4JQIH

Structure of active beta-arrestin1 bound to a g protein-coupled receptor phosphopeptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
219
structure length
204
Chain Sequence
VQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVTVSSASTKGPSVFPLAPAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Beta-arrestin-1
publication title Structure of active beta-arrestin-1 bound to a G-protein-coupled receptor phosphopeptide.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 37
structure length 204
sequence length 219
ec nomenclature
pdb deposition date 2013-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jqiH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jqiH01
1V8HA 1RIVH 3HNSL 1A6ZB 4MA8H 2DQDH 5K9KA 3G5VB 4OKVB 4R3SA 1GPOL 3H9ZA 3X17A 4IHOB 1UB6A 5LQBL 3D48R 3I02A 1QUNA 1N6QL 4NT6B 2IPUK 5BV7L 1FNLA 3BIKA 4OM1L 4CADB 2YRLA 1MLBA 2L7UA 4G8GE 1S7VB 1DE4A 3HA0A 4PJAF 4ZFOB 3IU4H 5CSZA 3DUSB 1E0OB 2CMRH 3DSNA 4PUBL 2IH1A 5C0DB 2Q87A 1X9QA 4G8EA 5C09A 2Y9RT 3FFCE 4JVUA 1KNOA 1ZV5A 3V6BR 2R8SH 1EBAA 1NGQL 4JY4A 1EAPA 3ALPA 3ETBF 4PJEF 4Y0GA 5DMJB 5T1MA 1TCRA 1T0PB 1WFNA 6CGTA 2C3VB 2VZSA 5L88H 4Y5YC 2XQBL 5FDWB 4LKCA 3RTQB 1UWGH 1KN4H 3FAWA 5EDXA 43C9A 1Z0NA 4XTRC 5IB5B 3SDDC 4X98A 2D0FA 4X99B 1S7WA 3S35H 4LLUA 3CX5K 5DMYA 3PQYA 1X5HA 3T65B 4F2MA 4RBPH 1KPVB 1JUFA 4PJDE 3O9WD 4G8FB 5CEYA 3REVB 1CGUA 2Y1VA 3C9NB 5FO9A 4XVUC 3IDNA 1R24A 3T4AA 1AR1C 5DXWA 3F12A 1F2QA 1MHEB 4KJWD 4HHAA 4L8SC 5TDPB 1RMFH 3O9WB 1JTPA 4LPCA 5IHLB 1G6VK 5E00A 2OK0H 1MY7A 3W2DH 4HC1A 1C7SA 2ITDA 5EUOA 1AXTH 1BBDL 4FG6C 4LLMA 1AO7D 5F3HA 3BVNA 1F42A 3OKLB 5HHOD 4NNPL 2VXUL 1MF2L 1PYWB 4CRPA 1XF5A 1BECA 5IW3A 2BVOB 1OPGL 4AYFA 8FABB 3VXQA 5KTEL 3QUKB 3G6JB 4OGYH 1AO7B 5TDNB 5EFIA 5HHOB 3GEWB 5HDOA 5HGHB 1NGWB 5I1DB 1AGEA 5IB2B 1RI8A 2UZYB 32C2B 4PJBA 1NKOA 4MMXC 4YO0A 4RWHA 3GNML 4H5SB 3H3KA 4PJCB 5GGTL 4KDTC 1JPSH 1OAUH 4MQ7B 2MKLC 3VU2A 2XV6B 1A2YB 4IBLT 1T21A 1QD0A 3IKCA 3MNZA 1CG9A 2VH5H 1GGBL 5B4MD 5ICYB 3IS1X 3MGTA 4LHJB 1XGTB 1BZ7B 4OBRA 5D2LB 1R3LB 2FO4B 5H94A 4XMPH 5EUKB 4HF5H 1NFDF 4QT5B 3TIEB 5I1KH 5J6HA 1NCAL 4WDIA 3MA9L 3S88L 1BOGA 2PYED 2FLRT 4ETQB 3HZYA 4JFOA 5FA3A 4Z95H 6FABL 2B2XL 3TC9A 3NIDF 1T22A 4PJXB 5ITFA 4EJ1C 2YN3A 4HWZA 2APXA 2PYEB 4YE4L 4MSWB 2HRPH 4XMLH 1WIUA 1K9TA 1MOEA 35C8L 5FECA 5K33A 1JZ4A 1BD2E 4OM0H 4WIQA 3ARDC 4UQ2B 3UBXA 3KWWB 5TE4L 1HHGB 1JWUA 4ELME 1VESA 3IFOA 3INUH 1ZT7B 3CFDB 5DJDA 2DI8A 5IVXB 2AW2A 2GK0B 1AJ7L 1SYSB 2KZ1B 5ISZE 1KG0A 2ZOLB 3P30H 4K9EH 3RWJB 2HT3C 4XNMA 2HFGH 4PS4L 1ZVSA 4RX4D 15C8L 2VJXA 2X1XR 1FG9C 2E3VA 3P4NA 4HIEA 4YXLL 5LJYH 1T0MB 2FZ3A 5E9DA 4NKIH 4EZMA 3DWTA 1MVFA 3TO4D 2DQHL 3L5HA 5KS9E 1PLGH 1JZ5A 4PRBB 1F90L 4Q0XL 1EHXA 4WFGD 3ZKQD 4M1DL 3X11A 2VLJE 3KPMA 3ME0A 3LZFH 1KLFA 4XPGL 5J7CC 3O6KL 3SE8L 1SY6L 4BA8A 2NMSA 3TO4B 5C2UB 1MAMH 2LTQC 3D69A 4OIBA 3VXRD 2E8YA 5IFJA 3BP7B 2WLZA 2JLLA 3OR7A 4KV5F 1E4KC 1MCRA 1W8NA 3GMMB 4WEMB 3U4AA 4LDEB 1E4WL 4ZS7H 2CRZA 3IFPA 2YD9A 2FJFB 3VXRB 4P3WA 2ZOKB 3S7GA 4BFIB 3PXJA 1GRWA 3JWOH 4P5TD 5FA4B 1ZHLB 1EIBA 3DMMA 1YEGL 4I77L 2MCPH 3MZGB 2XNAA 4JRXB 3T4YB 4U31A 4EUPA 1OLLA 1G9NH 3QXTA 1OAKL 4PTUA 4L4VA 4N1HB 2IBBA 4GXUM 3MLVL 3IFLH 3P4MA 4MCZA 4HH8A 1XF2B 4P5TB 5I1CH 2C1OB 3QG6A 3FRPG 3BDYL 4JCLA 4OZFH 4OIIH 5AUMA 3CUPB 1PSKH 2GYSA 1N2RA 1DVFD 3PDOA 4XAWH 1QRND 3VFMA 4OLEA 4ORGB 1KF9B 5L7XL 1R3IH 3TH3T 4KKBC 1G7JA 4S1SH 2XI9A 3QIUB 4RNRA 1U3HD 2YN5A 2JJSC 3STZB 3RUGF 1AFVL 1QRNB 1L7TL 1IQWH 2D4FA 1NAML 2FX8H 3BIBX 4ZXBC 4NO3B 2J6EH 2DIJA 2X5PA 2I27N 4PJHB 1CBVL 3FQXB 3HRPA 1S7QA 5CGYC 1A7BA 2FYYA 4OQTH 4PJ8C 1U3HB 3BP5B 1IGMH 4UBDC 1NCUA 4QF1B 1NAKH 5FYJH 4HD9A 3U1SH 1GVIA 3HAEB 4NKMB 1YYLL 4HKXA 4F7TB 2EZ0D 3MNWB 3ARTA 2VISB 1TQCC 4XB8A 5DTFA 4HFWB 4FTVD 4HK0A 4MCYB 5FHBL 1EUTA 4QWWC 2FR4A 1ONQA 2DDQL 4LCWE 5EU5B 4MQXD 4M7KL 4K23L 4QTHA 2VAAB 4JM4H 4HV8B 2P47B 5J06A 4FTVB 5CJQH 4DZBA 4G7VH 4ZFFA 2MHAB 4N5UA 2EH8L 5EOQH 2DMCA 5JPMA 5HYIA 2D03H 1ND0A 4MDIA 5C2BL 2WBWB 2CXGA 3LOWA 2AV1B 4P2RA 4U0QB 1HH6B 1T5XA 4A6YL 2HKHL 1JGEA 2IQ9L 5I1HH 4P4KC 5ID1B 4KVNH 1KEGL 5D2LE 1IEBA 1U8KB 4HUXB 3L7EA 3FMGH 2XN9B 2XZQH 3QHFL 3Q6FA 4MZ3A 3MRKA 5CBAA 3IGAA 4N5EC 5ICXA 3VXOA 2R2EA 3EOTL 4HKJA 3U36B 1QFWH 3AS0A 3BOVA 4PLNC 4CUCA 4PJXE 3AMLA 3RWFB 5EZJB 5B39B 4WEBH 3ZYJA 2PYEE 2AJYH 1YY9C 1JF1A 1JZ8A 1C16A 1MJUL 3F58H 4KRPC 4G43B 4OZHA 1FZJA 2PTTB 3CZFB 4PRNB 2HLAA 3V4VL 2V2TA 1TZGL 3AUVA 4F3FA 5L8JB 2DAVA 2R15A 3N1PC 4PV8A 3U83A 5E24E 3X3FL 5EZIL 2MWCA 2F5BH 3R0MA 1TJHL 1VEOA 2IBZX 2E7MA 2RGSA 4FNLL 3PWNB 3W11C 5EH1A 4AG4H 3DGGB 3OB8A 4OLXH 1ZLUH 3AU1A 4XTRD 3SDDD 3CDFA 3I84A 3G5XA 3MBXL 3HTLX 4Y5YB 2ZSVB 4XPAL 3AREC 4UB0L 4JVPA 5AWNL 2ZUXA 4RIRA 4XC1H 5KG9A 3SDDB 4XVUD 1NC2D 1WWBX 3MROB 4M7ZB 4OLWH 4QNPF 3U0TA 1AR1D 4W70A 3WXWH 1ZANL 3EO1A 3KPNA 4OSUL 1NGPL 2KDGA 4X5WA 1NBZB 1EX0A 5TH2B 3V52L 4WFGE 1NC2B 4G6JH 1HHIB 4NNYB 2VDLH 1QPPA 4TVPD 4P9HH 1R6VA 4NQXB 4FG6D 4HIIB 3RNQB 4L8SB 4O2CA 4R7DB 1T4KB 3MODH 5C3TA 1LEKB 4ZO8A 4H8WH 3Q48A 3WN5C 5IFHH 4JY5L 4JKPL 2P49B 