5JW5A

Structure of medi8852 fab fragment
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
227
structure length
223
Chain Sequence
QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSYNAVWNWIRQSPSRGLEWLGRTYYRSGWYNDYAESVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCARSGHITVFGVNVDAFDMWGQGTMVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MEDI8852 Heavy chain
publication title Structure and Function Analysis of an Antibody Recognizing All Influenza A Subtypes.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 223
sequence length 227
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jw5A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jw5A01
2EE2A 3N85L 3VWJA 4KKBD 5GISL 1FFRA 2AK4E 5FM8A 1QSEB 2I60H 3VFGL 1DSFL 2XN9D 4K23L 2EXWC 2Z8WC 1CDCA 3Q6GH 4P2RB 5SWZA 1NMAL 3OR6A 1JPTL 4WW1B 4F33B 2NTFA 5L7XH 4HKJA 5D1XD 3Q2CA 4I3RL 1FCGA 4LRIA 4O2CA 4HWEL 3QNYA 1EVTC 1F42A 2XFXA 3X13A 1MJ7H 4ZSOA 5BOZG 3LDBC 5EA0L 4QEGA 4HWNA 4UDUB 4HS3A 1TENA 1FSKB 3TO2A 2HMID 5MENB 3IKCA 1H0DB 1A0QL 4MQSB 3O2WH 1TJGL 3DSFL 4RQQA 3RWEB 1RY7B 4R6UA 1NAML 2NY4D 4LCWB 1ZLVK 4Z95H 2HKFH 4Y4FD 4XVTH 5CSBA 1HIML 2NR6D 1A7NH 1T22B 2EC8A 1ZHNB 1OSPL 1LO5A 4H26B 1DEDA 2PN5A 2VDNH 3G6JB 5HGHB 5DZLA 4XXCA 5K9QI 4G9DA 5I1HL 5FGCB 4CGTA 3ARBA 1VFAA 4H1LH 2ID5A 3L95B 3HC3H 2B2XH 2QSVA 4Y5VC 5FYJD 1Z3GH 2Y7QA 1WWCA 4UT9L 3PXHA 3VH8G 3T8XB 5DFVC 3OSKA 1DLHA 3ULVL 5C0EB 4Z7OE 1AO7A 3B9VA 1Q0YH 1JGEB 1JNHB 1TIUA 4NWUL 1MCKA 1S3KH 3VRIA 1HXMA 5C08D 4R4BB 1NAKH 4A6YL 1JGVH 4XP9L 3NGBB 1SMOA 3P9LB 3X3FH 5F1KC 2VDQH 4JAMA 4R97B 1RMFL 1A1OA 3RX7A 3OJMB 4YHNA 1LEGA 1B4RA 3QFDA 5KSVA 3LKNB 3RDTB 2QJDA 1K4CA 3VRLE 3EO9L 1HHHA 5KSBF 3HMXL 1VFMA 1JJUA 4KMTL 4NHUB 3S36X 2OLDA 2NY1D 4JJ5B 3MRCB 1PLGH 35C8H 5HI5C 2FLRT 4I2XE 2FX8H 3QUXA 2ZKHL 3KR3L 4DVBA 3MJ9A 3EJYD 3OKMB 3BKYH 4ZQKB 2XQBH 4WDIB 2YPKB 1M6OB 2MWCA 2WBJC 4U6XA 2VDPH 4XMPL 4HJ0D 2XWBB 3RZCB 5ERWB 3VE0A 5JOPD 3ULUH 1RK0A 4MYWB 4RMVA 2Q8AL 3MZGB 5EU5B 2RAMA 4KJWD 4JY6B 3FFCA 1A3RL 1OB1A 3BP6A 5D1QA 2PTTB 1AJ7L 2BOCB 4XPTH 3V95A 2BSSB 2NXYC 3HNSH 3RKPA 3E6FA 4OM0L 3IAPA 2VXUH 2GITB 4MQXD 3BN9C 5K9OB 5F3BA 3RVXD 5EZLA 2APTA 1Q9LB 4MDIA 3ULSA 1MAKA 3TNMB 4YHZL 1UM6H 4PJDB 3P73B 5JXED 4JFFD 3TM6A 1JP5A 4X9IA 3TPUA 2R1XB 1G6VK 1KCKA 1JPFA 5IEKA 5MI0C 3PWUB 1FJ1A 4Q9RL 3DMMA 4POYA 1M05A 2CLRB 3ZHLA 1MCDA 2YUXA 3MRDB 3OJDB 3FQTB 3VFVB 3CVHL 1D5IL 4LCYB 4ZS6D 5I1LB 5L2KA 4Y89A 5IF0A 4Y4HB 4PRID 4HSQA 3GMRB 2WP3O 2H6PB 1CR9L 5IW1B 2GK0B 2ICCA 2IPKB 4R4ND 1VENA 1MRCH 3QXVA 3W5MA 1B9ZA 4NQCB 1RUML 4NQVB 5J13C 4XNYL 4UILL 4K7PY 2CXGA 4WV1B 4NRYB 1YMMB 1DUYA 1N8ZA 4WNQA 5EBMB 2VQTA 3WN5C 3JZ7A 4ZNEE 1OW0A 1EHLH 1QG3A 4OF6A 1CDBA 2QL1A 4R2GD 5D2LB 3FB8B 3LZFL 1DBKH 4UIKL 1MCEA 3D25A 3PE9A 1DQDH 1AGCB 3QUYD 4XHJC 1OSZA 2PTUA 5HDQH 5IT2H 1ZAGA 1L6XA 5K59F 1KPVB 3EHBD 2H32A 3WBDA 1DN0A 3GRWA 5TQ0L 1T03H 3TZVD 1NGYA 5MEQB 1QP1A 3P77A 5CBEA 1RUPL 3MRNB 3L3IA 4XCFL 4JFEB 3GMLB 5I1CL 3ARED 4HFUH 5ICYB 5KG9A 1BVLB 5CEZL 4MXQC 3SE9L 4OIBA 1KNOB 3UYPA 2UWEF 4PS4H 1NDGB 5FDYA 4XTRC 1RHHB 2OSLB 3TBSA 1LE9A 3DIFB 2YBRA 4I0PB 3PWPE 4Y2DB 5E95B 3RVVC 4KZDH 1G7MB 4BSWB 3AU1A 4OZFB 5MHSE 3TVMC 5EU6E 4E5XB 2BHZA 3L7EA 3I6KB 4XNMB 4ODWA 5CUSH 3WXWL 1CFNB 1MI5A 4U1GC 4LVHC 4H5SA 5BRZD 1HYSC 2A73B 5DI8A 5T3ZH 3RWGA 1D5ZB 1MQKL 5E8EB 2RHEA 5EZIL 4BH7A 4DAGH 2XKNB 1UA6L 1CFSA 1IQWH 2WLZA 4PRNB 4QHNA 4LPTA 2F8XC 3HUJE 4JM2D 1BVKA 4UQ3A 2WBKA 5GGTL 1G7HA 4MA3B 3TV3H 2OTUB 1JN6A 3P40A 4PRPA 2ZSWB 3UBXB 1XEDA 3ARUA 4UT6L 1MLBA 2ADJB 4WENB 2F15A 2I9LA 2PW2B 2VLKD 4LCUA 3WHXB 4RGMB 4I48B 4XBPA 5J57B 3EZJB 5JPMB 1DANU 3MLVL 4MCYB 3FHAA 5EBGA 4P2QD 3QIBA 4PJEF 3HB3C 3ARFD 4G6FD 4Z76B 3HE7B 1XR8A 1YC8A 1SBBA 3BDXA 1IM9D 1WLHA 3SE8L 4NN7B 3U82B 2GJZB 4HFWB 4U6HA 2I9TA 4HQQL 3MACH 1I85C 4Y5VB 2YPLB 5DC9B 5I17B 2JCCE 3HI1B 3GSNL 2ESVA 2BERA 2OTWB 5FYKH 4JVPA 5F7MC 5KVFH 4XPGH 2FGZA 4TN9A 5A2KH 2HLFD 1QEWA 5DJ8B 3NVQA 3KS0H 5E7BA 4HKZB 3VXPB 4JFOB 5TDOA 4U1KA 3P3YA 4HGKC 1JGUH 1EEYA 1MHCA 1BPVA 1BZ7A 2AKRA 4HIIA 2HT2C 5E9DB 4Y4KB 1JWSB 1P5UA 3B8YA 1U3JA 2FH8A 4NQED 2QTEA 4OKDA 2NXZB 3D1MC 4JFYA 5B21A 2MFNA 1P5VA 3HCVB 4GRWB 1HH9B 4YHLL 1AR1C 2HVJA 4ZDHA 4TOYL 3MJ7B 3S3PA 4WU5B 3ZKQD 4RMUA 5KVMC 1V3LA 5EIIB 3E6HB 4M48L 2IH3A 4EDWL 3GBNL 1DQQA 3PJSA 4NBZB 3F12B 2YEZA 5T1LA 3MROA 4X6BA 4IRZL 3BIAX 3TA3C 2WWMC 5IGXL 4CN6A 2XY1A 1T2QH 4N8VB 3WLBB 5GGVL 3O41B 2DMKA 1NFDE 1YNLL 3H42H 1S5HA 43CAA 3UTQB 2C4FT 5J89A 4HZAA 1F4XL 1UVQB 2NXYB 3OR7A 3FT4A 1P9MC 3IU3B 4RISH 4G7VH 4XVJL 2IANB 4R7DB 3CK0H 4OLEA 4PG9B 3L5XL 4QRRE 2AQ3A 5JDJA 4OAWB 3O3BA 1CG9A 4WUKL 4XPBL 4F7TA 4ZOEA 3BP5A 1C8PA 5JPNA 3QNZA 4XMKH 5IIEB 4YO0A 2IGFH 4IM8A 1U8PA 4XC1H 1ZSDB 3RX8A 1JBJA 5MI0B 2AS5M 2PYEA 4Z7VB 1C5BL 2FGWL 2QEJA 5JQ6L 2G2RA 2WWKT 4WI9A 1MFEL 1UKTA 4EIGB 3TBTB 2D03L 3CFKB 5L88L 3Q6FA 1IAIH 1NGXB 2W9LA 3FO2B 2DQFB 3V4VH 3I9GH 5H35A 5IJKC 3NPZB 1TTGA 2R0WL 3EOBA 3TYGH 3GO1L 5J13B 3S3SA 1RZIB 3JV4A 1EO7A 4RRPA 2H2PD 3OGCA 2I26N 1XFPA 2AJYH 1INQB 4P5KA 3X17A 1DBAL 4RBPK 2EDXA 3O3DA 