1M1SA

Structure of wr4, a c.elegans msp family member
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
109
structure length
109
Chain Sequence
HSMINVDPPTGNYPATGGNSTHNITSESDSRLAFKVKSSNNEHYRVRPVYGFVDAKGKSKLDINRLPGPPKEDKIVIQYAEVPAEETDPMAPFKAGAQQGEIIVKLIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a C.elegans MSP family member
rcsb
source organism Caenorhabditis elegans
molecule tags Structural genomics, unknown function
molecule keywords WR4
total genus 19
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2002-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00635 Motile_Sperm MSP (Major sperm protein) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1m1sA00
4PTTB 2ZKHH 5C0ND 5F9OH 5JUEL 5SWSA 2AXJA 4LKCB 5IUSA 2IC2A 3DVNA 1NUNB 2DQTL 5GZOD 2Z35A 1UVQA 4RQQA 5L2KB 5SWZA 4GW5A 4MAYD 3LMJH 1OTSD 1R5VB 3WCYA 2E7BA 2X6MA 1AXSB 3HLAB 4G80A 5GHWH 3R0MA 5FM5O 4OLVH 3HI1A 4G8GD 1BD2D 4Y16D 5FYLE 4DOHB 1AE6H 5F3BB 2UY7A 3BQUC 5E9DA 3E8UH 3ES6A 3QUYB 1W72A 4AEIL 5JDJA 3TO4A 3GUTB 4Z0BL 2NW2B 1RJYB 3PHQB 4MJ6B 2OK0H 1N8ZA 3MNVA 4PJ5D 5IK3B 2AK4E 5ALBL 4APQC 3DI3B 2IF7A 4KKBD 4Z18A 1D5IL 1JPSH 3EYUL 1OQOA 1LEKB 1OP5K 2EH8H 2R39A 3VA6A 3MRIA 5CJQL 3SO3B 3QUZC 3GO1H 1A14L 3RVXD 3FO0H 2WBJB 4I3SH 4WFHD 1KB9J 4ZMAT 5J89A 5FF6A 4ODXA 1V3MA 4N8VA 4MB3A 3FRUA 4QXGL 5C3TA 4JANB 4HLZG 1CFBA 2B20A 1RY7B 1A3QA 1G7JA 3S4SA 4YHLH 3DXAE 3IDIA 1GAFL 1PW3A 1GJIA 3WLBB 2GCYA 1V7MH 3QHTC 3S4SG 1V7ML 5F7YC 4M6ML 2DIBA 2P42B 4JPWH 4YUEL 3RX7A 4QHMA 3P0VH 2VDQH 4E42A 1BM3L 2NZIA 3VI3E 1ZWIB 2XKUA 1NMCB 4JO3H 3LPWA 4NM8L 4PJXF 4H88H 3MZTA 1EMTL 1BPVA 3NCYS 1FE8L 5IK3A 1DQLL 4YFEA 1FDLL 1EHXA 4HCRA 4AH2B 2H32A 3L7FA 3MREA 1N5YL 1E28B 3WO4B 1U8MB 3BESR 3VWJB 4GAJL 4V2CB 4LNRB 5HSFA 1A7PL 2P7TB 2QQKH 3BISA 1SJVA 4PJCE 1RK1B 4JREC 3W82A 3S35L 3LRSA 2AEIT 3ILPB 4G8GE 3MLRL 5EUKB 2Y7QA 3EYQD 4PREB 4MYWB 1S7UA 4OZHA 2EDLA 3BT2H 2HTKC 4ZO8A 5F9WB 5C9JB 3MRJA 3ILQD 2BOCA 4OM1L 3W9DA 4K7PX 3SHSA 3BKJL 3MLXH 3INUH 1KLFA 3WFDL 3WFDH 4XCNA 5AYUH 1D6VL 4L5FL 4LLVB 4M61B 1QEWB 3TYGL 3DX9B 5JTWA 1U8KA 3I02A 1FGVL 4R2GD 4KJQC 3DX8B 4OLXL 2AERT 4ZAKA 4LCWA 5ILTL 3U4BL 3WE6B 4C4KO 4U6YB 3PQYB 3HPJB 2FH6A 2VLKE 4ORGA 2FX8H 1QP1A 3OR6B 3UEZA 2BSTA 5MERA 4X9HA 1EFXD 1CK0L 5EC2A 4JFDB 4O02H 1CLZH 3UAJD 4YDKH 4HBCL 5HPMB 2WLYA 3ZT7A 3GJFH 3BKCL 1AKJA 2BRQA 4PB9L 4CGTA 1S9KC 2AJZA 3DBXA 4XVJL 1C5BL 2GTWA 2QQLH 3ABZA 3NZ8A 4QYOB 5E94B 4D9LL 2BNRA 3PWNB 5JOEA 1QHPA 4WI4A 1AR1C 2VISA 1BOYA 1NANI 3MV01 3HZKB 4JM2A 4YDLB 2RHEA 3EO9L 3SE8H 4Z95H 1F3RB 2VN7A 3C9NB 4J1UB 4JKWA 4KY1L 3LKPA 4POZD 3UX9B 4QRPE 3HZKA 4ZFOL 1MCKA 3O11B 1SYSB 1U95A 4GUPA 2VAAB 4ZNEA 1P84J 5MP6H 4G9DA 3Q5YA 4UNVA 1MFNA 3O6FD 4JQVC 3S8WA 2PXYB 5DHVB 4CN4A 1NCCH 3OAUH 5A40E 5HYJD 2YXMA 4Y1AB 1QNZL 4N0YH 5DK2A 3SKMA 3X13A 4U1GB 3TFKD 3JWOH 4NJ9L 4JFEB 5C0GA 1MCSA 3T1FB 2E7MA 1CCZA 5J7CC 3S3JA 1OTTD 3PQYA 3HRPA 3A67H 2YD9A 3DROB 5JXEC 1XCTB 1Z5LA 3CFDB 3WUWB 5GIRB 5DC4B 4JFDA 4WI2A 3RL1B 4Y4FD 3MGTB 4X98A 4KDVA 1FQ9C 4KUCD 4RCAA 4LSVL 4PBVC 2H1PH 1P5VA 4LIQL 3B2VH 2J7LA 3MC0A 4PJGF 3LQMA 1J0IA 3LB6C 4NM4L 1AP2B 4DAGL 5HVHB 3S98A 2MKLC 1OHQA 2Q87A 2QQNL 3REWB 5CCKH 3QCUL 3E8UL 4HUUA 5FO7B 5HYIA 5C0NC 1NFDB 3CDGB 4UQ3B 3C09B 4NNYA 12E8H 4GW1B 2H2SD 4FQLL 1M7DA 2EC9U 4IS6B 1WSST 3D85D 1SM3L 3D9AL 5EO0B 4EUPB 3RY4A 3F7VB 3OF6D 1I1FB 5DI8A 4LASL 3VFUB 2L7UA 1BWMA 4WW2A 2VERN 2XXMB 5CEXB 4GRLC 5E5MB 1F4YH 4MWFB 4M43L 1FRGH 2YD7A 2DI7A 3JV0A 5F72S 3FFCE 4PS4H 1TZGL 2JCCA 3PDGA 3L3OA 2VNCA 3EFDH 4RFOL 3MLWH 5IWLC 3SE4C 3ZTJH 2ZSVB 1HSAB 5F70A 1B4JL 1U8IB 3QEHA 4DKEH 3G6AB 2EXWD 1EGJA 5D1XC 5DZOA 4L1DA 1UENA 2IH1A 1FG2B 3TBSA 4CMHB 1KT2B 4OD1L 4X6EA 3WKML 3RGVB 4LGRB 3N06B 2BHYA 3ZYOA 5H94B 4DQOH 2CR3A 4HZLB 4OZIF 1H3WM 4GW4A 1E27B 2R15A 4HXBL 3BQUA 3GKWL 1BBDH 5I66B 3O2WL 1GC1H 5IB3A 3MGOB 5ANMB 3VG0L 3FQXB 3LEXB 4HMEA 1D9KD 1KOAA 1KIPB 1XCTA 3V95A 1NFIA 3RY5A 5CEXA 2X9YA 2CMRH 4PJAB 3CZFB 4G6ML 1HHGB 4Y88A 1YEEH 4N90E 3O6KH 4MDJA 1LK3L 1X5GA 2E6QA 2GFBB 3GSRA 4R7NA 3LN5B 2Z31B 1AP2A 4V2BA 4ODSL 1X3DA 4R2GB 4XNMB 1VADB 4MAYA 1IZJA 2EDQA 3WL9B 1MVUB 3W0WB 2DQHH 1CFTA 4Y0GA 2VB5A 1QSEA 4HMDA 4NOFA 4MA1B 3L6FA 3T2OA 2OJZH 2VDLH 4P9HH 3ZDZF 4N8VB 1WWWX 1KB9K 5GRVL 4XBGA 3SOBL 3KPRE 1T89C 2DN7A 1HK6A 4M7KH 1CICB 4FQQB 3WO3B 1UEMA 3QDGA 5DK0B 3SBWC 1ZKAA 5E4IA 4JHZA 2Z4QA 1JTPA 1NCCL 3OAUL 4GQPH 4QKXB 4K3DH 5IBUG 2OTWA 3M1BB 4ZPTB 2EIZA 2E9JA 4P3DA 3MBXH 1KELH 5J8OA 4A2MA 2ICWI 4XPBH 1HILB 3UYOD 2P8PA 2MFNA 3LIZL 1P7QA 1NQBA 3TCLB 4TVSa 1F11A 2ZOKA 2FO4A 3C6LC 2IMMA 1I3GH 4MMXC 3AM8A 3RWHA 2F19H 1I85C 3QIUC 5DUML 3WHE1 3O3AB 4FQJL 5DJ8B 2OXGA 4CU6A 2R23B 3SQBA 5K9QG 3T0EC 1CD1A 1KT2A 4NN5B 2R0KH 1HDMA 2VDOL 4LEOA 4S2SB 4G9FA 4S1SL 1MFDH 4MXWH 3LOWA 4M1CD 1XCQA 4K2UH 4XBEL 4PJXE 1HHKA 5IFJA 4KJWD 2NY5C 1G7MB 4FQXA 1MQKH 3DVNB 3I9GH 5DJDB 3VGDA 1IKFH 3ECBA 1C08A 1GOGA 3V4UH 4V1DD 3IRZA 4HQQH 3LD8C 5EIIB 3B9EA 2Y36H 3GM8A 1ITCA 4KKAD 3OKLB 4YXKL 4G5ZH 2Z0BA 1MLBB 3GSNB 5KG9B 5T33L 2CXGA 1NC4D 1UC6A 3QIBD 3LDBB 1F4YL 5GGSA 5C6PB 3VXUA 