1CFTB 3DXAE 4NWTL 4ZUSA 4D8PB 3QAZB 4HS3A 1WBZA 3MJ8B 4XPBL 1FL6A 1VFAA 4HIXH 5FYLH 3RPIA 4RSVA 1Q1JL 3LIZL 3LRGA 4K3DL 4BJLA 2GJ6A 4EI5A 4PJ5A 4U6HB 3NCYS 3MJ7B 3PWPE 5GS0C 2IALA 3TJEL 2ZCHH 5E0QA 4U3CA 1KPRA 1CDGA 1A6UH 4ZFOL 5HYSG 4KPHL 3TYGH 3EYOB 1E27A 5EOCH 2GUOB 3W9DA 43CAA 3HE7C 1T0NB 3GSOA 1UEYA 2AEQH 5DRXA 5A2KH 4LK4A 1AP2A 5E03A 4KZEL 3BD4A 3E6HB 3C5JB 1VDGA 1HHKA 3SDYL 3HG1D 3N85H 4KY1L 3T77A 4XBPB 4M6OH 5I1AA 5DLMH 3SJVD 4BSWA 5DJXA 3LQAL 5FV1L 3JV4B 4YGVB 2V9QA 5ANMB 3JSSA 3HG1B 1DEDA 4NZUL 5KSBF 2PTUA 3MMEA 5BVJA 1EPFA 1F2XK 3T1WA 4PJGA 3SDCA 4J6RH 5DEGA 1INDH 1JI1A 1YZZA 1YMME 3ARDD 5EORL 4NYLA 3L3GA 3OJMB 4FQ1L 3O0RL 1U8PA 1QLFA 1MFBH 2YUXA 3TV3L 4OLYH 5C92A 3MLZL 5JTWA 1QVOB 4BFBD 3L9RA 3CH8A 1D6EA 2FCBA 3CMOL 4LNVA 1GIGL 4PPTA 4H1LB 4E41E 4JM2C 1Y6KR 4C55A 1BX2A 3ECBB 1I8LC 4C56A 2A6DA 3CXDL 3ESVF 2VKWA 1A5FL 3O3BA 5LGHH 2XPGA 3BJ91 2R0KL 1F8TH 5GGSB 1JK8B 5JW3L 4G5ZL 4F8QA 4RGOH 3V4PH 4RDQG 1A14H 4OFVA 1CLCA 4R4BB 4OT1L 3RIFF 1X5YA 3QIWC 1F02I 5J1TC 4L8CB 3B9KB 1R3KA 3ZZ1A 5KW9H 4WHYG 4XNYL 3F7VA 1TTGA 2X40A 2IQAA 1O5DT 2VQTA 1GOGA 4M5YH 4NQTA 5KAQG 4ORZC 4APQC 4KHTL 2G9HB 4U1IB 1F58L 1OW0C 4AIXA 2X05A 2LTQB 1CDBA 3S37X 1J05A 1K5NA 5AEAA 3NA9H 4XVJL 5TE6L 5I66A 4QHNA 5AZ2L 1J8HD 5D6DC 2Q76A 3HI6H 2J6EA 1GZQA 3DUHA 3CLEL 3EZ8A 4WWKC 3HN3A 1CT8B 4M48L 5J56B 4PJ7B 3NPZB 2PNDA 4NPYB 3O45B 4X4XB 4OQTA 2Q7YB 4G7YL 3DRTB 5AD0B 1J8HB 1M7IB 2ERJC 2XTJC 4ELKA 4NN6C 2OTWA 5D96B 4G9DB 3D3VD 3FB5A 3BW9B 5D1ZC 4HLZH 1Z9OA 3BP4A 5IBUG 2HFEB 1TZHB 1ZLWH 4GKZA 4GAGH 5HHXL 2QV2A 4X4ME 3D3VB 3OAZH 4U1MA 4NBXB 4KKBD 5GGQH 1J0YA 1P4IL 4XP5L 4JQVA 3HS0B 1T2QH 4Q6YA 2YOCA 4ZXBD 5TJWK 3WLWC 1KB5L 4JFHD 2VE6B 5CGYD 1EEZB 1G1YA 4PJ8D 3UJJH 4M6NL 3VFWB 5MEND 2AI0L 4LU5L 2P4AB 4YR6B 4OCWL 5GPRA 3FCTB 2UUDK 1G0DA 1F4HA 2ICEA 5ICZA 2EE2A 4CMMB 1JJUA 4YDVA 2R39A 1FCGA 1U8MB 4PJ8B 1ODAA 5I2IB 4MNHB 1MJJB 5MENB 4QWWD 5IEKB 4TOYL 1IC7L 1EFXA 3K81A 4QHUB 4WFHD 3D0LA 1FV1A 1M6OB 3BI9X 4LOUD 1TJIH 2J8UE 1U3JA 4TUKH 3VCLA 4DZ8A 1GGCH 2PXYA 4DVBA 1QP1A 4K3GA 1LP9F 1JV5A 2YD3A 4NRZB 3AM8C 3OKDB 1CQKA 2NW2B 4MXVE 1P7KB 1FH5L 2HVKB 1MFEH 1T04B 3L5IA 1HKLH 1FL5B 3VXPB 3OR6B 4P4KD 1D3CA 3ARZA 3RI5F 5C8JB 3AB0C 3LKPB 1MQKL 3O2DL 4RFOH 2EDYA 5IB1A 3RIAK 1OSPL 3KYOA 3PNWB 5L2KE 3D39E 1IEHA 1LD9B 1LWRA 4EI6B 4QRSA 2G75A 5CMAA 2ORBL 1IGFL 4LEXH 3E2HB 4I48B 4N5ED 1MHPH 5CCKH 1AHWB 4UT9H 1YNLH 3VW3L 5D1QC 5BZWB 1QSZA 1LK3H 3GSQB 1VPOH 1A3LL 4RGNC 3ZE2E 3MJ9H 4JO1L 1N26A 3BXNA 1UWEH 1KENL 3SJVE 1HOCB 1YY9D 3DJ9A 1YN6B 1BF2A 4KRPD 1HSAA 1UB5A 2QHRL 3KPRD 4F57H 5F9JA 1I8MB 3OHXA 2JELH 3S37L 3RVTC 3D9AL 2Z35B 3MCG1 4KRPB 3RJDA 3LEXA 3KPRB 4XVTL 4QY8A 2FD6L 3PHQA 1RZIA 3W11D 3LKQA 5K9KB 4PG2A 3T0WA 4GW5A 5I1LA 2PN5A 3MLYL 2WINA 3IYLW 5JO5B 1UB6B 5B38B 2IJ0C 3WD5H 3I02B 4P2QA 2R29H 3ARED 5C09D 1S3KL 4OFYD 2NXZC 1NCCL 3BIKB 3MRJA 3OGOE 4PLJC 4J3UA 1IZJA 1P7QA 4CJ0A 2D31A 3HZVA 4HLJA 2AJZB 5I30H 1DE4B 5FUCE 1OCWL 3UO1L 5I76A 1EO7A 1DL7L 2IH1B 4PJ7F 1A7NH 4G8EB 5FGSA 5C09B 4J3WA 5DQDH 1KNOB 1GGTA 3V8CA 5JHLH 5T1MB 2AK1L 1RIUL 2F8VA 4LKCB 4ZUTA 2E9JA 3CJJA 1WFOA 2CRMA 1FAIL 3MV7A 2NR6C 4ZAKC 1MJ7L 3LS5H 4FQCH 4X98B 1S7WB 4NM8H 2WBJA 4XXCA 4BZ1H 1CU4H 1T6WA 4LLUB 1BEYH 1E6OH 4HIJA 3ZT5A 1YEEL 4F2MB 2VR9A 4XCYB 1XFPA 4ZFGH 1JUFB 1DQLH 4K3EH 3FOMA 5CEYB 1U8QB 4JANA 4HT1H 3GSRA 3PIQA 3WN5B 4LVHC 3IDNB 3T4AB 4OF8A 5L0QC 5GRXG 1QKZH 1J8HE 3WFCH 4HHAB 2FJGB 2IPTL 4OKDA 1UCTA 2UZIH 1NGZA 5E00B 4MX7A 1WC7A 2BC4A 2RB8A 4LCUA 2ITDB 4WW1A 1I3VA 3NIFF 2BJMH 2EYSA 5DMGC 2W91A 4LLMB 3ZL4L 1K4CA 1S7RB 4YHML 5F3HB 3HE7D 3BVNB 3H7BA 1KELH 3L3OA 2HT4C 5EBLA 1XF5B 1NBVH 2C7UB 4EI5C 3VXQB 4OUOA 2Y6SD 1EK3A 1DQDH 2EXYC 5EFIB 5C6WH 1KBGL 3MLXH 1VFBA 4BQCA 4JPWH 4PJBB 4W81A 3VA2C 3SKUD 1DLFH 1FIEA 2ARWA 5GRVL 5DJAA 1T7VA 3TWCH 3RHWF 2VDRH 4JFHE 1F11A 5EU6D 3KPPA 3SE9H 4LIQE 2MTPA 1M71A 1S9KC 1T21B 3ES6A 3IKCB 1K4DA 5IT2H 4D3CH 1CG9B 1JRHH 3DGCR 1YQVL 2YD2A 3MGTB 1EEYA 2JK5B 4P48A 5E5MA 3ZT7A 1VB9A 5H94B 3PGCA 2O5XL 1HDMA 1MRCH 5J6HB 5A2LH 2J2ZA 4QRUA 2M2DA 2NY4C 2M8XA 2VRAA 1BOGB 3RAJH 4CN1A 4ZPVB 3HZYB 4JM2D 4JFOB 1RY7B 4MHHG 5HVGB 1CGXA 3L5WA 3I9GH 4WI9A 2IGFH 1NMBH 1T22B 5ITFB 1QACA 3B43A 2AABH 5HI3C 4HWZB 3KS0H 4OFKA 5DEFA 4GG6E 4JM2B 3UTTD 1A3RH 1BVLB 3HCVA 2E27L 1BAFL 2LFGA 3UBXB 3NA4A 4WGVB 1MCOH 5FOJA 1UZ6E 2R0ZL 1JWUB 1NFIA 3QIWD 1CWVA 3OF6A 3FONA 3IFOB 3VG0H 3NCYP 1PKOA 2I26N 3MOBL 1KG0B 3VD4A 1UM4L 4XGZB 3VD7A 4XNMB 3JWOC 1FORL 2FLBT 3NH7L 3U7YL 4APQD 4OZFG 5IW1B 1ZVSB 3KJ4B 1MAJA 3I2CH 1S7XB 3JWNC 1TENA 1G9NC 1PFCA 4N0UA 1VCAA 4APQB 5C86A 3C09C 4JFDD 4JRYD 4EKXA 4WWKD 1QLEH 3CVHL 4QHKJ 3TYFB 1AC0A 3D5OF 1KJ2L 5C0CD 3QZWG 5CZKA 2XTJD 4KAQL 4DWHA 3CFKA 2AXGA 3K46A 4JFDB 4JRYB 1Z3GL 4LRIA 4DVRL 1QFWM 1LK2B 2E9WA 3WFBH 5IFJB 5D1ZD 1RZFH 2X4OB 5JUEL 4L8BA 3OR7B 2O61B 2YUZA 5C0CB 4XXDA 2ERJB 2XTJB 4DGVL 4Z7QF 2EEDA 4NN6B 2CJUH 2NNAB 4O02H 5D1ZB 4KROC 5JA8B 4M62H 3QUYA 1HEZA 4NCC1 1YQ2A 5B8CA 2LU4A 3EAKA 3UPAA 3WLWD 1T66C 2YPVH 5EA0H 2XNAB 4EUPB 2FECL 3BE1H 1INEH 4OV5B 4L4VB 3IS0X 4LHUG 4XP6L 4MCZB 2OBGA 