1EO8H 3MLUH 4JO3H 2CKBB 3MXWL 5DD5L 4ODUA 3BEWA 1D6VL 4OD3L 1D5BB 4ZUSA 1KXQE 5I15L 2OI9C 4N90D 2IH1A 1X5GA 1BIHA 3MXVH 4PP2A 4LCIH 4QRPE 1NCDH 5ACZB 4S11A 2HFFB 2PR4L 5TE6L 4FQXD 4TSBL 3C5ZA 3D39D 3D6GA 3K2UL 2AI0L 1OP5K 2IAMA 4G7YH 3HI5H 1C5CL 3NN8A 4PR5A 1RUKH 3BPLC 4KXZI 1QLFA 3O0RH 5E2WH 1UB5B 3OBAA 5KVGH 4HC1L 3VXQA 3ZKSD 4AQ1B 3BOVA 3FQRA 3L3HA 3QH3B 3TBVB 3UTSB 4H1LA 3W11D 5TGBA 2NY3D 1B0GB 5EU6B 1T5WB 3G5VA 1FC2D 1RIUL 3DGCR 3DVGA 3HNTL 2X4RA 3IJSB 4JREC 1KV3A 2ICWB 4GSDH 4U1GB 3W9EA 4LVHB 1TTUA 1U8HB 3MCLL 1KCUL 5I66B 3DVNA 3IFNL 1SEBA 1BFVL 1DEEA 5DQ9A 1I1FA 4QT5A 5BS0E 3E1F1 3X12B 4MLIA 3B9KA 1X7QB 3DLQR 4OZGB 4S1DD 4WTZA 5E00B 3C2SA 4G8EA 1BBJB 3VCLB 2GTZA 3H3PH 5C07D 4C59B 3MGOA 4P2OA 1U58B 1WIPA 1MWAA 2AEWA 1TZHA 1A9EA 3O4OC 5EU4B 5E5MB 5JW4N 3KXFA 4G5ZL 3ARSA 2ZUTA 3UZEA 4PJGE 1RK1A 4MQ7B 4DGYH 4OGAD 1MCHA 1YPZF 4P46C 1MAJA 4FFZH 3B2UC 2HRPL 2HLAA 2QSQA 1FORH 4JPWH 3ALWA 5DJXA 3SEPA 2M8XA 1FZOA 3S4SA 3QA3A 4O9HL 3UPCA 1RULH 2VXVH 2C1PB 2DWEB 4ODTH 5TFSH 3AC0A 3LMJL 5FOJA 4RAUB 5AAMA 1A02N 2F5BL 1W2KT 5CWSA 5IFHL 3V5DA 4NQXB 3CFDA 1JHLL 4JKPH 3S3JA 1JNLH 3OKDA 3S37X 4AEEA 3ULVF 1QA9A 3HPLA 1EMTL 3CFEA 1C5DA 4MB3A 3V79C 2Q1EA 5D5MF 4ZFFB 1U8NB 2AAVA 4DGIH 3H9ZA 4K8RC 1KLUB 1ND0B 1MVUA 2FO1A 5F9OH 4PJDF 1KLGA 1T0PB 2ED7A 5EZJB 3JXAA 2B5IB 2Q20A 2FJFB 5DMKA 2BVOB 4NZUH 3T77A 2EDLA 3T1WA 2HP4A 5DVOA 5AWNH 4EVNA 2EIDA 5FAAA 4BKLA 1F3JA 1I8IB 1FFQA 4LPCA 4JM4L 3VXRA 2H3NB 2AQ1A 3ZYZA 5HYQB 1N5YH 4JPVL 1CF8L 1CVRA 2IPUK 3H6JA 4Z78B 4CL7A 2RQ8A 1ED3B 4P2YA 4OZIE 4BZ2L 1UM5H 3WFCH 5FOBA 4WHCA 3UJJH 5K9QG 3MGAA 3DNKA 5ICXA 4YFDB 1A9BA 4WO4C 4X7SL 1I9RL 4U7SA 1XAUA 1BQHA 4TYUA 4P57B 4AM0A 4LF3A 1ACYH 2SEBA 1CLYH 4NO0D 1GGIH 1RVFL 3IDMA 1IEBB 2V9TA 4JY5L 3IETB 3ARBD 4ISVA 4CMMB 2L7UA 4XWGL 2VABB 4OBSA 4ZUWA 5J6HA 3U83A 2GEEA 5HY9B 2QQNH 5EPMB 3S34L 5HVHC 1QBMH 4X8JA 1OWWA 1X5IA 5J11C 1CLCA 1MRFH 1CL7H 5CEYA 5EU3B 4DOHE 1RJZA 4FQIH 3MRFA 4G8GD 1ZHLB 1CFQB 4LLWA 5T3XE 2K3TA 4MAUH 4XNQA 2JJSA 3PIQB 2QSCH 3T2OA 3HE6B 1JHTA 1FZMB 3MLPA 4RMWA 5FIEA 1BFOB 5IHLB 4KTDL 1ITBB 4YUEH 2W0PA 1BM3L 3AFLA 5L2JA 2ZUQC 3ILPB 3MLWL 4NDMA 5KVDH 5ILTL 3D0VB 1F00I 3MRLB 3UC0H 3WIFB 5KW9H 2VN7A 1FBIH 4X9BA 2R29L 2Y5TB 2VB5A 2VLJA 2CMRH 2D7MA 3MRKA 5C3LD 4PGZA 4I13B 4M3KB 4JO1L 4RNRA 1YMHB 4M7ZB 1G6RB 1DN2A 3IXAA 1VADA 3K1KC 3I2CH 3QUXD 2DD8L 1LK2B 4MS8D 1I7UB 1RZFH 3CC5A 5TQ2L 3VFRB 3NCCB 5D9SB 5T33H 5FDWA 4BQ8A 2WV3A 5HHQB 5DVLA 4YQXH 1VFUA 3IDGA 3CD4A 2OS7A 4FQHA 3FFCD 5D1QD 5EC2B 3T0EE 5C8JA 3HZYA 1NGPL 2OI9B 3OKYA 1EGJA 3T0EC 2FR4B 4HXAL 2E27H 1IL1A 1BHGA 4QF1A 1N2RB 3HR6A 2H9GA 5DVMA 1H3UA 1VFOA 3KYAA 2DIJA 4WVRA 3X3GL 5IW6B 1KIQA 5D70H 1D6EA 5GGRY 3B2VL 2YWYA 4XMLL 3R1GH 4X5XA 3MV8A 3MFFB 1EXUB 5CZXC 2I07A 5JUEH 1CQKA 2X10A 5GGRA 2LVEA 3DMMD 3KYOA 4Z7QF 2PO6A 3L3GA 3M8OL 5BO1L 2QR0B 3KYMA 1HE7A 3MQIA 1MCFA 5F96L 1YEGL 4M5ZH 4LVNB 4Q6YA 5L2KD 4Q74A 4K8RL 4JREB 4PJ9D 3QUMB 1K8IB 4I5BB 4P4RA 1A22B 1ZE3C 4P9MH 4R0LA 2IPTL 1Q8MA 3MRHA 1JK8B 3SDAD 4GLRH 4KAQL 3WFHA 1U8IA 2IC2A 5BS0B 4OQTL 1N4XH 1HSAB 1AD0A 1IARB 5DTFA 1G7QB 4MA8L 4G3YL 3MLYL 2CK0H 1NBQA 3JTTB 1E4WL 3VRLF 5F7DB 4NQDA 1K3IA 1KPUA 1SBSH 5C09D 4FFWC 4KHXL 4FZEL 4YAQB 2HN7A 2ARJB 4KI5E 2VTFA 2GKIA 1LD9A 4KI5C 1JPGA 4POUB 5GZOD 5I16B 2J12B 5CP7B 4KJYA 4PJGB 4WFHE 2XZCH 4PJ5A 3VH8A 4M6OL 4LSPH 4KKLD 3FMGL 4G9FE 4PRHA 3FT2A 3JV5A 2ZCHH 3EYQC 4YHKH 5IB1A 4YXLH 4I77H 3QHFH 1BGXH 1JZ8A 2A6DB 1WC7A 1PKQA 2P8LB 4X99B 3OPZH 3QDGA 1Q72H 4C58B 4FXKB 3X14A 1ZLSH 5JO5A 4KPHL 4JZNA 4HGMA 3QXUA 4XPAH 3MLRH 1RZKL 5C0CE 5IUSA 1QSFA 2VE6B 2Y36H 3U4EB 3UEZA 4P99A 3FQWA 5EUKA 3U9UA 1MCPL 1CGTA 4HMEA 4X5WB 3VW3L 1T3FB 2NZ9D 4YFLI 1IGYA 1T5XB 3H9YA 5FV2A 1MCQA 5C9JA 2EH8H 4Z0XA 3QXDB 2VLMD 4OGYL 2WANA 4AZ8A 1R3LB 5CCKL 4XRCA 2W0FB 5CSZB 5T3XL 2Y25A 3U0TA 2X4NA 4R2GB 3FB7B 3RHWK 1OP3K 1ZT7A 5IMKB 4M4PA 3GSUB 1RJCA 2FJGA 3OJVC 5D2NE 3VWKC 1HH6B 1OLLA 4IHOB 5D2NC 5AG9A 3GHBL 1NGWA 5D1ZA 1OGAD 1JUFA 2AJSL 2GY7B 4UDTB 4WY7H 4NM8L 3GMOB 2W65B 1T1ZA 2GT9B 3GSVA 2W0KA 2BSRB 3SCMA 4HIEA 1AGDB 5CS7A 4ONGH 4AT6B 2CJUH 2YPVH 4GH7B 3MOAH 4JFDE 4GXUN 3QPXH 2FSEB 2YD5A 5CIPB 1ADQL 1I9JL 3LS4L 1V8HA 2X2YA 1A6TB 4Z77B 4OZIB 2IFGA 4M62H 3ZDYE 1W0WB 1DBML 1NC4B 1MREH 1FIGL 4V1DA 1JHKL 1RJLA 2X6MA 1SYVA 4WO4B 1KJ2H 1FYTE 3QIBD 3WIHL 3WL9B 4RFOL 1BX2A 1OHQA 2YRLA 5EN2A 4F57L 4L29B 4F2MB 4X6EA 3D87B 4U0QB 2HWZL 1S7WB 1PEWA 3B9EA 3OAZH 4AEIL 4LLUB 3L5IA 5HHME 3P11H 2ESVD 1SY6L 1OAZH 4WI8A 2BDNL 1KTKE 1JPSL 5AG8A 5I1IL 1UZ8B 4JFQA 5CFHA 3MRGA 2G60H 2Y6SD 1KIUA 4V2CB 3SE3A 5B4MC 1KEGH 4FZ8H 1XH3A 3T2QA 4K7FA 2YN5A 1RV6X 2ZG2A 4JHAH 1KB9K 1WEJL 4L1HA 1HILA 5J3HC 1Y18B 1IZKA 3DUSA 1MFNA 1NANI 1BZ9B 1AE6H 2F8OA 5F7KC 1WTLA 4MZ3A 2YOCA 4WEUD 4G6FB 4JRXE 4Z7WF 1Q38A 1T66D 4ELMA 3PL6B 1IGML 4YHYB 1KT2B 4OZFG 4H8WH 3P4MA 3PDOA 2OM5A 3CCHB 4LOUD 4ZTPH 4CUCA 4GW4A 1I4FB 3BDYH 3HUJF 3CMGA 4OM1L 4WWKC 3KPSA 1JRHL 5T1LD 3EYSL 1SJVA 3SGJA 4LLVB 3PHOA 3QI9C 4XZUA 4GRMA 5D7SL 3MUY1 2ITCB 3WNNA 1HQ4B 4TNWK 2E5EA 3ROLB 2XI9A 4WUUB 1QLRA 3STLB 3EDJA 3HS0A 1YEDA 