5D2LA 3K8KA 4FFZL 3GSQA 5FYJD 4B53A 3P77B 2JK5B 3BKMH 3RU8H 3W5MA 1UH2A 1KIRB 3QEQE 4KVNH 5TGBA 4QRUA 2J5LB 1PD6A 4ZSOE 1FFPA 1EJOH 3SJVD 4X7DC 4I4WA 5LGJA 4OCSH 3IDYB 5ADOH 3KPMB 5EU5A 2DI8A 4MCYB 3BFOA 1H3PL 4ZS6C 4EDXA 4JZJA 4Z7QF 4GBXD 4YFDB 2DWDA 2MCPL 4G8GB 1JCKA 5MEPB 4JJHA 5LQBL 1Y6KR 5C3LD 4HX1A 4F7TA 3S35H 2CDFB 4PJDE 5IVXE 2AV7B 1AGCB 3CXDL 3DIFA 3EOYG 4LF3B 3MRHA 3RDTD 1R3LA 4PJ5B 3H9YA 5HDLA 3JXAA 3DV4B 3FFCB 1ONQB 3QNXA 3V0AC 1YEIL 5B39G 4M7KL 1P4LB 4FTVD 1LEGB 4NNPH 3RL2A 1I7ZA 3QUZA 5IB2A 4TNVF 2O5YL 1MLCB 2FJFB 5J13C 1GZQA 3DUUA 4QRRB 3CCHA 1NEZG 3HNVL 2M1KA 1YMHA 4QXUL 1UA6H 3ULUD 4XAWH 4G8IB 2KZ1B 5I16B 3HAEA 5F3BA 4QOKD 4RNRB 2P5WB 5E8EA 4H1LB 4OCWL 2H2SC 2H9GA 4RNRA 1BFOB 4X8JA 1D5ZB 4YWGH 4X5XB 1FO0H 2X44D 2IAMD 3OXSA 2EDEA 2XNAB 1PGRB 3U6RA 3EO9H 5F9JA 3ZZ1A 4YHYC 4EDXB 3BPOB 1IGTA 2YRZA 3ESVF 5EWIH 3VGFA 3GSWA 1T1YA 3QQ9C 1UH3A 4UB0H 4NNPL 4HS6A 2CDFA 2NY0B 1IGTB 1LEKA 3ISWA 4XI5C 3RTQA 2OTUA 5EA0L 3GGWB 1RZIA 4JDVB 1P9MC 3NFNB 4PFEA 2Y25A 5DJCB 1OGTB 3W0WD 3DMMB 1ZV5A 3MO1B 1OP5H 4O00A 3TVMA 3C2AL 3WSQH 1LEGA 1KJ2H 3PWVA 5SWSB 3JTTA 2WWKO 3CVHA 4GKOA 3WD5L 5KSVB 5ILTH 5FO8A 4MD5B 3I02B 5KSAC 3PE9A 1VPOH 4KHXH 4U6XA 4Y5VC 1H0DA 4GLRH 1KG0B 4OLVL 3MRBB 3CSPA 2DIJA 3IU4L 3RKDD 1JNJA 1CICD 1YEGL 2AJVL 5KVEL 3HZYB 3SE9L 2MCPH 1HE7A 3BP6B 4AQ1B 2DWDB 5JMOC 4OZIE 1OAXL 3IAGC 1EAJA 5EBGA 1FC1A 4P3CH 1GOHA 2DQCL 3UPRB 2Z8WC 2DLFL 5HGBB 3PNWB 4OM1H 1A9EB 3JV6B 5IGXH 4HF5H 4S2SA 5EU4A 3WFCL 3WIFA 2LE9A 3LSOB 1CXLA 4K3HA 5D6CB 5GZNC 5C71A 1U8HB 5C2UB 2B0SL 4AK1A 1EA9C 3U36B 4LKCA 1PG7L 5CD5D 3AFLA 2YA1A 4LDLB 5GQBA 5SWSE 4ZPVB 1SHMA 5DEGA 1ND0B 3O9WA 4OJFL 4MNHB 4PR5A 2DAVA 1GGBH 5CEZE 4D9RE 3EJYD 5FYKE 1AI1H 2FBJL 3TT3H 4PJGB 3M17A 2WWMC 2H26B 2Z8SA 4F15B 4NZTL 3CVHH 2ZCHL 1U0QA 3GSUB 4TTGA 3TCLA 1DL7H 1JZ7A 3U7YH 5EZOL 3VG9C 1JF6A 1PZUB 1BM3H 5CS7A 3VFTA 2BRRH 3GSVA 4Q9BA 4YHIA 4CU8A 4XB8A 3FTGB 5D9SB 3NAAH 5DRNA 1KEMH 5AZ2H 3S3PA 4HLZH 2B39A 4X6BA 3WFZA 1F3JB 4DVRL 4P57B 3JWDC 2PR4L 3O6FB 3TT1L 4J2XA 5C0JA 2W65B 4YX2L 1QFUL 1RZFL 3L6FB 1PX4A 1FFRA 2Z92B 1A6TA 2CUMA 4KK6D 1UXSA 4GBXB 2XRAL 5ABDE 2Z92A 3F58H 3GMRA 5DMIL 3V4PL 1LDSA 5T3XL 5E8NA 1NMBL 4XX1G 3ALXA 3LN4B 5FUZH 3S88H 4Y4FB 3R06A 3KPOA 2Q8AL 1E6OL 4FZEH 2KQMA 1K8IB 1W0VB 5D96C 4O2FB 1PDKA 3CVIL 1RUQL 4WU7B 4PRBA 2WBJD 3MRFB 2CMRL 5IVXB 1A6ZA 2X4RA 1TPXB 3NN8B 3EYOB 1U95B 2YUXA 4UT6H 4ESKA 2QADD 3W11C 3ILQC 5C7XL 3BZFB 5F88B 3QEQB 3O2WH 2V7NB 1C7SA 3RKDC 5GGVL 3MX0A 1YDPB 1SJEB 4GRWF 4KQ3L 5DD0L 4U6YA 5HYQA 5MENA 4LSQL 3H3PL 1IVLA 3EYVB 3FOMB 4HIHA 3U0PA 1INDL 3BDBA 3DSFH 4N5ED 3TNMB 4F57H 1A9BB 1EUTA 4G3YL 1YECL 4OD2A 3LD8B 2EDFA 1BQLL 1MHPL 1JWMB 2AABH 4NN6C 5I1AA 1J5OL 4JFYB 1OAXH 1HH9B 3QIWC 3TBSB 1QLEH 2VKXA 2AJVH 3BUTA 4MJ4A 3F5WA 3IU4H 4OCYL 3NIGF 32C2B 3T2PA 2CKBA 2VIRB 3QFJD 4IM8A 2F5BL 1H3XA 2VLKD 1L7TH 2AJ3A 3HFML 1FFOA 3V7AE 4RMWA 3C8HA 2HKHL 1B4JH 4PJBB 2C4XA 3GMQA 4DK3A 4ODWA 2P5ED 4HUWA 3C6LB 3I2CH 5BQ7A 1EK3A 1MEXH 5I75B 3QEGH 4LBEA 4J3XA 4XRCA 4D9RD 2W60B 1OF2A 2CLRB 2YPLB 5A2FA 3I3DA 2NY2C 2OQJB 4LSUH 5GZOC 2QSCL 4GRWH 3D9AH 2DYPD 2QKIB 2AJSL 1FC2D 2VABB 5CJOH 5GGTH 3U7WH 2ITCB 3PV7A 2JJSC 1Y6MR 1BQHA 3ZT6A 3WIIL 1NC4A 5DJ2A 3V5KB 2VLLA 5HDBE 1FZMB 1JFQH 1U8IA 3QEHB 2ICWA 4QTHA 1QSVA 2MKWA 2R0LH 3ROOA 1I9RH 3EO0B 4YDJA 4LSSL 5FUOH 4H25A 4LK4A 2FSEB 3MBEB 1IC7H 3ORJA 4HFWB 1GAFH 2PW1A 4EIGB 3D69B 4MSWA 3M45A 1IGML 4MAUH 4Z7VE 4WDIA 4LRNL 3NCEB 4ONHB 3GI9L 4QXGH 1RUAH 4NZJA 5EDXA 2QQNH 5EC1A 4LCCB 2A6KA 2AXFA 2AQ1A 4XPAL 5D72L 4U49A 4ETQA 3MYZA 1Q9OB 4X4ZA 2VH5L 1FG9C 5CGYC 3OTTA 4EEEA 3IXTB 2ILLA 4NOBA 5HI3D 3KYNA 2XRAH 1FP5A 4NPYA 1ZLUK 3N1FC 2R2EA 5I19H 4ZAKB 3QQ4B 4HAFA 4NNXB 4DVRH 2VDKH 5ANMA 1H8NA 2FJGB 4KJPC 5F7WC 1EAPB 1S7RA 2F58L 3I6KA 3DO7A 3D6GA 2IBGA 4S11A 2PYEE 1CLOL 1U8OA 5HDQL 5LGHL 4UU9B 4ZPVA 1RUKH 5CBEA 5D7JB 3O2DL 1W8NA 2A6JA 2JCCF 3EJZC 1T0NA 2N7AA 3U7YL 1IC4L 3MV7A 3BEWB 2IQAB 1X5AA 3RGVC 3VXMA 1NLDH 2FGWH 2FL5A 3FCTB 1CFVH 3ZDYE 2C7UB 4CJ0A 1DQTA 3RU8L 2PYFA 2K7QA 4YBQC 2KDGA 5IVXF 1A1NA 4HZAA 3LKSB 3I75B 4FFYL 4M1GH 3EDJA 3Q0HA 4HX1B 3CU1A 4Z7QE 1L4IA 1L7IH 4OGAC 2PTUA 3SGJC 5DJ6A 2FIKA 4WI9A 4XNYL 1RJLA 4XVJH 3RTQC 2B2XL 1BD2E 1VENA 3ZE0F 3BDYH 3KXFA 2V2XA 3FQNA 1HHHB 5DRNB 3HB3D 3QFDB 1XZ0B 5CINL 1Z3GH 4OSUH 4RMRA 4NQDE 5I1CL 1OW0A 1E0OB 2YZ8A 4QF1B 3LZFL 4PRNB 3LS4L 5C0BB 4U1SA 3VFVB 2W9DH 3FB7A 2GUOA 3CJJA 4UV7H 1I7RA 2ZP0T 1PJ9A 1B0GB 3MV9A 3DURB 5IHZB 2VDOH 3BQUD 2UWEF 1CQYA 2GTWB 2UWEB 4Y4KD 3MV9D 1CLCA 4NKMB 4PJBE 4ZOEA 2HT2C 1A9EA 4WW2F 5DD6A 3CZJA 2I9TB 3FT3B 3LRSB 5J4MA 1J8KA 5DEGB 4ZO9A 1I8KA 1QLFB 5I1LA 4S1DC 4XWGL 3B2UD 4XPBL 4LCIL 2BXZA 3C2AH 1S9WB 2YD4A 4Q74A 3MRJB 3RZWA 3RVUD 5BV7H 1VPOL 4KHXL 5F7EL 2YC1A 2BK8A 5B39A 2VZ3A 2XZZA 1BOGB 1WIPA 3I3BA 4LCWE 4F37K 3OKNA 1IFHL 3UBXG 4F3FB 2NCMA 2ZOLB 4TVPH 3EGSA 3LKOA 4N0UB 4R4NC 1MRCL 1SQ2N 4P4RB 3MJ6A 3N1PC 1YY8A 5F96H 3S97C 1U8MA 4UV4H 1JPTH 2F53B 1N5YH 1T83C 1JHKH 2H9GB 4LLUB 4X5XA 4FZ8L 3CFDA 3ME0A 5IKCA 5DO2C 2P48B 4ZUSA 4KRPB 3MJ9A 5EOQH 3D87B 4JKKA 4NUJB 4I18A 4LF3A 