1M1SA

Structure of wr4, a c.elegans msp family member
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
109
structure length
109
Chain Sequence
b'HSMINVDPPTGNYPATGGNSTHNITSESDSRLAFKVKSSNNEHYRVRPVYGFVDAKGKSKLDINRLPGPPKEDKIVIQYAEVPAEETDPMAPFKAGAQQGEIIVKLIAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WR4
publication title Crystal structure of a C.elegans MSP family member
rcsb
source organism Caenorhabditis elegans
molecule tags Structural genomics, unknown function
total genus 19
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2002-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00635 Motile_Sperm MSP (Major sperm protein) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1m1sA00
2IAMD 3U2SA 3QIUB 2NY3B 1H3GA 3QO0A 4H26B 1LE9B 4LLVA 1I8LA 4LIQL 1A7RL 1MVUB 4J4PC 1MF2H 4JDTH 1CE1H 2NY3C 4R96A 4RGMB 1RZJH 3C5ZB 4PJ5A 3IFNL 4U1IB 4R8WL 2IPTL 3VI4E 3KHQA 4RGMC 2I9TA 2FBOJ 5DO2C 4W68A 4YBQD 3C5ZC 4LP5A 4FXKA 5JUEL 2WWMC 4G6KH 1PBYA 4NRZB 2W92A 2FBJH 2YD2A 3QDHA 1KIPA 1I7TB 1OP5H 2C5DC 4MB3A 4X6BB 1E28B 2R2BA 2XACC 2XZAH 5DWUH 2OP4L 4FQJL 5HGAB 4YDIL 5EZOH 2P8LA 3L6FB 1RZ7L 1CXIA 3NMEA 1JFQL 4HS8L 3MLTA 3JTTA 5LBSL 3EYSL 4HCRL 2V5RA 5IMOA 1U2HA 3PDGA 2BNRD 2X4SA 5IHUH 1AJ7H 5DD6A 1G9NC 1QLEH 1IM3B 3ULSB 4F7CB 3DVNB 4K7FA 7FABL 5L2JA 4X80H 2GW5A 1IVLA 2CK2A 5C09A 3VG9B 4EDWH 2R39A 3JVGA 2KKQA 4Z95H 3UPAA 3SE3A 3UTZA 4KZDL 3K2MC 4HLJA 1D5XB 3VG9C 3V5DA 1HOCA 4PRBB 4YFLF 1G7HB 3FFDA 4M03A 3UTOA 2GK0B 1FZMB 1C1EL 4NWTH 1LO4H 2NY5H 1Q9KB 4PJAE 4P2CG 3MCG1 1U3YA 4LCYA 1NKOA 1Q0YH 4WU5A 2JIXD 5DT1L 3BKYH 1HNGA 4LSTL 4KMLB 4XX1E 4LPVA 3F12B 4MQSB 3LPGA 1G7LB 4FXLA 3L7EA 1G9MH 3PWUA 1EHAA 5B8CB 3ZE1F 5JDSB 1NBYA 4X83A 4FHBD 4MS8D 5F6HJ 2CO7B 3IDMB 4P9HH 1N5YL 4WO4A 4O5LL 1W0WB 1T6WA 5DHXB 4NOBA 2PYFB 4FFWC 5FYLL 2QSCH 4G42B 5ACLA 2XXCB 2ICCA 3CLFH 4XI5C 5HI3C 1EO8L 4HS3B 4L4TB 1OTUD 2VLLB 3D3VD 3BSZL 4ZO9A 5EBLB 5DF0A 1XGQB 3LKNB 1P7KA 1JIBA 3ES6B 3MFFA 3JV6B 4K94L 