2W1NA 3BI9X 3GJFA 2A6JA 3ZT5A 3SDCD 2X9YA 1R5VA 4LGSB 5AZEL 1OTUD 2HJFB 1U3HA 1FNHA 1ZLVH 3IF1B 3UBXG 5HI4D 3Q1SL 3WS6A 1GIGH 3PV7A 4L4TD 3IAGC 3FONB 4PLJC 3DX7B 1HKLH 2X89D 3UP1A 1JFQH 4LHJB 1OT1A 2J1KA 4P9HH 4UUJA 4HUUB 1G1YA 3PDGA 4LBEA 4BZYA 4UBDD 1TCMA 2JCCF 3PP4H 4GKOA 4MXWL 4KH2A 1OTSC 4PJ8A 3RKDD 2QHRH 4LSDA 3ZT6A 3U9PL 1KENH 2DJUA 3O9WA 4TQEL 1P1ZB 4OV6F 5CJBA 3RNKB 1R3KA 1NSNL 1JNJA 2KQMA 1WQVT 1OAQH 4RFEA 3MRPA 3K4DA 4KC3B 3RTQA 2IF7A 4BYHA 1ODAA 3GSOA 4RMTA 1Z5LB 1GGBL 4PJIB 3BD4A 3QCVL 5KAQF 5BVJB 2BVQB 4LRNL 3CX2A 4HCRL 1L7IL 1L7TL 1C12A 3GZKA 4JB9L 4HH9B 2EYRA 4PY7B 3WS3A 2CDEB 3H7BB 5MERA 1F3DJ 4Z7NE 3DHJA 1NKRA 1A7OL 2EIZB 4XNXL 4C83B 1LK3L 3LKSA 4F7CA 4F9LA 3KLAB 3ARYA 3KPOA 4O00A 4G9FB 1RAMA 2ZUVA 1XZ0B 5I1AB 1AHWC 1PZ5B 1CWVA 1FO0L 1AI1L 5LKNA 4QWWD 2C7UB 3C09C 3CFJA 2QQKH 1DSFH 4OSUL 2VITA 4AIZA 3QO0B 1ORSB 2IAMD 1OAYL 1FNEB 2FYYB 2E7BA 3O2DL 1MAMH 1S7TA 1NFDF 2EO1A 2HFTA 3TWCH 4BH8A 3L3KB 5GSVA 3VXOA 5DGRA 5I6XC 4LLDA 3C9NA 4I3RH 5LGJA 2EE3A 1O7SA 3BHBA 4N8VG 1UCTA 3RUGA 3M17B 2XG5A 3JWDC 5FM5M 2NW3A 5FEBA 4RAVA 4WFEE 2ERJC 2R2HA 2MQCA 3VXMD 3B5GA 4X6DE 1RIHH 3SDDA 3QQ4A 1FL3A 5IFJA 1YEHL 2VUOA 1IFHH 3KDMB 3GK8L 1NAMH 1RZJC 3MA9L 3BGMB 5D2NB 5TF1L 3VWKB 1AIFA 3TBYA 4DGVH 3U7YH 1Z9LA 1O0VA 5IG7B 4U1IB 3MOBH 3B9KD 4CDGC 3FB6A 2O26U 4KK8C 4LDLB 5I8EB 5AAWA 2P5EE 5GGUA 1OSPH 1R3JA 1WBZB 4P2OD 3ISWA 4JFDB 4I18A 4R3SA 3SY0A 4MMZC 3ZLQC 3KXFD 5HYIA 1YEIH 1AR2A 3PQYE 1A7PL 4Q9BA 4M7JH 4JZOA 1ZWIB 1K8DB 4HHAA 4NRZB 4YFLF 4N0FA 4QTHB 2JTDA 1YEJH 2XWTB 4KHTH 1OM3L 4ZS7H 5LQBL 4JPIB 3FKUS 4PJHE 15C8L 3NH7H 4PTUA 3ULVH 1ZGLA 1HNGA 4LEXL 2O93L 2HG5A 3I85A 1D5XA 4WTXA 5C9KA 2ADGB 3VGBA 1I1RA 1NQBA 1W0YT 2AABH 2YMXL 4FQQA 5FYLE 4XP9H 1RUQH 3ULUD 5ITFB 1K85A 4NRXB 1D9KD 3C60D 2P7TA 3QJHB 4QKXB 3FQXB 3WD5L 32C2A 3TFKC 1A2YB 1VGKB 2A9MH 2XWJA 3P4LA 1WBXA 3ZDZE 2IFFL 3ME0A 1JRHI 1XR9B 2DQIL 3G04A 3DYPA 3EO9H 3LD8C 1VESA 3BGAA 3HMXH 3P9WB 4KMTH 4OCXH 1WTGT 2YS4A 3LRHA 1RZ8B 4E41A 5SX4I 1GSMA 1A6UL 1NGZA 4GAYB 2DIBA 3LQZB 3GNML 3F7YB 3V0VA 1KCRL 1T89A 1BJ1J 4XMPH 1S7QA 4MNQA 3VG0H 5IVXE 1F6AB 3O3UN 4GMTH 1IAMA 4HWBH 4JR9H 4P2CG 5C0BE 5FA3B 3WFBH 1A3RH 1LEKB 2Q3ZA 4IRSD 3SKOA 1IM3B 3HTLX 1TMCB 1AJ7H 3HNVH 4HDIB 5A1AA 2DDQL 4AG4L 1HQRB 2A9NL 1VDGA 3MNWA 4M61B 4H25B 4LLMA 4HXBL 1I3GH 1EFXB 2A6IA 2OR9L 5DJZB 4LGRB 4N0CC 4Z0BL 4L8CB 3HPJA 5TDNB 4HUXB 1YC7A 5DDHA 1XGYH 1I1YB 4YBQC 3QULB 3NA9H 4MQTB 5J1AA 3WSQL 2CUMA 1GZQB 4Y8AA 5JHDE 3ZO0A 4LLYB 2XTJD 3SE4A 1AGEB 1VKXB 5JORA 4RGNE 2LTQC 3W39B 4RGNC 4ERSH 1NFKA 4OZFH 1E27A 4Y16D 4BK4A 1KLFA 5F7YC 4NKIL 3DUUB 5I2IB 3C6SB 3MRJA 4L8DA 3EFDL 1XIWC 3U36B 3R8BB 4XNYH 4UILH 2VIRB 4RZCA 5ANMA 5IROA 5J12B 4K3EL 1PD6A 4ENED 5JTWA 1R6VA 4MHHG 1BBDH 3S36L 3MODL 3JWDL 1T1WB 5TDPB 2GIYA 2IPUG 2AJXL 4JG1L 5ESVA 3SKJL 1GPOH 4JCLA 1CXKA 4JY4A 4ZTOH 3E2HC 1YYLL 2DICA 1N64L 4KVNH 4UIKH 3DECA 5CEXA 2BXYA 4E0RA 1RFDL 1SYSB 4ZFZB 2ICEB 5T1KB 3L3DB 1RZJL 2Y72A 4G8IB 3MV9E 2R56H 2V9QA 4NFCA 4M03A 5T3ZD 4FQLL 5DLMH 1MHHA 1F6LL 5BJTA 2Y06L 3BSZL 1U93A 2D3VA 1RUPH 1FL5A 4L8BA 5I1CH 5SWSA 4QY8A 1CFVL 4JN2B 1LEIB 5IQ7L 5ISZB 3NCYS 1EEZB 4PJEA 5KAQG 1N6QL 4NWTH 4HD9A 1EEUA 4F37K 4KMLB 1F4HA 2E8ZA 1VCAA 1BQUA 4OZIF 4Q6IA 2BY0A 4NC0B 3BZEA 3HC0B 1AHWB 5FUCE 3DO7B 5FUCC 4RMRA 2XA8H 3C09B 3ZKMD 1N7MH 4WU7B 3DXAE 4IRJC 4RWHA 3TT3L 1T0MB 1KJ2A 4AL8L 1PY4A 1SJEB 3MV8D 2W9EH 4HGWB 1A47A 5CILH 2JIXB 5I6XB 2AGJL 2FEDD 1MQKH 5EOCL 5C0DB 3AB0B 2P5WE 4Y5YB 1FL6A 1B88A 5A3IC 4Y1AA 3CDGA 4ZO9A 4XC3H 2PO6D 5F9DC 3ARDA 5CINL 2ERJB 1T83C 2GTWB 3HHRB 3KYNA 5GGTH 3RGVD 1C08B 4W68A 5K9JH 5FYKD 4D0BB 3BUYA 4KK9D 2E9WA 3LS5L 4KQ4L 4JEGB 1LDPH 3OZ9H 1V05A 2VZVA 3IKKA 4DW2H 4OCWL 4LEOB 1UWXK 1XT5A 4H20L 3UPAA 4BZ1L 2J6EL 2V2WB 2V7HB 4IS6A 1MCIA 3MRQB 4AIOA 4X6CA 1YA5A 5I73C 5J4MA 4NQDD 5J6GB 2X4TB 5FO7B 3ZTNH 1L4IA 3EIFA 2W92A 3ARGB 4JG0L 3PQYB 1NCCL 4ZXBA 4PJ5D 3UYOD 3A67H 4HQQH 4Z7UE 4D8PB 4X7FC 3REWB 3SGEI 5KSUB 1PY9A 2EC9U 1C1EH 3F65A 3FQUA 5HGDA 4NHCL 4ZPVB 3O6LL 5DT1L 4XXDB 1KOAA 2BVPB 4RBPH 3KPMA 1X5XA 3QDGD 3LN5A 3T0XA 3UYRL 5I76A 3GSXB 2ZWLT 4R7NB 5DFTA 5LVEA 4U6YA 4EUPB 4OTXL 5HGBB 2J8HA 5JIKA 1YY8A 2DLFL 3DX9B 1QSFD 5DMGD 4OZ4B 3ZL4H 5HYEA 5F8QC 4NT6A 3O8XA 3SDAB 2VAJA 1V7NH 4M3JA 2YKLH 4JO2L 1S8DA 4U6VL 3RI5K 3EBAA 1CE6B 2IBGA 2PCPB 5A2IH 1RSFA 4X4MA 2DQEL 1GGTA 1FVDB 3BWUC 4KKBC 4LAJH 4IOFD 1ZHBB 3HN3A 4YR6B 5C09B 2EXYC 1OP5H 1QSEA 1NC2B 3U4BL 3ZTJG 1A1NB 5D6DA 5BV7B 4P2RA 3EOTL 2ZP0T 1Z0MA 4WW1A 2DM4A 5D1ZD 4F33A 3I02B 4LSRL 3S6CA 2HFEB 5KSAB 3QCUH 5HD8D 3SCMD 2VLLA 1MCOH 3JWOH 4HUNB 2CKBH 1IGTB 3BGFC 1KELL 4UDUA 4P4KB 3BWAB 2HJLB 3NZHH 3F62A 5ESAB 9CGTA 5JLZB 1H0DA 5DUBB 1F4XH 3W2DL 5ADPL 4IMLB 4BFBD 4XVJH 3I84A 3RWEA 5H94B 4PJAE 4CN1A 4LCWA 2HVKB 3B3IB 4WUKH 3FOMB 4XPBH 3KAAA 3A6OA 5IB5B 2DQHH 3P30H 2X1OA 1T22A 3VMPA 1ZHNA 5IR1B 5E5UB 3BEVB 1R5WB 4H26A 1QR1B 1ZANL 3DHMA 2OMNA 3TJEH 1MNUH 3G6JA 5HGHA 5JHDB 2DF3A 2LTQB 4RGNB 1DQTA 5I71C 1OOAA 3L95A 3VXUD 1WWBX 1OL0A 4LMQE 4HS8L 2YHGA 5L88H 5DMIL 5C0EA 1N59B 3WFEL 5IB3B 1PG7W 2VR4A 4MVBC 