4D0DA 4MS8D 3THML 2QL1A 5C07E 2OZ4A 3MO1A 4KJPD 2VOTA 1I9EA 4E5XB 4KMLB 4XHJC 4MLIA 4CN6A 1ODAA 3VH8A 2I60H 3BDXA 35C8L 4XGZA 3RRQA 2WUBH 3QWOA 5DYOB 1LMKA 3EZ8A 3KJ4C 3K3QA 4FZ8H 4KTEL 4G7VL 5HHXH 3IF1B 3IDMB 3RPIB 4LCUB 1JZ6A 1R3LB 2EH8L 3HNVH 1HYSD 4F8QA 3FO2A 4MGXA 4YR6B 1DZBA 1FNEA 1DBJL 4P2QD 3WEXA 4IRZH 4L9LA 1TZIB 2WBKA 4YBLB 4OFKA 3HPJA 1QFHA 4YBQD 2LFGA 4JFQB 4JG0L 2EDWA 4DGVL 6FABL 2WK2A 3PIQA 1HEZB 1BX2A 1W72B 4RWYH 4J4PA 3RFZC 2X42A 2F5BH 5A16A 4GG6F 3MLYL 1KXVC 5GS1A 4JFDE 3CXDH 4ZUVA 2H8PB 1QA9A 4OCSL 1I3RA 1PEWA 4K71B 4ZSOB 2F9BT 3WS3A 3KHQA 4XWGH 3MODL 5AUMB 4PRPE 4XZUA 5JPMB 2HFEB 2DQIH 5JQ6H 2W0LA 3OXSB 4RAUA 4DJMA 5LVEA 3EDFA 4JQXA 5EBMA 5L2JA 5ICYB 2ICEA 2G75B 1T22B 2NPLX 4F57L 1Z9OA 3RAJH 5DXWA 3TZVC 1MLBA 3GSNA 5T33H 5E2UH 1BF2A 4P23A 3ESUF 4N0RA 4FFZH 3IVKB 3CMOH 1Z0NA 1TTUA 3GSQB 1CR9L 2PCPA 2VL4A 5ACMA 1ZLSL 1ZVSA 2IG2H 5E0QA 2F53A 3HZVA 5C08D 5D7SL 1Q0XL 5DVMA 3QDME 4O58L 1QBLL 5FGBC 5E2VH 1ZHKA 1UZ8B 2WP3O 3RDTC 3IDYC 5SWZE 2A83A 1UWGL 2HRLA 4X6FA 3L3IA 1R5VA 1FVCB 2J5LC 4OCRH 2VDMH 4JG1H 3T0DA 1KUMA 1HOCA 1MAMH 3TH4T 1HZHL 3DURA 2AK1L 3X12A 4G6KH 4KFZC 5FOJA 4LQ1A 3P9WB 5HPOA 5BRZD 2BXYA 2H32B 3ARRA 4JLRB 3UCRA 2P8MB 3CC5A 4MA7L 2FBOJ 1NCUA 4GRWB 1IGCH 1BAFL 5IHLB 1AY1L 4PG9A 1ZVYA 4OLYL 4HWEL 3GDBA 3K7UA 3FT2A 2CK2A 1BVLB 4GAYA 5KN5B 5EBLB 3BD5A 3HC0A 1MCJA 1K5NA 4IRJD 2R8SH 4LCYA 5J56B 3ARGD 2R2HA 1KBGH 4AMKH 1HKLH 1QFWI 4QY8A 1E6JH 4Y16B 4KROB 5EFIB 1FIEA 4ZPTA 2EDNA 2ADGB 3IU3B 1MWAH 1G7JB 3S4SB 4DEPC 1IEAB 1S5IH 2P1YA 4I2XE 2AK4A 1P1ZA 4OGAD 5LG1A 4R0LB 3FT4B 2RBLA 5T3XD 4IIQC 4KKNA 3MV7E 5JOPE 4DKFL 5HDOA 1FZKA 2AK4B 2V9QA 2DF3A 5DJ0B 1KCRL 3FFCD 1Y6NR 1YN7B 5MHSD 1U8QA 3MRIB 3WFBL 3IDGA 5FYKU 1S9VA 3BVNB 5TQ0L 4KHTH 1E4XH 1FYTB 4JQIH 1YN6A 2DB8A 1DN0B 1WFUA 3PL6C 3ZHDA 1FVEA 1MVFA 1ZLSH 5IB1B 4NQEE 1CICC 2UWEE 3V6BR 2X09A 1MCWM 5A2LH 3SCMC 5J9PA 1CXIA 4MX7A 4Y2DB 2CK0L 4M1DL 2BMKB 1YQVL 4HWBA 5E2UL 1PYWB 2HLFD 4J3OC 5I73C 1VERA 1PLGH 4QRQA 4I48A 5CEYB 4ONFL 3FQXA 3LEXA 5DRZA 2VMFA 1KCKA 4NRZB 2EC8A 1MEXL 4U1KA 3CH1A 3RWEB 1RMFL 1BLNA 1T7VA 5SWQB 3DVFA 4URTB 3W39A 3UAJC 2HG5A 4EN3C 4PJBA 4AY0A 3QCTL 3WS6C 2VR5A 3KR3H 1ZHLA 4XVUD 1H5BC 4QRSB 4JM2F 5FHAH 2C1PA 4H0HB 1DE4B 5E00B 4LOUD 2O26U 3VRIA 1U8KB 4YHOH 3GMOB 4ZO7A 5IP4A 4G8GA 3L5XH 1XF3B 1ZGLB 2R0ZL 5KOVC 1YJDC 2GT9A 1T1ZB 5D2NB 1KCSL 1DBJH 3R1GL 5FK9A 4WWKB 1G7QB 5DMKB 4HKZB 4LVNB 1QRKA 4X99B 1CDCA 2BSSB 3PJSA 4JE4B 1VFUA 3NGBB 2ICCA 5MEOB 2UUDH 3OKMA 1R3KB 4JHWH 4ZQKB 4UDUA 3EAKA 4K7FB 4P5TA 1SYVA 5E99L 3TN0A 3IDNA 1JYXA 4HUUB 1SM3H 4O51A 1OVZA 4NJAL 5GSRA 3MJGX 3F7YB 5D8JL 3DWTA 1OTTC 1RU9L 4HZLA 3RX8A 2QHRL 1EO8L 2YUVA 5CZVH 1Y0LB 4X7TB 2EDYA 3I84A 3CVIH 2IPUK 3TVMD 3VRLE 4C83B 4WUUD 1UA6L 2V9RA 2Q8AH 3CDCA 1N64H 4NHCL 4QXTA 4BZ1L 1C1EL 3VFSB 3VI3F 5HHVH 1AO7D 5I8OL 2GFBA 4TSCH 3RIFK 3GBLA 2X2YA 3O4OB 4YLQT 3V4PH 1WZLA 1EVUA 4WIQA 1EXUB 1I7TA 1IQDB 2CO6B 3UJTL 1DJSA 5EU7C 1H15B 1AFVL 3BN9D 1F4AA 3H0TB 3QZWG 3ARPA 1UXSB 4OGYH 1T2QH 1T1XA 2E27L 1HSBA 5DSCA 5F1NB 4WHCA 5HDBF 1E6JL 1NCNA 5EPMB 2A6JB 4O2CB 2PO6A 1AGBA 3JBG7 4PJDB 3IS0X 2BJMH 3U0PB 4S1RH 3HUJE 3TT1H 2IBZY 3U0WH 1A8JH 3FRUB 4QRPB 4GG6E 3MUHL 4K23H 4H8WC 4LPYA 5BRZE 1OB1B 4Y8DC 4JFOB 15C8L 5BJTA 3V2AR 1CGYA 2BHZA 1JL8A 3TN0B 2EDHA 3B43A 2BOBB 5GGQL 4JFHD 1LGVA 5SV3A 2XKNA 3B9KC 4PGZA 2XWTA 1B4RA 1C5BH 1TJGH 5H37G 5CD3A 2R4RH 4X7TA 1G0DA 4FP8L 4NRXA 2IGFH 4UV7L 4WEBL 2R2EB 4EBQH 4XAKE 5FOBA 5J12B 1FCCA 3ARXA 2XV6B 1G7QA 4J6RH 1IGJB 4U1GC 4P48A 2CIIA 2ATKB 5C0AD 3DO7B 2FX8L 3HR5A 2ZSWB 3SY0B 2FB4H 3HC3L 3WUWA 4DTGL 3BUYB 3NVQA 1NLBL 2EDTA 4BFGA 5IR1B 4GQ9H 1W72H 5ICXA 1N0XH 4MQ7B 5HI4C 1H15A 1KN2L 4DOHE 2GEEA 5IVZA 1RQ5A 1HXYA 3DXAA 4W6YB 2EKSB 3CLEH 1HWGB 2B8OT 4HUVB 2WW8A 4O51B 4K2UL 3G6JA 4M62L 4NBYB 3GIVA 3F7YA 3U4BH 5IG7B 2D7MA 4OZIA 2X10A 5JHLL 1UWXH 2R0KL 4CKVX 3RAJL 5IQ7H 2ZCKH 3BAEL 4CVXB 4PJHA 2CUIA 4HWNA 5CJBA 1VDGA 2XIDA 3S36H 1FNGA 2DQCH 4MNQD 4D8PB 5GGRY 4N9OB 5GPRA 1JF1A 1IMHC 3ZKNC 5FA3B 1BD2B 1Q94B 5EZJB 4K94L 3EOAB 1JF1B 5IB5A 3KXFE 5D5MA 3QCVH 1D5XB 5CKGA 5LGKA 2ENSA 4KQ4H 1A3RL 4P2OA 1QFWL 3BGFB 3PABB 1I1RA 4Z0XA 3WN5B 3QXUA 4R3SA 4YQXH 1RZKL 1I4FA 5IBLC 2HRPL 4PY8I 4ERSH 3MUJA 1TDQA 4HKZA 2VDRL 5FECB 5IJKC 3OKEB 1DANU 1AXTH 5DJCA 4EQ2A 3TO4C 5CLTA 3H8NA 2JIXB 1T2XA 1DLHB 2E7LA 3MNZB 4HIIB 3MRGB 2P5EB 2HJKB 3W0WE 3UJIL 1U9KA 3MRRB 4BM7A 1A6PA 5FM4A 4WENB 3AUVA 5GS0C 1UM6H 4Y19A 2AJUH 1RAMA 3GM0A 2ZPKL 5FV2A 3BKYH 2FHCA 3VXRD 2VLKA 4NFCA 1BEYL 3E1F1 4XNUH 4UOW0 5JNYA 2L0DA 3N1QC 3QJFB 2O5ZH 3TO2B 4H1LA 1MRDL 2C1PB 3BH9A 5T3ZH 1E4XI 5DDHA 3CPLB 1DLFL 5LCVL 3U46A 4GAGL 4OIIL 5IW6A 2PTTB 3K2MC 1BBJB 1ULVA 3I2CL 4JFZH 1GGCL 2RFXA 2GW5A 4JFEE 1GHFL 4JEGB 2XQYK 1U8LB 2Q7YA 4X6BB 3IS1X 4FP8H 1K4DB 1QQDA 5EPMA 3WNNA 1LWRA 4H0IA 1TJGL 1OT2A 1SY6L 1YPZB 3T2QA 3BH8A 2IPUG 5HYJE 3RVWC 3ULVE 1ZAGA 2D31B 1NSNL 4POUB 1YYLL 1JPGA 1NCDH 4ONOA 5TJWK 1M7IB 3W11D 4WWID 1KTDA 2PO6D 4KKCC 1I9IH 4JRXA 3HI5L 4XPTH 2DQTH 1VFBB 2MWCA 2NW3B 1JZ5A 2EE2A 1KTLA 2VLJD 4U6XB 1F42A 3VGGA 5CIPA 4F15C 5J1SC 4PP2A 