BQHG 3O6KL 4LCWD 5JHLL 1I7ZA 4YPGB 2F54A 2HJLA 2APWA 1YA5A 2H6PA 3OJMB 4EDXB 4Z8FL 4YEFA 4P5TB 43C9A 4ZS7L 3ZL4H 1KPVB 2ZKHL 4KJQC 2J6EL 1UKQA 3GHEH 2GK0B 5EZJB 4N0CD 3LPGA 1OAYH 2WWMC 4HPYH 1MQ8A 1OAZH 1NQBA 3EYUH 4O9HL 4G8GD 2OK0L 4ZSOB 1W0VA 1NCTA 3TT1H 1IAIM 3BGMB 4U1MB 4HFUH 4W6WB 5AAWA 1FAIH 1NBVL 4IRSA 4LHUA 5FUCE 1HOCB 3O3DB 5D72H 1JHKL 4GBXC 3UTSD 1FL6B 1L9NA 4YBQD 5LWYL 1XH3A 2NZ9C 2DQFB 3KPQA 4K2UL 2VLKA 1VKXB 4LLQB 5IVXB 3GUTA 4IMLA 4IOIA 4PRIA 1VFUA 1U91A 2VQ1A 3FZUC 4LGSB 5DC9B 1PKQA 4CU7A 3U6RA 3CPLA 4PRAB 4GG6B 3HMXH 4NHUB 4UUJB 3H3KA 5F9OH 2EIBA 5T1DL 3SCMC 1T21A 3PHOA 3ZE0E 5DUBB 1XT5A 1CXFA 5C2BH 4JEGB 3VXSD 1QHOA 3QQ3B 4UNTA 4L4TD 3PL6C 1OAQL 1J10A 5JHLH 4MX7A 1FZJB 1UJ3A 3ARZA 4HDIB 3RWEB 1CGSH 3IXTB 4PV8B 4LSUL 1MFAL 5HJ3A 2AQ2A 4U6VH 4NP4H 2FECL 1ES0A 3JTSA 4WHTA 5B4MD 4U1LB 5F1OB 5DWUL 1HINH 3AMKA 5EU7E 3U83A 4R0LC 3RX8A 2BVPB 2VZSA 1NCBH 2OK0H 1T1YB 5IMLB 1H15A 3SJVE 3K8MA 3KPSB 3DX7B 4MSWB 2FJGB 2P7TB 1HHGA 4U1JB 1JHKH 3ZDXE 3IDGB 3C5ZC 1FVDA 2D03H 4H8WH 3ZDZF 4P9HH 1Q9KA 3RWIA 5LWYH 5DJ0B 5H37G 1K3ZA 3KPRE 4NO3B 5KVEL 3EFDL 1ZKAA 3VWKD 1H8SA 4IRJB 3BEVB 3U7YL 4NZTL 1FNFA 3QQ9D 4DQOH 3IFLH 1Q1JH 5C6PB 2KPNA 1EHLL 4LP4A 3RP1A 1CWVA 5B38B 5AYUH 2J8UE 2Z31B 4GAJH 2V6HA 4AEEA 1P4BL 2CLRA 3U36A 1QD0A 3LEVH 1XGRA 3OPZH 5E8OB 3MRGA 2DLGA 2EO1A 3P3YA 1UENA 2H32H 2VC2H 5GSRA 2RCSL 4JO3H 4BUHA 3MV9B 1R3JA 2XN9E 1QQDB 3AREB 1TCMA 3GZKA 4KI5F 3FKUS 5BRZE 4B0MM 1FPTL 4LSUH 4YR6B 1DQDH 3FCTB 3T0AA 1FORL 2HT4D 3OHXB 4OB5H 3VXNA 1KJVA 3S35X 4NT6B 3OGCB 3D39D 2FYYA 1URLA 2P42B 4DVBB 3F5WB 1ZANL 4X6CF 1MAJA 4LU5L 3ZT7A 3OMZA 1IC5H 4DAGH 3QUZD 4BH8A 5J3HC 5C0BB 2GJZB 2V5SA 4H26B 4PJDF 3RAJL 3NN8B 4DTGL 1FYTD 5FYLL 2Y36L 1N5AB 2VDKL 1I1FB 5F8RC 3EOBA 5H94B 3CSYB 4GBXB 5HYJE 5HHOD 4BZYA 2P8LB 1LO2H 5D9SA 1BMGA 3T2QA 4L8CA 3KLAA 2VXSL 5GHWL 2HVKB 3DXAE 3IJHB 3BKYL 1F13A 2R1YB 3QH3A 1AD0B 3FFCA 3RDTD 2GJ6E 3X3FL 1RUPH 4PRPE 3VFNB 3PWNA 1HHJA 3F7VB 4JQXC 4QXUL 4MZ3A 1KJ2H 1U3ZA 4PJIF 5I76B 4XCNA 5I1AB 2PW2B 1X5KA 3HNVH 3RFZC 2VJXA 4MHHG 1I8KA 3CX5K 4P2CG 4X6DF 4P3CL 4KJPD 4RMVA 3SGKC 2K1MA 4P5TD 5CZVL 2ZJSL 2VLMD 4C83A 1B9ZA 4LNRB 4ZFOA 4P2QA 3QFJB 2OYPA 4IDJL 4M1CD 5J89A 2ITCB 4LARH 4WFFD 5F6IB 1LHZA 4KHTL 3GM8A 4NRXA 3SO3C 3U46B 1YEKH 3DIFA 3DYMA 2YUXA 4PJBB 3P30L 4LU5H 4POYA 4R0LB 2EH7L 3D85A 5IB5A 1K4CB 2D0HA 1B2WH 5GS1A 5TE6H 3D2UB 4ZFFB 5E9DE 4XBGB 1PBYA 5EBMB 5I8CB 5GRJL 5E4EC 3W0WE 4OF5A 1I9EA 3C5ZB 3EYVA 5F7DA 3VXOB 3DV4A 2SEBA 5C9JA 1VFAA 4Z7QF 1KTLA 4QF1B 4OAWB 2EDFA 2EZ0C 4MNQB 1AR1D 5L6YH 3JWNC 1Q72H 1JYNA 2X4OA 4PG9B 5D1ZA 5T1KD 2VLLA 3S5LA 3I02B 5B8CA 4OD1H 1NBYA 4YBLC 3M8OL 1NDGB 1P84J 4LPCA 5F7UA 5GRYA 4L4VE 4RMQA 2WLYA 3NIDF 4JLRB 1AGEA 1PGRB 4JRWA 3REWB 4GJTB 1A2YB 1YEIL 5FUCC 2D3VA 3BW9B 4LLDA 3KPSD 3I6KA 2DTSA 1T4KB 4CRPA 1ZGLP 1J8KA 3F7PC 3DO7A 3NH7H 1Q9WA 3P30H 5IVZB 3VXRA 2NX5A 5D7JC 3UTTA 5GGUA 1V7NL 4XAKE 3G6JB 4RWYL 4GT7A 5F1IB 4ZUWB 1FO0L 1RSFA 4IRJD 3VFOB 2QL1A 2P24B 4MCYA 1KG0B 4L8DA 4YHOL 1FIGH 4X4YA 1KPUB 3PWLA 3ROOA 4P57A 3BWAB 4ALAH 3ULVD 1R3HA 3HC3L 4ACPA 4JDZA 3PDGA 4M00A 5E5MA 2J8HA 1WSST 4A2MA 1BWMA 5GSVB 5EU6A 4NFCA 4OT1L 4NRZA 3ARRA 4RSVA 5L88L 2B4CH 2X9WA 3F7YB 1QYGL 5JIHA 2PTUA 4JZJC 3MJ7B 3C8KB 2XY2A 5ERWB 3U0TB 3MV9D 4U1GC 3A6CL 1SJXA 2YEZA 4P48A 3VRLF 2AJYL 2QQLH 2AJVL 3R06B 2APFA 1X44A 1UM6H 2PXYA 1UXWB 4CVWA 1S8DA 5EU7C 5BV7L 4BFIB 4TOYL 1CZ8L 4M62L 2F5AH 3UTQA 5IBTL 1UC6A 1D6EB 2CSPA 4JDTH 4TN9A 2BC4B 3OKYA 2D7QA 3FRUB 4NNPL 7FABL 1K8DA 5D7LE 1U36A 5C0BD 4PJCB 4F33A 2JK5B 1HQ4A 4ZXBA 4M6AA 3O41A 5D1XC 1MCNA 3HN3A 2Y07H 3GNML 4DW2L 4NJAL 4HW6A 1B6DA 4MJIE 4GBXD 5TH2A 3ULVH 4XPHL 1F4WH 2VKWA 4OZHE 5DJCB 5E1AA 2NZ9D 4XCCH 3EOAA 3GK8L 3NABL 4XCYA 2DM3A 3MNZA 5I1DA 1OAKH 3P40A 2W0FA 1A02N 3LEYL 3GSNB 1P6AB 3VCLB 3MO1B 3S4SB 1Q9OA 5I1KH 3FB8A 5E2WL 3MCLH 4UT7L 2ED7A 1LO5B 2PUQT 4MQSB 1OQOA 4Y7MA 1ITBB 3QDJA 2JB5L 3WHE1 4X7EC 4Y19E 4PRNB 5HHNA 4GXVL 3RZCD 3FQXB 2AJYH 4E41E 4A6YB 4CGTA 2AJVH 3V6BR 1KCUL 5GS0C 1FN4B 3QFJD 5DEFA 4YPJA 4R2GC 2UZIH 1JF6A 1SVCP 3OXSA 1SEBB 3ARPA 3VW3L 3SDXA 3HZYA 3VFVB 3IDXH 1DR9A 2IQAA 2NY0C 2X42A 1T22A 5JTWA 3QO0B 5LAXB 1QR4A 1QO3B 5GIRA 4HEME 3MRCB 5F44A 5JLZA 4BK5A 2G75B 3D2UD 1MRDH 3QJFA 2OTWA 2BZDA 4W4OC 4I5BB 2XTJB 4I2XA 1FZMA 1IBGH 1YEDB 3RPKA 3B3IA 4LF3B 1TJHH 4WI7A 1S7QB 1T1ZA 2I9LB 5I16B 2F5BH 4MQXD 1IGML 1FNHA 5L9DH 1YJDC 1QLEH 2H2SC 4PB9H 1JHTB 3V0VA 4MNQD 3MUGA 4RA0C 5CS7A 5E2WH 3FQTA 3WJJA 4B5EA 2APXA 3SKOB 2IG2L 1OVZA 1QFUL 5DJAA 