1JGEA 1JNHA 2R0WH 5IVZB 1OARL 3QBTB 4EJ1C 1V5JA 3QXWA 3LKRB 4D9LL 1UH2A 1WCBB 4FG6D 4R4BA 4XVSH 3P9LA 1J05B 1NUFA 4PRDB 4G6KH 3A6CL 1DBAH 1F90L 1IGJB 1GAFH 3BE1H 4ALAL 1P84J 3E2HB 3FOLB 5DMYA 3LKNA 4M43L 2DLIA 3RDTA 1AQKH 2OQJB 4L8SC 5DSCB 4OD3H 4PJ7E 5GJSL 1S78D 3VFWA 4PUBL 3RVTC 1MHEB 3O2VH 4ZFOB 1PBYA 2NY1C 2W0LA 2FECL 4QRTB 2M26A 4NHUA 3KPSD 4IIQB 4JJ5A 2CQVA 5TE6H 2DM3A 1KB5B 1KN4H 3EJYC 2AI0H 4X83A 3QDJE 3OKMA 2KUTA 4WDIA 4CNIB 3HZKB 2YPKA 1M6OA 2Z0BA 4QXGL 5JOPE 3PWLB 4TVPE 2XWBA 3RZCA 5ERWA 2EH7L 2HTLD 1G9ML 3QPQC 2R2CA 5EU5A 4JY6A 4PRBB 1U3HD 3F6IA 3ESUF 43C9B 2PTTA 2BOCA 4D0CB 2YA2A 2BSSA 5JR1L 1YJDC 1OTTC 3QRFM 1Z6JT 7FABH 4M1CC 4XCEB 1RIUH 2GITA 3RVXC 5FF6A 3QQNA 5K9OA 1Q9LA 4M6MH 1KCUH 3QIWB 4M7LT 4X4ZA 2WIMA 1W72L 1IQDB 1N5AB 3TNMA 2AP2A 4DK6A 4DN3L 4TTDC 2F53B 3IFNH 4XAWL 2ZOLB 3GGWB 3P73A 3TF7C 5HJ3B 3STZB 4LPXA 4PJ8D 2R1XA 5HVFB 4LIQH 3IGAB 3PWUA 1A6AA 1HWHB 3MBEC 2DQGH 3CLFL 2CLRA 5GGSY 4AEHL 3O9WD 3U46B 3SGDH 3BRGC 4GUPB 4WRLA 5FCUL 3MRDA 3FQTA 4G5ZH 3VFVA 3RTQD 4KDTA 4LCYA 5I1LA 4OB5L 5DJDB 3GMRA 1FGVH 1KEML 2DQDH 2H6PA 3DPBA 2GK0A 4YX2H 1XGQB 2IPKA 1S9WB 2HRPH 4GKSB 5J56B 2VZTA 4N1EA 5I73B 4NQVA 3BQUC 5GS0C 4F15C 4LSQL 5E03A 4S0SD 5DJCA 1TITA 3DUHA 2Q7NA 4EI6B 4NRYA 1YMMA 1NH6A 3LMJH 5EBMA 3D3VD 1FLRH 4WCYL 4HWBA 3VMNA 4Z7UB 2RIKA 4N5EC 3WNOA 1F11B 5D2LA 5IFHH 2HH0L 4RX4A 3SDXE 1REIA 2DOCA 1AGCA 5CJQL 4P49A 1EMTH 1KPVA 5E7FA 5KN5B 5ICZB 1OAXH 3HI6L 1INDH 4MSWA 5MEQA 1A21A 3AREC 3MRNA 4UTAL 4JFEA 3PGDB 4U3CA 3GMLA 4QOKD 3WKMH 5ICYA 1RU9L 1BVLA 3HZMB 3GI8H 3U0WH 1KNOA 5EOQL 1NDGA 4ONFL 2DQTH 1RHHA 2OSLA 3LRGA 2JELL 1CK0L 1QBAA 3DIFA 4I0PA 1DQLH 2PTVA 4Y2DA 5GIRB 1G7MA 5D7LE 4BSWA 3HR5B 2J8UF 2XZAL 4OZFA 3SDDD 1HK6A 4E5XA 3I6KA 4F37F 1KJ3L 1CFNA 5BRZE 3GEWB 1G6RH 4EOWH 1YN6B 2CRZA 1FVCB 4R4FH 2A73A 1H5BC 4P23C 1D5ZA 5E8EA 4X7DC 4K94C 2X4OB 4TPRH 1E4XL 3N1PC 2O5YH 2A1WH 3HAEB 4JM2C 4MB4A 4PRNA 4QTIH 1B2WL 5FHAL 1E4KC 2BNUB 3BGFB 4O51B 4MAYC 3SKMA 1OCWL 4CW1B 4MXVE 1TETL 1MHPH 1LNUB 4WHTB 2NY0C 3BAEH 4MA3A 4EDXB 2OTUA 3JSSA 3TBWA 4XWGH 4L4VE 2DLTA 2ZSWA 4GS7C 2VLKE 1J5OL 3UROR 4R8WL 1A7BA 2ADJA 5JW3H 2GJ6B 3F7VB 3PG2A 2PW2A 1F4WL 2A2QT 3WHXA 4I48A 4YHOL 2GSGB 4JFPB 1U8OB 4JZJC 5JPMA 4IOSD 4JDZB 4JVWA 4P2QE 3U30C 3VXMB 4F9PC 4MCYA 4Z7NF 3L3OB 1BOYA 3S37L 2UZXB 4TVPL 5KANG 2WUCL 5EWIH 5C2BL 3HE7A 2BVTA 4WJ5B 4U2ZA 3CZFB 2HJKB 1NBVL 3H0TB 1MIEL 2GJZA 1A4JB 1DTUA 2FECI 1F2QA 4HFWA 1B90A 5ILTH 1YJDL 4Y5VA 2YPLA 5JXAH 1SMAA 4I1NB 5I17A 1GZPB 4MDJB 5JNYA 3HI1A 5EO9A 1FE8L 5BW7A 2J7LA 4UT7H 3O6KL 1N6UA 1JYXA 3LN9A 1F8TL 5DJ8A 3TYFB 4P3CH 5BMFL 3FFDB 4HKZA 3VXPA 4JFOA 3LB6D 5F3HB 5EUOB 4E41D 1LMKA 4M8QA 4UB0L 5D6CB 1SEQL 5DR5L 5CMAB 1WFNA 5E9DA 2FATL 2VH5L 4Y4KA 1JWSA 2VZOA 3VD3A 2Y07H 4G8FA 4HIJB 4O2FB 3GUTB 4X6DF 3HCVA 1LO0H 1HH9A 3WE6B 3VDAA 5DJ0B 4XI5C 1UWEL 2NY6C 2AJ3A 3L1OL 2EDYA 4WU5A 1OP3H 4PP1C 1WWAX 5EIIA 2NX5B 4JHWL 3E6HA 4U1NB 1YEFL 4N1HB 2M2DA 1BF8A 2Z4QB 4BK5A 1OPGL 3HLAB 5LBSL 5GS0L 1VEPA 4C56D 3F12A 3QDJB 3B2VH 2A77L 5HYFA 4XMLH 3KPQB 3HC4H 4O5LH 5EIVA 2C3GA 3BJ91 4TULH 1WAAE 1EJ6A 3WLBA 3WUWB 3O41A 5B38A 4PGBB 4M8VA 2VERN 1NEZB 4PJHF 2V7NB 3UTQA 1NMBL 5BO1H 1UVQA 4D2NA 4APQC 5F96H 1YEGH 4V2BA 2IANA 3VFSB 3VGAB 4K8RH 2RFXB 4GAJL 4R7DA 4PG9A 5F8RC 3DGGB 4OAWA 3QUZC 3RL1B 4IRSB 2IPTH 1QFUL 1JV5B 1FG2B 4OGXH 3U7AA 3VGHA 5IIEA 3GBML 4U6TA 4KRLB 2OP4L 1ZSDA 2YD3A 4IMKC 5B3NA 3ZDZF 4I3GA 2EDEA 4XBEL 3S5LB 3LKQB 1ZGLM 4GT7A 4Z7VA 1JGDB 3IU4H 5D7IB 1CGYA 2XTLA 4M9PA 4M00A 3TBTA 2E7LA 5CIPH 1J0KA 2F58H 1TNNA 3CFKA 4OD1H 4OCMC 1NGXA 1YNKL 4M6OH 3RPKA 2Q8BL 3TT1H 3KPRB 3FO2A 2DQFA 1FG9C 1KJVA 2MQ3A 4K94L 4OLXL 1PDKA 5CGYC 4GBXB 1RZIA 4F15B 4ZFGL 3K1DA 2H2PC 1CGUA 2YN3A 5IVXF 4Y16B 4NKMB 2YA1A 5SWSD 5IFAH 1HZHL 4NNPH 1EO5A 1INQA 4NYLB 2EZ0C 4LMQI 4KPHH 1NL0L 1WV7T 2L7JA 5D7KD 1B0RB 2CKBA 3ES6A 4ZNEA 5JIHA 3DX6B 1MRDH 1NCAH 1MFCL 3UTPD 3HFML 3BO8B 1MCPH 3MRRB 4N0YH 1J8HE 4N90E 3SDXB 4XB8A 2K7QA 1D5BA 3VW3H 5E8NB 4XHQA 2HYMA 4LQFL 5EOTB 4KRPB 4W4OA 4QXUL 5ACZA 4FQXC 3ECBA 5E4EC 5IHUL 2HFFA 5J06A 5CCKH 1MH5B 1H3PL 3RA7L 1EUUA 1JNNL 4GMSH 4Z5RB 4J2XA 1CD9B 4EN3D 2BRRH 4KY1L 3TIEB 4YDIL 2AJSH 5E8DL 4JQXC 1JYVA 4MX7A 1UB5A 1YQ2A 1GGUA 3DARA 3FCTB 2OK0L 3OHXB 4Y5XB 3QH3A 3TBVA 3UTSA 5KS9E 1CT8B 4J4PD 4NJAH 5D7LB 3SO3C 3CFIC 5EU6A 1T5WA 4NKQB 3LS4H 1ES0B 3LEVL 3MJ8B 3RWFB 3UDWC 2XIDA 4OCYL 3IJSA 1WVZA 2ICWA 4J3WA 1FGNL 1EPFA 1FIGH 1H5BB 1U8HA 4K71C 1JHKH 4P23B 4WI2A 3VXSE 1JI2A 3QWOB 4UTBL 1KIPB 5FECB 5I66A 2Q3AA 2W60B 2WINB 4NCC1 4OKVB 2CPCA 2ZCLL 4U3XA 4RFOH 4HV8B 3C2AH 4F57H 3BKCH 4OZHE 3X12A 3F7PC 5IHZB 4YHMH 5GJTH 5HYJE 4GG6E 4OZGA 1X7QA 5C07E 2NY0B 1BBJA 3FB5A 5FHBL 3VCLA 4DUWA 4YGAB 4ZXBD 4DTGH 1U58A 2JB5H 1CFTB 4L4VB 5FA4B 3MZTA 4AEIH 3U1SL 5E5MA 1PKOA 4U49A 1JMXA 4OGAC 1IC5L 3NMEA 12E8H 1RPQA 2BDNH 4MQ7A 4KV5E 3HG1E 4KK5D 5JZ7D 5GZNC 1X44A 4QO1A 1ZA3B 5EZOL 2VDOL 3GSQB 1I7ZB 3RGVB 5DMJB 4NKOB 5E08H 4POZC 3O4LE 2KH2B 3TN0C 2UYLB 1HYRC 3QQ9C 3R06B 2ZUWA 2C1PA 2DWEA 3IXTB 1BD2D 5I1GH 3O8XD 4RAUA 5L0QC 1OAKH 4QCIB 5TJWK 1WEJH 1Q9WB 