3QA3A 1WBYA 3LKPB 3CVHB 4KQ3H 4X83A 3RI5K 5H8DA 3CSYB 4OGYL 4JGMA 3HAEB 4R26H 1ZGLP 1JMXA 4XRCB 2JJWA 3S37H 2W9DL 3A6CL 3CFKB 4RGMC 3UZEA 3ULVD 3LZFH 4LSRL 5JW4Q 2Y06L 2UZIH 4WUUA 4N8CL 1QLRB 2EE9A 3O3EB 4PUBH 5F89A 4LVOB 1P6FA 4YXKH 2CSPA 3CFJA 4X7EC 5IT2L 4MQXC 1TCRA 4OIIH 4K3EH 2XN9D 5DQDH 3D18B 4W68A 2AQ3A 3IDUA 1FO0A 1P4IL 3WS6A 2YR3A 3ECBB 3KXFD 2VXVH 1WWAX 2XZQL 3KPNA 2RB8A 5CSGA 2VLRB 4PG9B 3MFFA 5CAYB 4I0PB 5ESAB 1C5DA 2QQQA 4WI8A 4JFFB 5C9JA 1R0AH 3QIBB 4JZNA 1KF9B 5T1KA 1U41A 2DD8H 4ODBD 1DDHB 4X5WA 4JANA 3E6FA 4D0BB 3QFJE 5FYJE 4E42B 4N9GA 4FQCH 4K07A 4XP5L 1Q38A 4LAQH 2FX7H 5L7XL 1OAUL 3QQ3A 3QPQC 1T6WA 4XHJD 1KPRA 2ADIA 3T0VA 1NBZA 4MNQB 3MYJA 5ITBL 5B38B 4K3JL 3B8SA 4ZTPL 4OLUH 4OCMC 4ZUTA 1QKZL 2JB6B 2VLRE 5C0AB 1NGZA 3RIFF 5B22A 3U30C 5F8QC 1A3RH 5ERWB 4N1CA 2W9EH 2C5DC 3TJEH 4JRWA 3LQAL 4FMKA 5C09D 3MLZL 5B3NA 5C08E 2X7LA 1I8IB 2D4FA 3SDDD 2P43B 1J88A 5TF1H 3QRGH 4LVEA 1QFWM 4LU5H 5D2LF 2WUCH 1I8IA 4CVZB 1T1YB 4G42B 1WAAF 4Y19B 4XCFH 3BXNB 1X7QA 5CEZD 1KLGB 2PETA 2CKBH 3PQYE 2WINB 1RZIB 4JDVA 5T1LA 3S96B 1PBYA 4D0BA 5JIPA 5DR5L 4F8TA 3RWDA 1RFDL 3BIAX 5GRWA 3EJZD 1SBBA 3L3HB 4PRPD 5JR1L 4P99A 5HY9B 1BF8A 3TYGH 2HLAB 3VXPA 5AD0A 3O3BB 3U4EB 3BPNC 4RGOL 2NX5A 4PBXA 3QSKB 5HHPB 1QSEE 4JGUA 3I50H 4QGTA 3QG6B 5GISH 3P0GB 3ROOB 1HSAA 4JO1H 3GMNA 1DUYB 1T20B 1DVFC 1F4XL 3ZHLA 3LHPH 2HN7A 4YH6A 2P5EA 2YZ1A 4HFUL 5GS1C 3FT3A 3TPUA 4ZFFB 1AR2A 4W4OC 4ZDHA 3ZDYF 1INEH 3KPPA 3KPLA 5IHUL 1MVUA 5AZEH 1U58A 1CDUA 3GIZH 2MQ0A 5TDNA 3KWWB 2XA8H 5EZLB 4MCZA 3ARDB 4X4XB 3ZO0A 2FX7L 2YMXH 5L7XH 1UM4H 3RWFB 3QRFM 2VQ1A 3UTTE 2NY4C 4JKPL 1VCAA 2OL3B 3LS5L 1TZGH 5JDSB 4PJHB 4YAQA 1KJ3L 5ISZE 1A1NB 1TVBA 3IAQA 3BGFC 2DQGL 3TWCH 4CN1A 4X6FB 1EMTH 3CPLA 5CGTA 1U93A 4HGMA 1PZ5A 3QPXL 2CGRL 3EZJB 3MROB 4WHDA 2VQUA 5FIEA 4PJ8B 2I25N 4XP6L 3ZDXE 1I1FA 5DI8B 2G60H 5L8JB 3NCFB 4FNLH 1OGAA 4O5LL 1IEBA 1O5DT 5EO1B 1FNLA 1F6LL 6CGTA 1TVDA 4AEEA 1M7XA 3GMOA 1XMWA 1P4IH 1RUQH 4OCRL 5DD1H 3P9LA 1LO4L 1LO3H 4Y4HD 4X4YB 1ORQA 1EZVY 2EXYD 2BZDA 1RUPL 5FUZL 3SDCB 1HHIB 2A1WH 3REVB 3LEYL 1IC1A 1DTUA 4R4ND 2CIIB 4O5LH 2C3VB 2OJEB 4R4BA 4CW1B 4FNLL 4QHNA 1SEQL 1L0QA 4BSWB 2A9ML 2BSRB 5LXGH 3KXFB 2WM0A 1AGDA 5CJXC 2NX5D 1YQ2A 2Q8BL 1BGXH 1TZHA 3JWOL 4UBDC 1IGFL 2GJ6B 1T7WA 5FOBB 3NPSB 5FYKH 3LS5H 5E08H 2GUOB 3FQWA 2ZNXA 1B6UA 1I8LC 3U9UB 5GHWL 4TUOB 2CIKB 1MH5B 1REIA 1TQCC 1R3JA 2V17H 3VDBA 5D7JD 5E6YA 4F33B 1KCVL 2NXZC 4N0FA 3TN0D 4R90H 2LTQB 4CDGC 5GGVY 4FQXD 3SDYH 1NL0L 3JUYA 1FNFA 5EU6B 3HR5B 4IRJB 3MTRA 4NNXA 3OG4B 5TE7H 4J7RA 4PG2C 2JLLA 1VADA 4MAYB 3AC0A 6FABH 1OQXA 4KUCF 3MV8E 5DFTA 2RFXB 1EEUA 3ZL4H 4NZTH 3T4YB 1WC7A 1AGBB 2EKSA 4DZBB 4ONGH 1QSEB 4QTHB 4QYOA 5E94A 1HHIA 4CNIA 4LMQE 2B4CL 1WTLA 4ODUB 1GGBL 3HUJA 4H8WL 2CRMA 4UTAL 3O11A 4EJ1C 1IM3A 4H25B 3MFGB 3MV7B 3ARBC 4WUKL 4M5YH 5EO9B 3WFHB 4F37F 4ONFH 5JR1H 1I75A 1CE1L 4WUUE 1U8NA 5E8PA 5DR5H 4DGIL 4L4VB 1OSPL 1WEJL 4AG4H 4K7FA 4P5TB 4S1SH 2BFVL 3ZSTA 1UWEH 1SVZA 3VXME 3IXAA 1YEKH 4X7SL 1FGVH 4TVPE 1R5IB 3FL7A 5EN2A 1NC2D 5ACLA 4M6NH 3SE3C 1ZT4B 4Z9KB 2VTFA 1OP3K 1G6RL 5FK9B 3AY4C 1FBIH 2EYSB 3RWJB 1JMZA 4OQTL 4R4FL 4X6CA 3RBSA 5TF0A 3TJEL 4QF1A 5FEBA 1QR4A 3ARZA 3O41A 4YXLL 1YNKH 4OD3L 4P4KC 1N4XL 2ATPB 1R6VA 3KGRA 1F4HA 1MHHA 2R69L 1AGDB 3ARTA 1QZ1A 3I85A 3SY0A 2D7TL 5IV2A 4P2RB 4KZDL 1CBVH 3RWFA 2MHAA 4HIEA 1MREH 3SDDC 3U9PL 5FYJL 3C60B 4HIEB 3FN0H 2BOCB 3GMRB 4OTXL 1RURL 1FG2A 3T8XB 3RWGA 4WV1C 4WJ5B 1D3CA 3JTTB 2FLBT 3SO5A 1YC7A 1WAAE 1ZSDB 2SEBB 3GBMH 4MWFA 4B50A 4JY5H 1MHCB 1NCBH 3BSZL 2VJXA 5JPMA 2HAZA 3NN8A 1OWWA 2AK1H 3ARGA 1AC6A 4OLWL 5DHVA 1K4CB 1BVKA 4IRJC 1LO0L 3V5DA 2G9HA 3FAWA 5E4EB 1T21B 1Z3GL 4OSUL 3DLQR 1KXTB 2JJTC 1MF2H 3D39A 4LP5A 4WUKH 3RY6C 2I9LB 2YHGA 3QUXB 4F9LA 3LB6D 4BUGA 4Y2DC 4PJBF 3MXVH 4Y2DA 1LE5B 3SCMB 2AEWA 2W65A 1UCBL 1I3UA 1R24B 3EW3B 3VWKD 2R2BA 1I9JH 3OX8A 2X05A 5BRZA 1JGVH 4MJIE 1WWBX 3ARDD 4J4PC 4HDIA 1UB5B 5F3HB 3L3DA 3ARFD 4JZOB 5HYSB 3PHOA 1GPOL 1X5ZA 3WIHA 1W2KT 3STBA 1A1MB 2D2OA 5C0CD 3F62A 1FGNL 3B9VA 4P5KB 2NR6C 1WTGT 2VR4A 5L2KA 4NCC1 4Z7UF 1JZ8A 1HHGA 2XNAA 2DQIL 3GJFB 2OSLB 3W9DB 4BFIA 3BP4A 2CDGB 4DEPB 3OAZH 1RK0B 2NXYB 1N7ML 2OZ4H 4U3CA 3FB8A 5EH1A 1F90H 1DBAL 4JLRA 4M4RA 4BZ2L 3LRHA 4PY8J 4JCLA 3MRLB 4X6DE 2F54D 5FKPB 2AVGA 3IFPB 4D2NA 4U4BA 2A9MH 5DJ0A 4FS0A 5IIEB 1TQBB 2Q8BH 1QR1A 1MJ8L 5MEPA 4OCXH 3FRPA 1BVLA 4FABH 1HIMH 2YSSB 3AAZA 2ED7A 3NTCL 4PGBB 3N0PB 3UZQA 5FHBL 1S9XB 2JB6A 2YD2A 4OZHB 4Y1AD 3N1MC 4GO6B 3TIEB 4HQQL 4FQIL 1NKRA 3RNQB 1IGMH 4EN3A 5F7MC 4NM4H 4DAGH 3LCYA 1AKJB 4MXQD 3FJTA 1VFOA 3F5WB 5K9OB 2OL3A 5HHQA 5ETUB 1JBJA 4QHMB 1LEIB 4XCNB 4JDZA 1KTKE 4UINH 3U48A 1EV2E 1B88A 1I8KB 3T77A 2R0LL 1JGLH 3P2TA 1XR9B 2R1WA 5C0BD 4P2QA 3WIIH 4YE4H 5ALCL 1ZHKB 3ARGC 2F19L 4JFFD 4MNQA 4RDQF 2G60L 2YD5A 4IMLA 3P3YA 2WINA 4OFVA 3HE6A 1GVIA 3RWCA 3U36A 3NACH 1NEZB 5D2LB 1Q0YH 2YMXL 5GS0D 1EUUA 1G9NH 4WFED 2VR9A 5IOPB 2K3TA 2DQGH 3LSOA 4HEME 4L8SB 3EDKA 4LEOB 3TZVB 2OR9L 2Y7QB 4KZDH 2HRPH 1G7LA 4IDJH 3HFMH 1XAUA 2IAND 2FO1A 3KR3L 4Z77A 1PG7X 3WXVH 3NH7L 4PLJC 