3ARFB 3MNZA 5CGMA 2R2HA 5JLZA 4GT7A 4EBQL 3D3VE 3ISWA 3ARFC 1EHXA 3HC0B 1J8HB 3WV0A 3TH3T 2E6JA 5D7IB 3T3PE 3DV4B 3H8NA 4PB9H 5C0BB 5AWNL 4D3CL 1JWSB 2OTPA 5ALBH 5HVGB 4KUCF 5GRVK 5HYEA 5HVHC 4BK4A 4Z77A 2XRAL 4J1UA 2ZCHL 2CXKA 5IKCA 4Y4HB 1JV5B 3DUSA 1KOAA 4BQCA 4OCLC 4OCYL 5IB2B 4Y4HC 2CDEA 4XPBL 1AP2B 1ZSDA 2AXGB 2ZP0T 1DEEA 5JXEA 5HHMB 1XFPA 5HHNB 4YFEA 5C6WH 1MLCB 3O6FA 1JNLL 3VXRD 1E4KC 3RZWA 4TOYL 2KH2B 3TA3C 4JGJA 5F44A 1QHPA 2HRLA 3QHTC 4AT6A 1DQLH 4TNVF 5JHDD 3VXRE 1DUYA 3GJFA 1BZ7A 2ARJA 5DMIL 2UZYB 4PJFB 4GG6B 1BVLA 5C8JB 4TTDC 5JHDE 1VFOA 1JRHL 2HTLD 2F74B 5HHQA 4GMTH 4OFVA 4M1CD 3INUH 3V6FA 3ULVF 2YPVH 3CSYB 1G6RA 5TF1L 4WW2F 2RFXA 3LV3B 4Y2OA 3BMVA 2NZIA 3U79A 3GMPB 1NL0L 1F8TH 3OR7B 2DQUL 3C9NA 3HC4L 2Z8WC 5C6TL 1DN0A 2BHYA 1R3JB 3KJ6H 4ZUUB 4C56B 4WUKH 3PHOB 4PRIB 5SX4H 1A6AA 4KI5F 4LVHB 2YRPA 4KTDH 4U1JB 2X4TA 4OM0L 4AL8L 1H15B 5E8OB 4LVHC 3KVQA 5DHVB 5GS0L 5MEOA 1P84J 1P4LA 3NTCH 2I5YL 4OTXH 1A4JA 3HZYA 1DUZB 4EIGB 1U8QA 1RUAH 3V4UL 3RZCD 4OZGF 3QAZC 1D9KA 1SYVB 3MRRA 4ZUTB 3VI4F 1ZHBB 3IDGA 1UCBL 1RJYB 4LEXH 4P2YA 4ZMAT 3FQUA 4YHKH 2EO1A 1A3LL 1B88A 4H0HB 3QUYB 1GOGA 1A64A 1GGCL 4R7DA 4WWKB 3IJSB 3QRGL 1VADB 2JELH 2WINA 1YC8A 3QUYC 3O9WB 4WWKC 4XHJD 3R06A 3HG1B 3G6DL 5BXFA 4H5SB 3HRPA 4QXTA 1XF4B 1BREA 3IXTA 1IQDA 1RQ5A 5E1AB 5K9JL 5EDXA 3ARGD 5DZNA 4OQTH 1JGDB 5I0DA 4RISH 4ONGL 4PJIE 4UQ2B 1RU9L 3U4BH 1RFDL 1SHMA 1RK0B 1NGWB 2R0LL 3G6JE 2DLGA 4LLWB 2HKHH 3QUKB 5ESVA 4BK5A 2R2EB 2CD0A 4JFDB 4S1QL 5DUBA 1BLNB 5IW6A 5LGKA 3GSWB 1QG3A 3AAZB 5KVFH 1F3DJ 4HUUA 1FFQA 1IM9A 5E7BA 4G7VH 1LNUB 1LO3H 5I75B 3PNWB 3GMQA 5CP7B 1T2JA 3MUY1 4PJAF 4QOKB 1AQKH 2BRRH 1A6VH 1JWUA 1L6ZA 4U1SB 3SOBH 2BNQA 5DURB 3ROLA 3QCUH 2X7LA 4LSSL 3WNPA 2C3VA 3RWEA 4X7FC 4DCQA 1OTSC 3V6OE 2P8MB 5JW5B 1CFNA 4IHOB 3W0WD 4FQIL 4LL9A 4DGVL 4JRXD 1E4WH 1AXSA 1RVFH 4IMKA 1EVUA 3PP3K 1FFNB 3T3ME 3TWCL 2EDKA 2XA3A 1KTRL 3VCLA 4X6CB 3W0WE 3U0PB 5F7DA 1WCQA 1FVDB 3RAJH 2G75B 1SVCP 3IF1A 1TETL 4NQUA 