2VDQH 4AIZB 3V95A 2H32H 1RZKC 5EUOF 1K3IA 1O7VA 3FB6B 3I50H 4DJMA 3CSGA 1F3JA 5MEPA 3PDOB 4JQVC 2RFXB 2AERT 4LCIH 3CDYA 3O6LH 2ZJSH 2YD1A 4Y5XC 2WIIA 2BVTA 2GITA 4FMFA 5HYJA 4I13B 1XEDA 1EBPA 1MCFA 2VDPH 4M7LT 4FMKA 4YQXH 3CSYB 2X42A 1FGNH 1A7OL 2ESVD 3MRFB 3EYQC 4HMDA 1BFVL 2FDBP 4ZD3L 3BYYA 4R4FL 4AL8L 4K3HA 4OD1L 1WJ3A 2V2XB 3VFTB 1CD1A 1HIML 4XP1L 3LY6A 1KCUL 3RZWA 3AB0B 2LU3A 4X6DA 4XNUL 1PG7H 4F7CA 3PDDA 4ODXB 4P2RD 1EHAA 1C5DA 5D1QD 4EIGB 2EDRA 4Y19A 4BH8A 4ZFFB 4G3YL 1YYML 4RGND 5BS0D 4MDIB 3RL1A 1MCPH 8CGTA 4P2RB 1T5XB 5D1QB 4XMKL 3UMTA 2X4UB 2BMKB 3BRFA 3PHSA 1IEBB 1HILA 2HAZA 2BFVL 3L7EB 3T2QA 3U7WL 1ORSA 5EU6E 4F7MA 4LDLB 2R1XB 3RVTD 3D18B 3PJSA 4W4OC 2I60H 3U82B 1QA9A 4IRJC 3Q6FB 4XB7A 3P2TA 5CBAB 3IGAB 1MREL 4FFZL 3VXOB 1C5BH 2R2EB 4HKJB 1VGEH 4XWGL 3MRPA 5IFAL 4JG1H 4LIQL 1W72H 1HYSC 4GUPA 3DTXA 4K94C 3MGOA 2BHUA 1IGTB 5I1GL 1QZ1A 3P0YL 1LO5A 4NQCD 3KYKH 2BOBA 3GSWA 4NO2A 4PLJD 3VMOA 5KSAA 5L6YH 1JF1B 4FXGA 4RDQF 1OD9A 1AD0B 5E08L 1K8IA 4FQ2H 1YEFL 3V0WL 4OZHB 4P9HC 4QCIA 2V2TB 1LDPH 4H8WC 3EO9H 4NQCB 4PV8B 1MFDL 3UTTE 5FXCH 2VLRE 3QXAA 3ARFA 5T1DL 5C6TL 4JPVL 1WBXA 4YGAB 4PJAE 3V5DA 5KAQF 1RIHH 1RZJH 4DUXA 2JJTC 3M1BA 2W92A 2EE3A 4F7EA 2NR6D 5DD6A 1FZKB 1FGVL 3G5XB 1NL0L 4J12A 1HHHA 5T1LA 4DN4H 5F6HI 3GMNA 4GLRI 3WUZA 2I07A 1FVEB 4RIRB 5KG9B 1DN2A 5BOZG 1NC4A 2DWEA 1PEZA 3U0TB 1LO2L 2NY7H 1NSNL 5E1AA 2CLZA 1PKQA 1Q0YH 4I0PC 2QTEA 4JFDE 4NKDA 4XHQA 4HJGA 4JRYE 4X5WB 3RWEA 1KXVC 4PJ9C 4Z9KB 4XXCC 4JKWA 5HDBF 1D5BA 5L0QB 1OGTA 1OAYH 5EN2A 2R1WA 5C0CE 3Q6GH 3BIAX 2WP3O 2GW5A 4UT6H 4OLZH 3HPJB 1NDGA 1NJ9A 2HT4D 3DYMA 3OMZA 1UJ3A 3BWAB 1LVEA 2GJ6D 4CKVX 4ZUSB 4EI5D 1ZKAA 2YSSA 4KK5D 1WBZB 2DJ4A 4U1GC 1DANT 3QXWA 1FL6B 2EXYD 1VFAB 1JFQL 1AQDB 3RPIB 1WITA 3HC3H 1IKFL 1BVKA 1VACA 1D9KA 1J10A 3HUJA 3SGDH 4KMQA 2GJ6B 1JPGA 4EI5B 1JGVH 1MAKA 1NLDL 3MJ6A 4PG9A 3RX8A 1YEHH 1T5WA 2R56H 3QR2A 4PREA 3QFDA 2IALB 2Q3ZA 4YNYA 5TFSH 3O8XC 5F9OL 1E27B 3W9DB 3W5NA 3V6OA 4FP8H 1KV3A 43CAB 4ZO7A 4LP5A 4UNUA 3GSOB 1AC6A 4UTBL 1AP2B 3MREA 1EDQA 3DV6A 3VFGL 4CW1A 5T33H 1GPOH 1HHKB 3CK0L 4HUUA 3X12A 2G5BA 4ZDHB 4U0RC 5DD0H 4DN3L 2NY4D 1X5IA 5DQ9A 1N6QH 5BV7H 5I1AB 4BSWB 3VFSA 1T7XA 3EW3B 1OAZL 1TVHA 4PUBH 4U2YA 5HI3D 3ZE0E 2NY4B 3C2AL 2LAGB 3GMPB 3MMEB 5D2NE 3UYRL 5BVJB 2F53A 2ESVE 5C0RL 3NFSL 4PJGB 1UACH 3OKMB 5DF0A 3CXHK 3NIDE 1T2JA 5DEGB 1KJ3L 3GSNL 2XQBH 4NYLB 3L3GB 5ETUB 3GFUA 4M5ZH 5IEHA 1U8PB 4QGTA 1R5VB 1QLFB 3GIZH 2Y5TA 4C56D 4K8RC 1FLRL 4YZFE 3G6AB 3L9RB 4LSRH 3O2WL 4GKSB 4NOBA 4QRQB 3ESUF 4ODWA 1WAAF 5GS0L 2V5RA 1KFAL 4GBXC 4C56B 2B5IC 2VB5A 3QNZB 4LKXA 3OKNB 2DL2A 2OL3B 4RGNE 4OZHF 5BS0E 2XPGB 4K7FB 3L3HA 5I16A 5FDYA 3IB4A 2K7QA 3I6GA 1MHCB 4TSAL 1MCWM 3E0GA 3ELAT 2BNQD 2H32A 5CHNA 1BBDH 2P8MA 2BVQA 3GK8L 5J0BA 3C09B 5EPMA 4LEOA 4CNIA 4FQHB 4M6AA 4NNPH 2VXUH 1MF2H 4X6EA 5DJZA 3F7VB 4AM0A 1M1SA 1FNGA 4F9LA 2HJLA 1MRFL 4JJ5A 1OPGH 2BNQB 3NBNA 1OTUC 3GJFH 1NBYA 3DX8A 3GSXB 1QLRA 1J05B 1K5NB 4DEPB 2COQA 4KROD 2CLRA 1RPQA 3ULUH 3CU7A 1JL8A 3TO2A 5FYJD 2CDEB 2Q76B 4NQCE 3MX0A 1GZQB 1KTDA 2ADFL 3MUZ1 1INQA 1T66D 2XRAH 3GNMH 3VFOA 1A9EB 4M3JA 3HI5H 4Z7VA 5JIPA 5GGTH 4KROB 5FIEA 2V9TA 4ELKB 4NN7C 1F97A 2CUIA 4LSQL 2N4IA 5D7JC 2W1NA 3FB5B 3T04D 4NWUL 2Y07L 3WO4C 2LVCA 3BZDA 5KBNC 5BJTB 2VNCA 1CR9L 3BP4B 3N0PB 1B2WL 1CXLA 3QUYC 1QEWA 4GKZB 1NCAH 3MZTA 4YUEL 3EJZD 2X70A 3TN0A 2CK2A 5IKCA 2VWEC 1PW3A 3C6SB 1DP0A 4U1MB 1BIIA 4P23A 5E8PA 6FABH 2B2XH 4XNXL 4NM4L 4YFDB 1A1MA 3U4BL 3EDJA 3BKJH 4JHAL 2AQ3A 5JNYA 5DFWH 4LLYA 4YE4H 5A2FA 5DVKA 5HVFB 4LCYA 1SJHA 1VFUA 3EYQD 35C8H 1GYAA 3RUGE 3VRIA 2AQ2A 2QR0A 1B0GA 5HYEA 3F6LA 5IVNA 5ESQA 4ZUVA 4NZDA 2I9LB 5TE4H 1NH6A 5ICZB 4ZYKA 5KJRL 3FQTA 5JIKA 1GGUA 5CFHA 5IM7A 1RHFA 2HH0L 2DRUA 4FQJL 3U46B 1CLOL 4PRHE 3S35X 3ZDYF 1YJDC 1OOAA 1V3JA 3TJHC 5F1KC 2VZVA 3QJHA 4MAYC 2HTKC 1U8LA 4Y8AA 2WUCL 3MSPA 4PS4H 3D0LB 15C8H 4YXLH 4YXKL 1IE5A 3C87A 3GJEA 1W72A 3K2UL 2I25N 3WFHA 2EDWA 4P5KA 4DZ8B 4P9MH 1D6VL 3F7RA 5D7LE 4DVBB 4LPYA 3BD3A 1FO0L 2R9HC 2PETA 3QDJA 2DQHH 4G6AC 5C0AA 2UWEA 1F90H 4Q0XH 2WZPD 1CZ8L 4M1DH 2YPLA 5HGAA 3UTSA 4W6WB 4PJGF 4XPGH 3BWUC 3JVGA 4OTXL 3O6KH 3SE8H 3QDGA 3KHQA 1C08A 1SY6H 3IDIA 4HFUH 4DGIL 3FT4A 3KYOB 3TA3C 1J11A 1ED3A 1A7QL 2G75B 5CMAB 5C6PB 1MWAH 4IRJD 4QXGL 2V6HA 2A6IB 4JGMA 5F93C 3IDJA 1E4WH 4L1DA 4WHDA 4HCRL 4Q6IA 1HYSD 4H20H 3HZKA 4X8XA 3LMJL 2KKQA 4IRJB 1PY9A 3HMXL 2DBJA 4BK5A 4OI9A 1A64A 3BXNB 1YEGH 1DTUA 2VR5A 1HSAB 1UB5B 1K3ZA 4QHKI 5F9JB 1OAKH 3BUYA 3MLVH 5MHSE 2X1QA 4KUZH 2BVEA 3OHXB 3SY0B 3TF7C 4M43L 4L9LA 5J1AA 4G80A 3LEXB 5CJ5A 1CFNA 1L6ZA 4P2QD 4QY8B 2P5EE 1RZIB 1D5IH 5LCVL 2MSPA 5FYLD 2DD8H 1P7QD 3G5ZA 5I1LB 4PGDA 3NCBB 4JKLA 2ZUSA 4ZUWA 2DQFA 4P2QB 1AFVH 4JG0L 1P7QB 1NAMH 3ARBC 3HZVB 3DURA 2BNUB 5I76B 4JO2L 4OD2A 5I8EA 1CBVH 3MV11 1KACB 1WUNT 2RQ8A 3O6FC 4I0PD 3GHEL 5E6ZA 5HGDA 3ARQA 4NZTL 1LEIA 2A83B 4PJ9D 4CVXA 1YYLH 3VGFA 4LF3A 4QNPE 3O3UN 2BNQE 4MD4B 5D7IA 4J23A 2FL5A 4XRCA 3K4AA 4I0PB 5FHBH 3GBNL 5B21A 2DDQH 4PJ9B 2VZOA 1EGJL 2WBJB 3QRGL 4M7KH 3BGMA 3MYJB 4HIJB 1OARL 3VMNA 2X09A 