2FJFA 3LY6A 5JOEA 1G9NL 3E2HC 4X9HA 5EC2A 2YC1A 5GGVY 3QEQA 4MXWH 1GC1C 2W9DH 3ZKMC 1NKRA 3I75A 3QEGL 4IJ3C 4JM2C 3MR9B 3CFDA 1ZGLB 4OFYA 3MRDA 1NC2B 3KYNB 3HC4H 1DBKH 3HC0A 1DBAH 3VW3H 4LHQB 3I50L 2Z8RA 5HHXL 1ZLSL 3V95A 2D0FA 1B4JH 1SM3H 2R2HB 3SE3C 3M45A 3SJVB 4Y5VC 4K3DL 3FT3B 2YRPA 5DJ2A 1D5ZA 4YXHL 3CX5J 1NDMA 2VQTA 1KN4L 2PTTB 2JELH 3EJJX 3OKKB 2VXQH 43CAA 3QNYB 2XXCB 2K3TA 1OAXL 2XKNA 4FQPA 5D1XB 3L3HA 1G0DA 3V0WL 5HI5C 1AJ7L 3WNPA 4R4BA 4AEIH 1TVHB 3PWPB 1D5XB 4JG0H 4JFPA 5DJDA 1J1OL 4ODVH 3ZHKA 3O81A 3DUUB 5JXEC 1QSFA 5ICXB 5TDOB 1WQVT 4K3GA 1SJEA 2DKUA 1VA9A 2J8UB 4JO2L 1KT2B 3D0LA 3KLSA 3AM8C 4LKXA 2BVQB 3QXVA 2E27L 2IG2H 1LEGA 3DUHA 1QFUH 4PJEB 2DQEL 2HJFB 2XN9B 4OJFH 4LEXH 4KQ4L 4POUB 5FUZH 3MNWB 5C0DB 4NZRH 3C5SA 3FHQA 2DBJA 1A8JH 1WCQA 4BH7B 2VDMH 4PBVC 1LP9E 4UIKL 1V7MH 1ZOXA 3UJTH 2BJMH 3SDCA 2DJ4A 3MJ9A 2QR0A 4AM0B 5CUSL 1A14H 4J1UA 4LPTA 5C09B 4XVJH 4GQ9L 3OX8A 5IWLA 1LD9A 4YHKL 4PD4K 4JJ5B 4QRPA 2GIYA 1V05A 3S3SA 4WGVB 1WLHA 5CILH 3L95B 4I0PB 1J87A 5C0RH 1AJ7H 2BFVL 4Y4FC 4K3EL 3EYQC 3QUYC 1OGAE 2V2WB 1WIPA 3EO9L 3DXAB 1I9RL 3U30C 5I8KH 1F00I 2HT2C 2GJ6B 1C08A 3HI5H 3MV7E 3DUSB 4JKKA 5FYLE 2F53E 4GKZA 1YNTB 2L4OA 3O9WD 3CVHL 2E27H 1PX4A 1JWSA 2BNQA 3PHQA 3NCBB 5FV2A 1AH1A 2DQEH 4KQ4H 2GI7A 3DMMB 1NAMA 3IAPA 3L5HA 1LEKA 3E2HB 4NUJA 4C56A 5LCVL 3WSQL 3BPLB 2VB5A 3QXUA 3C60C 4JM2B 3MBEA 2QQKH 3B6SA 5D93B 2VR4A 1KYOK 2Z9TA 1C7SA 2BSTB 1MJ7L 1CLCA 3UBXB 2I5YL 4X6CA 3GIVA 5CUSH 3UC0L 5IT2H 4M61A 1W0WB 3RL1B 1ZT1B 3B4NA 4ZD3L 2XTJD 5E9DB 3GSNH 1RUQH 1MHPL 2CXGA 2EECA 5I71B 5C6TL 3K4DA 1WC7A 3GKWL 2P49B 2XXMB 5GZOC 2XZZA 2Y25A 1ZXQA 1N2RA 4X7CC 1UZ8B 2FCBA 1DE4B 1ZLUK 1I9RH 2NTFB 4A6YH 4F58H 1DEDA 1E4XI 1MCRA 4TNWK 2MHAB 4PJIA 1EVTC 3E0GA 4QCIA 3VWJC 3TFKC 4P23B 4UNVA 1XR9A 3MRLB 2R2BB 4G9DB 4X6DA 3ULSA 1ORQB 5HSFA 4EDWL 2D7TH 4FQ1L 3SQBA 2AJXH 4OCLC 2QJDA 5HGDA 1NC2D 1YN6B 2HTLD 1LWRA 5JPNB 2VSDA 5TPWL 2MJWA 1IQDB 1U3HA 4H0HB 4H88H 3T65A 2LE9A 3HPLA 3KJ4C 3RL2A 5DFVC 3W11C 4OGAC 1ADQL 1O0VA 1TZGL 4GAGL 3SJVD 4Q9RH 1YEGL 4QT5B 3MV11 5IB2A 4ORGB 5I1IH 2VH5L 4HJ0D 1NBZB 5CP7B 4WUUA 3UC0H 1WBXA 4X7SL 2IC2A 3C2SA 4TNWF 4TSAL 3MLRL 3TO4B 4QTHA 2DQIL 5D1XD 3RI5F 2JB6A 4S1QH 4I48A 3C6LA 3VE0B 3HG1B 1H9VA 3PWPD 4JANA 4LIQE 5FA4A 4GUPA 5DJZB 2EYTA 2C1OA 2DIAA 4BQ9A 1P4LA 1PG7H 4X9IA 5M94B 1NEUA 2F54E 5DHYA 1RK1A 3H7BA 3QUYB 1T1XB 3CD4A 4POZD 1G6RB 5LKNA 4YZFF 5MENA 2R23B 1HKLH 4H1LB 1J11A 4OCYL 1EO8H 1XZ0A 2FL5A 1B0RB 4N0FB 3KYMB 1FG9C 2XN9D 4FZ8L 4Z7OE 1F58L 5SX4I 4HK3N 1NH6A 4JCMA 1NKOA 4GRLC 1HYRC 4OM0L 1OSZB 1VGKA 2HRPL 3F6LA 3ZMRA 1ND0B 4BSJA 1X5GA 3HE7C 4M7JH 1IGTA 5JO5B 2ITDB 2VLKE 3GBLA 3BN3B 4RGNC 5TQ0L 2B5IC 4LSVH 5EOCJ 4PRIE 4MA8L 5C09D 1TZGH 4J23A 1PKQE 1EAJA 2AV1A 5CIPH 3BESR 2KQMA 4WU7A 4M02A 4OI8A 8FABB 1S5HA 2C7UB 1U2HA 1YY8B 4PLKD 4X7SH 3PV6A 2H2PC 4RNRA 4J4PC 2QADC 3V4UL 1F6AA 1P7QA 4I0PD 5DYOA 1CE6B 2Q20A 2W9LA 1BFTA 1JVKA 1M6OB 4OZHB 3Q3GB 4NM8L 3QWRA 3QUKB 3DXAD 1RURH 4NBYB 3MRQB 2UVFA 2NZIA 2GJ6D 1MY5A 3L3DB 2Y23A 3IJYA 2QSCL 5KSBA 1AGCB 3U82B 3MYJA 4FFYH 4UQ3B 4OCYH 1S3KH 5LGJA 1FIEA 3K2MC 1AKJB 2AI0L 3QIWC 3DMMD 2Y7QA 3ZKXC 5D7IE 2EH8L 4HJJL 4N0YH 1R5VB 4GKNA 4QHLA 4FZEH 4U7KA 2X1PA 3ULUL 4F15B 3PGFL 1Z2KA 3R1GH 1PLGL 3ZKMD 4JM2D 3WJLA 4UU9B 3PABA 3QCTL 1MREH 3UCRA 4KDWA 4KTDL 5T3XE 1PQZA 2A83B 3BPNC 1TJIH 4KQ3H 5TQ0H 3EJYC 2C3VA 4GG8A 3TN0C 1QOKA 2HT3C 3ULUD 5IB1B 4HWEH 1X4ZA 4NQCA 3HI1A 3QIBA 5E7BA 3G5ZB 2Z4QB 5E9DD 3WFCH 2CIKA 4QHMA 2GTWA 4WWKB 5C8JA 2N4IA 1CDBA 4RWHA 3IKCA 3L3GA 1FNEB 3RWGA 4MA1C 2DS4A 2F58L 1H5BA 3O6MH 4EUPB 4D3CL 4F3FA 4NRYB 3EJZC 1KCLA 1BVLA 2BSRB 5HI5D 4JN1L 3TT3L 4EXKA 1OGTA 4MVBD 4PD4J 4X5XA 4UT6L 1X6LA 3UAJD 2DL9A 5E8PA 3RA7L 4M5YH 4WEMB 4F7CB 3NA4A 4P23D 3TVMB 2FR4B 1JRHH 1T04A 5F7EH 1G6VK 1QLFA 5INCA 5D2NE 3TA3A 2EYSB 1FZKA 4Y5XC 1I4FA 4DKFH 5J57B 5FA3B 1LK3L 1T2JA 3ZE2E 4XX1E 3ULUH 5ACMA 3HUJF 5KSAA 1C5CH 2EDTA 5DGRA 4GRLB 5EFIB 2LTQC 3K4ZA 5E8EB 1L0QA 4UINL 4RDQG 1QFWI 2EDHA 4M6MH 1FFNA 2IANE 3GMMA 4JY4B 4UOJA 1B0GA 2X09A 1GYAA 2Q76B 1F3JB 2XQYK 3MV8A 2ZG1A 1T0NB 2UVEA 3TO4D 4PJAF 1KENL 2IH3B 4R3SA 3DV6A 5CJOL 4LDOB 3HG1D 2VKXA 1U8NB 3R4DA 3MODL 4WI3A 3ZE1F 5DQJA 3VXTB 1AHWA 4MNGA 4XBPB 2DAVA 3INUL 4D3CH 1KYOJ 5JR1L 1MAML 3RZWA 5K9QI 5MEOB 2PYEA 4JN1H 4ZUVB 4P2YA 3MZGB 3EYQD 5C70A 1E4JA 2BVYA 1NMBH 3U4EA 2NXZC 4XTRC 2VN4A 1SY6H 4P2QE 4HBCH 5CLWA 1KBGL 1HQRB 5FGBA 1KIRB 3U1SL 1QFHA 1UQSA 4G43B 4JDVB 1U8PB 1PG7W 5IMOB 4I0CC 3S96B 1WBZB 2WWKO 4I3RL 1V3KA 4YO0B 2KKQA 