3OJDB 3QDGD 5FO8A 1KCRH 1CZ8L 2YSSB 1ZWIB 1RMFH 4KQ3L 1TJIL 3RIFK 3STLB 3VRLE 3ARBD 5I1DB 4Y5VB 1LDPH 5E6ZA 4RWYH 4MB5A 3SBWA 3T1FB 2FRGP 3QDGE 4KK9C 4MA3A 1JZ8A 4Y5VC 3PABA 4MB4A 5DJAB 1S7UA 4L1HA 1QTYT 3LVEA 1EHLL 3N9GH 4JFQA 3T3PF 4NQEA 1MCOL 1FCCA 1FNLA 3NABH 1CFQA 2IWGA 2K7PA 3QQ9C 4YBHA 2R4RL 5TH2A 5DQ9B 1OAYH 2B4CH 1U3ZA 4RSVA 1ZT1B 2DQHL 4XH2A 3U4EA 3MJ9L 3GMLB 4MCZB 2MCG1 3WO3B 5FCSH 2NYYD 1YN7B 3QA3B 4MA7L 5C0JA 1DVFA 1YNTB 1KTKE 2CSPA 1CE6A 1UC6A 2IANB 2K3TA 2YEZA 4AIOA 2P5EB 3UJJH 1DE4A 4F15B 1YUHA 1IAMA 2XN9A 4K23H 3FT3B 4M48H 2DL9A 4WW2A 4JFPA 3GSUB 3P30H 4F15C 1X5GA 1DP0A 2EDLA 1T22A 1MLBB 3V4PH 4Z76B 2AQ1A 3GSVB 4PRHB 5I1EL 4FNLH 3V5KA 2L7UA 4ZS7L 2Z31D 3QEQA 3SDAA 3U4AA 1CD9B 1NGZB 3N1QC 4BH7A 1FDLL 5I73B 1MFDH 2R1WB 1MJJB 2BSSA 3GDBA 4HBCL 3TGXA 4ETYA 1YQVH 3PJSB 1ULVA 4OZ4A 4XT1C 5I73C 1IC4H 1KPUB 3D39D 3FB6A 1AXIB 2G9HB 2CIKB 1F4YL 4CN1A 1T6VN 4OZGA 4UDTB 3K1KC 2R8SH 1IEAA 2D31B 3D39E 4JANA 1T1YA 4NN5C 3TBWB 2IJ0C 4G8EB 2XFXA 3EFFA 5CD5D 4IJ3C 1OF2B 2YA2A 2ICES 3CD4A 4N0FB 1FNSH 1Z9MA 1CCZA 3RHWF 2Q20A 4IOIB 1OTTD 2ZUQB 1TXKA 3HN3A 4L29A 1A6PA 3K2UL 1NFIA 1RJZB 1KBGL 4F7TA 4Y19B 5F7NC 4ZOBA 5TDOA 1GC1C 1FPTH 3RWIA 2CUMA 2ZUQC 4KKBD 5FGSA 1BQLL 1N2RB 5JOPD 3T0WA 4U6YB 1A2YA 4NM8H 2SEBA 1A1OB 3PWNA 4QTIH 1CLOL 5JOPE 1ORQA 1PG7W 2EYSB 3GZKA 1F2QA 3S37L 5MI0B 3SE9H 1GVIA 3EBAA 3H0TA 3PV7A 5IMLA 4FFYL 4F33B 2X10A 3WEXA 2E8YA 4XCYB 3DSFH 4PB0L 1XF2B 1GAFH 1TQCC 2OSLB 3MREA 4GAGL 4JRWA 1LO0H 2FNBA 2X9WA 3LRGA 4OLWL 5ALCH 5C6PB 3WIHA 3RX7A 1YJDC 4TVPD 1FZKB 3CDGA 1MCQA 4NP4L 1BHGA 1AGBB 2XWBB 5DJXA 1A3RH 4L3CB 5D2LE 3RJQB 3VXNB 1MQ8A 3ZTNH 5ACMA 4MXVE 4PJIF 1KACB 2HVJB 3QUMB 4TVPE 3VFNB 4MJ2A 4X4XB 4M7JL 4OCRL 3G6JF 2D7MA 5CJOL 1FJ1B 2AJZA 4HKJB 4PBVC 3F7YB 2ITDB 4NYLA 2LE9A 3BAEH 3IAQA 2AERT 1P7QA 4DKDC 4M3KB 4OD1L 5TJWK 3PG2A 4IDJL 4DN4H 5DD3L 2D9QB 3OWEA 2ZOLA 2QQLL 5HD8D 1M7DA 1QBMH 4WI5A 1LP9E 2EE2A 3W2DL 4M1DH 4PIRF 5D7SH 3HR6A 4Z7VE 4NNXB 4QRTA 1BIHA 5FYJD 