5F7EH 2UVFA 4I0PA 5HJ3B 3HG1D 1PKOA 2DQFB 4X6DF 5D93C 4G43A 2V5MA 4KC3B 1NDGA 2WMPA 1T0MB 5FO9A 1L9NA 4P2RD 3TCXA 1U92A 4LSPH 4ZDHB 4G3YH 4L4TA 1FZJA 3V4VH 1SVCP 3TGXA 2E7HA 1A47A 5A2JH 3QIUD 3RZCD 2I26N 4P5MA 5JHLH 4IEFB 2VZ1A 5KZCB 5C0FB 1A6AB 4KK8D 2HTKD 5JW4R 43CAA 1OM3L 2OYPA 4WW1B 4ODTH 3HZYA 1RJZA 2WBJA 5C9KA 3TF7C 4LHUD 1HN1A 3RUGE 2N7BA 1MCPH 2XTJB 3N85L 1MH5A 4I2XA 4L8CB 2IADA 1A6TB 4IRSD 5INCB 1GZPB 3GKWH 1DUYA 1IAMA 5J11B 4PGJA 1D9KA 3HC3H 2EEAA 4NDMB 2CXKA 1VGEH 3KYOB 3MRKA 3X14A 4H1LH 3MUGB 4F7EB 3BRDA 2DYPB 4CJ1A 1KTDB 4WO4B 1JYNA 2Q76B 4U1NB 4BFEA 3KAAA 4NDMA 1FNAA 3MRRA 5CMAB 5I6XC 1YEHH 4HKBB 3IJHA 3QIBC 1IAKA 4P2QB 1A1OA 4MQXD 3HLAA 1ADQA 1QRNE 2KH2B 3GHEH 5HVGB 4HFWA 1B90A 2KZWA 3PF2A 3ES6B 5E70A 4JVWA 1UG9A 3BXNA 1B0RB 3IVKA 4JAMA 4IDJL 4G8EB 4XPGL 4ZYKB 2NW2A 2HJFB 3BPLC 4D3CH 5T1MA 2OR9H 4G6AC 2G5RA 5E9DB 3TZVA 3NIFE 4Q6IA 2BVTA 1OAUH 3PP3K 4JY6A 2VDPL 4X80L 1T2QL 5B38A 3IDJB 2Q3ZA 2BCKA 5D7IA 2YSSA 3QUXD 3VJ6A 2DQDL 3I6LE 1MCQA 5EZOH 4MQTB 1QFOA 4GKZA 1WT5A 3QYCA 2X4SB 1UB6B 3HS0B 5I8OH 5IV2B 2C3XA 1N3NA 2VDML 1S7TB 1XH3A 2FEDC 3T65A 1KFAH 3CFBB 4UINL 2AV7A 3DIFB 4JDZB 3BEWA 5FHBH 3TVMB 2VXVL 1FFQA 2XQYG 3C5JB 3EO1A 1BJMA 4N9GB 3OR7A 3C6SA 1GIGL 3FO0L 1FH5H 5EO0A 5FM5M 4KTYA 3BP6A 3MR9B 4Q9RH 4NJAH 2NY5H 3CMOL 1G0YR 5SWZD 3K8MA 4QHKJ 4R26L 2XA3A 5E6IC 4Y5YA 3BO8A 4MJ5A 4RX4A 4XAKD 5DUBB 5F44A 1DP0A 3X3GH 3MLVH 4LSRH 2FIKB 4BZ2H 1K2DB 3QUKB 1G9MH 4OF0A 5E56A 2JTDA 4XP9L 3O3EA 3QHZH 3VFRA 3B9KD 1WK0A 2YBRA 5CUSL 3PGDA 5D7JA 1NGPL 2XYCA 4LFHD 1J8HB 1DQML 2BVOA 1UWXK 3ZT5A 4K55A 4HPYH 1FLRH 4KK8C 3VXMB 5GJSL 3LEVH 4PJDA 1Q8MA 2XPGB 3IJYB 5DJ8A 4WDIB 1IM9A 4C4KT 2BY1A 1M7IA 1QVOA 3WD5H 1XGPB 1DBBH 1UYWH 1RIUH 1YNLH 4JPKH 3UROR 3FB5B 3MV8B 5HYJB 4JJ5B 4ZS6D 3HCVA 3O8XB 1ZLWH 3QZWA 1KB5L 2VXQH 3QA3B 4CU7A 5EA0H 5EU3A 5KTEL 1HQ4A 4ALAH 5F1IA 4MXQC 5E8OB 4RGOH 4Y7MA 4O02L 4CADB 1MF2L 3LH2H 2FNBA 5EU3B 3T08A 2A6IA 1FAKT 5TDOB 4XNUL 5JOPD 4KRNA 4I5BA 1NGXA 2RIKA 3AS2A 1U8OB 5KVFH 1FJ1A 1EFXA 2Z31A 1NGYA 4OFIA 4PRHA 4KK9D 4QXTB 4HUWB 2GSGA 4YWGL 3ZTNH 4XBPB 3LEVL 5MI0B 3OJMB 2OMBA 1YEJH 3B4NA 4C58B 5FGSA 1MHHB 1U2CA 4LARH 2WUCL 5B3JF 1CT8B 2VXUL 3BSZH 5DMYA 3V6FA 1NCBL 3IFNL 3D3VD 2HFFA 4MB4A 2HVKB 2Y1VA 3AS3A 3EJYC 4HUKB 1U91B 1JHKL 2IANB 3QO0B 5FGRA 2R9HC 1U36A 3H9HB 3CIQA 3D25A 3ZTJG 4ONHA 5F8RC 5LAXB 4XMLL 3QJFA 1WFOA 2V2XB 2VUYA 1ZXQA 4AL8L 2Y72A 2I07A 1UJ3A 2XQBH 4M8QB 1ADQL 5CJ8A 4YZFF 5BV7L 5BO1H 1OCWL 5E8PB 1CIDA 5IROA 5IBLD 4W6WB 4EI6A 4OZFB 3MRPA 3KYAA 3UC0H 2NY1C 1T21A 1XR9A 2R1WB 3QAZC 3QXDB 5JHDB 1A6UH 1FAIL 3D2UA 3HTLX 3QT2A 4XBPA 3GI8L 1BZ7B 1ZLVK 1QFPA 5IHZA 1KJ2A 1X4YA 5J12C 2LV4A 4PJDF 5F6HI 2ZNWA 4NC2B 3CX2A 5IROC 4QHKI 2XICA 1A6WH 1CGSH 2EEDA 1KN2H 1KTLB 3VXRB 4H8WH 2BFVH 4OZIB 3X3FL 5GS3A 4K3EL 3TT3L 1RPQA 3TN0C 3C60A 5EUKA 5MI0C 2YWZA 4YC2B 5KJRL 3FQWB 4JAMB 1FIGH 3C5ZC 1RZGB 5D70L 4GQ9L 1FYHB 1KLUA 3I6GB 4D8PA 3NFNA 1FYTE 1PG7H 1HHHA 2Y07H 1MCNA 2VSCA 2DLEA 1XGUB 4KU1A 1NL0H 4I77H 5DGRA 3HNTH 3WNMA 1KCVH 5CJ5A 2FGWL 1CF8L 1F90L 1FZKB 3ARFB 3B5GA 1DQDH 3GSVB 5KANG 1K6QL 3UYRH 4CL7A 2AEPH 4UNTA 4I1NB 4I3RL 4KKAC 2HVKA 5JMRA 2VQTA 1LVEA 3WIHH 5ELIA 4EDWL 5CBAA 3T2NH 3MRMB 3VGAC 1AE6L 1LO5B 3EIFA 1XGQB 4GG8B 4FFVD 4OF5A 2X41A 2BNUB 4YXHH 3G5VA 1JTTA 1UCTA 3GK8L 2PO6B 1BQUA 2PYEA 1MI5A 4NQXA 4IJ3C 1NJ9A 3NIDF 4QWWD 5DQJB 4MA3A 1SY6H 1GPOH 5C09E 2GI7A 2GK0A 4MVBD 5BRZB 4Q9CA 3LKNB 3RHWK 4L8BB 3WSQL 4HKJB 5CSZA 1ZE3C 2F74B 4PJCF 3V4VL 1OAKL 2DQUH 1UCBH 1XF4A 5DD5L 3SGEI 2PXYD 2AXFB 5D72H 5C08B 1JWSB 3G08A 4GAGH 3V52H 3KPQB 2YXFA 3NGBC 1XIWA 4KDWA 4MNHA 4PR5B 1MCRA 3FO9A 2CKBB 3UXFA 1A22B 4ZD3H 1CL7L 1SEBA 3W39B 3VFOA 1NGYB 4PRHB 5KSAA 5EO1A 1XF5A 4WWKC 4U05A 4BZ1H 1RJYA 3PHQA 4MJ6A 2EECA 5D8JH 5CLWA 3HA0A 5C0AE 5BS0D 3P40A 3GMQB 1DBML 1P1ZB 1MCWW 1OSZB 2E7CA 3VRIB 2GJ6E 4JCMA 1MHEB 2YD3A 5CZVL 5FXCH 2QBWA 4KGJA 3BGMA 4M61A 4MJID 3Q6GH 1P2CA 4MDIB 4WTZA 5GGSY 4PJIB 2A74A 3QPQD 4HCRL 4PJ9B 3STZB 1PFCA 2X4SA 3L3KB 4XAWL 3QDJD 5EBMB 1FLTX 5L2JB 2CGRH 5ISZA 3V5KA 4M7ZC 5JW4M 1NC2B 4FQ1L 3Q6GL 5I1AB 3WHXA 4AIXA 5I18H 1HHJB 4HS8L 5KSVA 4YHOL 4NQVB 1KJ3H 5FO7A 3DGGB 1A2YA 4LLVA 4ODVL 5FHAL 5FGBA 3REWA 4ZNCD 3SDAC 1S7WA 1HI6B 1NAKL 5DTFA 5I0DA 5AZEL 4EUPA 4YFLI 3NPZB 1Q72L 3H9SA 1KPVA 1OAQH 1KCUL 3MOBH 5IEHB 1B2WL 1C12B 2VLMD 5IM7B 3P4LA 4QHUB 4NNYB 1QLEL 1H0DB 2V2WB 4P2QE 1S5HB 1H3PH 5EUOA 5A2KH 4R96B 2DQEH 2R0WH 3UJJH 2IADB 1YZZA 3BIBX 5I1DB 1EJOL 2X1OA 3OF6A 1J1XL 3OAYK 1T5XB 4EI5B 4HEPG 1FYTD 1IZKA 2GSIA 4QEGA 5E2TL 4WO4C 4L4VE 5IIEA 2NY0C 4QRRD 5GRJL 1N2RA 4LKXA 3LY6A 4GBXA 2IQ9H 4M5YL 5MENB 1W72L 5DRZB 3E6HB 1CD8A 1OM3H 5I15H 2CK0H 4M1DH 1JZ4A 3KLAB 2RJMA 2XTJC 2LVCA 4OZGE 5TF1L 4APQD 4LHUB 5BVPH 2YPLD 5FCUL 2DLTA 4LCYB 4U6VH 2A6DB 2ERJC 3QWRD 4RIRA 1CXEA 2ZJSL 4Z7WB 3FZUC 4DN4L 4BK5A 1YN7A 2A73A 5D1ZB 1JWUB 1QSFD 1AHWA 3VFNB 5I76B 4G7YH 2BDNL 4HJ0C 5T1MB 1EDQA 1S7QB 1A02N 3VW3H 1OAYL 2A6IB 3H3BC 1J05A 4ORZC 3GSRB 3O6FA 4R7NB 2J1KA 4ODVH 4XT1C 4P2OD 5E08L 1HOCB 1MFEL 1GOFA 4NRYB 5JW3H 4YK4B 4UOW1 4OF6A 5ERWA 4K8RC 