5KVMC 4OLZH 1AXTL 3QIWB 1BBDL 1A3RL 1GPOH 3ZKXB 5BZWB 2XT1B 3O8XA 1LP9B 5CBEB 4NJ9H 3KPOA 3Q5TA 1ODAA 4P5MB 3SKMB 4L3CA 1KB5L 2Z8VC 4M9PA 1GRWA 2B20A 3Q6GL 3BP4B 3WBDA 4JFZL 3QIUA 5I2IB 3BQUC 4Y16B 3PJSA 2DQHH 3BP5A 3GO1H 5C1MB 1JYWA 1BVKA 1QA9B 3WMSA 1JI1A 2LU7A 2Z92A 4AL8L 2F19H 3GMPB 3CH1B 3ARDC 4C55A 1FCCA 3UZVB 5IEKA 3F58H 1IJ9A 4K8RD 1G6RH 3S37H 1QG3A 1Z3GH 3MRJA 3QNZB 4H1LH 5IR1B 3G08B 4UDUB 4AQOA 1OGAB 1RUAH 1UCBL 5JW4Q 5JR1H 2IWGA 4FFWC 2ICCA 1RIUH 3GI9H 1EHNA 4MHHI 3DGGB 4AIZB 3KPPB 3MV7B 5C7XL 1J05A 2LV4A 5IKCB 3OBAA 4HQQL 4M4PA 3KPTA 4QKXB 1YQ2A 5DS8B 2F53B 1IAOB 2Q86B 1U8QB 3EUUA 1AKJD 5FO7A 1G84A 4RRPA 3O2WL 4K3JL 3DBXA 4OGXL 3U1SH 1RZKL 1LEIA 2EIZA 3KPNB 1UFUA 4AT6A 4OSUL 4PJFF 2DQJH 5DJ8A 4JREC 2F8XC 2GYSA 4LCUA 3VXRE 1UZ6F 1BBDH 2NX5E 3NA9L 4XBEH 1DQJA 4ZG1A 4LEOB 5F7WC 3RKDC 4YHIA 3JWOL 4X5WB 3MMEA 4M1GH 1MVUB 4ZOBA 2B39A 5A40E 4RQQA 4K8RH 4RMWA 5CCKH 2N7AA 5DRNA 5C0IA 3FO9B 4WWKD 1PSKL 3MXVH 3PWUB 1K9TA 1NGZA 4P2OC 5C2UB 4E5XA 1AFVL 5D8JL 2NY6B 1S9VA 1OAUH 1XGYL 4BZ1H 3GBNH 2XRAL 1A6WL 3BN9C 1J18A 5EN2A 3PXJA 1GVIA 3WDJA 4M7LH 3QJHB 2OSLA 2YBRA 4LKCA 1IVLA 4NUGL 2VITA 1CGWA 4XP5L 1OP5H 3FOMA 4KMQA 4ODWB 4G9FA 3QEUB 1KLGA 3TVMD 1IEBB 4MXVF 5E2VL 3LDBB 1UB5B 3RTQB 3LD8C 3GGWA 3WIHH 3GSUB 3FQRA 4OLUH 2GITB 2ESVA 2OMNA 4W6YB 3U9UA 1NGWB 4GRLD 1YNKL 2I07B 2A9NL 1R3IL 3RWJA 4HLJA 4MJ5A 1MHHB 5CJQL 4PREA 2XG4A 5D70L 3QULA 4GLRI 2QHRL 1KPRA 1FSKC 1EEZA 4EUPH 4YUEH 5IB4A 1GJIA 5BO1H 4F57H 1EA9C 2VIRA 2Y1VA 5J1AB 5ECJE 3LV3B 2VMFA 3OSKA 5EIIA 3BX7C 3BSZL 1BAFH 1UGNA 2Z35A 3ES6B 4JRXB 2H2PD 1WK0A 1Z5LA 1AQDA 5FGCE 4J4PD 1N3NB 1UB6A 4HIXH 1ACYH 1XF4B 1YEEL 1I7ZB 2F54B 3F8UB 4UT9H 3RWDA 2H6PB 1MWAA 3H9YA 4Y89A 4G6KL 4GQPH 43C9B 1T80A 2EDDA 2JTDA 4NUGH 4KUCF 4Z7NE 5D2NC 1S7WA 3QG6A 3V4VL 1W0VB 1RMFH 12E8L 1IKFL 4B53A 2XIDA 3RVWD 3C09B 3VFGL 4KK9C 5KOMC 2FLBT 3O0RL 4IRSB 4LHUB 5JHDA 1JTPA 2VDNL 5F93C 5ACLA 1EJ6A 3LN9A 3VMNA 1T5WA 2PCPA 1XH3B 1Z9SA 3KPQB 2VLKB 4WJ5A 1G9NC 3VFTA 5CJQH 1J8HE 3GUTB 4Y1AA 4IMLB 4IOIB 4PRIB 2XTLA 1U91B 4ZFZA 1PKQB 1I1CA 3U6RB 1ULVA 3LQAL 3CPLB 4JO1H 4Y16D 1JGVH 2HVJA 4HUKB 4QNPE 1BQHA 5DD5L 3C6SA 3O3BB 5DRZA 1T21B 3T3ME 4KZDH 3PHOB 2ZOKA 3QUMA 5DMJB 3CDGA 5AYQA 1OGAD 3JBG7 4HIJA 1EGJA 3U0WL 5IESL 3FT4A 15C8H 4K07A 1YEEH 1AGDA 1TTFA 3EJZD 4MX7B 1EV2E 3RIAK 3MV7D 2V2TA 1UJ3B 1CI5A 5HJ3B 2CKBL 1HN1A 1MCSA 1TETL 3SQOH 2VWEE 1ES0B 3JTSB 4WHTB 1X4YA 2J12B 4N8VA 5HBBA 1EJOL 2P1YA 3L5JA 3V4VH 4DKAA 1N4XH 2EEAA 3M17A 4OM1H 2ZG2A 1E28A 3MUJA 1DLFH 1HHGB 1DBBL 3LD8B 3NFSL 2HLFD 4S0SD 5CJBA 1RIHL 2IBZX 4FMKA 3VD9A 1FVDB 3V6FA 3RWIB 1Q9KB 1A9EA 3OG6B 4OCWL 2I60H 1EHAA 5F97E 5IHZA 2HA1A 3RRQA 5BW7C 1VERA 4JY5L 3IRZA 4Z95L 2D7NA 1UM4H 4O00A 4M7LT 1X5LA 1QSFE 1LK2A 1ZA6A 3MROA 2NY6D 3P4LA 5EOQH 2YRLA 2PF6A 1N0XH 4LQFH 5D1ZC 3ABZA 2CLRB 1G1CA 2WM0A 3U36B 4LCCA 3K4AA 4DN4L 4DUVA 1XGRB 3MRGB 2WQRA 1G9ML 5EA0L 5GSRB 1FGNL 4RBPK 3U0WH 3GBML 3HRZA 5IESH 4LSRL 1R3JB 4M8VA 4F9LC 4QRRA 2UUDK 4PYGA 3ECBA 1D5MA 4OFVA 3VFMA 1EDQA 4OD3L 1TXKA 2E6QA 3ARFA 1INDH 4TQEL 1Q8MA 4ZFGH 5EOCL 4WWID 4XPAH 1TETH 4I77L 4XTRD 1KJVB 5FB8A 4HWZA 4OTXL 4S0TD 3RTQD 5CZXC 2VZ1A 1I7TB 1QZ1A 5JW4M 3CXDH 5GJSH 1N7ML 3VD5A 2VZOA 4BH8B 5JMRA 2O5YH 4S11A 5F9AC 4XHJC 5SWZE 2XWBA 2WUBL 3MZTA 3V7AG 1XCQA 1RIHH 4EI5A 3ILPA 5IJVA 4HC1L 2FEDD 3EOBB 5L0QB 1NCNA 4ZQKA 5CD5C 5F96L 1CDJA 2IANB 3KPLA 4KPHH 5D9SB 4L8CB 3KLAB 1X5IA 3Q2CA 4WHDA 4Z95H 3MRFB 4IMKA 3RIFK 1N6VA 4U0RB 3VGEA 6CGTA 3AU1A 5D2LE 2LQRA 5I0DA 3BAEH 3QH3B 3FFCB 3OZ9H 3P0GB 1WCBA 4ZTPL 4TRPL 3P0VL 4JRXD 3RPIA 4R26H 1HHJB 4PJ9A 3GSRA 5F1KC 5ENWA 5KTEH 3MOAL 3ZTJG 1EPFA 3IDUA 2Q3ZA 5FM5O 4XCNB 1K85A 1DQLL 2NY7L 3K2UH 4YE4L 2VXTL 1CDCA 2F54D 1I8KB 3B5GA 5EA0H 1FGNH 2BNQE 2DQCH 4S10A 1A9BA 4C83B 3TYGL 2Y06L 2X44D 4FFWD 4ZFOB 4HKXA 4P2QB 4RX4D 1T66D 3HFML 5IJKA 5GGQL 1L7TH 4C56E 1E4XL 4OGZA 4WVRA 1H3PL 4DN3L 2YK1H 4OTXH 2ERJC 5SV4A 4LCYA 5AD0A 5HVGB 3DIFB 4X6CE 4IRSD 4LHUD 4NQDD 2W38A 3WS6C 3D85B 1A7NH 5IB5B 2MQCA 3ALPA 4LCIL 5BS0A 5GS1B 3ARWA 3HUJA 3SOBL 5KN5A 2VLKD 2F15A 2JCCF 2Y6SC 4PRID 4UIMA 4R9HA 1S5IL 5J6GA 5FK9A 1KNOA 3EYVB 2XZQH 3VFSA 5F96H 4RZCA 1YNLL 3E6FA 4WDIA 4LIQH 4K55A 2SEBB 4J7RA 5C9JB 1A47A 2KBGA 5EU3A 1VFAB 1KTLB 4PJAA 2R2CA 1UWXK 4HWBA 4KK6C 1QACA 3KYAA 5EPMA 4TRPH 3ZHDA 2X4OB 5GS2D 1JGUH 5D1ZB 2VLLB 3S5LB 1RY7B 5B3JE 1DQLH 1CU4L 4M7KL 4YE4H 3HMWH 5B8CB 2VZUA 1DVFC 1CFTA 1NBYB 4XP4H 1JFQL 3VA2C 2AJZA 4L3AA 4LFHD 4JKPH 2D7OA 5JQ6H 2ENYA 3CLFL 4NZJA 3ARGA 1J7VR 1WZMA 