5KSAC 4O2CB 3RUGB 1H8SA 4XMPH 1DEDA 5IG7B 2NTSP 5L8KB 4PGCA 3SDDD 4CMHC 5DTFB 5FYJE 3T3MF 4Q97A 5I15H 4WNQB 4HT1H 4BH8B 4XP1L 3MBXH 2FJGB 4LLMA 1VGKB 3DO7B 3CGTA 4YXLH 5HGGS 4KMTH 3U48A 1S5IH 1U3HA 2VXQH 1XT5A 15C8H 4PRAB 4YNYB 3CVIL 3VRLF 3QNZB 1A7OL 4X8XA 3AS3A 2A6IA 5HYQB 2E5EA 2EDXA 2BVUA 5JORA 4L4VA 3OKDA 4MXQC 1K8IB 1YMMD 1XGRB 2DYPB 2WV3A 1OAZL 1X5HA 3HPJB 3PP3H 4PG9B 2ORBL 4MNGE 5TDNA 2X89D 1KT2A 1RUML 1X5ZA 4PREA 1YMME 3WIIL 5A2LH 5DVLA 3VFOB 3HA0A 1TZHB 4HFUH 1TZIA 1I1AA 3UJTH 4KDTA 5BW7C 1A22B 1VFAB 1LDSA 1AKJB 1EEYB 1WBYB 4OF7A 2VC2L 3MPCA 1MIEL 3GJEB 1A14L 4G8FA 4Z0XA 2W9EH 4WI4A 4NO5A 4EUPA 1NCCH 5HYJA 5KSVA 5FUOH 5I1HL 5ICYA 4JPWL 4NSKA 3O6ML 3QEHB 1WT5C 1D5BA 2CRMA 1D5ZB 4E5XB 3C5SA 3MXWL 4KV5E 3SQOH 3MRJB 1ZA3A 4P3DA 3HE7A 4HUVB 1WLHA 4JQIH 4P4RA 3RDTD 4YAQB 4HWZB 1F42A 4HXBH 1FHGA 3VXTA 1JCKA 3CVHB 3MV9D 3O41B 3BH8B 3TO2B 3WXWH 1F3JA 5HHXH 2VXTL 4UILH 4KJPC 5I6XB 5GGTL 1UT9A 4LOUD 2OS7A 4UT9L 1FVEA 4PJ7E 3LMJL 1AO7B 4KWUA 3FONB 2FGZA 3MV9E 5I6XC 4YHNA 3VXPA 4CADA 5BQ7A 3M8OL 4CAGA 5BJTA 1AE6H 3HCVB 1WIPA 1JTTA 5GGTA 2EXYC 2X40A 4LLDB 1G84A 4JAMA 3DX7A 1NGQH 4E0RB 1FSKB 2LVEA 1WV7T 3HC3H 5C2UB 4ZXBB 1KLGA 2CJUH 1V7MH 4LQFH 2JK5A 3CLEH 3E8UH 1MFAL 1UXWB 4XCCL 3CSGA 3PWJA 1VEMA 4G5ZL 3GSNA 1VGEL 4G3YH 1FZOA 4ZXBC 3V0AC 1MUJB 1HNFA 1GRWA 2MTPA 2VL5B 3KLSA 3MTRA 4PJ9A 1WBZB 5BCAA 5E9DA 2Z9TA 2CDFB 4FQHA 2DQFA 2X4QA 1PZ5A 2GJ6B 5HYIA 2PYED 3STBA 4NM4H 1DSFH 2RCSH 4WCYL 1HILB 1HYRC 4RGNB 3QZWA 1KJ3L 2Y07H 5K9OB 4JKPH 2PYEE 3OKYA 1H8OA 4K8RL 3DYMA 4JN2B 2YPKA 5KN5A 4I0PB 3QIWC 3G6JA 4RGNC 3ECBA 4Y16A 4JPVL 5E5MA 4DOHE 3TVMC 4XXDB 1FLTX 5A43C 2WUCH 1NMAH 3RL2A 4I0PC 1F5WA 5HJ3B 1NCAL 2P46B 4J3UA 2P47B 2APVA 2GCYA 4QY8A 4IRJC 4HZLB 5E70A 5B38G 5SV4A 5D2LF 3KG5A 4LNRB 4KJQD 3G04B 4M1GH 1B0RB 2C7UB 4LSRL 4HJGB 4D9QD 3U6RA 2DTSA 4XTRD 4K3GA 2Q8BH 1VPOL 5IWLA 4ODHH 3ZYZA 5IJVA 4D9QE 2B0SL 4NUGL 4NKMA 3X14B 5E6IB 2FX7H 3RA7H 2D4FA 3HI6H 4O2FB 3I6GB 1Q9OB 3W0WA 5CZVL 