5AG8A 5ITBH 2MSPA 4WWKD 3LPFA 4MCYA 4XNXL 4NHUA 4Z7UA 3V6ZB 1JVKA 3HNSH 3LQZB 3RVVD 5B38G 1G0XA 3H42H 4X7FC 1TXKA 2R8SL 2X9XA 1G6RA 4KVCL 5JW4N 1DLHA 5EC2B 4RAVB 4ZUUB 1P9MA 1JV5A 1NGQH 1AY1H 4V1DE 4F58H 1L0XA 4UDTA 3DUSB 3N50A 3MUGA 3FONB 3T0WA 3EYSL 3ZDXF 4G42A 5C86A 2VLJE 4U1JA 4GAYB 1P4LA 3VRJA 1ZHNA 3LKQA 5E2WL 1Y18A 2ADGA 5GS2D 4HS3A 4K7PH 5ESAA 1P7HL 4NHCH 3MBED 1RUAL 4PJ9C 3O3DA 4LRNH 5FYJH 3RA7H 5I1GL 3HMXA 4PLNC 4XCYB 3FN9A 2GKIA 1CI5A 1IM9D 1MAML 3ZYJA 5T5NF 4F7MA 4Z76B 1U3HA 1OGAB 2QEJA 4WUUB 5KVDL 3TO4B 2Z93B 5IFAL 4JHAH 3TH3T 2FO4B 1BJ1J 5D7SH 1ZVSB 5AUMA 3VMOA 4LGSB 1IAOA 4BSVA 2AW2A 5KSAD 3EGSB 1TIUA 2H8PA 3WMSA 1TENA 4I3GA 2PKDA 1QSZA 5J3HC 4OCLC 4C57C 1OAZH 3V8CA 2Y6SD 3AMLA 1T20A 2WLZA 3AU1A 2BY3A 1GC1L 4WFGD 4PJHE 5ISZB 3HUJF 1RVFL 4E41B 1CQKA 4B7LA 1WAAA 4NKOA 5AYUL 2NXZD 1ZOXA 3DX6B 2Z8RA 2QADC 4X6DB 3BW9A 4LARL 3UBXI 1OP3H 4P23B 5DRXB 3C5ZA 5F71A 3HS0A 4XPTL 3TBTB 4XP1H 4PV9B 1UKQA 4Z7NE 1A7RH 3UPCA 1RI8A 1ETZA 4UAOC 1LNUB 4L1HA 5C0FA 5F7DA 3JTSA 1GHFH 1CXKA 2O61B 4WV1A 2DMCA 4FN0A 4MXVF 3I75A 5DJZB 1WBXB 2EDDA 2P4AB 4JDTL 4P5TC 4J3VA 3SKNA 3VGEA 4OB5L 5D71H 2VUOA 5BZWB 3WXWH 2F8OA 1M6OB 1KXQE 3LPGA 2LU4A 1FL5A 1KIQA 4LLDA 2HJFA 1DBKH 3UO1H 3C2SA 3L3HA 4UB0L 1I9JL 3ARFC 1GGYA 1AO7A 2P24B 1G7IA 1QLRA 1CFTB 3MRMA 1II4E 2QSTA 4PJEB 1RSFA 2I60L 4LLAA 1LD9A 3FT4A 4BQ9A 4QRPA 3TBYA 3JVGA 4HJ0D 5GRVK 3VE0B 1UM6L 1QA9B 4YO0B 4KTEH 5T3ZL 3S3SA 4YUEH 3MV11 4MA3B 4Y19E 1MNUH 4OUUB 3SGDH 4JM4L 4JGJA 3TFKC 1EFQA 35C8H 4L3CB 5KW9H 5EFIA 3MNWB 5KS9A 3QISA 4QT5B 4C56B 5DK0A 3KG5A 1D9KC 1JF5A 4R2GC 1AGCA 1IT9L 4OZHF 5AYQA 4XWOC 3FB6B 5FYKL 4RAHA 4YPGA 5BJTB 2D03H 3CUPA 4NZRL 3L1OL 4Z7WA 2VXSH 1EEZB 1F13A 2GJJA 2VXTL 4L8BA 2W0FB 4DKFH 1CG9B 5BVJA 5T3XH 3WYRA 4NQEA 5ESQA 5IB2B 3CFEB 1RZJH 4UI2A 1JWUA 5HHNB 1ROWA 3BYTA 3GO1L 2ICES 4ERSL 4HJJL 5HVFB 3J8F7 5F93C 1K3ZA 3DETC 3BP7B 4HG4J 2N1KA 2O5XH 1I85A 1HINL 1YMHB 2XACC 5DRWA 3UTZB 4ZTPH 2YC1B 5LBSH 4Z7UE 4FXKA 4NQUA 4G9FE 3TA3D 2EDBA 5IVOA 1NEZA 1CBVL 4WGWB 1KJ2B 3N9GL 4E41A 1IQDA 1TLKA 3L5IA 4LAQL 2NY1B 1TMCB 1UKSA 4K9EH 1AGEA 1ERNA 1ACYL 5KS9F 3OQ3B 4M93B 4FXLA 4PJIA 5CGYD 4N68A 5ICXB 4PP1D 2X89D 4JZOA 5MP6L 1TNMA 4HD9A 3QIUA 4PJCA 5BCAA 1T4KA 3RVTC 3D5OF 4P4KB 5J6GB 1FBIL 1QLFA 5SWSD 3CX5K 3VXTA 2Y6SC 3CAFA 1T1ZA 4P2RA 5FA3A 1MFAL 1X4XA 1A2YB 1IBGH 3C6LD 2ITDA 5IBTL 7FABH 2DL9A 4JG1L 2XWTB 4XNXH 4FQXC 2ZCHH 1RHFA 2J4WL 1NAML 5CSBA 1RULH 2DMKA 4XPGH 3WUWG 3O6LL 1A7OH 4WTXA 5E1AA 1FHGA 2B2XH 4NQCD 3CLEL 4U1SB 3VFVA 7CGTA 3EYQC 5C0BE 4P49A 2EIDA 5FECA 3LH2L 5D2NC 1ZS8B 3BMWA 5HGDB 3K2UL 2GT9B 5LWYH 4X7CC 5JW5A 1MIMH 3CGTA 4NO3A 1CR9H 2OP4H 4R3SB 2FJGA 4JM2D 3C5SB 3ARBD 1V3LA 3TNMA 1BMGA 1HEZA 2C4FT 1DUZB 3VXSB 3MLTB 1HHKB 1R24A 1EEZA 4HH9B 3I50L 5CSZB 1B0WA 4Q7DA 3O8XC 1Q9OA 1DEEB 5I8CB 3SDXA 4MAYC 2J2ZA 2EIEA 2J3SA 2WSKA 3WFEH 4JFYA 4UIMB 1FLRL 5B8CC 1JRHL 4GKSA 4YBHA 1NSNH 1X5KA 3F8UB 4PRDA 5JA9A 5D1QB 5KSBB 2NYYC 2IAMA 4LNVA 3TO2A 1EZVX 3VMPA 5T3ZE 1T83A 3MGOA 3AREB 3MXWH 1NKOA 3MLYH 4GKSB 1M4KA 2E7LC 1P6AB 4EN3D 4XP9H 4JO4L 4Z78B 1AFVH 1AQKH 4Y1AA 3C6LA 1KGCE 3F7VA 3MOAH 4WHYG 4X4MA 4POYA 5BQ7B 1KSRA 2VZSA 3SGDI 3SKOB 1JTOA 3GSXA 2X4TB 5L8LB 1GGCH 2OTWB 3M1BA 1AR1D 4YJZL 3U46B 4JFFE 2ERJB 5HI5C 3FTGA 5D1XD 5D9SA 4JN1L 4YDIL 1DQLH 5DC0A 4GAFB 4XXCA 3WHE0 3MJ9H 3DYOA 1U8JB 3MRPB 3QUZD 5JXAL 4C54A 5CBAB 3VFTB 5IW1A 2NY2B 1BVKB 1EXUA 1I7TB 1YY9D 1MCOH 2PTVA 5DVKA 3SDXF 1QOKA 3VE0A 2CLVB 3PDDA 4W4NA 5D1ZC 4ODSH 3NH7H 4LCWB 3EO0A 1NANH 1HH6B 4M00A 4ZFZA 1QBMH 5DQJA 1WICA 5F7LB 3L7EA 4G6MH 4EQ3A 1I3VA 2NZ9C 2VLRD 4H20L 3K1KC 4X6EB 4Z7OE 2BNUA 3O41B 4LSSH 1HCFX 4FFWD 3SDXB 1MNUL 1KYOK 4PP1C 5JDSA 1NCTA 1BBDL 4NGHL 1CL7I 1JFQL 2DWEA 2M26A 2V7HA 1J1PL 3O45A 4GRLA 2VISB 1LHZA 3KPSE 4NN6B 3LKRB 4MS8C 5CZXD 3QDJB 3T04D 2QSCH 4PJ8A 4WU7A 5JHDA 4G6FB 3SDAB 1EERB 5HGBA 3IKCB 4Y2DD 4KROD 3DI2B 1QFWH 4RA0C 4U3HA 4PRAB 5JOFB 4RMVA 3VXSE 3AY4A 5ITFB 4DKEL 1MY5A 3PV6B 1U3HB 2Y4SA 4LPTA 3FN3A 4K94H 5TDPB 1U8HA 3ARDC 4J4PD 2FHFA 2C9AA 4XP4L 3ARSA 2XG4A 4PLJD 3RZCC 1WUNT 2B1AH 3DROA 4J3UA 2ADJA 1OLZA 2IPTH 3MA7A 2KKQA 2VZUA 3RDTB 4KK5C 3ZHKA 4F2MA 4G9FD 2X4PA 1YMME 2IALA 4YHKH 4GKZB 1FORH 1FRGL 1RK1A 2HN7B 4D0CB 1OTUC 4QHNB 3ULVF 1MJ8H 4MHHG 1NCWL 4ODXB 5IWLA 1YMMA 1YQVH 1GGTA 3OJDB 2RR3A 2PYFB 2HT2D 2K7PA 1MJUH 5DGQA 2BVQB 3QQNA 1AO7E 1UJ3B 4GBXC 1PLGL 2GTZA 3GK8H 3BPNB 4Q6IB 4RMTA 2V5RA 5EZIL 4FA8A 4NO2A 3UDWC 4YHIB 4KHTL 32C2A 4PRPB 3OAZK 3HZMA 2OL3L 1CIUA 5DF0A 1IAII 3BD3A 2X1QA 3EUUA 5IFAH 3NCYP 4UQ3A 4CVWA 1YNTB 1W0YT 1FGNH 5E7FA 3B2VL 4NO0D 2FYYB 5CD3B 3QRGL 3IDGB 5DJAA 2Y9RT 1MI5B 4R97B 1QO3B 1YN6B 1MWAL 1MIML 1X5LA 2YRPA 1I8LA 4FQPA 1N8ZB 4PRBB 2BY2A 1J8HA 2IMNA 5K9KA 3T4YA 4JFZL 1X7QB 1EH9A 3JV4A 1A7OL 2X89A 2NNAA 1RULL 5K9KB 3X3FH 5KS9B 4OLYH 3IJSB 2IAMC 1CGSL 1E4KC 2BNQD 4OUUA 4WEMB 4NFDA 4NO5B 2J8UB 5DURB 3VRLF 2F58H 3BO8B 1N2RB 4P2YA 3NAAL 1Z6JT 3MBEA 2A9NL 3NACL 2H3NB 2EYRA 5EORL 5C07B 5HHOA 3QZWB 4F9PC 2O93L 4TSBL 4MQSB 1IGYB 3DX6A 5EULV 4JN2B 2A6DA 4MD0B 1UJ3C 4MA7H 1YMMD 3GSUA 5DRXA 4JFXB 5HHVL 