3LRHA 5DJ2B 4Z7WA 3ROLB 1U95A 3CSPA 3C6LA 3FOMB 4JANB 2EH8H 3BH8B 1QBLL 4PTTA 3TBSA 5J1SC 5C2BH 3QP3A 4PGEA 1BQUA 4P57A 4A6YH 2HKHH 1X5XA 1RU9L 4U1GB 2Q8AL 1PBYA 1NGZB 1TNNA 2A73A 1KEGH 4MX7B 1WC7B 2VDML 4LPUA 1UJ3C 4MMZC 4LCUB 3W9EA 2FX7L 2EYSB 1YPZA 4RFEB 1U8JB 2DLHA 3H7BB 4PB0L 3EOTH 2W0KA 1BFOA 4TYUA 4OZIA 3ILPA 4UAOC 4FQLL 2QADC 4BFEA 4S11A 4W68A 4R6UA 5DS8A 5FV2A 4MJ6A 3SDXB 3VWJA 2ATKA 4AY0A 5H37H 3OX8A 1VFBB 1ETZB 5JORA 3MV9A 1MJUH 4WNQB 1G7LA 3V4VH 4U0RB 5DJAB 3QPXL 1FLTX 2QSQA 1F11B 1NMAL 2YK1L 4PBVC 3KPPB 3UCRA 3UZVB 1CICC 1M71B 2OM5A 3X3FH 3KLDA 1TJHH 4X9GA 2IH3A 3JBG7 4NO5A 2V17H 3FJTA 5F7HA 1EEYB 5LXGL 3FQWA 1G1CA 1QOKA 3PGCB 1HDMB 3OJDB 4K8RD 3MBXH 1C5CL 2GEEA 5KANI 4XPAH 1ACYL 1X44A 2E5EA 3S9DB 3GJFA 1KOAA 2R0WL 5AWNH 1CLZL 3L5WB 4GBXD 4HW6A 4OI8A 5TQ0L 1ZANH 5DEFB 4HWEL 4OSUH 4WUKL 5FUOL 4HXBL 5E8EA 1NGPH 3DVFA 1XCQA 3HCVB 4GBXB 4Y4HA 5GGTA 3V52H 4L3EE 2B5IB 3KYNA 1QYGL 4UOJA 5IROA 3MRLA 3UTPD 3O3EB 3QULA 2C1PB 4YHLL 2JF1A 1X4YA 3B9VA 4LSUL 1I8IA 2CUMA 4M4RA 4JY5H 5DURD 4JKPH 1A1NA 1NANI 4Q97A 4NWTH 4X83A 4OGXH 1OTUD 2Q7NA 5F1OB 4XPBH 3CSBA 3BKYH 4DOHB 5HXMA 3O11A 2W38A 4N0UB 4Q9BA 5LKNA 3K2MC 3LIZH 3QWRA 3ARWA 1A1OB 1HINL 4K3DH 2VLKD 1HCVA 4YFLI 1J5OL 3CFBA 3TJEH 4YHZL 4ZTOL 4F9LC 4KPHH 2VLKB 3HZMA 4RGMC 3WIIL 4YDLB 3CFKB 2DIBA 5D7JD 3K74B 5EO9B 5TE7L 4EDXA 3A0OA 3S3JA 4KZEH 4LPXA 1FN4A 3IAPA 4L8BB 3X14A 5E95B 3QUYD 1ZLSL 4XXDB 5F7YC 3VDCA 4NN7B 4YEFA 4PLKD 3MRBA 5D7JB 3RWGA 4ZO9A 5KVGL 4YHIA 5DA0B 4KY1H 1TITA 3WO4B 1S9WB 1K8DB 2BDNL 5FGCE 2BSTA 3MRCA 3LQAH 1D5ZA 3QUYB 1MCKA 1TVBA 4UV4L 5I8OL 3WV0A 1FIGL 3DYOA 1L0YA 4YBQC 4Y2DA 4NZUH 3GSUB 4LBEA 4IJ3C 1DEEA 4X0KA 2GFBA 3UBXI 5F21B 5EORH 4Y4KA 2GSGA 3K4ZA 1SY6A 2OTUA 4FQ1H 3O0RH 5F9WC 5JXEA 1IC4L 3VH8G 5JLZB 5LWYL 5IBLC 2EDNA 1ZHBA 4P23C 1F3JB 1XGPB 3TV3H 1UM5L 5MEPB 3MLZH 3TNNA 2ITCA 4MAYD 2HTKD 4DQOL 5IESL 1UZ8A 4Q9QH 3RBSA 3TEUA 3PUCA 4TNVF 2GITB 4MQSB 3S4SA 4V1DA 3UYPA 3CXDH 1A5FH 4MAYB 4XH2A 1N64L 2R9HD 2R0KH 3A67H 1ITCA 1G7IB 4G6AD 3VFRA 5HSFA 4X7TA 4WI5A 5JW3H 4G5ZH 3ZSSA 3AMKA 4GQ9L 3T0DA 1LP9E 4X8JA 4OT1H 2ADGB 3CIQA 4FXLA 3QHZL 1QPXA 5DVMA 1W2KT 2X4SA 3TA3D 1FE8L 2VXTL 2WV3A 1FFPA 3UAJC 1GH7A 1DUZA 2CO7B 4G8GA 1CD1B 5CZXC 3BP6A 4XNYH 2HT2C 2UYLA 3NTCH 3WHXB 4KHTH 4X6DB 3G9AB 3FFCA 1F58H 1QSFD 1C5DB 5T5FL 4Y19B 5IP4A 1HQ4A 2F54E 3CFEB 2RHEA 3C8DA 3JVGC 5TE6H 4N8PA 3SBWA 1RZKL 1TPXC 1OB1A 5AZ2H 2WSKA 3BESR 3FO1A 1NAMA 5ITBH 3RL1B 1QSFB 3WO3B 4F15C 4KQ4L 2YZ1A 4TTDD 2BOCA 5A2JH 2Z8WC 1Y0LA 1OF2A 4G7YH 3WYRA 4NC0B 3QUXA 3C60A 3LPGA 3O4OC 4E0RA 2EH7L 2EIZB 4PJDA 4F7MB 4GQPH 2WQ8A 1RUPH 3LH2L 3MRNB 3PJSB 1OGAD 1H0DB 2E9IA 5CLWA 3F5WA 5EOCJ 4AT6A 1F4YL 2XYCA 5HHXH 4BELD 4CN4A 3MRPB 4GUPB 1OGAB 5DJ8A 4CGTA 4S1DD 3MGOB 3L3JB 4XP5H 5IBTL 3PGDA 4IS6B 1LO5B 1GXEA 1X5KA 2BOBB 4NO2B 2IAMA 4FXGB 3ARFD 3ARBD 3DPBA 1K8IB 1KB5H 1SJEA 4M7JL 2G5RA 1FVCA 4NHCL 4NJ9L 4A6YA 5IHUL 2DM7A 3O6FD 4M6NH 3IDGB 2AI0H 4LU5H 5FHAH 2UVFA 3P0VL 3ARFB 1CGSL 3ARBB 3JTTB 1WBXB 3Q5OA 1I3GL 5E4IA 5T1LD 5TPWH 5ACMA 4MDJA 4WO4A 1GZPA 3UTPE 2GCYA 3M1BB 2Q6WB 4F7EB 4WCYL 5DD6B 1NC4D 1IC7H 4DOHE 4TOYH 4MXQC 4AQOA 3VXNA 1XF4B 5JPNA 5T1LB 3GMNB 3OAUL 1T3FA 1C12A 1TFHA 2I07B 1FHGA 1NC4B 2DWEB 5GS3A 2EDOA 4KMTL 1XGYL 1FH5H 4LVNB 5E1AB 3RA7H 2VLKE 4Y4FC 2NTSP 4EIZC 4I5BB 4HJGB 3RWEB 4JFZL 2B1HL 1N6VA 1F3RB 1A21A 2NXYC 4ZSOB 3O2DH 3VDAA 1P53A 5CIPB 1OSPH 4O5LL 5EN2B 3GHBL 1FC2D 2E9BA 3F8UB 4IEFB 5BV7C 3BO8A 1NJ9B 1UJ3B 3IVKB 3B8YA 3FT2A 4C59B 3VW3H 2YSSB 4X9HA 3GB7A 1BD2A 2ZUUA 1U6AL 4KFZC 5IQ9B 5E6IC 5D5MF 1A3LH 2VWEE 1I1YA 5DJCA 4ELMA 3F6IA 4U7KA 3VDBA 1BVKB 1MFAL 1KENH 1P4LA 3VXSD 1U93B 1JPGB 5ISZA 3WUWA 3IJHB 4UAOB 3QDHA 4BZ2L 2QHRH 4XZUA 4PG9B 3DECA 3QFDB 4LASL 3VE0A 4JGUA 4GRMA 4HUWA 1CICD 3VXSB 4JFXA 3S37H 5DDHA 1WCQA 3IJYA 4UT7L 2H9GA 3LN5A 4GRWB 2FD6H 1CGTA 3HAEH 5KS9A 1N3NA 4CW1B 5IG7B 1CGWA 2FX9L 1M05A 5DA4A 1OAXL 1CICB 3MLYH 4DW2L 1EXUB 3BGFC 2VLJA 4ODUA 1IC5L 2G5BB 2H45A 3EOBA 3H42L 3ZDZE 2BNRE 5CSBA 5FCUL 2VUYA 4PP2B 1A6ZA 3ALWA 3VFSB 4CVUA 4JFEE 3UO1H 4G9FD 1TVHB 1FCCA 4GLRH 1DL7H 4XC3L 1KUMA 4NT6A 4OCNC 4PV9B 5J6GA 4F80A 5E99L 4HDIA 5HHMD 4WHCA 2VOTA 2H3NA 1S7VA 4ZFOA 2ZPKL 1JZ6A 2AK1H 3LDBC 1RIUH 4G9FB 5C0DA 5IEHB 1TDQA 4HG4J 4L3CA 2HFFA 1FAIH 4NKOA 2WW8A 2Y5TB 1MJ7H 2NY2C 5HHMB 5T3ZE 4PJFF 3IDXL 2X41A 3S5LA 4X5LA 3ARPA 4ODWB 2XA8L 2YEZB 2C3XA 5ACZA 1QSFE 1JNLH 5I6XB 4Y4HC 5IROC 4AK1A 5FEBA 5IMKB 2JB5L 3BSZL 1KPVA 5C7XL 5I16B 3NACH 2IPTH 1UGNA 3H9SD 3MUHL 1DQML 3KDMA 5E2WL 2BY2A 4EBQL 1D5XA 5CKGA 5CHNB 3ZL4H 4LEOB 4CNIB 2Y36H 3H9SB 4X6EB 5DJZB 2W0PA 5F7KC 4AM0B 3G08A 1FNGB 1DBBL 4M9PA 4JJ5B 3U48A 1KCRL 4U33A 4RGMB 5I73C 2CR6A 2XWBB 1NBYB 2A2QT 5KSUB 1QLRB 4QRPE 5AG9A 4WUUD 8FABA 5IMOA 5B3JF 1IKNA 1H3PL 1FFRA 4JFQA 4RQQA 1KTDB 3EHBC 4LCWA 5TDNA 5HGHA 1NGWA 3HNTL 4ZQKA 4Z7VB 3QEQE 4K8RL 3WFEL 4WUUB 2R4RL 32C2A 3M17A 1YQVH 4RISL 4ZOCA 2B0SL 4H5SA 1UWXK 3OG6B 4HJ0C 5IBLD 2O5XH 4P23D 4IJ3B 1A2YA 4LL9A 3SE3C 1QEWB 4ZNEE 2X70B 3TN0B 3WMSA 4Y1AD 5IKCB 1ZTXL 1UFUA 3WKNA 2F5AL 4Y2DC 5D2LA 2FO4A 5F9WB 4Z8FL 