5E6IC 4DK6A 3W82A 1ZHNA 1INQA 5EU6A 4M9OA 4TN9A 1LP9F 2JLLA 5CP3H 3WNMA 4J6RH 3MLUH 4Z7VF 3DYPA 2XWJB 4JN1H 5E1HB 1TCRB 2VISB 3MRLA 5D7JB 2DQIL 2VXUL 1GPOL 1Q38A 2N1KA 1PW3A 3CX2A 1UM5L 4UT6L 1CT8A 2VN4A 4A6YB 4F9LA 5J1SC 2YN5A 1IAKA 5D7JC 2Q76A 2DWDB 2IQAB 3H9HA 1FBIL 2BXYA 3Q48A 3MRBB 3BD4A 4ZS6C 3O3DA 4V1DD 2VH5L 4F7PB 5GJSH 4H1LA 4JPIA 3ZL4H 4I5BA 4MDIA 3QULB 1AQDB 4NPYB 4LASL 4YO0A 5CGYD 2JJWA 3F58H 3NCYS 4V1DE 4UV7H 1FL5B 3AU1A 3PIQB 4QTHA 1AR2A 2C26A 2VNCA 3MLZL 4MJ5B 3PXHA 3ZKND 4G6FB 1W72L 3MYZA 1LWRA 5JHLL 5JA9A 3CSPA 4RGOH 4S0SD 3U9UA 1RAMA 4GW4B 1KJ2H 4IRSB 1KPRB 2Y36H 5FGRA 5I1IH 1IARB 5IF0A 3ZLQC 5I18L 4ONHA 3BYTA 5B39A 1ETZA 4OB5L 1V5JA 3O4OC 5T5FL 4EOWL 3AXLA 2CGRL 3P9WB 4JE4B 1DLHA 2VZ1A 5TE4H 1FAIH 1KCVH 2QJDA 5C86A 3U7YH 3TJEH 5CWSA 5DS8A 1S7WB 5AZ2H 2VDNL 5D4QA 4NZTL 1KELL 2ERJB 1NC2D 1CDHA 4F8TA 1KLUB 1WTGT 1KN2L 2H8PA 1HWGB 5KSUA 2ERJC 2V6HA 2EEAA 4NO0B 4WJ5A 2NQCA 4M9PA 2OZ4H 2GFBB 3L5WB 5CMAA 3RIAK 2D7TL 3UTSB 3QPQD 3A0OA 3KPLB 4WY7L 2BFVH 1QD0A 4C59B 4PJGB 4X6FA 4PP1C 5E2UH 3WLWC 4XMKL 3TZVC 3V0VB 3GBML 4PJ7F 5BOPA 5KVEH 4YQXL 5GGRB 3VGHA 2BSRA 4R26L 1QSVA 4GJTB 1RIVL 2HVKB 2V2WA 4NUJB 4M8QA 4P4KB 3LHPH 4CRPA 1QRKA 1XIWA 2BOCB 3QIBD 1YN6B 4JRYA 4RMTA 1EFXB 1T1WA 4P4KC 3AREA 2JB6B 4ZO8A 1MCNA 1BX2B 3QR2A 5BRZD 3VG0L 5EORL 4Z7OE 1EEZB 1FNHA 3MRQB 1EGJA 4KQ4H 1HYSD 1QSEB 4X7CC 1UM6H 4NKOA 1EMTH 3GSXB 3VFTB 4GRLD 4OCXH 2VAAB 5BRZE 3BP6B 4PGDB 1VEPA 5JMRA 1ZV5A 4RIRB 4LF3A 1ZVSA 1UH4A 4GQ9H 2H45A 1K3ZA 3QHZL 5IK3B 5ITBH 3GHEL 3BEWA 4CBPA 1L7TH 1P4BH 4LAQL 3M17A 1I8MA 3SKNB 3ALXA 4KJWD 4IRZH 2C3GA 5GPRA 4FG6D 1G7JA 1JPGB 4HMDA 1FYTA 3CFKB 3RVWD 1FV1B 2KZWA 3QFDA 4Y0GA 4R4FH 1Z0MA 2X4UB 1R5VB 3W39A 4GFTB 2G2RB 1E4XI 4YDKL 2FX9H 4K3EH 5T1KD 5FYJL 1WCBB 5IESL 4DVBB 3BRFA 2OBGA 5EA0L 1F2XK 3ME0A 1DFBH 3ZE0E 3T08A 1N6UA 1X4XA 2DMKA 3KPNA 4I3GA 2C9AA 1ES0A 2DQCH 3MACH 1J1XH 1A21A 4R2GD 2H41A 4O51B 1XGTA 1MFNA 3VDBA 3WIFB 1FNEA 1A9EB 3FO9A 2C1PA 3BVNA 1JMZA 3LN5B 