1OF2A 1AGEB 3RQ3A 1R3LA 4FQHA 1GGIL 4LRIA 4N0UA 2EC9T 3I6KB 4WEUD 1F42A 4LASH 3DO7B 2VDQL 3N06B 1OSPH 1Q9WB 1NEZA 1KELH 3VXRB 5FECA 4URTB 2NX5B 3NFNB 4YXLH 5GGUB 3UTTB 1F6FB 2E5EA 4CVZA 4O2CA 3TM6A 5T3XD 4KHXL 3UPCA 1JUFA 4PGJA 2FRGP 4TVPE 4Q0XH 3L1OL 3MA9H 4L8DB 4X4YB 1WIOA 32C2A 3PWLB 4N68A 3RVUC 1HHIA 4P57B 4LVHB 3WJJC 2NLJA 3OV6A 3ZE0F 1T3FA 3FL7A 5GS2H 1R3HB 4HCRA 4JDZB 4PLJC 5E5MB 5B22A 5FV1L 3EZ8A 5C0CE 2CRIA 4HH9A 5MENE 4NRZB 5FHAL 3FT2A 5L2KA 1U93A 3P4OB 1CDYA 3AGVA 1CE1L 4CDHA 1FNSH 2YEZB 2WSKA 2AK1L 1S8DB 2IAMC 3BZFA 1NLBH 3B2VL 1E6OL 3TPKA 3V8CA 5I15H 3NIDE 3UTQB 1D5IL 4U1MA 3TZVA 3IETA 4P4KC 4P9ML 4XNYL 1AXSA 2DWEA 1MCBA 2FD6L 1L4IA 3O3DA 1VCAA 5T3XH 3QQNA 3ZDXF 1K8DB 4PJFA 4F33B 4F9PC 1HQ4B 3I3EA 5EOTA 4ZXBB 3LIZH 3O41B 4HUVA 3BZEA 3VD7A 1F4YH 2W9EH 4QHNA 1I3UA 1AC6A 1N64L 1VGEL 5JIIA 1RPQA 5TH2B 4KHXH 1CDIA 3O2VH 5E1AB 5L8KB 3EOAB 4FFVD 2XKSA 4NSKB 4XCYB 1T03L 3MNZB 5I1DB 2J8UF 3ARUA 2HRLA 2IFFL 1JNNH 1U9KA 2HAZA 2W0FB 3FFCD 4K7FA 4QGYA 1ZLVK 3O4OC 1Q9OB 3CVIL 3O2DA 2BRQA 3FB8B 2A6IA 4J2XA 1GGUA 5T5FH 5KSBE 3L3IA 2MCG1 5FGCB 4MXQC 3QDJB 3HE6C 4P2RA 5FHAH 3L6FA 3SKNA 1FZJA 4HDIA 3WD5L 1CE1H 5HHNB 3VRLE 5F7YC 2EIDA 2XNAA 3U4BH 4P2QD 1JTOA 5DEFB 1JWUA 2IBZY 3OXSB 1CLYH 1TTUA 4ZNEE 3H42H 3SDXB 1N5YL 4X80H 2MFNA 4EBQL 5F1SA 4ZYKA 2DOCA 2IQAB 5ESAA 3FRPA 4LSSH 1WT5C 4MQ7A 3EYSL 2HKHH 1G7HA 2WP3O 5HHVL 4M6OH 5GIRB 3D85D 1JF5A 2CK0L 1BJ1H 1OT2A 2VXUH 5JLZB 4I9WE 4CVUA 3QJFB 3RVVC 2OTWB 1MFNA 1JMXA 1IGYA 3W82A 4M7ZB 1I3RA 4NNYA 2YD9A 4FP8L 1J8HB 4I2XB 1FZMB 5L7XL 4JHWH 4WY7L 3U7WL 4NHCL 3B3IB 1QFWL 5JPMA 1OWRM 1P4IL 1T1ZB 1UYWL 5I1EH 2NW2A 3QHFL 4WFEE 2E7BA 3QUXA 1T03H 1KCRH 5J1SC 2Z31A 5I6XC 1UH3A 2CLZA 2HFEA 4TSBL 5F9JA 4XVTH 2B0SH 3V0VB 3MUGB 5F7NC 4GW5A 4OZIF 1CICA 2D31A 2R0KL 4QHKJ 3SHSA 3FQTB 3DYOA 4HWNA 1QQDA 5ADOL 5D1ZD 4NYLA 5CJ8A 4Z7WE 2FJFB 4LQ1A 2P8PA 5EC2B 4K94L 5D7SL 2YC1B 4ZAKA 3QEQB 4KVNL 3G6DL 3I75B 3CFDB 1TNMA 5IIEB 1SJVA 3MRDB 5DEGA 2IADA 3VXPA 3HC0B 5EDXA 2X70A 2D4FA 5D5ME 1RJCA 4QTIL 3VXUA 2JIXA 1BF2A 2QQNH 3BOVA 5C86A 1XIWC 3PGDB 5HHVH 5DJ2B 1D5ZB 3VXRD 1NDMB 2NX5D 3UTTD 2P44B 4XAWH 1UH2A 1RUKL 2BMKA 5F88A 2P8LA 3T4AA 2DBLL 3BO8A 3PQYE 3QZWA 5GRXG 3N50A 2XKNB 4WW2C 3L3HB 5D7KE 4C4KO 5DVOA 5ICZB 4R4BB 3GMOA 3VI3F 2WBJC 3U7WH 4JFPB 5DJDB 4NHCH 4YFLI 4PYHA 1AD0A 4XC1L 1QSFB 2PYEE 1T7YA 3MGAA 4EVNA 2WWKT 2Q8AL 3L5WA 1KLUB 3HNTL 1SJEB 4W4NA 2XQBL 3B8YA 3MOBL 4WEBH 5EU6D 3SCMA 5I76A 1OPGH 5I1AA 2OMBA 1WV7T 3D0LB 4XPFL 1DUYA 2GY7B 3O4OB 3ZT6A 2RIKA 4OBRA 5DZOA 2VDLH 1LEGB 4NKMA 4WFGE 3UTOA 1OOAA 5MERA 4BQ6A 3PL6A 2PXYD 3HE6B 1GIGH 3MLTA 5D7SH 1W72L 2ITCA 4LSPL 4KVNH 3QCVH 3IFOB 2BVEA 3B5TA 2VXVL 1M71A 1IGJA 1KOAA 3SN6N 5E1HB 3S88L 3SDCB 1EFXA 3AROA 3PP3K 4DK6A 3S4SG 2Z0BA 5DD3L 2GEEA 2QR0B 5IBLC 1OT1A 4J1UB 5IB3A 1ZE3C 1LD9B 4ZXBD 5LVEA 2IGFH 1OTUC 3EDEA 4LP5A 1CL7I 4KH2A 1A6PA 5EULV 5I8CA 3G04A 4QRPB 1NGQH 3FB6A 3C5ZA 3QISA 5CEXA 1TCRA 2R9HC 3I2CH 3N9GL 3C08L 3TESA 4HIIA 4DUXA 4Z77A 4QF1A 4RMRA 1GZQA 3MRBB 3PE9A 4UV4L 4DCQA 1FL3A 1DANT 1F4AA 1U2CA 2UYLA 5I1JH 3VGGA 1C08B 3V5DA 4TNVK 3HNTH 3JWOC 1T83C 3QDJD 1ERNA 4L4JA 4Q6IA 4XVSH 4GKZB 2CO6B 1U3JA 4L3EA 5I75C 1L7IL 4UBDC 1JWSB 4Z7UA 2BNQB 3BJ91 4TYUA 1NAMB 1HH6A 2V5YA 2ZOLA 4G6AC 3D48R 2R29L 3CMOL 3NACL 1NUNB 4LSPH 1Y0LA 4NUJB 4C56B 5ILTL 3QFDA 1T4KA 4RAHA 3MBEB 4A2LA 3B6SB 3AS0A 3SDYH 4OGYL 4X6CB 4U7SA 3HLAA 1SBSL 3GIVB 3OGOE 4HJGA 4J6RL 1AE6L 1A3LH 1MCLA 4M61B 1BHGA 2R56L 3WFEL 3H9HA 3WO3B 4TNVF 2ARJA 4OZHF 3B2UC 4YQXH 1MVFA 3WFZA 4NFDA 2H26A 4KKAC 5C0NC 1WC7B 3N9GH 4P5KA 1H3XA 1A22B 4XCFL 1RULL 1N2RB 2NYYC 2X1QA 1G7JA 4FQQA 4NNXA 2P47B 2Y5EA 5JW3H 4DGVH 4ODBD 3RVUD 3UEZA 5JOFA 4JQXA 4DZ8A 4PLJD 4PJIB 1J12A 4O5LL 4U1KB 4QCIB 5JIKA 4NN5B 1UWGL 3NZHL 1XR9B 2XA8H 4X6DB 5DMKA 3ULSB 3QEQD 2BVTA 5A2JH 4F37K 3WJLC 3SGKA 4OFYD 1FL5A 5HGDB 2ESVE 1KUMA 3S36X 3T77A 4DFIA 1CDGA 1XGTA 4XP6H 3T65B 1U3HB 5IVNA 3HPLB 5F89A 3CX2A 3O4LA 3WXVL 4HAGA 1LDSA 2QV2A 4KGLA 1WFUA 2JK5A 5GPRA 3VG0H 1KF9B 2EIEA 1NUDA 5IB2B 2XZAH 4OGYH 1KJMA 2DJUA 5D96C 3BRFA 3BH8A 5BXFA 4ZODA 1WBXB 4LMQE 3KLDA 2R56H 2EEBA 4J3VA 4QTHB 5DT1H 3DETD 2FNBA 2JB6B 2JCCA 4I48B 3C6LB 5F7MC 2IBBA 5A1AA 2V9RA 2Z93A 3O45A 4JANB 5ESVA 3KYKL 3D6GA 1QSFD 1CR9L 5FA4B 4D2NA 3HB3C 1RV6X 4F37F 4GUPB 2C1OB 2VYRE 1P4LB 1H3UA 1RULH 1S7VA 1BZ9A 3EIFA 1ZK9A 5DHYB 4NQEE 1C5BL 1RK1B 3H7BB 1OLZA 4Y8DC 2CXKA 5IHBA 4HH8A 2GAZA 4R96A 4HUNB 1EK3A 5MENB 2EE2A 1KN2H 5FKAA 5CSGA 1DBJL 3RY4A 1H0DA 4YHML 1XZ0B 4OCSL 2DLFL 