1BIIB 4KI5C 4PRAB 4P23B 5E8PB 4FQIL 4HWNA 4JEGB 4NZJA 3HUJF 1O7SA 4M1GH 4N9GB 4QOKD 5D4QA 4P3DB 5HDQL 4ZSOE 4QTIL 5ALBL 3QXDA 3BAEL 5JXEC 3MXWL 5DSCA 2J88L 4LCYB 3DI3B 4RAVA 3VRIB 3V4UL 3KLHC 2QR0B 1B0GB 1BAFH 3GO1L 4PJXA 5ESQB 4ZUVB 4QOKB 4HULB 1WIPA 4F33A 1N0XL 2YBRA 2R0ZH 4ZYKB 3FQTB 5IM7B 4BKLA 5F8QC 5BO1L 3G04A 2PYEA 3UAJD 3MOBH 3KPSE 5CZXD 1UM4H 2HT2D 2N56A 4UQ2A 3QJHB 1V3MA 1FORH 3W0WE 3NH7H 3U7YH 1P1ZB 3STBA 2VXSH 4JGJA 3NIGE 4MA7H 1SVZA 1ZT7A 4M7LL 5C0AD 3LAFA 2GK0A 3WFHB 4UTAL 5IB3A 2YPLD 4FZEL 4JN1L 3UTSD 1FFNA 2WQRA 4RMSA 2F9BT 1E4XL 1H3GA 1H3VA 1PDKA 1KB5A 2BERA 3L95B 4W6XB 5C0AB 1KSRA 2UWEB 3VXSE 2WLYA 3CVHH 2YPLB 5HGAB 3UTSB 5GGRA 3GM0A 3BEWB 5FYKE 1TETL 3S3PA 5I1EL 1PAMA 4XP4L 1KJ2H 3F65A 5ACLA 2Z8RA 2IG2L 1C08B 4KAQH 1CN4A 1IM9D 3FT4B 1Z3GH 1P9MA 1RUKL 1ED3B 4F15B 4DVRH 1NCDH 4Z7NF 4C4KT 1MPAL 4YK4B 5JUEH 2K9UA 1FG2B 2NY0C 1JF6A 1J87A 2GTZA 4DGVH 4OCYL 5F7DB 3K8KA 2H8PA 3IDJB 3O4OB 1IM9B 2EE6A 5BXFB 4MZ2A 3P4OB 3FN9A 1S9YB 3HZKB 5SWQA 3OGCA 1VFOA 3VGEA 2CDFA 4L3AA 4DAGL 3QUZC 4JQXA 1I1AA 2OMNA 12E8L 3RIFK 2OJEB 4EXKA 4JPIA 3EYUL 1MY5A 4ODVL 2BCKA 4G9FE 4XNZC 3U0WH 3DXAA 1PX4A 1KCSL 4N0YL 3GSVB 5FA4A 1ZHLA 5CD3B 2EDEA 3O2DA 4L9LB 1A7RH 4JQIL 4YHKL 4UILL 2IBZY 4FFVC 5FOBB 4P5TA 3PWPA 2C1OA 3G5ZB 3L3IB 1JTOA 1KIUA 4MXQD 5HDLA 2B7DT 1QFWI 4ZUWB 3IDYC 2YD8A 5CJXC 3O81A 2DQEL 4ORGA 2GSIA 5K59F 3DURB 2EDTA 3GUTA 4OD2B 4B41A 4N68A 5T3ZL 3CFIC 4XCFH 1DVFA 1DANU 2N7BA 2MPAL 4Z0BL 3KVQA 4ZD3H 5HGDB 1LEIB 3SGEH 4R4FH 2WWKO 2NXYD 4NO3A 4CVXB 3H9SE 4ODTL 4AL8H 4LF3B 3FQXA 1MCCA 3MTRA 3FO9A 3G5YA 4MJIE 2DTML 5D7IB 1HIMH 4XP1H 4XRCB 1KCUH 4QF1A 1IC1A 3HAEA 4WEUD 3T0EE 2NXYB 4F7TA 5F96L 4XNUH 4HUNB 2HJFB 3NN8B 4AH2B 3BGMB 2AEPL 1MCNA 4GAJL 1SM3H 1DQJB 4Z7WB 4K7PY 1U95B 4MCYA 1YMMA 3LN9A 5E6ID 4UMGA 1YYMH 5BV7B 3JUYA 4JRWA 4PTTB 3TBSB 5CJOL 4PGEB 5DMKB 1OL0A 4WUUE 1CD0A 3E1F1 4IIQA 1OHQA 4P57B 4XMKH 3LEVL 1XH3A 1BWMA 1UJTA 2MHAA 3SGKA 2A73B 5E6IB 3OKKB 4XBEL 1T7WA 2Y25A 3ROOB 4D0BA 1YC7A 4E41A 3U7WH 5LGJA 3W9EB 2AV1A 3I3DA 1YPZB 1HH6A 1BF8A 4POZC 2OR7A 1GC1L 3V0VB 1T20B 5ID1A 1MREH 3ARGA 1CF8L 1U8KA 4HUXA 1BFOB 2MQCA 4IOIA 3ILPB 2X1PA 3MV9D 4XWGH 5IFAH 4LIQH 1CDIA 4I3GA 4KGJA 5DS8B 4MJ6B 3NGBC 2ATKB 4Y1AE 3NFNB 4LSPL 1YEIL 4YX2L 3P0YH 5I1GH 5GGRY 2CRIA 2PW1A 1B6DA 3RI5K 1HNFA 3DX7B 1REIA 1H3UA 2EC9U 5E08H 1YEFH 3MV9B 5EZOH 3RVXC 3V0WH 2AK4E 2UWEF 4QOKE 5EZJA 4MA1C 4UI2A 3HE6C 1OVZA 3TFKC 2QKIB 1EMTL 2Q3AA 2FBOJ 1MFDH 5T1DH 5C6TH 3W5MA 2CLVA 3PL6A 4JPVH 5CBEA 3BPCA 2HWZL 3MRDB 3CZFA 4NO5B 3UJIL 3FQWB 5C0JB 2BHYA 1H5BA 2NY2D 1FGVH 4NO0D 3SDAA 1GGIH 1NL0H 3ZDXE 4R0LC 3LDBB 5E5UB 3PWNA 2ZP0T 3MV8D 3GJFB 3DGGA 1CFSB 2A74B 4CMHC 5FO7A 4Y4HD 3OAYH 3KPOA 2NY2B 5JW4Q 1A6AB 3DRQA 1RJZA 1XGRA 5F8RC 5ABDE 1LO2H 2VO5A 3D85A 4KGLA 2VLME 4Y5YA 1NSNH 2ZSVA 2DKMA 3MV8B 4EN3A 1WAAE 1BQHG 4TSBL 4N0CC 1L9NA 2PO6C 2VZTA 2EYRA 4X4MA 4IRZL 5DRNA 1XCQB 1BPVA 1SJVA 5LAXA 4Y4HB 1B88A 3SDDA 3EIFA 3KYNB 1FRGL 1IVLA 4NQDD 3MRLB 4O2FB 3MFGB 5E94A 3PWUB 1PG7X 1S9XB 2F8OA 3ZSTA 3QWRD 1A1NB 3KGRA 2W9EL 2Z93B 1TIUA 4NQXA 5FYKL 4LSSL 3K0WA 3MA7A 3RNQA 4L8SA 4AEIL 1T4KA 1A02N 3O11B 1JFQH 3MUGB 1CYGA 1OTTC 1P84J 4NNXA 5DC0A 1IKFH 5CSGA 2X4QA 2APTA 1CFTA 4D8PA 1JHLL 3WFDL 5I73B 3EHBD 1F4WL 3CFBB 4R26H 2J8UA 1GSMA 3HZMB 4LARL 2R0LL 4U6HA 5SWSD 3ZTNH 2ZCKL 1LE5A 4UTBH 3QDAA 4HJ0D 3S34L 1FN4B 4G6KL 3VFGH 3X14B 3NCMA 1IKNC 4ZPTB 3FOLA 3QDMD 5SWSB 2GUOA 1ZE3C 3O4LE 4OF5A 3MRBB 3RWGB 3TIDA 4DN3H 4Z7WF 4Y2DD 4YHIB 5MI0B 4AZ8A 1JHTB 3NCJH 4KI5D 3MRCB 5L2KA 3MACL 3D39A 3RVWC 4FRWA 1D5ZB 4RRPG 3UPRA 1TVBB 3P9WB 1OAZH 4OZGE 3QDMB 4BQBA 4Y4KD 2BP3A 1DR9A 3C2AH 4Y2DB 5JXED 2CKBL 3UYRH 4OFPA 2B4CL 2R69H 5C0RH 3CVHA 1DEEB 3NFSH 4X0KB 4YPGB 3KLHD 1J8KA 1I7ZA 1KJ3H 3GSNH 4YGVA 1KJ2A 4Y4KB 5JMOC 4M8QA 3C5SB 2OTUB 5CZVH 1J0ZA 3BRGC 1X7QA 2OZ4L 5CEXB 1A3QA 3SJVA 1ZHBB 3BQUA 4O58L 1FLRH 3BYTA 1GGYA 4OZIF 4WV1C 2ITCB 3O2WH 1ROWA 1UZ8B 3KNBB 4RMWA 3V0AC 5C71A 3NZHH 5GS0H 3DVNB 3ZDYE 1KFAH 3BGAA 3S4SB 3RHWK 1WZ1L 1DDHA 1L0XA 1QVOA 5K9JL 1NANH 1JGLL 4JKKA 3ARDA 4XH2B 2IFFL 2DQIH 4OV6F 5K9QI 5SV3A 7FABH 4KJYA 3VFRB 4X7TB 3DHJA 1MRDL 4A2LA 1HXMA 4G8GD 4TSAH 1UA6L 2B8OT 4AMKL 4X8JB 5DZOA 3GK8H 3AS1A 3STLA 1CE1L 3T3PF 1H9VA 1FFPB 5EBGA 4G8GB 4JFPB 3BP6B 4GMTL 2UYLB 3SKMA 3QNXA 1I85A 1MRFH 2NY0D 1E4XI 1FYHB 3DX6B 1EVTC 3VD5A 4L8CA 5HHNA 4L8DA 1M7XA 4M6ML 3QUXD 3AY4A 1OB1B 3PWLA 4JE4B 3ULUF 2NY0B 3DLQR 2G9HA 2G60L 3FO1B 3QUZD 3VGHA 5DUPH 2ADFH 2EICA 3AXLB 5DHVB 3ZKMC 5LVEA 4JREC 5DHYA 2DLFL 5TF1L 3QUXB 5JA9A 4EEEA 1E4KA 1XR9B 4E0RB 4EDWL 4PJDB 4LSQH 3CVIL 3PP3H 1V7NL 3ARXA 1RIVL 2DQDL 4MJ4A 4NPYA 2Y07H 5D93C 3F5WB 2I5YL 1WLHA 4XNZB 5DT1L 1CR9H 3DRTA 3EFFA 4AT6B 1B2WH 1J8HA 4FFVD 4KU1A 4YUEH 5D1XA 1I1AC 4PFEA 1X4ZA 3LKOB 5DJ8B 2DKSA 2A6JA 2W0LA 4XNXH 3PGDB 4H0IA 4NM4H 2UZXB 2OXGA 3U4BH 2IAMB 2ICCA 2A1WL 4JHAH 5ESAB 1IAIL 3UC0L 3FHAA 5A40E 2R8SL 3QQ3B 3IDYB 3QB7C 4WFFD 4A6YB 1KTLA 1FFQA 1UCBH 4R8WL 3D0VA 3HS0A 4C83A 5KJRH 1G9MC 4FQJH 2HH0H 4DGYL 4NQDE 1CLOH 2VE6A 4MDJB 2E7HA 2JJSA 2VKXA 3RNKB 3ZTJG 4D0CA 4NC2B 4YR6A 