5H8DA 1IC7L 1CLZL 4XH2B 1I85A 3L5WB 4AMKL 4NQXA 3VWJC 3BPOC 1CE1L 4K2UL 5CKGA 3JVGA 2CLZB 4ZFFA 5SWZE 5BQ7A 1U8NA 3IJYB 3IT8D 2H1PL 1X4XA 4P2RD 1ND0A 2EYSB 1ETZB 1CDYA 1T1XB 5F1OB 5DGQA 4PJCB 3ZE0E 5F6HI 3CXDL 4I9WD 5EZJA 3EYSH 5GRXG 4DN4H 5IJVB 3QEGL 4LRIC 1L6ZA 1WIOA 2BVOA 3PV6A 4ZSOE 3MO1B 3TJHD 4UQ2B 2D2OA 4MD4B 1I8IA 4OLUH 4LPYA 2DQJH 5E6IC 2NY6B 2H3NA 2DYPB 2GQHA 5HYQA 5C0ND 5MEND 1ZT4B 4JANB 3ALXA 5AZEH 1J1OL 1LHZA 1ZVSB 4Z78A 3V4PL 1QRNB 1ED3A 1U8KB 4LCWD 3SDYL 5CGTA 1MY5A 4PREB 4U1HB 2BNQD 1A1MA 5DA4A 4UNTA 4JHBA 4DCQB 3S9DB 2O5ZH 4P59H 4P57A 1RHFA 3NCJL 4YDJB 4XXCC 1A6WL 4L3ED 2XZQH 4Z7UF 1JIBA 3ARBC 1KTDB 1DDHB 5CJOL 5KSBE 1IEBA 1KFAL 2Y4SA 2VWEE 3IETA 4MXWH 2VWEC 1CIUA 3BVNA 4CMMA 4OD2A 5I0ZA 2Q86B 3PWVB 3T3PE 5DS8B 4APQB 5D1XA 3IDYC 1U92B 5FKPA 5HY9A 3NACH 5EPMA 4KUCF 2ZUSA 2CO6B 4OLZH 4YWGL 1NSNH 3MV11 1AO7E 4JQVA 1SVCP 2RCSL 1XMWA 5EU3A 2FEEL 3QUZB 1ZHLA 1CFQA 2JB6B 3OXRB 2LV4A 4TSAL 1U6AH 3QCVH 5K33A 5TPWL 3PIQA 3HE6A 1FZMA 3MV7D 4JFZL 1BFOA 2ZNWA 4CJ1A 2FCBA 2NTSP 5LCVH 3RNQB 4EUPG 5GRVL 1NLDL 1WJ3A 5F9WB 4JPKL 1FNSL 3ILPA 2A83B 3LIZL 2PNDA 2X4PB 3N06B 4JDTL 3D0VA 3RDTD 3MRLA 4UI2A 3VDBA 1LK3H 3WIFA 2Y5TA 2CD0A 3PGCA 1CCZA 1QBLL 3OGOE 5DJYB 1DFBL 4F58H 1JTOA 3OJ2C 2FIKB 2FX7L 3QUXC 5D72H 1G6RA 1KN2H 2OL3L 3D0LA 1LK2A 3V6FB 1I7UA 1Q9KB 3G6DH 5D7JC 3VFRA 1C16B 5D9SA 3LH2L 2VL5A 5HHQA 5FYJU 1YYMH 3JV6B 3FFCE 2CIKB 4WI6A 2ED9A 1QPXA 2MCPL 1J8HB 2YD4A 2VDMH 5H2BB 2B1AH 4PJAF 5EC2A 2FR4A 1S5IL 4CADB 3LRSB 2JJUA 4PB9L 3RY4A 1N2RA 1QRKA 1P4BL 3MNVB 5E4EB 2XNAB 1RUAL 3ULVD 5IW6A 2VKXA 4JJHA 2Z92B 1YEHH 5CBAA 3LOWA 1T20B 4F3FB 2XRAH 4EI5B 3MFFA 4JLRA 5C7XH 3CXHJ 3OQ3B 5K9KA 4K3GA 1EXUA 3LPWA 3W0WB 4HEME 2R4SL 5K59E 4Q0XH 1MF2H 2OZ4H 1NCWH 3ZMRA 5L2KE 4O02H 1IGCH 1WBYB 5FGBA 3A6BH 3V5HA 5HHOD 4Y4HD 2CK2A 1FFPB 3QUMA 4J3VA 3ZKXC 4N1CA 3N9GL 1K8IA 4PB0H 3DTXB 4I5BA 2AJUL 1DUZB 2FX9H 5HPOA 4I4WB 2B1HL 1JK8A 4PJBB 1BAFH 4NQCD 1I8LC 5HHVL 4LEXH 2DQUL 5LJYH 25C8H 4BJLA 2IQ9L 5BS0A 2ZUYA 1YMMD 1HSAA 2Y1VA 2Z31B 4O58L 1G7QA 4HW6A 2HA1A 3JTTA 2ENYA 4PJ7F 1MFDL 2YMXH 1OW0C 4WIQA 5ID0B 1F45A 3HRZB 4YAQA 5GZOC 3WD5H 3GIZL 5E8OB 5CHNB 5DK0B 5I16A 2R8SH 4KKLC 5CP7A 2QQQA 4PJGA 4JFFA 1YEKH 3UAJC 5GRVK 2IFFH 4G6AC 3HG1B 3L6FB 2DQIH 4O4YH 1OD9A 2P42B 1QFWL 4QHKI 4C4KT 3OKKB 5DEGB 4R9HA 4Y19D 3IJHB 4XCNB 3O4LB 3TN0B 3C8KB 2A6DA 5B22A 3BUTA 2P8LA 4JFED 1HCVA 4JO4L 4X99A 3EYFB 4FXKA 1E6OH 1A7RL 3DRQB 3FRPA 5L0QB 3QO1B 2J4WL 1FH5H 5DRNB 2X1QA 2XZZA 2FHBA 2VE6A 4PLNC 3U4EA 4OF8A 3QDME 1UYWL 1TPXB 1J11A 1B4JH 4X5WA 4DKFL 5JW5B 1T3FA 4YHIB 2AK4D 1T5XA 1J1PL 1UACH 1RZGB 3LEYL 1NCTA 5DJAB 5DVKA 2Y23A 3QXDA 3D3VB 2EXWD 4HULB 1MI5E 4HPYH 5KVEH 2VDLL 2EDRA 1R3LA 2MPAL 2W0FA 5CSZA 2NTFB 1TQCC 3FB7A 5FUOL 4AG4H 2A9NH 5C0GB 3GSUA 1S9KC 2XFXB 4HXBH 3QUYA 3CLEH 1HH6A 4IHOA 5DD1L 5KZCB 2DTMH 1LQSR 2D7PA 4PG2A 1G9NL 4LPUA 3GMOA 5E1HB 4Z0BH 2W65A 2GT9A 2VYRE 5E6IB 3B6SB 1AGDA 3TZVA 3S35L 4PRPE 4AT6A 1UWXH 3T4YB 5DK3A 4BSJA 2FSEA 1A6TA 3RIAF 4Z77A 4OZIA 1J1XH 1IAOB 1W0WA 1NC4A 3MJ9L 5B39B 1EERB 1LO4L 3QIBC 4N68A 1SJHA 3WL9A 1LO5B 4YIQB 2QV2A 2WUBH 1X5HA 3QQ3B 4BA8A 3CFCL 4G9DB 1NPUA 1ZTXH 2C1OA 3UXFA 1FAIL 4L29A 5KSBB 4F2MA 4P5TB 3F58L 5JHLL 4K3EH 3OKEB 5F1IB 1SQ2N 1CS6A 1S7WA 2WLYA 3DOSA 3MODH 2C4FU 2Q76B 5DVNA 4LLUA 1H8NA 1ZT1A 2AJXH 2X1PA 1YYLH 3CUPA 5L9DL 1UZ8A 2Y6SC 4IJ3C 2EDOA 2ZCKL 5E2UL 2EIBA 3BYYA 4B0MM 4OJFH 3FN0H 3PGFL 1GL4B 5D96B 4WW2C 1LEGB 2Y06H 2DL2A 4G80B 2NXZD 5TE7H 5KSVB 3H7LA 4XP5L 4W6WB 1PAMA 1Y18A 1PQZB 4DWHA 4UNUA 1BZ9A 1N6QH 4LSSH 1HHHB 2BY2A 4Z8FL 4XBGB 2I24N 1G7IB 4TSCL 3B4NA 3PL6A 1KBGH 1IM9A 1K3ZA 2VJXA 1KT2A 2F19H 1N0XH 2BCKA 3O3EA 4JM2F 1I4FA 3TT3H 1AH1A 1Z9MA 1GC1C 5D7JB 5AD0B 4M02A 4LLVA 1KYOJ 3PXJA 1BWWA 4MXVF 5GHWL 2B4CC 2ITCA 4K7PL 4MJIB 2EDTA 5D8JH 3ARXA 1HQ4A 2FHCA 4ZO7A 5FYLH 3RBSA 4EUPH 4S1SL 1T04A 3ROLA 4WUUA 3STLA 3C5JB 5AZ2L 2DQCH 1YEEL 2DMBA 4PGCA 1OTUC 1V7ML 2Z91B 5CINH 2NXYD 5C0AB 3GRWL 2IAND 3BN9D 1UQSB 3IF1A 4DFIA 1IGIL 5E1AA 4LHUB 3FONA 5LAXB 3DX7A 4H20H 4QHMB 5BV7H 2J6EH 4FN0A 1XGRB 2NQCA 2VKWA 5F7EL 3MUHL 2PYEE 1W8NA 4M1GH 2BOBB 4GW5B 2MNUA 4KVCL 1X3DA 2DM2A 1YN7B 5EO0B 3RKDC 2ZPKL 3T65B 2VQUA 4C56B 4FMKA 1FDLL 2YUZA 4CVUA 1QFWI 3BJLA 5F7LB 4Y88A 1NCCH 5CZVL 1U8QB 4JDVB 1P1ZA 2VLRE 3RNKA 3ZKXB 2H2SD 4ZD3H 4OLYL 4DQOL 3EYOB 1DBBL 3LPFA 1Z5LA 5IOPA 4PJIA 2UWEB 5DT1H 4FQJL 3V6OA 3EO1B 5BVJA 2BVQA 1N8ZB 4XGZB 2OJZH 4HH9A 3UYRH 1PFCA 2APFA 2AJVL 1KUMA 2CDEA 2DKUA 3DV6B 3H7BA 3K80A 4C83A 2EIZA 1KC5L 4U6VH 1KXVC 3KLAA 4PTTB 4XHJD 4G9FA 1Z0NA 3C08H 1Q94B 4QWWC 1XZ0A 5I1AA 1PZ5A 3MREB 4UV4L 3C5ZC 2C7UA 1AY1L 5I19L 3ZE1E 3WFDH 1F3RB 3THML 1WAAF 3QO0A 4S10A 1ORSA 5ENWB 3EOTH 1U3ZA 1FNEA 1WZMA 5A16B 3L3KA 5L6YL 4TVSa 5ID1B 4KGLA 4D3CL 5JOFB 1TDQA 4ODVH 2YBRB 4XTRD 3QDMB 3I6GB 1D3CA 3V2AR 3AU1B 3GB7B 3RVVD 3UTSD 3PWPD 1BEYH 5I1EH 3WCYA 3ZHKA 3WUWG 3M17A 5MHSD 2XYCA 5EU6D 4KZEH 4EBQL 2QKIB 2AXGB 5ALBL 1DL7L 1U2HA 5DI8B 1TQCB 3RWGB 4Q9QL 5ADPH 1BVZA 2EDQA 3WXVL 1HYSD 1DLFL 4XNUH 2GW5A 4G6JL 3CSYA 1KIRB 3KDMA 4DVRL 3BGMA 2J88H 4LP5A 4BSVB 