3TA3C 1MQKH 4WENB 4KTEH 1JYVA 4O5LH 1TNNA 2EDYA 4WRLA 1A0QL 5LGKA 1BJMA 3NVQA 2Y9RT 4M43H 4FMFA 3F6IA 1A6ZA 5FEBA 2G2RA 1TQCC 2CDGA 5JHDE 1VGKB 4X8JA 4YXKL 4HK0A 3AXLA 4JFQA 5DD1L 5CGYD 1IGTB 4G6JH 3FONA 3SDCD 2VZ3A 2QLVB 3MRCA 1FE8H 2AK4E 2AV1B 1HZHL 3QQ4A 1MRFL 4S1SL 4WU7B 1R24A 1FGVH 4QRPD 1S5HB 1RZ7H 5MEPA 2DRUA 4AMKL 4TULH 2HH0H 5GGTA 1IKNA 3PV6B 5D7JA 1AHWC 2AJ3A 1F6AB 1IFHL 4CVXA 1P7QB 5I16A 4OQTA 5DYOB 1A7QH 2HFGL 2AP2A 4JE4B 5ACZA 3B9VA 5F70A 1GGCH 4OZGE 4TUJA 2DDQL 5F72S 4L29A 5FYKD 3IJYB 4RMTA 4GSDL 5KSBB 2GQHA 2CR3A 3MYJB 1IZKA 4YHMH 5LGJB 4JZJA 1G7PA 4NM4L 4UB0L 2BNQD 5CGMA 3MPCA 2VL5A 2Y7QB 4KI5D 1EFQA 3MJ9H 5KJRL 1QPXA 4QHLB 5IF0A 2RQ8A 4C56D 4NC0B 3BDYH 4DVRH 2QSQA 3IF1A 1G9MC 5I8OH 3MBED 5I30L 2P5EE 4PGBA 3PABB 2OQJA 3B9DA 2E9WA 5TF0A 3M1BA 2JJTC 1PQZB 4WI2A 2C3VB 4OFKA 4GG8B 3SY0A 2EE3A 4HIHA 4Z7VF 1KCVL 3QPXH 3E8UL 4NQCB 4PRBA 4XPBH 3HI1B 3P11H 3QIBB 4JAMA 4ETQA 4CBPA 4EIGB 1NJ9A 4S1SH 4Q9CA 4R4NC 3KPRA 2CIKB 1MH5A 4QHMB 2GTWB 5C8JB 5CJXA 4MB4A 1DZBA 3IKCB 3X13B 3RWGB 3RX5A 4RGMC 5ALCH 3RWFA 1H5BB 3NTCL 1GHFL 3UO1H 1X6NA 5FYKH 3EO1A 4F3FB 2XICA 4Q9BA 2HFGH 3JUYA 1BVLB 1F90L 5DC0A 1IT9H 1ZA3A 4QRRE 2FECI 4XC3L 4WFHE 1A7RL 1OGTB 4XXCC 4CU6A 1HXMA 4HUUA 4X5XB 4K9EL 4OIAA 2CRMA 1NAMH 4ONFH 2W07A 4XNZC 4NGHH 5DQDL 3WNLA 2HJFA 5E8PB 1VPOL 3H3PH 3K0WA 6FABH 3SE9L 5BRZA 1JGLL 1T04B 1NPUA 1QLFB 5IHUL 3TA3B 2ED9A 4XGZA 1I4FB 5IMMA 1QFWM 1HWGB 1MCEA 1U3HD 2J2ZA 4PJXF 5KSAB 1U92A 4ZUSA 4JHAL 1TQCB 5KW9L 2DQGL 5D5MB 1RD6A 4YHNA 1P5VA 5F71A 3W2DL 1DSFL 2DMCA 2BXZA 3GMMB 2X41A 1B0GB 3CSBA 4WUUD 3AY4A 3MV8B 1DN0A 3WFDL 2YSSA 3CLEL 1CXKA 5HDQH 1EX0A 4LSQL 4PGDA 5HYJA 2ZNXA 4X4ME 4R3SB 5F7LB 3DV6B 4W4OA 5J7CC 3C6LD 2X89A 1VESA 4YC2B 3ARVA 2VE6A 3GI8H 1BREA 5DQJB 3MUHL 2ADFL 3W5NA 1AHWB 3QWQB 4MNGB 2QTEA 5IP4A 4J3OC 4XWOC 3O6FC 4PRPA 2VSCA 2PYEB 1F90H 4G6ML 1CGUA 3OAZK 3TH3T 3U4EB 5MEND 5ADPL 2MQ0A 3LN4A 4OZIA 1QRNE 1KSRA 2GJJA 4XMKL 2ICEA 5DHVA 3PV7A 4WU5B 4PUBL 1UQSB 1ZT7A 1Z6JT 2M26A 4LL9A 4ODSH 4XI5D 5IBUB 1CFBA 1PJ9A 3WHXA 1NCUA 5BVJA 2NCMA 2FX9H 2FGWL 2R0WL 4UBDD 1MSPA 1EO7A 5BS0E 3O8XB 2BSTA 4RCAA 3HKFA 3MLSL 3KPOB 3STZA 3KNBA 3QA3A 2R4SH 3VH8A 5TJWK 4MAYA 4L3CB 3HRPA 3MJ8A 5IGXH 2YD7A 2XKUA 3RL1A 2RR3A 2C5DC 1NLDL 1Y18A 4Y5VA 1WF5A 3QIUB 2FO4A 2AQ3A 3PJSB 4LGPB 3BP5B 5DSCA 1BVKB 1T2QH 3W0WA 4AEHL 2Z92B 4HF5L 5SV3A 5J12C 1RU9H 4LSQH 4C58B 5C92A 5CZKA 2FB4H 5IEKB 4MA7L 3N1MC 3B2UD 5E8DH 4Q9QH 3QWRD 3RVTD 3MRJB 1YEHL 5JZ7D 4KKAD 1E4WH 4RGMB 2VUYA 5JXEA 4JGUA 1WBYA 5C9KA 2Q8BH 2YOCA 5D1QC 3JV0A 4X5LA 2NYYD 1J05B 3U79A 1MNUL 3ORJA 2NY1D 4Z7OF 2P5WA 1A6VH 5FO7B 3IU4L 3DBXB 4PUBH 1U95A 1LEIB 1UH4A 3VA6A 2EIZB 4L4VA 2R8SH 4N0UE 4AT6B 4HD9A 4G6FD 5IW1A 3KYOA 4ONOA 4L9LC 5DJ8B 1QBLH 4OLYH 4LCUB 2VERN 4NZUL 5TF1L 4S2SA 1TZHA 4BFGA 1DQJB 4ISVA 4ORGA 5A2LH 5L8LB 1S7RA 4YHIB 1UEMA 1X5YA 3FAWA 4U49A 3MMEB 1J1XL 5E70A 3FQWA 4PRDA 3WS3A 4NQCD 2CIIA 3QIBD 4RQQB 4Y2DA 1HIML 4I9WD 4PJ7F 4ONGH 5DRNB 1G7LA 2OZ4L 5C0IB 3GIZL 5ISZA 1A6UH 1WAAA 3ARBC 1NGZB 2VLRE 4WHCA 4HF5H 3EZJB 4E5XB 5H35A 5MP6H 4DGYH 3QDGE 3AS3A 1S9VB 2AV7A 1JZ5A 4PP1D 4RGOH 5HD8C 1UJTA 3F65A 4WFED 2GY5A 5EN2B 1DQML 4Y4FA 3QUYA 2OSLB 1JHLH 4LKCB 2HTKD 5TQ2H 3UDWC 5HGBA 4TUKH 2VAJA 1B0RA 2VITB 2W1NA 3H6JA 4KZEL 3O6FB 4OZFA 1SHMA 5DMGC 3FOMB 1ZEAL 4G9FB 1CFSA 3BXNA 3BKCH 3VXQA 1A5FL 5D7IF 1BECA 4NKOA 4APQA 2E9JA 4MDIB 5EBLA 3IFNH 2ZUWA 3GGWB 4R4FH 3MREA 1ND0A 2A1WL 2ZPKL 3Q0HA 4HMCA 3FQRB 4U0QB 4YK4B 1G1YA 1T7WA 3W9EA 3WXWL 2ESVB 5KSAD 3U9UB 3GDBA 5GZNC 2AEIT 3RWJB 1RK0A 4MJ5B 1ACZA 5TF1H 3MRMA 5D7LA 1W0YT 3C60A 4PREB 2JLLA 1MPAH 3IDYC 3QULB 1I7UA 1KPRB 1EEZB 3QDHA 3MV8D 2RAMA 5IB4B 5DRXA 1KEML 5C08E 4MJIA 2VIRB 1A1MA 1IAKB 2OZ4H 1CE6A 4LCCC 3GIZH 3FN0H 4M6NL 5EIIB 1N6QL 4FFZH 2YUZA 5D7KD 2Z35B 1Z5LB 1AQDB 5C07E 4YFEA 5I18L 5J12B 3HI6L 1KXTB 1UB6B 3MLWH 4D0CA 4P2RE 4TSCL 4FQLL 2PYED 1DN2A 2WP3T 4XCEA 3ARFC 1DQMH 2XYCA 3DI3B 4KKLD 1BBJA 2AERT 2OR9L 3RWDB 1MWAB 1L6XA 1YEJL 1J0HA 4YHLL 3N85L 3NAAL 5HI4C 4Y19A 1NCWH 1S7WB 2A77H 1IL1A 4G7VL 1FVCA 4MGXA 4E41A 4GMSH 4HUWA 2DQTH 3VWJA 3DTXA 4OD2A 4GRMA 4M48L 4O4YL 2WANA 1MOEA 3I9GH 3ZE2F 3VXME 1ZMYA 2A0LC 4LVNC 5JHDB 3G9AB 1MF2H 3WXWH 1SEQL 3O8XD 2WLZA 4OI9A 1VEPA 5I9QB 1W8OA 5TDNA 1TPXB 1T5WB 2PCPB 4QLRA 4IS6A 5FYJL 5EUOE 4I0KA 4WJ5B 4ZDHB 5LG1A 3VFTB 3ZYIA 4K94C 3KLHD 4U1SA 3O11A 1RUMH 4MB5A 4ZFZB 5GJTH 3QIUD 2NY5H 5LBSH 2YPVL 5FHBH 4OV5A 2HVJB 2J6EA 4G8EA 3H0TA 5DGQA 4LSTL 1BQHB 3EOTL 4N1HB 3SE4A 1S78C 1A4KA 1HKFA 2UWEF 4XNMA 