3RU8L 5GZOC 3TT3L 3U2SB 4ZXBA 4FFYL 3VXNB 4CMMA 2CO6B 3NAAL 4YXKH 1S5IL 3K2UH 4JDTL 2DICA 3HAEG 1OP5H 1T3FB 1C12B 1D6VH 1HI6A 1MJJA 5MENA 3U30C 2RCSL 5HHQA 2C5DC 4QHUA 2O93L 4X7CC 1ZWIA 4I3SL 2ZSWA 1M6OA 5DUML 4D9RD 4Y5VA 4GJTB 1CZ8H 1J12A 3HC4L 1XR8A 2HLFC 1AXTL 3RZCC 4LSVL 1I8KB 4OTXH 2XKSA 4NRZA 4ERSL 3V7MA 3MLUL 1ZLVK 4PGJA 4LVOC 1BD2D 4POZD 1T04A 4NUGL 5SWSE 5I1IH 5HHPB 2IWGA 4HEPG 4U1LA 3LKPA 3BO8B 1JNHA 4YC2B 4GG6A 3PNWA 3FT2B 5ISZD 4HCRH 4IIQC 5CEZE 3TNMA 2BVPA 3GB7B 3Q3GB 1BD2B 3QDME 3LMJH 4MLSA 4P4KA 1DCLA 1J7VR 1I1YB 4I48A 3MFFB 5DJCB 1KIRB 2EDXA 4PP1C 2OX5A 4MNQE 4KI5E 1P4LB 5J12C 5ISZB 4L4TE 3RVXD 5DVNA 5BZWA 3A6OA 4JZOB 1U8IB 3HE6D 1RV6X 2GJZA 3TFKD 3ARGC 3I3BA 2VH5L 1UXSA 3VE0B 5BMFL 4HUWB 4M43H 1YN6A 4JFXB 1CD9B 1X5GA 2P7TA 3IJYB 3MYZA 2VLJD 2H9GB 5B39G 3R8QA 3LN5B 4YAQA 4RMVA 2EE9A 5JOPD 1ZAGA 4MA1B 3HE6B 3DV4B 5LCVH 4EQ3A 3HR5B 1I8MA 3IFNL 5KS9B 1N3NB 2AJ3B 4HS8L 3V6FA 1F6LL 4Z77B 4NIKB 2Z35A 2BY0A 4XNQB 2VLJB 4YHPA 4ODUB 3QXUA 3EOBB 4I1NB 1L9MA 4IRSC 1ITBB 4RMQA 3PL6C 3VI3E 3LKSB 5CILL 5JO5A 4JO2H 5B38A 4DTGH 2XIDA 4KZDL 1JNNH 5ID0A 3GHEH 4DKAA 5J6GB 4N0CD 2PO6D 1H5BC 4NZTH 4HDIB 2BX5A 4UNVA 5E8NA 3SDAC 2AJZA 2H3NB 2DL9A 3OJ2C 1QG3A 1T83C 1JRHI 4OCMC 4K9EL 1U42A 3AREA 4L3CB 2HFFB 4OFYA 2HFGL 4NKOB 2JCCB 2PO6B 2DYPD 4F9PC 2Y23A 2CXKA 5F97E 1TZIA 3S5LB 3QRGH 5D8JH 1OARH 4EN3C 2DB8A 1T1WB 4MB5A 3ULVF 5ACZB 1RQ5A 4AEEA 1OTTD 1B0WA 1QBLH 2DYPB 1KPUB 1PLGL 2A9NL 3S36L 4NFBA 2C3WA 3WE6A 4XCYA 3LZFL 3ZKSD 2ED7A 2Q8AH 1U8QA 2D9CA 1RZGB 4KK8C 4U6XA 3VXUE 3WN5A 2WANA 4HK3J 3KDMB 3T3ME 1D5XB 3GSNA 4MVBC 2FJGA 1AE6L 4N8VG 4JHBA 4ODHL 3V7AG 4JO3L 4PB0H 1NEZA 3G08B 2YD4A 3EO0A 3VD3A 4XT1C 2GY7B 4FQLH 5GJTL 1X6LA 2OQJA 1S7RA 1AD9A 4LCWD 1U3ZA 4GW4A 1EHLL 2C7UA 3KXFE 3RVWD 5IMOB 4JFQB 3BMVA 4RQQB 5EO0B 3EJJX 3HE7A 4LCWB 3QPXH 5I1CL 4ZQKB 3K1DA 2YK1H 4WFFE 5IJKC 2ZUYA 1BQSA 2A77L 3CFCL 4K07A 3IKKA 3M17B 2CGRH 2P44B 1QBML 5LXGH 3EDEA 3L7FA 4M61A 2DJUA 4LLVA 1YEKL 3OG4B 2C4FT 1CIUA 4EQ2A 2YD7A 2AEIT 2JK5A 1ACYH 4J3VA 4XPFH 1IGJB 2R0WH 5EU6A 1CLZH 4ELMF 2J8OA 4JFYB 5EOTB 2YD5A 4QXUL 4WV1B 2FNBA 5TQ0H 4MJ5A 3WS6C 3QXDB 4WUKH 5FUOH 5DSCB 3BPNC 4ZPVA 4HXBH 3BQUC 4D9RE 4RAVB 1QYGH 4H1LG 3KYAA 4U6YA 4F33B 2YBRB 4GFTB 1YNTA 3RX7A 4BKLB 4C58B 4YHLH 4F7PB 3G04B 3OB0H 1Z2KA 5E2UL 4JM2A 4LSUH 1BVLA 1I8LA 5KS9F 2OSLA 1UVQA 2Z0BA 3UTTA 2VLRA 4KUCD 5H35B 5IB3B 3MUJA 4XGZA 3RVVC 1FFNB 2JIXA 1HINH 4QRRE 3QFJD 1UKSA 5IW1A 1J5OH 3QIWA 1KB5B 4KVNL 3TZVC 1S7XA 1P2CA 5FUCC 2ICWA 4YHZH 5GGRB 1HH9A 4ZTOH 5CEZL 1I85C 2GK2A 3WIIH 1U92A 3QFJB 4APQA 4DKDC 5IIEA 3NPSC 1OW0A 4RBPK 1AI1L 2X4RB 1J0IA 3KPTA 4TQEL 4JREB 2VXVL 3TYFA 4X6FA 3AY4C 2R2CA 3MO1A 3V5HB 5JOPE 5D6DA 1ZLSH 2GTZB 1I1AD 2H8PB 4JFDA 4JRYA 1I4FA 5KZCD 4JR9L 1JYNA 2YWZA 4WWKA 5KVGH 3VRJA 2OTPA 1LK2A 2AJYL 5SWQB 3L5XL 1H8NA 2BDNH 3OGCB 2A38A 2X4OA 3DXAD 5ADPH 3F58L 2O61A 2CDFB 2LVEA 4XPHL 5C0CA 2CKNA 2NNAA 1I1AB 2A0LC 1KC5H 4PY8I 4UV4H 5I8OH 1FO0A 2QL1A 5KZCB 4JPIB 2E6JA 4GOSA 5D70L 3NCCB 2BCKB 2FH6A 1DFBL 5D1ZA 3DXAB 1HXYB 3GDBA 4TRPL 4P4RA 5D1XC 2OL3H 2QBWA 3PWPD 4HKZA 2WWMC 2MCG1 2EKJA 2JCCE 3SGJC 3B83A 4AG4L 2EO9A 4OV5A 1DLHA 3BRDA 3WNNA 1Z9SA 4AIZA 4ONGH 1T1YA 3PWPB 3JWDL 5GZOD 5IESH 5E4EC 2NTFA 3FB6A 1JYXA 2H26A 3AVEA 4XC1L 1IAII 1Q0XL 4ODSH 4HCRA 4X4ZA 4IDJL 2B20A 1NGYA 1YEJL 2ENSA 2RFXA 3WXWL 2XXCB 2GSIB 5F7UA 4HMCA 3G6JF 2VL5A 3GUTB 1N64H 5JDSA 2IMNA 4H26B 1F13A 2X10A 4JAMB 4IM8A 1DVFB 2FRGP 2W59A 4OI7A 2HLFD 1LILA 3U30B 1BM3L 3CSYA 4PLOB 5DWUL 4GQ9H 3RZCD 2A9MH 3MLSL 2EYTB 3QHZH 5IMLB 2NY1C 4OLVL 1ZVHA 3FO9B 3MRFA 1FE8H 2VXTH 3G5YB 4PJCF 3QEHA 1YMMD 3OXSB 4MB4A 3P73A 1AQKL 3RZCB 5D7SL 1XT5A 1MIML 3L5JA 3VGBA 2SEBA 5EC1A 2HTLC 3AM8A 4HIXL 4Y5VC 2V2XA 2ESVA 5D2LF 3VFTA 5T5FH 3TT1L 4P99A 1RURL 2EKSA 4LVOB 3MRMA 1YMMB 4P59L 1F5WA 1RZKH 4MJ2A 4PP1D 5HHVL 4E41D 3SKOB 3UYOD 5F9AC 4ODXA 4KQ4H 1XAUA 4IIQB 1OM3L 1XH3B 4RZCA 5D5ME 4MQTB 5J8OA 3ARGD 4PJXF 4NFDA 4OCSL 2EH7H 2AEQL 4D0BB 3VI4E 4E41B 5LGJB 5J12B 2P46B 2YA0A 1A7PL 4ONOA 5D1QA 4S10A 5F7EH 5TGBA 2X4UA 2BMKA 1P5UA 5I0ZA 5BS0A 4FFWC 3ARGB 2X44D 1F4YH 3QCUL 1EGJA 4YJZL 4IOIB 4M6OL 2R1XA 3D18A 2GY5A 4JFFD 5DLML 3ZO0A 5IVXF 2ENYA 3U79A 5IBTH 2PW1B 2EIEA 1KN2L 1VHPA 3MNVB 4IOSD 3SGDI 3PL6D 3WIHL 4M7JH 4JFFB 2G2RA 4DKFH 4Z7UE 4NHCH 3RGVC 1IGTA 5I8KH 4X6BA 3P0VH 5B38G 4U1KA 1AD0A 3SDAD 5C9JA 1CGSH 2CLVB 3PL6B 4Y16C 5CBEB 4NBYB 1IEAA 3BPCB 3SKJL 1VGKB 1X5AA 3CGTA 4NQVB 4QKXB 1I3GH 5LBSL 4DK3A 4Q2ZA 4NQCA 3SKNB 4OZ4A 1H5BB 1I1RA 3SDAB 2EDKA 2VAJA 3SCMA 3VXMD 3D85D 3HPLB 2XY1A 1N7ML 4BK4A 3OAUH 4EN3D 4QYOA 3OWEA 1FZKA 1MCQA 5FO7B 1JGUH 3GI8L 3KPOB 3MXVH 2MMXA 4JZNA 1BJ1H 3VXMB 4PJFE 3DRQB 1RJZB 1XGRB 3CLFH 5KOVC 4KMTH 3D85B 4FQXA 2VIRA 1FC1A 3DARA 3QFJE 2R23A 4EN3B 2Q1EA 2D3VA 2VDOL 1FVEA 2BHZA 4LQFH 4JFZH 2B1HH 2H1PL 2EYRB 4ZAKA 5DRNB 4KK8D 2PF6A 5LAXB 5JOFA 5KANG 4LDOB 4OUUA 2KBGA 4O5LH 5CINL 5E94B 4MVBD 1KYOJ 4K94H 3GHBH 4M5YL 1W0VA 3RY6C 5F1SA 2Z92B 3H0TB 4KRNA 5IUSA 1MFCL 2VITA 1OTSC 4OF3A 1WZKA 3RUGA 5DMIL 3MA7B 5D7KD 3HI6L 3HPJA 4MS8C 4NNXB 1U3YA 4OFIA 3RGHA 