1QHOA 5HTSA 4KRPC 3ULSB 5I1KH 2BRRL 4NQDD 4NQSA 5C2BH 2QQLL 2X4OB 3RWIB 4HUXB 1KPRB 4EVNB 2GYSA 5FAAA 1BECA 3UPRA 4WWKA 3NA4A 4P3WA 4XXDA 5I71B 5TDNB 3CVHL 3O6ML 4Q9QH 3KYMA 3CFKA 1XF2A 1RZJC 5D2LE 4XNQA 4XVSL 1TETL 3G5XA 1EGJH 4HWZA 4HJJH 4LLDB 1Z9LA 3NABH 1N26A 4J23A 4DVBB 2HMID 3CFJB 2EO9A 2JCCE 1S7VA 4RA3A 4XNQB 3IYLW 5CHNB 2X7LB 1VACB 1X9QA 4X8XA 4EOWL 3C6SB 3VRJB 2B0SH 2HWZH 3HMWH 2D03L 1KPVB 4YHML 1ITBB 4HXBH 1CDGA 5GGSB 1TZIA 3O4LA 1CFSB 3DOSA 4O2EB 4W4OA 1JV5B 1NMAL 3MLXL 3RNKB 5ENWA 3UTOA 3OZ9L 1W0WB 4B41A 3MCG1 1N5AA 5DS8A 3IKCA 3QDAA 4IRSC 3AS1A 2P5WA 1XZ0A 5I74B 5EUOE 2R0WL 4L4VD 5ICZB 1FFPB 5A16B 4MD0A 1NFDF 4TQEL 3F6LA 3QI9C 1RK0A 1Q1JH 1F11B 3QEQA 1VB9A 4DGIH 1NDMB 2JJTA 3ARUA 5I30H 3GBNL 3JV4B 4JVPA 2WWMD 4Y4KB 2VZVA 3DARA 1T80A 5F9DC 1A7PH 4MJ2A 4UTAH 1GCFA 1WF5A 3V5HA 3ZE1F 1FYTA 2A74B 3WS3B 4RMUA 4KZEL 2ADFH 1U8LA 4XB7A 1RHHB 4KWUA 1RUMH 4P46C 4NHUB 5E95B 3KPRB 1K4DA 1QQDB 4G43B 1P7KA 1RIUL 5SV4A 1C08B 4RIRB 2L7JA 5EOCJ 2PCPB 3KPLB 3VWKA 1GGIH 1DLFH 4PGCB 3P0VL 1HILA 3WJLC 4FQLH 1N59A 3GMMA 3Q6FB 4K7PY 1FZJB 5FO8B 2Y5TA 2GCYB 1AHWB 2A38A 3L9RA 3IGAA 3VFNA 2GIYA 3O8XA 2R9HD 1TITA 1ZHNB 4RZCB 2IQAA 5HD8D 5A2IH 3ZYIA 2OSLA 3QUXC 4BFIB 3G5ZA 2X4TA 1J05B 1NAMA 3JV5A 3WLWD 4XXDB 3GUTA 2H45A 1LNUA 2EDXA 4I0CC 3S88L 3ALWA 3TBWB 1L6ZA 3MLVL 4LSVH 1ZLWK 2P24A 3VD3A 4ZD3L 3FOLA 4XCEB 4L3AA 4Z7NF 2AS5M 5BZDB 2VSDA 25C8L 3U9PH 5DA0B 5INDB 3G6JF 2K1MA 2Q7YB 1Z9SA 5FYLD 2JJVA 4D94A 4I18C 4XNMA 3KLHD 1WCQA 5IB4A 2CH8A 5ALBH 3U2SA 5C8JB 4PJFE 5DQ9A 2AJYL 3GRWH 1AQKL 5BS0A 4CAGA 4JZJB 3KPRA 3E6HA 1FZMA 4PJ5E 4PLOB 2F5AL 2DDQL 1N6QL 5DJYB 1J18A 1X6NA 2V5TA 5M94B 2JIXD 4YIQA 3S37X 4GRWE 5ADOL 5E2WH 3T4AB 1IGCL 3QFJB 3MNZA 3HC4L 1Q9KA 3PDOA 1A5FH 4XGZB 4OQTH 1BFVH 1KIRA 2DLIA 4IBLT 5D6DC 3T77B 3ARQA 1E27A 1ES0B 1UVQB 4Z5RA 4M48L 5F6IC 1QTYT 5GRUH 2DWEB 3UTTB 1H3GA 3SDDA 4LEXL 4G6KL 2F53E 3SDAA 2ED8A 3KYKL 1INQB 2EIBA 3HNSL 4PRAA 1S7SB 2X4UA 4FQ2L 3T0EB 4KKCD 3QQ3B 5E03A 4AM0B 4CRPA 5FGCE 1MI5D 2IFFH 5IMKA 2NXYD 5I17A 1QBLH 3FHQA 4FQHA 1Q0XH 3GIVB 8CGTA 2X4NA 5IFJB 2F54B 2Y36L 4NQCB 3MLSL 1HKFA 3O6LH 1T4KB 1FO0B 5DD6B 1F4WH 1RV6X 4ONGL 5HYSA 4DFHA 2Q3AA 3WFHA 1JI1A 3QCTH 3G08B 3HB3C 1A6WL 5DD3H 5JIHA 1NLDL 5CP3H 3MZGB 3LV3B 1A3LL 2V5YA 2CLVA 1IBGL 2BNQB 2NY6B 3OZ9H 4LLMB 4WRLA 4OKVB 5DUMH 3BEVB 2NY3B 4PJAF 4WFEE 3V79C 4IS6A 3MRDA 3O2DH 5ECJE 4XC1H 2A0LD 3TEUA 2KUTA 4WFFE 4JPVH 1CLOH 5GGQH 2HWZL 3HMWL 5HHQB 4M9PA 4LCCA 1JGEB 3HC4H 1A6UL 2X4OA 1KELL 2G9HB 3PABA 1HXMB 1OARL 4G9DB 4XNZB 2VDKL 3B9KB 5J0BA 1FV1B 5T3XE 4OFYA 3P4NA 1YYMH 2CKNA 5GRXG 4W81A 4ODHL 2V7HB 1I7RB 1ORSB 4X6CB 3STZA 5CEZH 1TQCB 5IW1B 3STLB 1T5WA 4QRPD 4IRZL 8FABB 5IR1A 1SJHB 2CLZB 4PJ7A 3WFBH 2NLJA 1XGQA 1P53A 2WIIB 5FA4B 4MSWB 1DR9A 5C2BL 4WVRA 1WBZA 2D3VA 3NFSH 1PKQE 3D1MC 1LK2B 1PVHA 1JPGB 4XTRD 3WL9A 4H88L 4OAWA 5HHOD 3MLTA 3MCLL 2GK0B 1LK2A 1H8OA 2BVPA 3IXTA 1LO4H 1YEEL 3DV4A 1MI5E 4JRXD 2BNQA 5D7KD 3THMH 1SYVB 3L5WA 1ZHBB 3KPQA 1BOGA 5IEKA 2AJ3B 2OR7A 4UIMA 4ODUA 2CIKA 1PAMA 4NCDA 4OCWH 3GRWA 3L5WB 3ZTNL 1I9RL 1BVZA 4Y16A 3VI4E 3BWAB 5C09B 5DVLA 1FNSL 4FXGA 5TE6H 3UP1A 3EFFA 4MNGB 4P59L 3GMLB 5T5FH 4RISH 3SKJH 3RKPA 1XIWD 3BHBB 3UPAA 2OM5A 5F96L 4F3FA 4I3SL 1CZ8L 4OQTA 5EBWB 1C5CL 1A7BA 5LGJB 3D3VA 3QG7H 2QADB 3NA9L 1AD0B 1AC0A 5GGRA 5AAWA 5KTEH 3G04A 8FABA 3D3VE 4MLSA 4WI7A 1KCSH 3MV9B 2JIXA 4OKVA 3F7QA 5IHUH 2ZSVA 4PJ9A 4WFGE 3KLSA 1CLYH 3MRGA 4W6XB 3V52L 3DGGA 1A7RL 2RCSH 4NZDA 4PS4L 4OCYH 4LQFL 3OJDA 3VXUE 4KMQA 4WO4D 2EO1A 4O58H 1QEWA 4ELMF 1OP9A 1WT5C 4C55A 1RMFH 1AJ7L 2HFTA 4KVNL 3H3PH 5HXMA 3BRFA 2B7DT 3A6BH 3QDMA 3PP3H 1A6VL 5C0DB 3U82B 5BOZG 3RZCB 3MRBA 5JQHC 1ZT4A 1OTSC 4M43H 4FXKB 1ZHLB 4PJ7B 1U3HC 4S1DD 3TBVA 4LSQH 2H32H 2R23A 5I1CH 1N7MH 2OZ4L 3F65A 5INDA 5L88L 5IESH 5E7BA 3JSSA 1S7XA 4X6CF 4HHAA 3UTTD 3X17A 4M5ZH 4ZXBD 2GSGB 2Z9TA 1G9MC 5I0ZA 2X4NB 1KV3A 4XP4H 4ETYA 3DRQA 5KVGL 1G6VK 5KVDH 1QACA 5HHPA 5MEQA 3D39E 1MCEA 2PXYC 3QB7C 5C0IB 3WNLA 3DXAB 3HI6L 2QSVA 4PJ8D 1A9BA 4HS6B 1BP3B 4I0KA 3EKCA 3K4ZA 1PY9A 3MLZH 1E4JA 3KPSD 3OKMB 4IOIA 3DECA 2AEQL 3L7EB 1X5IA 2YEZA 3MRDB 4WNQA 4JJ5A 3K4AA 3D2UD 2DQDH 3RVVC 1FVEB 5LJYH 2D7NA 4UTBH 1YC8A 1J1PH 4MNGE 5EO9A 3NCJH 3U0TA 5IJVB 4XXCC 1HH9A 4IIQB 1WFNA 1YPZF 4YHNB 2BC4A 4IOSD 2CRIA 2XN9E 4NGHH 5EORH 3BP7A 4BH7A 1JRHI 3BPCA 3QNYA 4P9ML 1JK8B 1SBSL 4O9HL 3QQ4A 4Z7VF 3QXTA 4I48B 4XH2B 4APQA 2O61A 5E5UB 3K81A 1H3UA 4FFWC 3AVEA 5DURD 2ADIB 3PWUA 5C0CA 1LE5A 3GI8H 4UT7H 3IDXL 3P9MB 5SX5K 3VDCA 4WI3A 4UUJB 3QHFH 1SY6A 5I1JH 2DJSA 1HYSC 5C0AA 2I9LA 3QUXA 3CC5B 4L3EA 3NFSL 2Z91B 5CZXC 1XIWC 3UTQB 1A7QH 2ZZUT 4XMPH 2OQJA 2VDNL 2DM4A 5T5NG 5HI3C 2YA0A 3H0TA 4QRRE 2XZQH 1DL7L 5I8CA 2MQCA 4NQTA 4M6AA 2UY6A 4NIKB 3L5JA 4HC1L 5A1AA 4NP4H 3FQTB 1IFHH 2ICWB 2D7TH 4M5ZL 3ZLQC 5EU6D 4PJGA 2NY6D 1JGEA 3RGVA 2EDOA 2G5BB 3T0XA 1CLZL 4YDKL 1UH4A 5JXEA 1M6OA 4PRHD 3GNML 2E5EA 1Y18B 4HF5L 4LPXA 4LHUG 3NIGE 4G8EA 1KC5L 4MZ2A 4PLKC 3RVTD 3SN6N 1S9YB 5E2JA 3E2HC 1X44A 3CK0L 2GJ6D 3DX8A 4Z76A 1DQJA 2X1XR 4LRIC 4DQOL 5KBNC 2ZCKL 5E00A 5EB9A 3WE6A 