5FYJD 1AXIB 3C6SB 2FHCA 3BE1H 2AABH 1N59A 1ZTXL 5DRZB 4FABH 3IYLW 4M6NH 4KGJA 3H2WA 5DUML 4FN0A 2BCKA 3CDGB 2W59A 3ARBB 3D9AH 4N8PA 3HI6H 4HIJB 3DRQA 3FT4B 2AGJL 2ZUVA 1AGDB 3MYZA 3X3GL 2V2TB 1CF8L 5IV2A 2FR4A 2BY3A 3TLRA 1QSEE 1QNZH 2OTUA 3N85H 1LO0L 3NAAH 4HXBL 1TIUA 4FNLL 2EXYD 4N8VB 1XEDA 2FATL 1M4KA 4C4KT 2ENSA 4HIEA 3VXUE 4RFNC 3MJGX 2BRRL 4M48H 1NMAH 1E28B 1O5DT 1S9XA 3JXAA 3V2AR 4UQ2A 1PAMA 5ALBL 4Q97A 4G3YL 5T1LB 1DL7L 1NFIB 3HE7A 2VDPH 4GW1A 2YMXL 1A9EB 5FYJH 4JPVL 5IHZB 2YWYA 4AEFA 1M7XA 4LPVA 5GS3A 5I1LA 4R97C 4XNXH 3VRIA 2ADJA 2VQUA 5I19L 2DF3A 5D71H 1QRKA 2DKSA 5EIVA 1U8NA 1LK2B 3GSXA 3WUWG 1ZA6B 3MROB 4YWGH 1CL7L 3VXTA 4ODHL 5IK3B 1ZTXH 3H9SE 3DVGA 4K71B 4LCCB 2YHGA 2LVEA 2MWCA 1IGCH 4U6HB 4WI6A 2VZVA 4OLVH 1JPFA 3HRZB 5F3BA 3ARGC 4QRRB 3ECBB 4JPKL 4F2MB 1D5MB 4XWOD 3VFMB 1Y6KR 4YDJA 1J9CT 1CF8H 4ZS6C 3S7GA 3ARFB 4HS8L 4G9FD 4IRZL 2ZCKL 4KRPB 1U8PA 5FB8B 1I9JL 4HWZB 1LO0H 1MFCL 4OCRH 3L3KA 4XP9L 4C54A 4OCMC 4J3SA 1MHCA 3ESUF 1BIIA 4DGIL 3JWDL 1IGFL 3U9PL 3TBWA 2XWBB 3DSFH 4DOHB 4BM7A 5ALBH 4LVNB 4EI5B 5CKAA 4JG1L 3ILPB 2EYRA 5IJVB 2WBWB 2VUOA 2DWDA 5EIQA 3PF2A 2J5LC 4JPVH 3GFUA 3WN5C 1MIML 3KPLB 4PJGF 4D9RE 1QA9A 2KH2B 3C2AH 3TN0A 5BQ7A 4Z7VA 4H0IA 1ZHKA 2NMSA 4XB7A 1CGVA 1S7UA 1PEZA 3AU1B 3EKCA 4HT1H 2LABA 3VDBA 1WCBB 3BUTA 1CFQA 3RPIB 1A1OA 4PJ9B 2HKFH 3GSRB 4HMEA 5ENWB 3AVEA 3LEXA 5I74B 5JQHC 3LKRA 4L3EE 3KPPA 1MCQA 1G0XA 2EKJA 5KOVC 4Z7UE 1C12A 1A9BB 4CN6A 2R0ZL 4JPKH 3TZVC 4HKXB 1QRNB 1E6JL 5D6CA 3T0BA 4YDKL 3GMRA 5CINL 1FCGA 3EOYG 1MFCH 5LQBH 3GRWL 4LCYB 5AD0B 5E24E 3UJIL 5JHDD 1TLKA 4MCZA 4Y5XA 2VABA 1A7OL 4KXZH 5E6IC 5KANG 5DVMA 5I1HH 4X7FC 1QKZH 2OL3L 4RFNB 4P99A 5DEZA 5BS0B 2X4SA 4PJXA 3HUJB 5E2UL 5KN5B 2DQDL 4Y1AD 4JG1H 4UIMB 3A6BL 3MX0A 3QUML 5J6GB 5FK9B 1KNOB 2CK2A 1QLRA 1F4XL 5CEZL 3VFSB 4ENEC 4RZCB 1MIMH 3E6FB 4WDIB 4FQXA 1ZHBA 3P9MA 3QNXA 5EU3B 3OAYK 1HEZA 4PJAB 4I13B 4R97B 3EAKA 3LQZA 4LLVA 4UTAH 5IMKA 1MWAH 4P46C 1AY1L 4PLOB 5EPMB 5HPOA 3MRNA 3T4YA 5FOJA 4YDIH 3BWUC 3BPCA 5HVHC 4XMPH 2PO6C 3QDME 4QYOA 4GO6B 3ZL4L 4UTBH 5HD8D 1CFTB 3TBYA 1WICA 1MCWW 2AJZB 4Z7NF 4HPYL 1OAZL 1EVUA 2EDQA 3EYUL 1IE5A 3HA0A 3TT1L 3QCUH 4JZOA 5DMIH 3ARGB 3LZFH 1CBVH 1OF2B 3GJEA 1XGQA 4HFUL 5EO9A 2H3NA 1FAIL 1U41A 5DMGD 1R3LB 4O58H 4FQHB 5D72L 3O4LE 3WLBB 2ZSVA 4N0UB 5ITBH 2RJMA 1WGOA 5F6HJ 1NEZB 3WNKA 5FECB 4CVZB 5E2UH 5I73C 4O2CB 3V5KA 1LO3H 1DQQA 3HMXL 2O5XH 2OXHA 3QUXC 4CL7A 1AIFA 5DD0H 3QUMH 3X17A 1L0YA 5F9OL 4OIIH 2AKRA 1EGJH 3BQUA 1CICC 3T3MF 32C2B 1HHIB 1A1NA 2NLJB 5C2BL 4JQIH 1ZHLA 3ARDA 2EDEA 3QDGB 1RVFL 4HH9B 1AY1H 3FT2B 3KJ6L 4EN3C 5L2KB 35C8H 5BVPH 1U93B 3TPUA 2GCYB 3I3BA 1YUHA 1NCAL 1CGSL 4ZAKC 4QRRD 2RHEA 5T5NG 3RNQA 1RIVL 3QHZL 1CIUA 4WFHD 4U6VL 2BNRE 4NP4L 3KWWA 3ARFD 1HINL 5KAQF 1FO0A 2WQ8A 3BZFB 2ARWA 4KRPD 5DZNA 1NCBL 1NANH 3SDDC 5IFJA 2E3VA 2J4WH 4G42A 3IETB 3TZVB 1AXSB 5E0QA 2DWEB 5DUPH 5TFSH 4PJ8C 1EH9A 1P2CA 2D03L 4H8WL 1LMKA 1FQ9C 2X5PA 2ILLA 4IIQA 4P9HL 4PJFB 3LRSA 2WINA 4LLAA 5EOTB 4ELMF 4HUVB 4GS7C 3BZEB 2A0LD 4EI5D 4HULB 3V6ZA 4F7EB 4QHNB 5CGTA 1I3GH 1DFBL 4EQ3A 3OKNA 4DQOL 2APVA 3IFLL 1Q1JL 2W65A 3D25A 4XMLH 1XAUA 1VENA 2WIMA 5DF0A 1LILA 1BWWA 5ESQA 4Y5YC 3O3BA 3EDDA 4PJ7A 5AYUL 2IPUK 4GAJL 1JZ6A 4PRHE 5F3HA 4HGWA 3LEVL 4K7FB 3OPZL 4L8SC 5HHME 4HFWA 2XFXA 5J56B 2VC2L 1LDPH 1RZIA 1S7SA 2A6IB 4P2OA 4PJ9D 3L3IB 4JO3L 5JA9A 3O3UN 3HHRB 1RVFH 3WFBH 4P2RB 1PY9A 3KJ6H 3L6FB 4Q2ZA 3SKNB 1AGFA 1NCAH 5HHPA 1DQDL 1H3TA 2FIKA 1RIVH 3QHZH 4XNUL 4OB5L 4LLWA 2XNAB 2CJUH 1JWUB 3X12A 4OKDA 3MA7A 1CFVH 4JO4H 3I6GB 2YD4A 3CU7A 5DK2A 5D7IA 1BLNA 1J5OL 4ZYKB 4DAGL 1IC5L 1UT9A 2ICWJ 3L5XH 5KVGH 5ESAB 4GAYA 4MQ7B 3MC0A 1G7HB 5K59E 5JXAH 1AO7E 4K9EC 3S6CA 2UY7A 1UVQA 2BP3A 1FVEB 4D9QE 5BS0D 3R8BB 5C0EA 1LO2L 1IGYB 5EUOB 4NNYB 1I3RB 2EDRA 3QWOA 3S5LG 4KDTC 3NGBC 1DFBH 1E4KC 5GGSY 1NFDF 2WIIA 5JPMB 5D2LF 2NW2B 2OJEA 1RUPL 1O7VA 25C8H 3QUXB 3WIFA 1KJ2L 4GMTL 1NBQA 3MXWL 2CLZB 2HFEB 4OLXH 4Q6IC 5F9JB 1JRHI 5K9QG 1B88A 3QG7H 3HNVL 4GW5B 3HZKA 4MAUL 1CICB 2D31B 1YZZA 3T2NH 3UBXI 2B1AH 1VFBA 2BY2A 2CR6A 4NYLB 3CGTA 4MD0A 1G7MA 3T0EE 3UZEA 4EN3B 2P8PB 5EC1A 4U4BA 1FHGA 4ZAKB 4LARL 4XNUH 4P4RA 3T08A 1IEHA 1QBBA 3TIDA 5DEGB 3WEXA 2IADB 3QAZC 3VXPB 1I7TA 1YEKL 1ZVHA 4ZS6D 1KXVC 3RUGA 2X70B 3CCHA 3SE8H 5D2NA 2H1PH 1J5OH 3I85A 1H8OA 3VXUB 1B2WL 2JIXB 1FNLA 5TE6L 5DLML 3DHMA 4Y4HC 1KEGH 4ESKA 3DX6A 3VFWA 3UTZA 3STLA 2YPKA 1OD7A 3TIEA 2BMKB 4LVEA 5F88B 2IANA 5ELIA 3T4AB 3BO8B 3QZWB 4HWBH 5T3ZE 1ZS8A 4WW2F 3MRFA 2WUCH 