2X4QB 4K7PX 3BWAA 4PRHA 3G6DL 5SX5K 4BZ2H 2VTFA 1AQDA 1BZ9A 1ZXQA 3LQZB 1BGXL 5C07E 3H3PL 4LASH 5EULV 2D7QA 2DQUL 3T1FA 2J8UB 2ZG2A 3N1GC 4PJHF 1U2HA 4P46A 1J0KA 4GAGL 4X4YA 5HYQB 5I1JL 1LE5B 3U7AA 4U1HA 2VUOA 5L2KD 2FX9H 3D39D 1OAXH 3C8KB 4JLRB 4DW2H 3FOLB 1IC5H 3H42H 3TIDB 3VH8B 3HLAB 5FCUH 2AP2A 2CK0L 5FF6A 5L2KB 3D39B 2AXHA 3UPRB 2KQNA 3KJ6L 4ZDHA 4YWGL 4XC3H 3QG7L 1XF3A 5HVHC 3BQUD 3P3YA 1UT9A 5E99H 3CVHB 1IILE 1AGDB 4NC1C 2ZPKH 1I7ZB 1KJ2B 1TCMA 5J89A 2YC1A 3ALXA 5IVZA 4M8QB 1EERB 3R0NA 1A6TA 1X7QB 3GMPA 3BPNB 4R90L 3SJVB 3BQUB 3QWOA 3OKMA 3KLSA 4R4NC 5ALCL 3Q1SL 1JBJA 1JPTL 3B9EA 5ETUA 2XA8H 3TCXA 1R5VA 3T2NL 5FCSH 3E3QE 1LO3L 3UBXG 1DDHB 3G6AA 4LCCA 3RVVD 2HT3D 4GKSA 3ARDB 4LPVA 2P5EA 2JB5H 4KC3B 4QRQA 3MLWL 3QEGL 5C7XH 3RWDB 3LS4L 4KJYB 3TZVD 2ZUWA 1CXEA 4PY7A 1HXMB 4FOMA 1EVUA 1CL7L 4OAWB 3QNZA 4F58L 1DQMH 5E2WH 1ZLUK 3OKNA 4EBQH 2VYRE 4D9LL 4NOFA 1A6WH 1N0LA 2OL3A 3GKZA 5A16A 3DBXA 1FAKT 4LEXL 4K7FA 1AXIB 1DBJL 3STLB 3OPZL 3TZVB 4HZAA 1F4XL 1MHCA 2YHGA 1B4JH 3SKMB 1Q9OA 2YPKB 2RIKA 1DBBH 3QNXB 1KCRH 4TSCL 3EUUA 1WBYA 5GJSL 4HBCL 2W9LA 4D0DA 1RUML 3MJ9L 1C1EH 4FQHA 3NPSB 2ED9A 2P5WD 4I3RH 4Z7NE 3QJFA 5GGVL 5HHNB 4L8DB 3VRLF 1OSZB 4JFFE 4NQED 5HI5C 5I8CA 2FEEL 3PWLB 2BNQA 3F7QA 1GHFL 1H3PH 2A0LD 2D7TL 1ZK9A 3GSXA 5AAWA 4NDMA 3HNTH 5DHYB 4K8RH 3WFEH 2R4RH 5KVDL 2CDEA 4ZODA 5D1XD 2AQ1A 5K93A 2WWMD 4XCNA 3ET9F 1A9EA 4K7PL 1KIQB 3LEYH 4O4YL 3EFFB 3TBWA 5D1XB 2N1KA 4EUPG 3S3SA 1ZTXH 4WW2A 1OT1A 4DKEH 3VXME 1AR2A 1NEUA 2A6JB 5BJTA 1LEGB 4W6YB 4LVEA 1F6AB 1I75A 5HDQH 1CIDA 3C6SA 5DQDL 4QTIH 5ALBH 4X6CB 5E4EB 3BAEH 3MXWH 4NGHH 2J88H 3AS3A 3ZYZA 2EEBA 1KTLB 2NZIA 3MOQA 5C08E 3V4UH 5F6HJ 3KPQA 3D0VB 2J8UF 3GO1H 4MWFA 4C83B 3QNYB 5J11C 2NY1D 4Y5XA 3D1MC 1I1CA 5BO1H 3D2UD 1LGVA 4NM8L 5I71C 4UBDD 2AV7B 4D0CB 5MP6H 2I9LA 1MIEL 5DGRA 4ZXBB 1I7UB 2YA2A 1S7TA 3MLRL 4GW1A 2HTLD 3U46A 3SOBL 4M7LH 2NY1B 2NW3A 3WL9A 3D2UB 3D87B 4PRID 1SBBA 1CVRA 4UTAH 1HI6B 4KHXL 4JN1H 5D7KE 4BSJA 5HHQB 1MQ8A 5DD1L 4UDTB 1E4XH 1ZWIB 2ZSWB 5SWZE 1RD6A 4LLQA 4Y5VB 2DLGA 4PRIB 4IMLB 4EVNA 1TQCB 1XR8B 2AJSL 5I1EH 1TETH 2GT9A 4XP4H 2IG2H 5DYOB 5D2NC 1RUKH 3BPLC 4TNVK 1MPAH 3B2VL 5IHBA 2W65A 3K8MA 4F37F 4U1LB 5DI8B 5FM8A 1DQDL 1JNHB 4FFWD 2F74A 4OCYH 4YDKL 4GG6B 3WEXA 3FQUB 3MJGX 5I18H 3TNMB 4L3EA 2BVPB 1KLUA 4P4KB 3V79C 2A6IA 4DAGH 5AAMA 4HS6A 1GL4B 12E8H 1G9ML 3EDDA 3EYUH 3UDWC 4W4OA 4ODVH 1YJDH 4IRJA 3RGVD 5DQJB 3JV5A 1KCSH 2GJZB 5IT2L 4N0YH 3SQOL 1UXSB 3LN4A 1JWSA 5FM5M 3GMQA 1JHKL 5JQ6L 4XX1G 2P7TB 1XMWA 4Y16D 4JQIH 1MRCL 4MNGB 2FJHA 4YAQB 4YHKH 4UILH 3SY0A 3GI9L 3V6FB 2QQLL 1EA9C 4P2YA 4Y16B 4YHPB 4EOWL 2C9AA 2FWOB 2MNUA 2DQEH 3RTQC 1ZOXA 4FABH 4LFHG 4UNTA 5T3ZH 2JJTA 2MPAH 5ID0B 4FXKA 3EFDH 1EAJA 5E8NB 3SCMC 1ZLWK 5F71A 2BNUA 2R2BA 4ACPA 5HYFA 3AREB 3ZMRA 5IQ7L 2DTMH 2E8ZA 4YIQA 1J1PL 4I0CC 2YD6A 2A83A 1OP3H 5F96H 3UROR 1TZIB 3QA3A 4FQXC 2DTSA 2J4WL 2AEPH 1RFDL 1OTSD 4GAJH 4HUKB 2Y5EA 4RAHA 4MD4A 5TDOA 4I0PA 1IMHC 4NSKA 4GS7C 2P5WE 4PJ9A 3UJTH 4MS8D 4NRXA 1Q9KB 1ZGLP 3ZKXC 2YKLL 4NQEE 3GRWL 1TLKA 4HG4K 3MYJA 5IB4B 1IGCL 3WE6B 5J9PA 1U8OB 5DJ2A 3ROLA 4JKMA 1R0AH 2EO1A 4NJAL 3LEVH 3BH8A 1CDHA 5E5RB 1BLNB 4U6XB 2KH2B 4XBEH 4HPOH 5CGMA 2V5SA 1IFHL 2VL4A 3GMOB 2QSCL 5DZLA 4L5FL 1ERNA 3GSNB 2I9TA 4B5EA 1CFVL 4WGWB 4ALAL 5GS0D 1NEZB 1CF8H 4KWUA 1Z9MA 5INCB 1PD6A 3EO0B 2QHLA 1L7IL 2VXQL 2OQJB 1RZ7L 5HGGS 3FB7A 2B1AL 1RVFL 3QBTB 4JN2B 4RFEA 1U8JA 3P0GB 1AD9B 4YX2H 1LP9A 1YEIH 3QSKB 4X6CE 1JNJA 4GW4B 3ARRA 1IBGL 3O8XA 4U7MA 5DD3L 3Q5TA 1A22B 1H3XA 5GIRA 3HKFA 4P46C 3SDXA 3HE7B 5JW4N 2VDQL 2VLLA 3BZEA 4UIMA 3KR3H 3TM6A 1YDPA 5E56A 4OB5L 1ETZA 3EOAB 3QUMB 4WNQA 1SQ2N 4E5XA 2HWZH 2F54A 1G6RB 4PD4K 1LHZA 4D9QD 3UJIH 4FN0A 3L7FB 4M61B 5ERWA 5HVHB 5CD5C 5I19H 2AXFA 4AENB 1X4XA 4LLVB 1ZT1A 5CIPH 4R4ND 4GG6F 3BX7C 3GBMH 5KVFL 5LGKA 1ES0A 1AIFA 1IARB 4UDUA 1TNMA 1Y6NR 3OJDA 1RUQL 1UZ6F 4KKNA 2WM0A 5EU6B 4PRIE 4XWOC 3T0XA 4AQ1B 3V6ZB 2WUBL 1MH5B 3FB8B 4MJ5B 5EB9A 5BVPH 1DUYA 1DBAL 1N5AB 4TSBH 4IRZH 4HXAL 2IANE 4CDHA 3MRGB 1FRGH 4PJIB 4U6YB 3CPLA 2VQUA 1YNTB 3S6CA 2VLRD 2DN7A 4GBXA 3FN0L 4JB9L 4X5XB 4LCCC 2Q8BL 4UV7L 2JIXD 4U1NB 2OSLB 2W9EH 2XOTA 4GRWH 3JTSB 5CUSH 5FYKH 2GKIA 4LSSH 3O3EA 2C1PA 4AEIH 1UVQB 3UTTB 3ZT6A 2VLRB 1WF5A 4PJAB 2GHWB 2JIXB 5HI5D 5FFLA 3EBAA 3WFDH 3QIWB 1GOFA 3C5ZA 1DBML 2X1WL 1P2CB 1OT2A 1VADA 1BP3B 1F4WH 3I75A 3Q5YA 3T2PA 3IXTB 2ICWB 3EGSA 1HH9B 5DZNA 4MNGE 1A1OA 4LARH 3ULUE 1U92B 5IIEB 2R0LH 2NX5D 4Z7OE 4ZTPL 3RL2A 1FYTD 3S34H 4WFED 2FGWL 1XF1A 4KQ3L 4X6FB 3VGDA 3MO1B 5DRZA 3SO3C 2HYMA 2VLKA 5E2VL 2FEEI 2NX5B 1I4FB 5TQ2L 3BHBA 3DOSA 5EO9A 4OQ1A 3S96B 4WWKB 3VRJB 2AGJL 4YHNA 4HJJL 1UC6A 4HQQL 3MACH 5GISL 1LE9B 2VDKH 3FRPA 1FO0B 5D7JA 1DN0A 3WSQL 2X4PB 4WHYH 2CKBH 5DK2A 3DI2B 1S9WA 1K8DA 4P4RB 5SX4H 3QIUC 4Y2OA 5C1MB 1NCWH 1H8OA 4HKZB 4WW2C 2FHCA 2OZ4H 3GSUA 4U7SA 5GRUL 1DLHB 1EJOH 1FSKC 1T1YB 1N6UA 3PWJA 2Z8VC 3R8BB 2NTFB 2H26B 5JLZA 1FVDB 5J11B 1SEBA 1XGPA 1NGYB 1WZ1H 5I71B 5K9JH 2NY7L 1JGLH 3EOYG 2VL5B 2IFFH 5BQ7B 5JDSB 1RJLB 2MJWA 1MRDH 5IF0B 4N0RA 2JJWA 1BQLL 