2DMCA 4DZBB 1MOEA 1KB5H 2D9QB 4NZTH 2B0SL 3LY6A 3WDHA 4GQ9L 5IG7A 4U1IA 4U1LB 4FP8L 3RVUC 3QSKB 5ADOH 5I8EA 1CICC 4P2OC 4PRPB 5D5ME 3ZDXE 4QRSB 4ODBD 4EN3B 1WBZA 3KXFE 4JFDA 3VFTB 1BQSA 2UVEA 1ORQB 5I74C 5JMRA 2O5XL 2QADC 3IDXL 4JGUA 1K8DA 4QTHA 4NUJB 3S8WA 2XWTA 1GC1L 3WIIH 5DMIH 1UWGL 3WFEH 2B4CL 5EOCJ 3UTTE 4AK1A 3NFSH 3FAXA 4NBXB 3DI3B 1OARH 3ULUE 4D9LH 3VG9B 4XPHL 3NZ8B 5ITFA 4NRXA 3T09A 4YBLC 3QXTA 3QJHA 3FQXA 3QHZL 1A2YA 4LP4A 4XVUC 1VGKA 2NCMA 3B5HA 1S7XB 3QFJB 2MKWA 4KK6C 1A14L 5BCAA 3VDCA 1XR9A 4KUZH 3ARQA 5TDOB 3AAZA 1AD9B 4H0IA 2CDFB 1F4YH 1Z9SA 3ZSTA 2ATPB 2HT2D 4UIMB 3K0WA 1T7YA 1RZ8A 1P6AB 3CH1B 4WW2B 4OI8A 3B43A 1OAUL 3QEQE 4GAYA 4YXKL 3BKML 5KS9F 5T5NF 3VFUB 3LQZA 4KJQC 3F7YA 1IEHA 2YD9A 3VXRE 1AR1D 3ABZA 2R69H 1TVHB 4ZOCA 4X4YB 4FABH 3BZ4B 3WUZA 1F6AA 4WTWA 2EH7H 4OIIL 2OZ4A 1R3IH 2VXQH 3MBXL 1BD2B 2QSTA 5FA3A 3Q6GL 4LSTL 1LEKA 2IH3B 3GHEL 2BC4B 1IM3A 1W8OA 3IB4A 3PJSB 3TGXA 2P24B 4X6BB 4HDIA 1I1AC 5ALCH 1U8MB 5F7NC 2FRGP 2PXYC 5H37G 1HQRA 4OZHF 4KKAC 4H25A 3TA3D 2HFGH 1I9EA 4GG6F 1MJ7L 2WWMD 4FNLH 3CJJA 1EFXA 1T1YB 2V9RA 5DJZA 5L8LB 1MEXL 4HUXA 3RJQB 1NEUA 4KV5F 4I3SH 2XTJE 1GZQA 3QWQB 2XTJC 4LLYA 4AEHH 1VKXA 1AGEA 3W39A 4P5MB 1P69B 2HKFL 2ZUXA 4XVTL 5FCUH 1A7NL 2VXSH 2JJSC 3DUUA 5I2IA 4KKCC 2AK1L 3C6SA 1QBBA 2VDNL 1U36A 3B8SA 4OUUB 1YQVL 3EJZC 1AXIB 3HE6D 4UV7L 3RWHB 2PYEB 3U36A 4DEPC 1I3RB 2X42A 2VIRA 4ENEC 3HAEH 3EOAB 3HC3L 2B2XL 4B53A 1MLCB 4AIXA 1T1WA 2BNQB 5TDPA 2VLJE 3FO0H 2BX5A 2D7NA 2KPNA 2VLRB 4L3EB 1Q0YL 4NO0A 3ZE0F 5CEZE 1S3KL 5I9QC 1SYSA 4ZFZA 2ICEA 4G8IA 1AQDB 3K8KA 3WNPA 4CVWA 1GGCL 3X3FL 2VDQL 3QIUC 4Z7QE 2ICWJ 1J10A 4ODUB 4KJPD 4UTAH 4PLOB 1IILE 1MWAL 4G8GA 2FBJH 1LEIA 4JN2A 5ISZA 3BKJH 4PY8I 4ZUSB 1CTNA 2JE8A 5LXGH 2F5AH 5DYOA 5ITBH 2ZSVB 3DWTA 3MV7B 5F9JB 1CN4A 4ONFH 2CIIB 3HC0A 1AHWA 4QHUB 2JELH 2D7QA 1CK0H 1PLGL 3DO7A 35C8L 3ZKMC 5EH1A 3C5ZB 2FX8L 1R0AH 2N7BA 2YXFA 4NNXB 4O2EB 2A6KA 4K55A 4WU7A 3MLXL 3UPRB 2XQBL 1T0MA 4NM4H 1KJ3H 3MV8E 2VDPL 4XX1E 3RWCB 1SJEA 3ULUL 1IZJA 4HGWA 2JIXA 4AEFA 3H9SB 5C0DA 3UCRA 1NDMB 3FQRB 3T3PF 1NAMB 4Y5YA 1E4XH 3BPNC 2C9AA 5TGBB 4FQ1H 4XPTL 1YPZB 1B2WH 1A5FL 2D0HA 3G5VB 3HNSL 2K1MA 2VXUL 2GTWA 4KK9C 1C08A 4D0BA 2GCYB 4IDLA 4MNGB 1UB6B 4GW1B 3WO4B 1NMCC 4LEOA 1Q1JH 3A0OA 1MJ8L 1T6VN 1UM6L 3QAZC 3PWJB 2V2WA 4YHOH 3T2NH 4QT5B 3MRQA 5BS0D 2KL6A 4OCRH 4B41A 4NQDE 5GS2H 3MGOB 1CICB 4TVPH 1WFOA 5D5MB 4HK3J 2WUCH 1A9EB 5J6GA 5F21B 2X4TA 3B83A 5FO7A 5E2VH 2ILLA 3L7FB 1MIEH 3WDIA 1X5AA 3ARGA 3PQYA 3KPNB 5I74B 4A6YB 4PRHE 3VFNB 3IDIB 4HH8A 1YJDH 4MJ6B 3RVWC 4D8PA 3REWA 5KSUA 2JJVA 5JIIA 3WHE0 1FE8H 1A8JH 2OBGA 4ZPVA 1PKQE 1HWGB 4XXDA 3UTTB 2BVPA 1F8TH 4FQPA 5CZKA 2V5TA 2EYTB 4R90H 4OFIA 4JRYB 5HHOB 3MCKB 4PJ9A 3GSXA 3R0NA 3ARWA 4R7NA 1NBZB 1EHLL 5GGSB 2BNRE 3EOYG 1V3JA 5HGBA 1PG7L 3DX9A 1DBKL 2FIRT 1DQDL 2NY7H 3SDAA 4MJ5A 4IBLT 1CGVA 3JTSB 5HDQL 1CE6A 4HJGB 1C5DB 4CVXA 2PCPA 5IT2L 3BD5A 5FM5O 1J9CT 4IOFC 2CH8A 2F74B 1FVDA 2DWDB 1UWEH 1IT9H 1ZHBA 2DRUA 1TCRB 1T03L 4K8RD 2ADFH 4YR6A 4GXVH 3RBGA 5C09A 4NZRL 1OGTB 5E2TH 5HYSG 4HFUL 4JHWH 1NC2A 4XWOC 2IMNA 3VFPA 1A1NA 2AEIT 5D1ZC 3QEQB 1OPGH 4FQ2H 5GS0H 4F7EA 1J86A 3C6LC 3E3QE 1LP9A 3E3QC 3GSRB 3I02A 2A77H 2HFEA 5HD8C 1T0NB 5KSAA 4Y19B 2ICES 4LFHD 1IGTA 5DHXB 5CUSL 3MRIB 5IEHB 5T5NG 4P4KA 2DJ4A 3BWAA 1JZ5A 2HJLA 3LQAC 5ESAA 5JLZA 4KDWA 4V1DE 5DUBA 5T3ZL 1I1AB 5T1DH 2GUOB 5SV4A 2PXYB 1NC4D 1PSKH 4IMLA 5DHVH 3DYMA 4GAGH 4DAGL 4WO4D 5H94A 1BQHB 5EB9A 4GAJH 2AK4B 2HVKA 1MCLA 4X98B 3NTCL 3FOMA 2R1YB 3CVHB 4KDVA 5IB5A 3WNKA 5B8CA 3IDJA 3P0YL 2BHUA 4HEPG 2L4OA 4OLWH 2OP4H 4Z7WE 1QNZH 1EGJL 5IR1A 4ZUWB 3BEVA 1R5WA 3V5KA 5JHDA 4U1SB 5F9AC 3KWWA 1FN4A 1OGAA 1VACB 4L9LC 4NZDA 3LDBB 2FWOB 1X5FA 1CXLA 4ZAKC 1MVFA 1RIVL 2Q8BH 5KOMC 1N59A 4WFFE 4KRNA 3W82A 1CTOA 1QZ1A 5IB3A 5CD5C 4K94H 4J3UA 5IVZA 5FB8A 4C4KO 3LKRA 4ZFGH 4MZ2A 4NDMB 1WCBA 2HTKC 5DO2C 2EO9A 4M93C 3MACL 2D31B 1XGTB 1J05A 3X11B 1E0OB 3MRBB 4PRDA 5EIQA 3NABL 2VLJB 1IGJA 4M7KL 5KVFL 2CLVB 4LNVA 4XPGL 4ELME 1AKJB 3BP7A 3FOLA 1AXSB 1JYWA 2OQJA 3PL6D 5DSCA 3PP3H 4AJ0A 5I9QB 2V17H 4U3HA 1JGUL 4M1DL 4HF5L 1MHEA 3KPSE 4ELKB 4RCAA 4ZFOA 4LQFH 1QKZH 4DKDC 3CC5B 3QIUB 4QRTA 1PJ9A 1J7VR 4IIQA 2YD8A 1PVHA 1H3PH 1KB5A 5FGRA 4CNIA 3HZKA 4WUUD 2EDDA 3TH2T 3PWLA 5KJRH 1EVUA 4YDKH 4D9QE 1IL1B 4MCZB 4QF1B 3RY6C 1KGCE 1XCQB 4X0KB 5JW4R 4PRBA 1H15B 2VN4A 3PWNB 1G9EA 43C9A 2EEAA 5I8KH 5E56A 3TIDB 4K07A 3P4OB 1VPOL 3QDHA 3LEVH 4X9HA 4XCEA 1CVSC 4OCYH 1S9YB 1UJ3C 5B39G 2DKSA 1T2QL 2QHLA 5FK9A 3QIWA 5CZXD 5F88B 1IQDA 1N5AA 3L3JB 5BVPH 3KYOB 2F53A 2ZOLA 3GGWA 4I2XB 1MJJB 2BY1A 5HJ3A 3STZA 1BWMA 3U7WL 4YK4C 3IGAA 2WBJB 2YSSB 4MGXA 5FO8B 5DWUH 2OR8A 2R0ZH 1FRGL 3U46A 3HZVB 1GH7A 5D4QA 3U1SH 3ESVF 4GUPA 1N0LA 3O11B 3QAZB 4XMKL 3H3BC 2IGFL 4WW2F 5DJDA 3SDCA 1ZLUK 1XGQA 1S9WA 3SBWC 2VDOH 4WI7A 4AENB 3GSNB 4GKSA 5SWQA 3V8OA 4L4TA 4R96B 1VFBB 2HN7B 5F6HJ 4EI6A 1P84K 2X89A 4KI5D 4F9LC 4BFGA 1IAIL 5AYQA 1UM4L 4WFHD 1U8JB 3LQAL 3Q5OA 4PRHB 2IADB 3I9GL 3V4VL 1IC7H 4J1UB 3MLZL 4Z7UA 4G9FD 1F11A 3T0DA 3TYGL 1MY7A 3G5ZB 4M7LH 