3GMOB 4WTZA 4RMUA 5L6YL 2XY1A 4EVNB 1Q72L 2UWEA 4K23H 3L5WB 4GMTH 2IQ9H 4Y5YB 3MXWH 2X10A 1X5FA 3SCMB 4EZMA 5GRUH 4OZIE 5L2KD 2P45B 4OD1L 1DUYB 4MAUH 5B3JF 4GOSA 4OUUA 1EMTH 4TPRH 3P4MA 2ZUXA 4NKMB 4QOKA 5MERB 3DRTA 3PL6B 1UM5H 1MELA 2JJUA 3MLTB 3K81A 1WFTA 4ORZC 5K93A 3OR7A 4NDMA 1M71B 1BQSA 4I18A 1IGJB 5EZLB 1R0AH 1CLOL 3NH7L 1YY9D 2FDBP 1EFXB 3P0YL 3ZHLA 5IB3B 4LOUC 1A6AA 4ZTOH 3CSPA 5DLMH 4YX2H 2P43B 4L1HA 2CH8A 2AVGA 3G04B 1LGVA 1OM3H 3OKLA 3FB6B 4G7YH 1WZLA 4X98A 5CEXB 1TCRB 4HCRH 1KC5H 4HXAH 1FIGL 1IQWH 1F11A 3CK0H 2I26N 4JB9L 4ALAL 5BW7A 4P3DA 4HIIB 3VI3E 3SGEH 4Z77B 2RBLA 1GZQB 3NGBB 2XWJA 4DCQB 1FL3B 1R5WA 2FBJH 2B4CL 1JPST 4KDVA 2UYLB 3VDAA 4NC2B 3V5DB 3VGDA 3ALWA 1K4DA 1YMHA 2Q6WA 4H25A 2AW2A 2QQLL 4P2RD 5FM8A 4N5EC 2P5WE 4Q6IB 1B6UA 3MRRA 5E5UB 2ADIA 1UM6L 5IW6A 3VU2A 4L3EB 1D5BA 1EBAA 1PDKA 4JFDE 3I6LE 3BPOC 4Z7UB 4F9LA 1YYLH 2F5AL 2WAHA 4Y4KC 4EOWH 1HH6B 2HLAA 2ZOLB 2Q1EA 4JDTL 3PGCA 1WEJH 4H20H 5HDBE 1Y0LB 1G7IA 1MJUH 1NGXA 3LHPH 3QFDB 1JCKA 1CLOH 3TBVA 1FC2D 2OX5A 2YUWA 4GRWE 1JWMA 1PZ5A 3P0YH 3HS0A 4QWWD 2Y07L 3W39A 3HLAB 3BMWA 1IKNC 3NFNA 4NPYA 5CWSA 1U6AH 4HJGB 4JM4H 3D3VA 1X4XA 1YEFH 3TNNA 3MRHA 3ULVL 4TTGA 5AAMA 1IM9A 1KB9K 3H9HB 1F4WL 5ISZE 1HNFA 2ARJB 4P49A 4XCCL 2ICWA 1S9KC 1WAAE 5ANMA 2OXGA 4Y4HB 5T33H 1OW0C 3CVHA 2H26B 3O2DH 5FXCH 2R69H 3GMNA 4J8RA 1OAKL 3F7RA 4MD5A 5JDSA 4KJWC 3UJJH 4P5KB 3WIIH 1YC7A 4PJGA 1TVBA 4JB9H 5I1KL 3QUXD 3MCLL 2VR5A 2WV3A 2Z31D 3LSOA 4NO5A 5KSBF 1G7JB 4FQQB 4NNXB 3RKPA 1CICD 3P4OA 1RFDH 5JOFB 2NY3C 4YBHA 3EHBC 4DZ8B 3ARED 3BRDA 4HHAB 5F1NA 2UZIL 5DMKB 4ZAKD 4LPXA 4PJ5A 2DQUH 2DM2A 1B0WA 3IDXL 1FL5B 5DRWA 3T77B 4YHYC 4NO0B 1QP1A 4KJQD 5CSZA 5DD6A 4KUCD 1XGTB 2WWMD 1CXHA 3FO2A 1W8NA 4FQCH 5F89B 3VXUD 3O4LB 2JIXD 5JOPE 2YXFA 1VFMA 1MRDL 3KHQA 4WV1A 4KKCC 3SO3B 1KJMB 1BEYH 3RJDA 3BH8B 5CJXC 5BXFB 3WS6A 1IBGL 3TWCH 1TJHL 4MNHA 1BM3H 3MLYH 2F5BL 2ICES 5EBWA 2JCCB 4NSKA 3JV6A 1PYWA 3EDKA 2F74B 5L9DL 1I1RA 3FZUD 5E4EB 1EAPA 5EWIH 1QLEL 2Z93B 3O45B 4PB9L 4EI6B 5ESVB 3BUYB 1P9MC 1KV3A 3O6LL 5J1TC 1OTSC 1VHPA 3AUVA 5B21A 1S7VB 1BZ9B 4LDLB 2GHWB 3SCMD 1ADQA 1FG2A 2GAZB 4R96B 4Z7WF 4L5FL 1MCFA 3BGFC 4PTUA 5FKAB 3T0EC 1MY7A 1H0DB 4M93C 4HGMA 4OCXH 2HJKA 4MXWL 2W9DL 1BFVH 2ZNWA 1CDHA 1U58A 3PL6D 3HZMA 3HC4L 1DBKL 2A2QT 1DBAL 1ZT4A 1A6ZB 1DVFA 4YBLB 2H8PA 2G2RB 4LLUA 2CDGB 1ZWIA 5AZ2H 5CEYA 1B4JL 4X8JB 5D5MF 1SM3L 1U8HB 1RAMA 2WNGA 4HK0B 3AXLB 4JFQB 2MKWA 5C3LD 1QHPA 1C8PA 4D8PA 1IILE 2PTVA 3FONB 4ETYA 5BZDA 4PP2B 1EFXD 3QP3A 3AY4C 4Y88A 1UACH 4AYFA 1OCWH 5C3TA 4U3CA 4M3JA 5BOZG 2JELL 1XGUA 1CVSC 1P5UA 5SWQA 3L3OB 1BIHA 2CDFA 2VXQL 3QQ4B 2O93L 1BX2A 1M05A 1R24B 1D9KC 1J8HA 4NN6C 5MEPB 4AEIL 3C5ZD 1UADC 3KS0J 2ZUTA 4JG0L 5D7JB 2COQA 4ODVL 3OKOA 2AJ3B 3KR3L 2X4PA 4CVXB 1Z9LA 4E0RA 3OXRA 5GISH 4XRCA 4D9RD 5CD3A 3HNSL 1INEL 2ORBH 3WLWC 2UV3A 5ACZB 4CMMA 1G0YR 4IDLA 4TUJB 3O6LH 1EUUA 5HHMB 4EKXA 1NFKA 4Z0XA 4L29B 1RJZA 1GOGA 3AS1A 8CGTA 4JPWL 5FUZL 4OJFL 4LEXL 4L5FH 1H3WM 3TCLA 2VDRH 4NZRL 1NGPH 4L3ED 2PR4L 4JZJB 1G7PB 3VXSE 4KV5E 4PPTA 1MAKA 2VDML 2VL5B 2C4XA 4U1GB 5IIEA 1NUFA 1V7ML 2FH8A 2EDWA 3UJTL 5BCAA 4MD4A 2BJML 5IF0B 3ZKNC 5INDA 2IAMA 1BOGA 4MAYC 2VOTA 3IF1B 1A14L 5EO1B 4XVJL 1C16A 3PGDA 4PGBB 4P4KA 2OQJB 5F9WC 3M1BB 4RGNE 1EHXA 2IBGA 2V17H 2YKLH 4UMGA 4XXDA 3SY0B 3LVEA 4X6FB 3B8SA 2I24N 4HIHB 2CO7B 5CILL 3HAEA 4PRBB 4ETQB 4JAMB 5J3HD 4U7MA 1NJ9B 4F9PA 3A67H 4ELMA 3OQ3B 3KPRB 5C0RL 5FDYA 1MH5B 4LSDA 5ICZA 5KVDH 1WUNT 3B9AA 4MWFA 4OF8A 1MCDA 3RWFB 3KR3H 3EO1B 1TMCB 4JVWA 2V7HB 3JTTA 1U8IA 5I8KL 3HNSH 1INEH 1ZAGA 3MLVH 3HI5L 1T5XA 1KLUA 4XPGH 1DLHA 1UWEH 1ZA3B 2A6JB 4H5SB 3LN5A 4PLNC 1A6TA 4HS3A 1MIEH 1HXMB 1S7TA 4HUUB 3HR5A 5EBGA 2NXYC 1YYMH 2KDGA 4JPWH 4KK5C 2BHZA 1I1YA 2BHYA 2HYMA 3HE6A 1IC4H 2IPTH 5BRZB 4FQIH 2PR4H 2FWOA 4W6XB 3CFEA 3IFOA 3S35H 3WNNA 3BZDA 3OKEB 3PG2A 4XGZB 5IMMB 4AG4H 2YR3A 4LLMA 1WZ1H 2B7DT 2QQKL 3AAZA 4G5ZH 3T04D 2YWZA 3THMH 4R2GB 5GGVH 1U92B 4ZUSB 3CZFB 4GAFB 1Q0YH 1RZJC 1FBIH 1MCPH 3O4LD 5IT2L 4Y2DC 4YHNB 1I9IH 3T0DA 4AIOA 2NY0B 1WT5A 3TJEH 5SWZA 4LRNH 3GSNL 1RUQL 5J11C 1DN0B 4Z7VE 1Q0XH 2YSSB 1JNLH 1HE7A 2UUDH 3QRGL 4PGDB 5HYJB 1FYTE 3MLPA 3LKSA 4YFDB 2VE6B 3MRBA 1EERB 1NFDA 5D2LA 5HHOE 3UMTA 4RFOH 3JZ7A 4A6YL 4K7PX 4F58L 2R0LH 4PRPB 2IFGA 4M8QB 3DNKA 4YNYA 2EZ0D 1KB9J 1LO4H 3BDXA 3DX8A 3V4PH 4APQC 3LN4B 4OZIB 2DICA 1JE6A 2D7TL 5MI0C 2ICEB 5DHVB 4Z9KB 2AJXL 2C3WA 2GW5A 3RWCA 3V7AE 5FM4A 3SKUD 1M7DA 1KCSH 1ZT7B 1AQKH 4N5ED 3AMLA 3WHXB 5BVJB 4H88L 4U1HA 