1F5WA 3HI5H 5ICYA 2VC2L 4P3CL 3S5LB 3GSWB 4YGVB 2XWJB 1P7QD 1S7TA 2A2QT 2BSTB 5MERB 1NUFA 1NMCC 3BKJH 3GMNB 1KC5H 3OKDA 1IILE 3T3MF 5JZ7C 4NQCA 4TRPH 2Q76A 4U1NA 2W91A 3OWEA 4FQXB 4QHLB 3FZUD 1QPXA 5ETUA 3MRKB 2HTLD 5T1DL 3GZKA 4QOKE 2YUZA 1E28A 1IC5H 3C60C 3EBAA 2B4CH 3B9AA 3BDYL 2VYRE 1J5OH 3KDMA 1HNFA 1PZ5B 1D5BB 3ILPA 1DVFD 2QQKL 1WIOA 3RPKA 3QG7L 5I18L 4KKBC 5ENWB 3EFFB 1RJCA 4YAQB 3QI9A 4I5BB 1J10A 1H3TA 4N5UA 5T5FL 5GGVH 5C07A 4RX4D 4BELD 4U2YA 2JELL 1GSMA 2A77L 4NO0A 4PD4K 4NRZA 2ENYA 4RMQA 4AJ0A 1FL5B 2EIZB 4P3DB 5CGMA 3U4EA 3P73B 2DLHA 4EI5D 1KEGL 3HE7D 1TCRB 4BKLA 1DQMH 4UT7L 4NZUH 1FPTH 4HPOH 5C70A 1CDHA 4H5SA 4RRPG 5L8KB 1R5WB 4I18B 4XZUB 4WU5A 4NUGL 5BMFL 2BJML 4KKLC 1MJJA 1ZT1B 3D0VA 4P9MH 3VFPB 1WISA 3CSGA 2NY7H 2XZCH 2CDEA 3F58L 4JFFA 2YPKB 1ZT1A 3VMNA 2YPLE 4I2XB 3O81A 3IAPA 5I8EA 2DIAA 1DSFH 2WZPD 4E0RA 3U0TB 5IJVA 2D7PA 2FJFA 3RHWF 2AEQH 2VXTH 1RZKC 1QRNA 4DCQA 4PG2A 3WLBA 5B39B 4A6YL 4TNVK 2A6KB 3W2DL 3HI6H 2UZYB 3SCMD 2N4IA 2HMIC 5KSUB 1KEML 5AZ2L 4UILH 3WNPA 4M6OL 2Y5TB 1JRHH 2GITB 2NY6C 3PWLB 2VLKB 4HH8A 2P5EE 43CAB 4QLRA 3BEVA 2DBLL 2OX5A 4XC1L 2YBRB 4JR9L 2VZTA 3BKML 4PJ7F 4QHLA 5SX4H 3BOVA 4Z95L 4LHJB 3R8BB 3BAEH 1VSCA 1KEGH 4GRLD 1JE6A 2ESVE 3UTSA 4AIZB 2FEEI 4KI1A 2CD0A 4ZUSB 3X11B 4ZXBC 3KDMB 1F8TL 4PJGE 5DLMH 1AI1L 4HIXH 1YMMB 2DJ4A 3FT2B 1ZT7B 3T3PF 3K4DA 3QI9B 1CVRA 4LRIA 1CFSA 5D70H 4LSDA 2BCKB 1CK0H 5D7IB 1I1CA 4NQDB 1ZTXL 4Y4HA 4X6CE 5JORB 5D7IE 1JIBA 3GSOA 5JZ7D 4XBEH 3BZDA 4LHUA 3QH3A 3GEWB 3P73A 4MD5A 2XOTA 2CJUL 1QPPA 1SMOA 1T04A 5CIPB 1EEYA 4TQEH 3V7AG 2MQ3A 1OGAD 1MQ8A 3SDCC 3DHJA 1IKFL 3QFDA 2PW2A 5L6YL 3QUMB 2VIRA 5HI4D 1TVHA 1QBBA 4GLRI 3RZCA 5EZJA 4EKXA 5AG9A 1RJLB 2DLFH 1LILA 3U1SH 1CFQB 1A7NL 4ZFGL 3FO2B 4YR6A 3PWLA 5FUCC 4KV5F 3VFOB 2ARWA 4GXVL 1E4WL 4PGEB 4NRXB 1C5CH 4JZJC 1XGYH 3I6KB 2RGSA 2VWEE 1T0PB 3CK0H 3C08H 5JNYB 2XFXA 1WQVT 3GNMH 1BX2B 1N6QH 3FB8B 2ATKA 4P59H 2FGZA 3Q1SH 5HGGS 4UU9A 4DN3L 4I0PD 1KPUA 4NKIL 2IANA 3QO0A 1XCQB 3DRTB 4JHAL 4XBGB 4PGDB 4Q97A 1YEFH 4MMZC 5DEZA 4FZEL 4G8IA 5I16A 4XVUC 3SQOH 4K7PL 2YPVL 3WUZA 4YHNA 3I6GA 3MUY1 3C8KA 3LN4A 2D31A 3GMLA 2MJWA 2CRYA 3ULUL 2VITB 1AHWC 4ZUVB 1AKJD 2J88H 4Y4FC 2W0KA 1DVFB 3L3GB 3P4MA 4TSBH 5HHMB 2DQHL 1CDYA 1WLHA 3MRNB 3ZE0E 3JWOC 4WI6A 4M6NL 4HWBL 3OJ2C 4J8RA 3D39B 3P11H 5F1IB 1OPGH 3H42L 1KBGL 4AMKL 5L9DH 4QHUA 1RJZB 3G6AA 4X4ME 4Y5XA 1MAKA 2D7OA 4NYLB 4P46B 3SCMA 5KVFL 3JVGC 4ZUWA 4HWEH 2R2BB 1NFIB 1A0QL 1QRND 4YDJB 1CDIA 4PJ7E 4UQ2A 3BH8B 3J7HA 5FYLH 4W70A 3ET9F 4LSUL 2BDNH 3D69A 4L3EB 4N0UE 4HG4K 1JWSA 2GTZB 1SJHA 1A4KA 2CLZA 3GSNH 3TVMC 1P84K 4UTBL 3T1WA 5SX5H 4P0DA 1OWRM 2OS7A 2RAMA 2AGJH 2W92A 5MEQB 3QDMB 4LHQB 3VCLB 5F6HJ 5DD3L 5H2BB 4IOFD 4IRSB 4L8DA 3WKMH 2MPAH 3EFDL 1NGWA 3D0LA 1L7TL 3D85B 1A1MA 3OKOA 4I13B 1D5MA 4ISVA 4OBSA 1V3KA 3BH9B 2XY1A 5HGHA 3TNNB 2VE6B 4NKDB 5DJAB 5BVPL 5F1SA 5TH2B 4FMFA 4NQCE 1MJ7H 2R1YB 2EXWC 4N8CH 4TNWF 4KJYB 4X5LA 1Z9MA 3KNBA 5IFHL 3L3KA 3HAEG 1CFNB 5DLML 4FXGB 5T1KD 2HJLB 3U79A 1S7XB 4KK5D 4HJGB 1KNOA 1S78D 1MWAB 3WN5A 3NFPB 2MHAB 2VLME 4EOWH 3BI9X 2WAHA 2XWJA 1AJ7H 3SGKC 2FD6H 2ITCA 2FHBA 3MACL 3S7GA 1UKTA 1MJ7L 5LXGL 5I71C 1A6VH 4OF8A 5DWUL 4XCCH 1WC7B 2APWA 2NY5L 1U3JA 4XVSH 3H9HA 1S8DA 1S7WB 4EUPG 1YEGH 5KVEH 1AIFA 3LEYH 5I6XB 1AXIB 5I73B 4PJXB 4I0PC 5KSBF 3RNQA 4PTUB 2P5WE 3NZHL 3QP3A 3BPLB 2DDQH 4A6YH 4NWUL 5I1IH 2Z4QB 3VFWA 2EZ0C 5CCKL 2XKNB 2YS4A 5E24E 3WDJA 2FECL 2I5YL 3O45B 5EN2B 4L8DB 1KJ2L 4DGVH 1P69B 3OBAA 1I1AA 3QDJA 3PP4L 5D1ZD 3KPSB 4PRNA 3R06B 4G8FB 3RI5F 4NJ9H 3GSNL 1EBPA 4LVOC 3U83A 1N0LA 3CMGA 2XWBA 3DMMD 5IVXA 3BE1L 3D2UB 4KVCH 3VXSD 4PPTA 1G7IB 1MCFA 1CD9B 1DE4A 4OCNC 5ID0B 4TUJA 1LO0H 3BX7C 1R3HB 5E9DD 4OAWB 5JW3L 2GAZA 3WV0A 4WGVB 1LO2L 5F1OB 3TH2T 4YHYB 3O6FC 5EOQL 4HWBH 1XEDA 2AI0H 5IEKB 5CKAA 4D9LH 3GJFK 3BJ91 4OTXH 3IDIB 1K8IA 3ZKQD 3ULUH 2F15A 3MCLH 4L4TD 3MNVB 1CG9A 5BVJB 2XI9A 4Z7VB 4MNGA 3I3EA 3LKNA 3GSXB 4MZ3A 2QR0B 1RUML 4PV8A 1A6AA 4DKDC 3SQOL 4R6UA 3VXMD 4WNQB 4R0LA 4L8SC 3LQAC 1FVDA 1CU4H 3HAEH 1J11A 3IDNB 3EOTH 1I1AB 1HXMA 1RZKH 3QUZB 4JQXC 1TZHB 1BFSA 3CFIC 4X9GA 5DUPH 3G5YB 1R3JB 5J13B 1M71B 1N4XH 1R3IL 5IQ9B 2XFXB 1ZANL 2IQ9L 1NH6A 5TQ2L 3F12B 3U9UA 1OTUD 1RFDH 3IB4A 3ARGB 3F6IA 4TRPL 3VG0H 5IMOB 4R4FH 1XR8B 4DWHA 5KS9E 2W60A 1D6VH 5J06A 4ODTL 4O4YH 1H3VA 4OZGB 1G6RH 4OFDA 3DTXB 2J8HA 4YNYA 3B3IB 3WIFB 4KJQD 2WIIA 4AH2A 5DFVC 3QULA 1T1XB 2DQJL 4KPHL 3VXQA 1A3LH 3C5ZB 3GB7A 4TTDC 3BMVA 3KJ6H 3DSNA 4GW5B 4WFHE 3WN5C 3VCLA 3KPSA 3ULUF 1OSPH 2G75A 2BHUA 1KCLA 1KCUH 3MOBL 1FCGA 5L6YH 4JRYE 1RZ8A 3BT2L 3HMXH 4IMLB 1N0XL 4HLJA 1U93B 4TVPD 3WXVL 4N1HB 2H26A 3TC9A 4LAJH 5CILH 3DX7B 3MV9E 2FB4L 4OV5A 4OLUL 4ZS7H 4JY6B 2WQ8A 1U8PA 1F45A 1B0RA 5ESQB 3V4UL 3WDIA 3HG1E 4BQCA 4PJEF 4EI6B 4HIXL 2IFFL 2BP3A 4YHPA 2ESVD 4MXWL 4ELMA 3U2SB 2VDNH 4M3JA 5IF0B 3QXDA 3CU7A 2MCG1 4BK4A 2X4QB 1MAJA 3BUYA 3CDFA 3S34L 4YHZL 2WUBL 3RJQB 3TA3B 4L3CA 1HDMB 1HH6A 2NY1D 2J12B 1TQBC 2F54A 4OZFG 4ZFZB 3TESA 3QXAA 4JPWL 1KENL 3QCUH 2J8UF 1OGTA 2FR4B 4HT1H 1BFVL 3VH8B 5I8KL 4M7LL 4K9EL 4UILL