1DE4B 1DVFC 4HKXA 3JUYA 5KN5A 2AJYL 5ICZA 3ROOA 2R23B 1ZMYA 3MLUL 4JO3L 5E8PA 4H0GA 1FV1B 2ADIB 2BNRB 3PGDA 5E0QA 4BFIA 5D93C 1MPAH 3HZMA 3RUGE 2ZG3A 5GRJH 2WNGA 3MXVL 1MCRA 1BREA 2C5DC 5EO1B 1NCDL 3U0PB 3WN5B 4NQUA 1MIMH 3SDDC 1X4YA 3U0TB 3HR5A 3VI4F 1BJ8A 2WAHA 3BW9B 3HI5L 3O6FC 3V4PH 4CU7A 2J5LC 2BMKB 3VWKD 4LHUG 3C6LB 3O0RL 1YN6A 5E2WL 2EDWA 2NMSA 1A3QA 1F5WA 2X4OA 5HHPB 1QUNA 2NY2C 5IBTH 5DHYB 3HAEA 4LSUH 5DK2B 3NCJH 4HIHB 1HKFA 2BNUA 3V6ZB 4JFDD 5FKAA 1JPST 4CW1A 5CJOH 1LNUA 4WHTA 4GSDL 4EDXA 2A0LC 1OD7A 4V1DB 4J23A 1SYVB 4N9GB 4NKDB 5CP3H 2GJ6A 3F7VA 3PWPB 3WLWC 3PHQB 2R9HC 5IV2B 3KNBB 3TVMB 2GSGA 4JFPA 1U8OA 4JDZA 3VXMA 4MNHA 3L3OA 3H3PL 4Z7WB 1Q0XL 5TPWH 4LASL 1YECH 3KPPA 4KTEH 4N9OB 3H8NA 5BZDB 4JFZH 4LPWA 4WJ5A 2RJMA 3QYCA 3CZFA 2HJKA 4FMFA 4U7KA 2W91A 3H0TA 2ZJSH 1NLDH 3MLSL 5HHMD 1MUJB 3DSNA 4L9LB 4JPKH 1FNSH 3HUJB 4FFZL 4UINH 2X4SB 1FORL 4JPWL 3ZE1F 5HDLA 5DD3H 4ZAKB 4MDJA 2EIEA 4DUXA 1WZ1H 2W9DH 5I75C 5B4MD 5E4IA 1RULL 2VXVL 2J8OA 1I9IL 1YNTB 3TYFA 4L4JA 1T80A 3LAFA 3FFDA 5M95B 1MFAH 1WITA 5F3HA 5EUOA 4B7LA 5D6CA 5CMAA 5J3HD 1T89C 3MCG1 3OKNB 5DQJB 5A2JH 4JKPL 2GK2A 1JNLL 4MNQE 3SQOH 3VI3E 4Z6AT 3LH2H 2BK8A 2EE6A 1Z9OA 4HIJA 3GUTA 5C70A 3WE6A 2MCPH 2BHYA 3P4MB 3BT2L 3D48R 5F9OL 4FFVC 2RB8A 1D9KA 1KG0B 3C60A 1EK3A 2YK1H 3GIVB 4PB9H 2NX5A 3ZSSA 4WWKD 4NZUL 1SM3L 2JCCB 4XZUB 1HEZA 4U1NA 3DV4B 1PGRB 2Z4QA 4CJ0A 3HLAA 1K6QH 4M9OA 1EFXD 3ZDXF 1CGSH 3HS0B 1YEDB 5F7HA 1ZKAA 2OMBA 3GJFB 4ZUUB 3KPQA 5ETUB 5GRUH 1N5YL 2KQNA 4YDLC 2R2BB 4M4RA 4M5YH 3GKWH 2R4SH 3M1BB 3SE4C 4PGBA 1UM5L 3WFCL 3UJJL 5HI3C 1NEZA 3KLHC 4NGHH 2DLHA 1KTRL 4NOFA 1UJ3B 2RFXA 3ULUF 3N9GH 1ACYL 3AROA 4LDEB 1UXSB 2FL5B 3DGGA 3T3ME 2AJUH 4XCCH 4NN6C 1AGFB 1GGIL 1YY9C 4QHKJ 2B1HH 4IRSA 3RL1A 1IAII 1WFTA 5DD6B 5ANME 1FG2A 1UJTA 1OTSD 1I7RB 3BYTA 1IKFH 5E70A 4YK4B 1QBML 3TA3B 3S5LA 4OV5B 3LKQA 5AYUH 5D7IA 1MRFL 1CL7L 2EDNA 3O3AB 3SJVE 3GJFK 4HLZG 3NFPB 4W4NA 1MFBH 1FNLA 1NFDB 2HAZA 1G7JB 4MAUL 3S88H 3BFOA 1RZKC 1CLOH 5T1KD 2QSCL 1P6FA 3KPRA 4M6NL 1ONQB 1P7KB 4YC2C 4RIRB 2EYRB 1KTLA 4KKNA 4YUEL 4GBXA 4R26L 1H3TA 2J2ZA 4QRRB 1CD1B 4PBVC 4JO4H 4Y16A 5KVDL 4NKMA 4OCNC 5D7KE 3LKSB 3UC0L 4AH2B 5KW9L 1FBIL 3NPSC 4NYLA 5ISZD 2X9WA 2ORBH 4HT1L 2CMRL 1XGUB 1B0RA 4Q6IC 2J4WH 3UTPE 1JVKA 3DX6A 2RBLA 3MYJB 3CPLB 4ONHB 2C3XA 3BO8A 3MRRA 4HZLA 3SDXA 1DVFB 1INEL 4BQCA 1CBVL 3LEYH 1CD8A 5E8NA 5EOTA 4CDHA 3L5HA 2YA0A 5T33L 3ZYJA 1ZEAH 4XCYB 4ZPTB 2H26A 5DUPH 1MH5A 4ODSL 4YQXL 5FUOH 2JIXD 4Z5RA 1BQLH 4Y1AE 1EA9C 3NCFB 5J8OA 5DD1H 3RUGB 3TIEA 2XPGB 2E27L 2NW3B 3ARDC 3MUGB 4JKMA 5HTSA 5IHBA 2F54E 3FCTA 3AY4A 4WFED 4Y5XA 1UFUA 1CT8A 1QLEL 4JFHE 3W81A 3ZYIA 5D7LA 1ZHKB 1EAPB 1ES0A 3FTGB 3O6FB 3R1GL 3MJ8A 3RWFA 1EUTA 4ZUVB 3TBYB 4GJTB 4TUKH 3TLRA 4N0UE 2CUHA 4UOW1 3PABB 4P23A 4X6CE 5JUEL 4MA7H 1LO4H 2P44B 3QWOA 1CU4L 1KIPA 4PFEA 4QRPB 3F5WB 2WINA 4OKVA 2P5ED 2FHFA 5E24E 1HHKB 4R3SB 4HV8A 4KRMB 3CFCH 3KYKL 1S9VB 5IHZA 4NFBA 4M5ZL 3ARGD 4ZXBC 5JHLH 3PQYD 2EECA 3T2PA 3BPLB 3NCYP 5IM7B 5HDBE 1CZ8H 1CFTA 2VR5A 5FA4A 4P9ML 1ZGLP 3KVQA 1ZGLB 1MELA 4IDJL 5JZ7C 5BXFB 1TTFA 2HG5B 1OLZA 1QFWM 1NCBL 1N4XL 1VB9A 2VAAB 4J8RA 1ZA3A 3GSQA 1I7ZA 3ILQC 4RRPG 2CK0L 3RGVA 5CJXA 4NKOA 2ZCKH 1SBSL 1PX4A 4GRLC 1GXEA 5FYLD 2UYLA 3GMNB 3R06A 3PGFH 1OP9A 3O8XC 3IXTA 2EKSB 1T21B 5FYKU 4J3OC 2XICA 5HHXH 4RWYL 4N8CH 1CDGA 1AGBB 4LSPL 4FFYH 3SN6N 4QCIA 5I30H 4QNPE 4X4ME 1Q9WA 5DZNA 3M45A 4PGDB 3VA2C 4XH2A 3LKOB 5INDB 1QHOA 1G7LB 3L5WA 4YHKL 2E7CA 1JGLH 4Z8FH 1QSEE 3QHFL 4I77L 2R15A 3O45B 4TSCH 4FTVE 1EFQA 4Z9KB 5T5FL 2CLZA 3O4OB 4JQIH 3S97C 5C0IB 1Q72L 1NC2D 5D6DC 1ZLSL 3IJYA 4DJMA 1FPTH 1HI6B 2EYSA 4XPAL 3MLRL 4P46B 3WJLA 4PJCA 5I1KH 2Y36L 5IJVA 2GAZB 5DUML 1S7QB 4MNQB 5KSAD 3TJHC 1HINH 5GHWH 3MO1A 2OYPA 3RJDA 4UQ2A 4MD4A 4S1SH 4H1LG 4BUGA 1UXWB 2P47B 1IEAB 4MLSA 4P4KD 3V52L 2DYPA 1QSZA 1V7MH 4JANA 3NCMA 2H32H 4OGZA 1ZVSA 3GRWH 4LCWE 4TRPL 2DI9A 3Q3GB 1QRNA 2AEPL 1U8KA 4QYOB 4EXPX 3D69B 2E7HA 1IGIH 4PREA 1CDUA 4N0CD 1CL7I 3FL7A 5C6TH 4HK0B 4ONGL 2CJUL 4LCCA 4DCQA 4YBQD 3MOAL 3G6JE 3LSOB 3QPXL 4YDJA 5C0RH 2PETA 3VD4A 5F72S 1IKNC 5FGCE 2VDKL 1KTDA 5JHDD 4G6MH 4KVCH 1GCFA 5HGGS 2ZPKH 4M62L 3K4AA 4J6RH 2OXGA 2Q86A 3PWVA 1FDLH 4RGND 1MREL 1A3LH 2D9CA 4BELD 5DS8A 2D7TL 1KJ2L 1AFVH 1RD6A 1U92A 3EJJX 3BH8B 1IMHC 5CZVH 3QXAB 3LN4B 3OMZA 5KOVC 1S7SB 1N3NB 5LWYH 1GHFH 4NN6B 4DQOH 3QRGH 3QUZA 2OJEB 1DBBH 1F3DH 2JB6A 1XIWD 4RZCB 3OXRA 1XGPB 3NGBC 4IMKA 2PW1B 4WHYG 1O7VA 5K93A 3EYUH 4R97C 4LU5H 3K3QA 3P11L 5IKCB 3UJIL 2O61B 4ZOAA 1NGQH 1OAZL 5IB2A 3SJVB 2A83A 4E0RB 1GRWA 2G60L 4TNVK 2XG4A 2X70B 1KEGL 4FZ8L 5F44A 1A6PA 1FZJB 2IBBA 4YC2B 3VJ6B 5CJ5A 5HVHB 3EDEA 4PBXA 4OF3A 5BJTB 5J11B 3P0VH 4UV4H 5F7UA 2FIKA 4JHAL 4PRAB 2UZIL 4LVOC 4QY8B 4DOHB 3VXUA 3V6FA 2VL4A 4X6FB 1Q9KA 3NPSB 4HMCA 1UCBH 1GOFA 1II4E 3CDCA 2HKHH 3DX8B 3RZCC 1C7SA 1WT5A 4HLJA 4E42B 2CRIA 4CN4A 3JV6A 2CIKA 3CGTA 4HLZH 1I75A 1J8HA 3N0PB 5H2BA 2ZUQB 2NYYD 5IWLC 4ZTPL 4U31A 4CADA 3BDYL 3LRSA 4AYFA 4KQ3H 3DXAD 1F58H 4DZ8B 5CP3A 4EBQH 1I3VA 2VO5A 3MNVA 1F02I 2ARWA 1DL7H 2DTSA 