5I8EA 1X4ZA 2B39A 1SJEA 4FQXD 3EO0A 1V3LA 4JG0H 5HDQH 4LLYA 3SCMD 3PWLB 3JV4A 4GXUN 3TT3H 2R9HD 1MHPL 3EOTL 4OFIA 4RFNB 5EUOB 4DWHA 4DQOL 4YHYB 1BFOB 3P9MA 5IR1A 4XP6L 5H8DA 3LEXA 4F37K 4U6HB 3E0GA 4YWGL 4KKCD 3A6BL 2XKNA 3DX6A 1AD9B 2O26U 5D1ZB 1D5MA 5F1IA 4KJYB 4QHNB 1Q9LB 3Q0HA 4ZAKB 1BAFL 5D1ZC 3B43A 4LCIH 1XGPB 3BRDA 3RNKA 3QDMA 1EK3A 5LQBH 1MI5D 4ZAKC 3U83A 5C0EB 1YYML 1J1PH 5F70A 2DQEL 4WI7A 1KYOK 3RY5A 1KXQE 1HQRA 2VR5A 2GT9B 3VXMB 3IU4L 4HLZH 1MI5E 2JCCE 4N0UB 2NR6D 4HXAH 1P6AB 2UYLB 1OAQL 2VYRE 3Q6FA 1AHWA 3S97C 1PY9A 4M6ML 4XXCA 5A3IC 3UTTD 3ARVA 2R2CA 1S9XA 5CSGA 2H6PB 2OTUB 4M93B 1NSNH 5DI8A 5I1LB 3ULUC 3UTTE 4KZEH 6FABL 4LLAA 3DNKA 5FB8B 4M93C 5CEXA 3RVVD 1FO0L 1VDGA 2V5TA 5F7YC 4DUXA 2CUHA 3DURA 4HJ0C 3SKOA 1NGXA 4HKBA 1FRGL 3I6LD 4MNHA 2IF7A 4OSUL 5IVZA 2YPLB 5E0QA 3WJLC 4HIIA 4XVTH 1BIIB 1KTLA 4HKXA 4DZBB 2VSCA 4C58B 1FO0A 1IKNC 5IB3A 3UYRL 1TVHA 1ZTXH 3FQNB 4LVEA 2A6DA 4WU7A 1V7NH 4CVZA 2PO6A 4YHML 3BJ91 3V5HB 1M71A 3MV9A 4EQ3A 2VDQH 1DDHB 1EAPB 4LSUL 4KRNA 4M6OL 1IGCH 3HNSH 5KW9L 3C8KA 4WUUE 1M05B 4NWUL 4R4BB 1QYGH 4UNUA 1IQWL 1AGEA 1NEZG 1NC4A 3RQ3A 3O8XB 1F6LL 4FQQB 5D1QA 4HPYH 4BA8A 1MJ7L 2EKSB 4R90H 1NBZB 1CGSH 4HMCA 2W91A 5CIPA 2KPNA 1BQUA 2AK1L 2HJKB 4GRWH 2Q7YA 1I7ZA 3BP7A 2PTTA 5F9JA 1U93B 1IL1A 4KVCH 4AYFA 3IU3A 4WIQA 3Q3GA 3MV8A 3MNVA 3X3GL 3IS0X 4NZRH 2BVPB 4L8DB 1Y0LA 1CTOA 4PJHB 3ZKQD 3GMMA 4AIXA 1YYLH 5D5MB 1YECH 1ZT4B 3BPCA 4R97B 4N5UA 1XZ0B 1A6UL 4ODTL 4NZUH 4YE4H 5IFAL 2E27L 4HX1B 4QF1B 2FD6H 3UEZA 4R97C 2IGFL 2EIDA 3K74B 2I07B 5LAXB 4Z7OF 1MF2L 4HH9A 4JDTL 1CE1L 2G5BB 2J8UE 4Z8FH 5ADPH 1G7QB 3KLHC 5KJRL 2ID5A 3HRZA 1G0YR 3NIDE 1MRCH 4OUOA 1OGTA 4XPAL 3C08H 5JIIA 1JYNA 4TSCL 2PCPB 4RMVA 5I17B 2XPGA 5ICXB 4ZSOB 3HUJE 2PTUA 1I7RB 3F62A 3STZA 1YEDB 1AGCB 4S2SA 4HV8A 3OF6A 5DQDH 5TF0A 2WWMD 4XVUD 5FK9A 1J11A 3B8SA 4CN6A 2ZUVA 2AABH 3VJ6A 2WANA 1X5IA 1AIFB 3RGVD 2OTWA 3SE4A 1I9JH 4XWGL 5LG1A 1QA9B 2HWZH 5IB4A 4J23A 4AIZB 1N4XH 2A2QT 5B3JE 1WICA 