3ZO0A 2D2OA 1NCDH 3MOQA 3ARSA 4IJ3B 1F3DJ 5IG7B 4Q9RL 4PJXE 5I1IL 3STZB 3KNBB 4NCC1 3QA3B 5IFAL 4ZSOE 2PYFA 3VH8B 5BMFH 4WFFE 4MAYB 4OQTL 4D9LH 2OJZH 2AJSH 3MJ8B 2ZG3A 4HUMB 1XR8A 1Y18B 1XIWA 3J7HA 4Y5VB 1C5DA 5F9WB 2FO4B 4S1QL 5IQ7L 4XWGH 4FQJL 4PR5A 5DSCB 5D7JD 3W0WB 4MS8C 4CW1A 3WHE0 3QRGH 3ARYA 3BH9A 4XPTH 1MJ8L 3SDAC 1PG7L 4WW2A 3WNMA 2XACC 4X99A 3T1FB 2WBJA 3EYOA 3SPVA 4GG6E 3Q1SH 4GH7B 3FMGH 5HHMD 1HDMA 1HKLL 1WBYB 1EO8L 2KZWA 4G80A 5GRVL 1IAIH 1V3MA 1KB5A 4U1KA 1U8MA 1D6VH 4BZ2H 3IGAA 4FTVA 5E99L 3MLUH 4R8WL 2P5WB 4ODTH 3L5IA 4N9GA 2F9BT 1U95B 3CFIC 1BQLH 3T09A 4L4VB 4JQVA 4M7JL 4N0CC 5T1MA 1AD9A 5IW1B 3KYOB 2ADGA 4LSVL 1CTNA 2BSED 4NN7C 1UWXH 4S2SB 2HN7A 4DFHA 4M3KB 1TZHB 5KANI 4ISVB 4KJYA 5GGTH 3BISA 4JVPA 1S7RB 1OY3B 1LVEA 5IFAH 3SE4C 4OQTH 3FQWB 2AEQH 3KPSE 1EXUA 3IRPX 4PRDB 3WS3B 2CIIB 4YBQC 4Y2DB 2LAGB 1G7LB 1Z9MA 3KPRD 4KKCD 3LKNA 5ISZB 5IQ7H 3SKJH 5T5NF 4FQJH 4RAUB 5H35B 4XVUC 1RURL 2AV7B 4OZGF 1MJ8H 3PDDA 4MMZC 2WZPD 3LS5H 1KJ3H 4Y4FB 2MSPA 5HVWA 5C0CA 1GZPA 4NWTL 5HVFB 4JGMA 3U30B 3IKKA 2W92A 5HGBB 4RFEA 4FFYL 4DUWA 1E0OB 1OTSD 1S3KL 4OZFB 5GS0L 1T83A 4UDTA 1CFSB 3BXNB 3S9DB 4LPUA 3VXQB 2DN7A 4N0YL 3NPSC 4AH2A 1CDUA 5BRZD 5E99H 4G8FA 5TE4H 5ID1A 4R8WH 5AWNH 4FZEL 4NKOB 4APQB 3DWTA 5EBLB 2CPCA 3R1GL 1XCTB 4WNQA 2HG5A 2YZ1A 3MREB 5B39G 1UA6H 3W9EB 5GS0D 5C0FA 1MREL 4R2GD 4NWUH 1TJIL 4KQ3L 2MCPH 3JUZA 3FO0L 4O2FA 1RK0B 2EKSA 2GKIA 4HWEL 3MRMB 5HPMA 2NY0D 5D7LB 3C60B 2B1HL 1JPGA 1I7UB 1KTKE 3WFCL 4U6YB 5A2KH 3UZQA 4L9DA 4WHYH 5DRXB 4PJ7E 1A4JA 2XZCH 4MJIB 3O6ML 2R4RH 5HYJD 3V6OA 1A1MB 1FLRH 5FCUH 1ED3A 2EE6A 1YJDL 3OKDA 2X89D 1KULA 3VWKC 1LQSR 5IBUG 4W68A 3EO0A 3GSVA 4F7MA 2FSEA 3QQ9C 7CGTA 3HZVB 2GSGA 4D0CB 4UILH 1GAFH 4PRPD 5DURB 4XCEB 1X3DA 3VFUA 1BFOA 5TDPA 2H2SD 2DIJA 1BBJB 3EW3B 4M5YL 1EBPA 1MFBH 4NWTH 2XPGA 1IC1A 1V5JA 4U6XA 1GC1L 1JRHL 2M1KA 5F7EL 1Z0MA 2YD2A 3BVNA 4Y19B 2FX8H 5GS0H 1G7QA 1IL1B 1FVCB 2FX7H 4DKFL 4E41B 4HUWB 3ZLQC 3VWJB 1J88A 3DTXB 4OD2B 5I1GH 4GRMB 5E8NA 1C5CL 4ZNEA 4R6UA 2NQCA 4YDLC 3RHWK 3E6HA 1ZLVH 1OWWA 5TDNB 4M6ML 3NIGE 4IS6B 1YN7A 3FO0H 4MAYD 3KJ4B 2KL6A 5FKPA 3KGRA 3QUZC 5A16B 4U1SB 2B1HH 3O11B 1DQTA 2NPLX 2OP4L 1RJLA 2Y5TA 4KAQH 4OV5B 2C1PA 4KRNA 4X6EA 3X13A 4G8EB 3H0TB 4NQVB 3W0WD 3WL9A 3GHBH 5EZOL 1A4KB 4RRPG 4XNMB 4U3XA 4U33A 1HHKA 4HS6A 4Y0GA 1N59B 1YJDH 3ZYOA 1HH9A 2BCKB 1NMBL 1FFQA 2PN5A 1KIUA 3DRQB 5DHVH 5JXED 5IM7A 1SY6L 3FN9A 4HBCL 1EEYA 3OJDA 2DL2A 2ATKB 3GB7A 1CN4A 3VGAC 1GOFA 5IV2B 4XP1H 1HHHB 4MNQE 4WIQA 1ZV5A 5KSVA 4Z7WA 1BZ7B 2P5WD 5IFHH 1GC1H 3U0PA 2OTUB 5DFWH 4KJPC 4MB3A 1J1PL 3RUGE 4P5TC 2MPAH 5DJYA 3I6LD 2UY6A 2C3XA 4L4VD 4KK5D 4HIEB 4OLZL 3K8KA 2BDNH 3CFCH 1GPOL 3NCFB 3NPSB 4NJ9L 4M1CC 2A74A 1QPPA 1VB9A 4LLYA 4V1DA 5HGGS 1S9XB 2BY1A 5D5MA 2NR6C 2A73B 4UQ2B 3WKNA 2X4UA 3P9WB 5DHXB 3HE7B 4GW1B 1NCCL 5FIEA 1PW3A 1RZFH 4FQXC 2DQHL 3GO1L 3RBGA 5IHLB 4RGNB 2B5IB 2FEEI 2F19L 4XAKD 4Y2DD 4YHZH 5I1LB 2OP4H 4K7PY 3VRIB 2ADJB 3VJ6A 2CKBA 3F58L 5ISZD 3PQYA 3S37L 1G6RL 4BJLA 3GSXB 2UWEE 1Z3GL 3G6JE 5EZOH 5IROA 3V8OA 1RUAL 2QADB 5FDWA 3DVGB 1GCFA 1RIUL 3OF6A 3GI9L 5HDOA 5JORA 4Y4FD 3VWKB 3QUYD 5CHNA 4YIQA 3K74B 3NCYS 4R7DA 4ERSH 1JPFB 4QOKE 5F3BB 4ZO8A 5HGHA 3N1GC 1JGEA 5J9PA 2HT2D 4YDJB 4CAGA 4WU5A 1OQXA 3CFBA 4FOMA 1CQYA 4O02H 3UXFA 4P59L 3UYRH 4WCYH 4APQD 4HKBA 3L3KB 2DQJL 1EZVX 1J1PH 1OARL 4F8TA 2B4CC 4Z0BH 1IGIL 3B83A 1MHCB 1BIIB 4XBEL 4RIRA 5FGRA 5HY9A 1RZJH 1NSNH 1QBMH 1I8MA 3TBWB 1YECH 4M1GL 2WMPA 3G5XA 1NC4A 3C60D 5D7LD 5JW5A 2I25N 3WUWA 5JOPD 2EYRB 4K8RL 5CCKL 3X14A 1NCCH 2DWDB 4M1DH 4ZUTA 4EQ2A 2JJTA 4KY1H 3BPNB 3MXVL 3NCJH 3GMLA 3TN0B 5BQ7B 4N8CL 4MJID 4Z7VB 5D4QA 1ZHKB 2V9TA 1F4HA 4Q74A 1S7UB 1OAUL 3MBXH 4BZ1L 3GBNL 4H0GA 4M7LL 2JKXA 3U7AA 1CFQB 1A1OB 1KCKA 4MA1B 4OZFH 3LEXB 3TH4T 2Y72A 2X7LA 2AEWA 5DURD 2OBGA 5GZOD 3PP3H 2L7UA 3LKRB 1OHQA 3LRHA 5AUMA 4KUZL 1C12B 2DD8H 3S34H 1QEWA 4HC1A 3VGHA 1ZSDA 4XXCA 4Y19D 1BJ8A 5D6CB 1PD6A 3QPQC 3WIHL 3X11A 3BKMH 4BQ8A 4E41D 3GMRB 4OLUL 5CJ5A 4PV9A 4P59H 3VWJD 3TFKD 4IIQC 3WYRA 1OARH 2BOBA 1IGIH 3LH2H 1YC8A 4MCZB 2NNAA 4Y5XB 2VABB 3Q5OA 1JZ3A 3D3VE 2O5ZH 5EZIH 3DVIA 5CKGA 3U48A 1WIUA 2FZ3A 4RX4A 2X4SB 4PJXB 4ZPVB 3ZT5A 2CUIA 3N1QC 2MNUA 4YUEL 2J8OA 5DFVD 3W11D 5DQ9A 5ANME 4OGAD 5BO1L 4F57L 2LTQB 5BV7C 4D0DA 1QLRB 1FRGL 2PNDA 5E03A 4PJGE 5FF6A 4NQDA 1BAFL 4FQXB 4N8CH 1KIQB 2K7PA 5HYSG 1ZHBB 5EO0A 3P9MB 3QNXB 4Z78A 4N8VG 3MLZH 1HEZB 2V2XA 2XTJE 4HIXL 5KS9F 4I8DA 1ACYL 1IARB 5FUOH 3LQZB 3QEHA 4LLVB 5IMKB 4AENA 4LAQH 3MRNB