4QGYA 1U95B 2E7MA 1GVIA 1BQHG 2Z92A 5EFIB 3QIWD 2YRZA 1T20A 5TE4H 1HCFX 4F3FA 5A3ID 1X5YA 3U48A 4EI5A 2F53D 1T7WA 1QQDB 5CD3B 3ARDB 2YD6A 3P0GB 2F54B 3K8LA 3LHPH 4GLRI 4FS0A 3W0WA 4C57C 4FP8H 4XNZC 4NC1E 1HHGB 4NC1C 2VOTA 1HXYB 3GJEB 3QG7L 1HKLL 1WBYA 1JFQL 1QYGL 3UDWA 1HOCB 4LSVH 3VD7A 2CKNA 2O5XH 1FFPA 3MNZB 3T0EB 4N0UB 2VRAA 3CMOL 1TJHL 3IDXH 3DTXA 1DUZA 1GC1H 2MCG1 4I4WA 3KLSA 2LU7A 3CX5J 3PP4L 4PJBA 1UWGH 1KCVH 3P9MB 3ZZ1A 1YMME 1J0YA 4ELMF 2QHRL 3F8UB 3FRUB 2Z31A 2R0KL 1FNGB 2DB8A 2J8UE 3DETC 4HBCH 2BVUA 5ID0A 5GRYA 2D0FA 5D2LE 2JK5B 3CFBB 3CH8A 5CHNA 4TUJA 1HDMB 1TNMA 4WEBL 1A14H 5F6IC 3L6FA 1XF3B 4WGVB 2BZDA 1U2CA 3REVB 3KJ6H 5MEOB 3OKKA 4KUCD 5DEGA 1BJ1H 1DQML 3IJHA 4XCNA 3IFOB 3O4LA 1CDIA 4GRLB 5FM4A 3C8KA 1LO2H 1UADC 1MQ8A 3MTRA 1S8DB 1OAUH 1X4ZA 3DRQA 3BKMH 3D85B 3QO1A 5DRNA 1U8LB 4I0PC 3IFLL 4Y2DC 4P48A 5KTEL 2WW8A 5JW5A 2QQKL 1T4KB 2EXYD 4FTVB 4YHIA 3IDNA 4OIIH 1RZGA 3MBXH 5DJAA 4LSTH 2FD6H 3QZWB 3GHEH 3D3VA 5AUMA 1MAML 3TWCL 4NUGH 5DRZA 4OI7A 2BFVL 4XX1G 1IBGL 3V0WH 2P8MB 4K3DL 3DVIA 5C0GA 3CXHK 3N85H 2VLLB 5GISH 4D0DB 1S7UB 4U05A 1AC6A 3VFGH 5FFLA 2MHAB 1K2DB 3BZFB 3QR2A 1MEXH 3MSPA 4K23H 5E2JA 5E6IA 1NMAH 3B6SA 1RIHL 1JPTH 4RGOL 1OF2B 1ZXQA 3VXNB 4HKBB 5I1JL 5C0CB 3T4YA 4QOKA 3V6BR 1IFHL 4HWEH 4G42A 5AEAA 2GJ6D 4RGMC 4OCSL 4DGVL 2CDGB 3U7YL 1IAOA 5F1SA 5EA0H 3MGTB 5B39A 2ENSA 3MOBL 3I50L 1JF6A 2AK1H 1A0QH 4YIQA 3HE7C 1TJGH 1YQVH 3DSFH 3QQ3A 4UV7H 1H8OA 1YEIL 3EDFA 3MR9B 4NN7C 5KSBA 3VRJB 1LE5B 1FIEA 4M7JL 4P5TA 3DJ9A 3INUL 3LV3B 4MB5A 4X80L 5MP6L 3OKEA 5F1IA 2YPLE 5I8OL 1QFHA 1YEJL 5IMLA 2Q76A 4KHTL 4ZS7L 3RL2B 1HIMH 3TO4C 4PY8J 3NH7L 5BW7C 2NNAB 3OTTA 3N1FC 4NNYB 3EZ8A 5F1NB 3ARTA 4MVBD 5I1HH 3CIQA 2AABL 1RUQL 2R2EB 3RUGF 1GGCH 5E9DE 5ACLA 2WWKO 4Y4KC 2XQYK 1FO0B 4UT9H 2NXZC 2ARJQ 1FYTB 2A9ML 4G80A 4GRWE 1MWAH 5IBUG 3BXNB 4BUHA 3VFWB 1PQZA 4NWUH 4GKZB 4XBGA 5D71L 1U0QA 4A6YH 1D7FA 1G7IA 3RVTD 4OCXL 4YPJA 4RA3A 4LVEA 2NX5D 1RMFH 5HHMB 1RZ7L 2FDBP 5SX5K 5J9PB 4LVOB 5DA0B 3QUKB 3MLXH 1Y6MR 2CO7B 3T0VA 1EDQA 3QDJD 2DJSA 2C3HA 5D7JA 5AD0A 4WHYH 1P7QB 3VG0L 5GS2D 4YLQT 1CIDA 2P4AB 4GMTL 3GM8A 3E8UL 1EBAA 4TVPD 4MJIA 1ITCA 3NFNB 4HWBL 4JR9L 1W0VB 4W6XB 1U9KA 5JA9A 3QPQD 3WFBL 3C5JA 4FQCL 2IALB 3HNVL 2VQ1A 1A5FH 2Z35B 1VA9A 2ZKHH 3KR3H 3RWDB 5KBNC 2Z91A 1HHJB 1OTTD 2IANE 5FF6B 5C0AA 2V5MA 4M1CD 3BIBX 1I3GL 1UQSA 5C2UB 3AVEA 3OF6A 3MMEB 2JKXA 4RMSA 4JRXB 2Q8AH 4LHUA 1MJ8H 1YDPA 5LAXA 4QHMA 4NSKB 4TTDD 1XGYL 1XGRA 3Q5TA 3NA9L 4WWKB 1N26A 5ACMA 3V7AE 4OM0H 4MD5B 4Z7VE 3H9HB 1A6AB 2BOBA 4XNZB 3QI9B 4GW5A 3WJJA 3MBED 3D18B 4ERSL 1YN7A 5EO0A 3T65A 1QO3B 4C56A 5B3JF 3UX9B 1JWMB 4FXGB 2E7LC 4YHZH 4HAFA 1U8QA 4JDVA 2H2SC 3KPRD 1A7QL 1Y0LB 1CXHA 3EYOA 4Q9RH 3WO3B 2FO4B 4GBXD 3VI3F 5DJCB 2MOVA 1I8LA 2ZOKB 2UWEA 3BP4B 3BQUD 4Q58C 2VSDA 4XP4L 5GS0D 3EO1A 1QD0A 5IESL 1BBDL 4D9RD 2Z93B 1D5IH 3CVHH 4LDOB 4XGZA 2YD1A 3JWOC 3ORJA 1GPOL 2AVGA 1JWUB 2J8UB 4ZTOL 1CD0A 1CR9H 1PG7H 2VZSA 3DV6A 4KVNL 4N5ED 1I8MB 1RUMH 1NJ9B 1P4IL 4PTTA 2R56L 3FZUC 3AMKA 5F6IB 1QOKA 4MSWB 1Q94A 4W4OC 5DLML 4KRPD 3MREA 1QFOA 4NZRH 3AXLB 1KYOK 4TNVF 3LZFH 3R4DA 5HHNA 5TH2A 4NWTL 5ENWA 3DRTB 3FQNB 4I0CC 1BMGA 5A16A 4UU9B 1XCTB 3CAFA 5ID1A 5JOFA 3QDMA 3UTSE 2G9HA 2BY3A 3I6GA 5TQ0H 2XA8L 3VXTB 3FN9A 4JKKA 3UZVB 4D94A 1N7ML 3GB7A 5BZWB 4XCFH 5D7LD 5J0BA 3T3MF 5CEZH 2APBA 1ZK9A 2QKIA 1JZ3A 3I6LE 2AXGA 4PD4J 3SE9H 1IC4L 2W9EL 4XAKE 5CILL 1IAKB 4DFHA 3MRMB 3CSGA 4P23D 2AERT 3DVFA 2AV7B 4HIXL 2OR7A 1KIRA 5FO9B 4BSVA 4DZBA 4XC3L 3RPIB 3NTCH 3SKMB 5IBLD 4OZGE 3WXWH 3U2SB 4MAYD 3VFOB 3AS2A 4U1LA 5K9JL 3P0YH 3GM0A 3TEUA 2NY0D 1EGJH 3TBWB 4YEFA 1LDPL 3OZ9L 4H88L 4QRSA 4PIRF 4EN3A 4DW2L 5EZIH 2YC1B 4L4VD 2OXHA 3VFTA 1UA6H 1MSPA 4Y7MA 1ZLUH 3MC0A 4EIZC 1J0ZA 1ORQA 4MD0B 4NUJA 2E8YA 4XP6L 2FZ3B 1P7HL 3RQ3A 4J4PA 1RIVH 4X6DB 1FFNB 4KXZH 3ZTNL 1A6VL 4UT6H 5DXWA 4F8QA 5LGHL 2V5SA 3G6AB 4KROC 1NUDA 2X5PA 4OQ1A 3A67L 5DJ2B 3NZ8A 3G5YB 3MLVH 4PGEB 1ACZA 2HT3C 4QRUB 1EBPA 3TO4B 1C1EL 4QHLB 5JNYB 3NABH 5EO9B 4M7KH 4RFNC 2P5EB 3JVGC 3IAQA 1S7XA 3B5TA 3QFJA 3BPCB 3RWJB 1H9VA 3ZKND 2HT4C 3PUCA 4B7IA 1AD9A 3SE8H 2CDFA 1FZKB 2I25N 5JOEA 4NO3B 4M1DH 4HF5H 4M8QB 1Q9OB 2WSKA 4CMHC 2ATPA 1G9MC 2MKLC 2B8OT 3ZL4L 2B5IC 4UIMA 1V7NL 4LARL 1LO3L 2YKLL 3GSNH 3CH1A 4ODXB 2G5BB 4WW2A 4PJHB 4G8FB 1U42A 3ETBF 1UGNA 4LIQE 3VFUA 1HSBB 2H8PB 4Z18A 4XI5D 1VEOA 2GI7A 2AJ3B 1TVHA 3QEUB 1U91B 5GGQL 1S7RB 2NY6D 3BZ4A 2DYPD 4X4YA 2AXFB 4PP1D 1KXTB 5F89B 2DS4A 1BD2A 3M07A 3QG6A 4X6CF 4KGJA 2BC4A 2AJZB 1QRND 1S9XB 3NIFF 1JF5A 2BSTA 2P24A 4URTB 3KPLB 4YHLH 3LEXB 1U8MA 1VPOH 4HWZB 5HGAA 2E9JA 4TOYH 3QCUL 4ORGB 3LD8B 4YEEA 1MCOL 3JWOL 2XN9E 2CKBL 1EZVX 4FHBD 1T1YA 1VGEL 1CQYA 5HDBF 3RY5A 2XA3A 3T0WA 2GY5A 5B38B 4M48H 3NZHL 4FOMA 5T1MB 3QEHB 4EDWH 3GBNH 5D1XC 3K8MA 3T4AB 4IRZH 3U7WH 4APQD 3IS0X 2EKJA 5IGXH 4JQVC 1WCQA 5IVXB 5DD0L 1FRGH 4P5MA 3D2UD 4FRWA 5GGVH 5C0BB 3VGDA 2V5YA 2AXHA 4ZMAT 1J88A 3QUZD 2HMIC 1TVDA 2CR3A 2DQHL 1YNLH 3P30L 1R3HB 5MENA 3UBXI 3AS3A 5FXCH 3HE6C 3TJEL 1MNUL 4QNPF 2MMXA 4OUUA 3RWHA 2NY4C 1UH3A 2N1KA 3JBG7