3A6OA 3DYOA 3ARTA 1CFVH 4X7TB 1KFAH 1LGVA 5HGBA 2ICWJ 1QSFB 4ZODA 2NX5B 1IAII 5GRZA 1CLYH 3JWDL 4QRSB 4Z95L 4NDMA 2EH8H 3FQRB 3OKOB 1C5CH 1J1OH 1GGTA 2OXHA 4K3HA 4JQXC 5GISH 5DK2A 2Y5TB 3U36B 5DRZB 1LO4L 1IEBA 3LH2L 4ORZC 1MNUL 5E7FA 1KCSH 3HR5B 1Q0YL 1IAOA 1VKXA 3W9DA 2F19H 3O0RH 1QFPA 4GKNB 4XAWH 5IQ7H 2YXFA 3THMH 5FA3A 1G9ML 3C5JB 4NKQB 3OPZH 2CK0L 4ZPTB 4JFFD 1OSZA 4PYHA 4FABH 3MRNB 1LHZA 5EH1A 2X4SB 4PJCE 3BKCH 1KCUL 3B6SA 4KK6C 4LLQB 4JHZA 3LD8B 4PRPD 3VXOB 3NA9H 4UINH 1WJ3A 4JFFE 3LD8C 2QSCL 2X4PB 3KLAA 2BC4B 4JFHD 1AC6A 4PRPE 1QNZL 5C70A 1F00I 1I4FB 5I1CH 5ID1A 2X4NA 3K1DA 4C55A 4ODVH 3DI2B 5GS1C 4FFWD 1XF3B 4JFHE 4G8GB 1NDMB 4PUBL 4PGBA 4I3RL 2FWOB 4CVWA 4UUJA 1I9IL 3VD7A 4F7EB 4GXVL 4OZIE 5HYSG 5FO9A 5EO0B 1CU4H 4L3EA 1DN2A 3H7LA 3LQAL 4PB9L 2W9LA 4MJIA 4B50A 2B2XH 3QP3A 3B9KC 4PJXE 4ELKB 4WFFD 3ARFD 3KYNB 3IFOA 4JFYB 4RMQA 3DVFA 3FQTA 4MLSA 5T3ZL 2ILLA 1G7IB 3VA6A 2KBGA 5F1SA 4CKVX 5TQ0L 3P4OA 1JL8A 1RPQA 1M6OB 1BFSA 4WFFE 1HHJB 3K4ZA 4Q58C 5FDYA 3CFBA 3WFDH 1HHHB 5E2WH 3U9PH 1HXMA 4YH6A 1B2WH 4Y5YB 5E8EB 3CDYA 2MOVA 1CGVA 2P24B 4Y4HD 5CKAA 4GOSA 1DLFL 4Y5YC 4Z78B 5DK3A 3H9YA 5DJCB 5JLZB 2XQYK 2ZJSL 1DQLL 1MWAH 4D0CB 4ERSL 3KS0H 3OKMB 5JR1H 3BN9D 2QQQA 3TA3D 3B9VA 1VHPA 5CSBA 2QKIA 1MJUL 2X9XA 2AJYH 1UWGH 5EZLB 4U1LB 2BNUA 4Q9RH 2XXMB 3VH8A 3EGSB 3QDJB 1YEEL 4YUEH 3WO4B 4J3VA 2UV3A 2D0HA 4J7RA 1LO2H 3QIBA 3WO4C 4DJMA 1TVBA 2H3NB 4XZUA 3BESR 4Y88A 1FLRH 1I9RH 4P5MB 2EDTA 5DVNA 1AR1C 1BBJB 3BPOC 4ZNEE 1SJXA 3LKRA 1I3UA 4GG6E 2OJEA 3KJ6L 1HN1A 1I1YA 4MWFB 3E2HB 1C08A 4OV5A 2F8XC 5C0NC 4GSDH 4C83A 5C0CB 5C0DB 4ZFFB 4KDVA 3E2HC 4RAUA 3WUWB 5F9AC 3NA4A 4S1RH 3KDMB 4LCWA 5EG6C 5JPNA 5IOPA 4OTXL 3EIFA 4QT5B 2CUIA 2J8UF 4C56D 1RUAL 3BMWA 1JNNL 3G5ZA 3IJHA 3NIDF 3RWDB 4X9IA 1FFRA 3NCJL 5EULV 3FFCD 3V6FB 4LEXL 5DMKA 4C56E 1KJVB 2FECI 3U0TA 3HUJF 4YHKL 1K6QL 4ZO6A 1M7IB 3MR9A 3PHQB 1RIUH 4NQSA 2CLRA 3FFCE 5I8CB 5ILTH 4P2QD 3EZJB 4L9LA 3EO9L 2RR3A 3O3BA 1U95B 3DHMA 4JFED 4UI2A 