1UA6H 4AMKH 1KGCD 3AAZA 1OAYL 4Z5RA 5T5NF 2HKFL 4MAYA 4PJBF 2BNRA 4S1RL 3E8UL 2X9XA 4YFLF 1JGDA 2FSEA 1G7IA 4J3OC 1CE1H 1DQTA 3MV01 4OLZL 3IT8D 1EO8L 4JFEA 3QEHB 4GMTH 3P73B 2FO1A 4BM7A 2ADGA 1OP9A 2SEBB 5EC1B 5D2NB 1T1XA 2ESVB 3BPLB 2EKSB 3MRMB 4NKQB 4DFHA 4GKNA 3IF1A 4M6MH 4BSVB 3WHXA 2G60H 5C0BE 2DF3A 3O6MH 1SEQL 1YEHL 1WTGT 2D0HA 3TA3A 1LQSR 3QPQC 2PCPB 2A6KB 2DLFH 3CFEA 4J8RB 4J7RA 4RZCB 5TF1H 3VWKA 4G8IA 1ADQL 2VC2L 4TUOB 3VFNA 4EDWH 3QRFM 2XWJB 4MAUL 3CVIH 1QSFA 2NY3C 1V7NH 2DI7A 1Q9WA 4NC1E 3WIFB 1N59A 4P0DA 1ZHNA 1YY8A 4JM2F 5T33L 1MNUH 1U91B 2I5YH 5TGBB 5DT1H 1WZMA 4D9QE 4RGNB 5BS0B 1ZSDA 2FIKB 5DD0L 2EIZA 1FDLL 3MRNA 1IAOB 4RFNC 2EIDA 2I24N 3VXTB 1H0DA 2GIYA 3BZ4B 3CC5B 1NDMA 2PR4L 3RTQD 2A1WH 2OR9L 1IAIH 3UC0H 4FQQA 4L4JA 1OGAA 2G2RB 4PJIE 1R3JA 1UACL 3L3JA 1KXTB 1YEDA 1UKQA 4IS6A 2NXZD 4U1SB 4R8WH 3VJ6A 4X6BB 1AY1H 4M5ZL 4U1KB 5C9JB 5KSVA 3BZFA 3SCMD 1OY3B 2BRRL 1IEAB 3BISA 3GIZL 4QRPA 3TH4T 4AIOA 4DGYH 3T8XA 1BQHB 1OQOA 4LSRL 4M7ZC 3TBYA 1J1OL 3IDGA 4OGAC 4Q2ZB 2NXZB 4OZ4B 3RU8H 3TT3H 1U58A 3ARBA 3JTTA 4FFYH 3SCMB 1G7HA 3NAAH 3QEQA 4FQXD 1S5IH 1OQXA 5FB8B 4JDTH 5DFVC 1R5WB 2Q6WA 1N5YL 2H41A 4I2XE 4QYOB 1RSFA 3O6FA 3RFZC 4ZAKD 1MLCA 2RCSH 4BQ6A 4JZNB 1P5VA 4PJEE 3DETC 4I3SH 3UZEA 1XF4A 4HGWA 5DUMH 1VFMA 1A0QL 4FQXB 2Z31C 1I7RB 2VIRB 3MRRA 4PRDB 2R23B 2BSRB 4ZNEA 3HC4H 5D72L 3U4EB 3QAZC 3ULVE 4CN6A 3PABA 4LSVH 4ZAKB 5JOFB 4GS7B 4ERSH 3KYMA 5FK9B 3MLUH 3ZKXB 5T3XD 4OUUB 1S5HA 3BN9C 4KTEL 4Z78A 2NX5E 1W0VB 4NUGH 4I5BA 1ZA3B 2YWYA 4ZSOA 5BRZE 4UOW1 3R1GH 3L3KA 1FYTE 4I9WD 4WFEE 4LVHB 5CIPA 4PRHD 1QSED 2VITB 4Y8DC 2X7LA 3PGFL 3DNKA 5DMGD 3RUGB 3ULUL 1CFBA 3W39A 5H8DA 5DO2C 5HYSA 2X1OA 3QQNA 3IVKA 2CRYA 2XRAL 4PRHB 1QSEB 2C4FU 2ZNWA 1AKJA 1JIBA 5JHDE 3HI5L 3KPSA 5EU3A 1UH3A 5D7LD 1A6PA 4S0SD 5KN5A 3SEPA 4P46D 3W0WA 1B90A 5IQ9A 1BZ9B 4CBPA 1G7MB 5BMFH 3T1FB 2KPNA 1U93A 3IJHA 5GSRA 5D7LB 4BZYA 1P84K 4P46B 1IM3B 4X4YB 3OZ9H 4U1HB 3IFNH 3ZE0F 5CD5D 4HS8H 3VXSA 2EECA 1EV2E 1UYWH 3RKDC 1YNKL 4NCC2 1Q8MA 3BKJL 3HNSH 4HX1B 1BZQK 5IG7A 2OI9C 4GMSL 5FF6B 4XWOD 3B2UC 1CICA 1EXUA 3LD8C 1AGFB 2R2HA 5CILH 3P9MA 1IT9L 5LQBH 2AXJA 4KZDH 2ZG3A 4YZFF 4LAQL 4XAKE 4QRTA 1XF3B 3WKML 5DK3A 4PP2A 4OM1H 5CJ8A 1A9BB 1NFDE 3UX9B 1J0JA 4GG8B 2ICWJ 1IQDB 5E8OA 3IXAA 2YC1B 1KGCE 1M7DA 1W8OA 4O9HL 5IVZB 9CGTA 5I15L 1G7PA 5MHSD 1A6TB 1I9RL 4PV9A 5H2BA 1MCSA 3QIBC 3QWOB 1NGQH 1BREA 2V7HA 2VZ3A 4G9FA 3QQ4A 2P5ED 4P9ML 4NFCA 1HZHL 1I9JL 1OLZA 1TJGL 3B4NA 2F19L 4JDVB 4CU6A 1T03L 5I0DA 2EC9T 4LCCB 3B9KC 2A9NH 5BW7C 3S36H 2IFGA 2P5EB 2PTVA 2YEZA 4HLZG 4J3TA 4HUMB 2V7NB 4E42B 2CKBA 4M9OA 4PY7B 4HFUL 5HGBA 5IMKA 5A16B 1MWAL 3DBXB 1AE6H 1HHJA 3N06B 4FZ8L 4ODHH 1JZ2A 1BFTA 2OZ4A 3OXRA 4JO3H 5JQHC 3QUML 4DK6A 1Q9OB 5K9QG 4JRXD 4H20L 1G6RL 1WBYB 4MD5A 5GJTH 1QRKA 3C5ZC 4D0DB 5D71L 4Q9CA 3H9SA 3QJFB 5D96C 3QYCA 4GAYB 1EHLH 3OKOA 4R9HA 1DSFL 4TPRL 3SO3B 2X4NB 4Z76A 5I8CB 4MJIA 5KTEH 4HKBA 2XWBA 5FM5O 5KSUA 2X6MA 4NDMB 4KUZL 3T0EA 1JE6A 4ENEC 3TVMC 3F7YA 3BDXA 4KV5E 1I3RA 3QIUD 1MCIA 1TQBC 3GM8A 2A77H 3CFCH 1D5IL 4XCNB 1QBMH 2DD8L 2VABA 5AZEL 4WUUA 1EZVY 1YEKH 1XIWC 1RK1A 3TBWB 1YC8A 4X9FA 2EDDA 1GGBH 5JOEA 4WW2B 4HH9A 3HC0B 5DJYB 2ADIB 1XGUB 1CDCA 1I7TB 5HTSA 3MCKA 1A4JA 3MA9H 1FSKB 3S88H 1KJMA 4QO1A 4QXUH 1KJVB 2FB4L 2PKDA 2FECI 2FBJL 4PRAA 3WJLC 5SX5H 3DYPA 3KPQB 5CWSA 1YMHB 3EJYC 4N9GA 1E4JA 4P3DA 4Y1AA 2R1YB 4MWFB 3G6JE 4X7DC 1AO7E 3TGXA 4Y5XB 2C3HA 5E2UH 1RUAL 5T3XE 5HHOE 1T89C 4ZFZA 3ARVA 4LOUC 4U05A 2YRPA 2AK4A 4QOKA 1S7TB 3ULVL 4GW1B 4N0FA 2NW3B 4I9WE 3WL9B 1QSEE 1L4IA 2QJDA 1AJ7H 4PJCE 2XN9D 1P1ZA 5KSBB 3NFPA 1Z5LB 2ATPA 3E2HC 4LLQB 4NQSA 5E2TL 3FFDA 3QO0A 3JV0A 4EVNB 3QPQD 3A6CL 1AHWC 5CEZH 2GT9B 2WP3T 3K80A 1NQBA 3SGEI 2LU7A 1NKRA 2J8HA 2NY3D 3L95A 4WJ5B 4L3ED 2J1KA 1AI1H 1WQVT 4TQEH 2VXVH 4B7LA 1AGBB 1JPFB 2W65B 3BEWA 1HK6A 4OCLC 2VERN 2F74B 1WAAA 3WEXB 3M8OL 3RWCB 3QISA 2NY3B 4JR9H 4M93C 5DGQA 5L9DL 4L3EB 1K2DA 2XG5A 5HVWA 5D9SA 1KLUB 3L5XH 3VWKC 1HNGA 1SYVA 3ABZA 1FG2A 4XPHH 4LLWA 5F7DA 4HS6B 2W60B 1IM9A 3IU3B 4PRPD 5BXFA 4JY6A 3O3DA 3P4OA 4RFNB 5D70H 1S9YA 5IVXE 2MFNA 1DFBH 4XCCL 4TRPH 2VR4A 2P24A 3LN4B 2V17L 1JWSB 2Y7QB 3LV3A 3GMQB 4KKLC 1FZOA 2OJEA 4I77H 4PRPB 3GJFK 4ZUUB 2FJHB 3WLBB 4YHOL 2E6PA 3GSVA 4OGAD 1LNUA 5CD3A 3JWDH 4KK9C 3OSKA 5F1NA 2OLDA 3THML 1XZ0A 2V5TA 3BDYH 4YHYC 1Q0XH 3MR9A 3PP4L 2P42B 4IDJH 5DFVD 3WDIA 1YEJH 5FOBA 3OKYA 2DQJL 3L3IA 3LSOB 3W81A 5JR1L 5L7XH 2VN7A 3DETD 3QWQB 3IJSA 1SMAA 4K3JL 2Z31D 1GC1C 3TBTA 5E8DL 3O4LA 1L7TH 3ARYA 1BM3H 4FXKB 5DWUH 3MLSH 1MCEA 4YDJA 5DHVH 5FGCB 4OLVH 4P5MB 4Y88A 3BN9D 2R2BB 2Z31B 2DLTA 3V8OA 3VXRE 4QHMB 3NMEA 1WSST 4YIQB 4OZGA 4OGXL 1AQKH 5D7SH 1MIMH 2XG4A 4GAFB 3BKYL 4XBGA 4LAJH 3ILQC 3QA3B 3KPLB 4LPTA 4WW2F 4LPWA 4JRXE 3TT1H 4ZG1A 1RURH 3MRHA 4N8VB 4AJ0A 3UEZA 3QT2A 4Y4FA 5TDOB 5CP7B 2QSTA 4P59H 4NSKB 1QBBA 2VZ1A 5DO2D 4NRXB 2HJFA 3NN8A 5HHVH 4AH2A 4K23H 2OP4L 5JZ7C 5J9PB 1DQJA 3VFPB 3C08L 4KK6C 1OM3H 4GSDL 4KRLB 1KTKE 3TPUA 3V5KB 2E6QA 1CXKA 3QI9A 4Z6AT 1WEJL 2BY3A 1JYWA 4OCSH 5DFTA 5DMKA 2J7LA 3WBDA 4K2UL 1NCBL