4FXGB 3JWOH 3T8XB 2A73B 4JPKH 3NPZB 3BQUD 5C07B 3CCHB 3N0PB 2HT2D 4P2QE 1U8PA 2FHCA 4JFEE 3L3DA 3TYFB 1L4IA 5B3JF 2NY6B 3C6LB 5A40E 2P8PA 2H26B 1J05B 5ITFA 3CXDH 5E8NB 3U4BL 5F72S 4U1KA 3N85H 2NY6C 4PYGA 2HKHL 1JZ6A 3FOLA 3TPKA 3BZFA 4HLZG 4XC1L 3DBXB 5FKPB 5I71C 4M7ZB 1JZ3A 3ZKMC 1SY6L 4HG4K 3SN6N 1NAML 4ODWA 3VRIB 5KVFL 4JHWL 3DTXB 4M7ZC 3DX9A 1ITBB 3OG4B 4GAYA 1OGAB 1IFHL 3CAFA 3RWGB 1Q72H 3J8F7 4JM4L 1AQKL 4QRRA 4X0KB 2WINB 5EU3B 5FUZH 2X44D 3QCUL 4WI8A 1SY6A 1NAMA 4QRQB 5DRWA 4P3WA 2BJMH 3T2PA 5TPWH 3G08A 4EI5A 1B4JL 3GSQB 3LN9A 4E9LA 2WBJB 3HZKA 4F8QA 1RVFL 2P43B 4PJCF 4WEBH 4QOKD 4M62H 2WBJC 1UACH 3QQ3A 4N0CC 3RAJL 4CL7A 5E24E 3MGOB 3MRHB 2CKBH 4QOKE 1KCRL 2EDHA 4NJAL 1UJ3B 4HIHB 3MRIA 1LDPL 2O5XL 3LN4B 1S7TA 3ULUH 1CL7H 4Q6IA 4PJ8D 4QXGL 1UXSA 1UJ3C 1CG9A 3GMQB 2Y25A 1KN4H 1MH5A 1NPUA 2J88H 4M7LT 4OZIF 4P46C 3N9GL 1N3NA 2GSGB 4KK9D 1HHKB 1YY9C 2X7LB 1CGTA 4P99A 3QRFM 4PJXF 5I8OL 1XMWA 3MCLH 2NTFB 1A9BA 1HXYA 3A67L 1Z9LA 5ISZA 2FLBT 4JY6B 3PL6B 4NQCB 3A6CH 3LOWA 1S78C 2B4CL 3VWJB 5L0QC 4WUUA 3RY6A 4NJ9H 5GGSB 5DD0H 4GQPH 4DAGH 4BKLA 1E4XH 1CTNA 1H3TA 3JV5A 1TIUA 2OXGA 4NN6B 2A6KB 5L2KA 1F45A 5F96L 3UJJL 2XYCA 5EWIH 4XVJL 4XGZB 1BM3H 2H2SC 4K23L 4NN6C 5IT2L 3TO4A 3P30L 3KPRD 3QXUA 4RBPK 4OKVA 4NT6B 4Y2DB 4FQLH 1KC5L 1S7SB 3KPRE 3RTQD 2HG5B 3N1GC 3RIFF 2H2PC 4Y2DC 3L3HA 4RFOH 3VWKA 1MFDL 3D25A 4OD3H 2D03H 5JO5A 1YQVL 2FYYB 1RHHA 1KB9K 1NUNB 2JE8A 4N8VG 5AAWA 4JVPA 1CDIA 1IT9L 1O5DT 3I9GH 1EAJA 3TN0B 5HHOD 3FHAA 1ZGLM 1HKLL 3S36X 5DEFB 4BSVB 3DARA 5E08H 1WWCA 3D2UB 4GG6F 3L3KA 3QUXA 1T5XB 32C2B 4EIZC 1YNLL 1CQYA 3L3IB 2VWEC 4I2XB 2IADA 5D9SB 1YEKL 1P9MC 1I3RA 5HHOE 5KANG 3AVEA 1FNAA 3SKMA 1LE5A 3ULVC 5H94B 5MEND 4J4PA 4OZFH 1KV3A 3QIUA 1MCDA 1P53A 4H26A 1LE9A 5DGQA 3FRPG 1HQ4B 3IDYB 4P5TB 2YWYA 1MVUA 2N7AA 2VITA 5MENE 1Y6MR 3C5ZA 3ARWA 4NM8L 4ZOCA 1RUQL 3IDYC 4P5TC 4JJ5B 1BD2D 4U1IA 2DIAA 4ALAH 3CFDB 3RBSA 4OZ4B 2K1MA 2WK2A 5EOQH 4NRZA 1BVZA 2Z0BA 2VERN 1UZ6E 1BD2E 4I0CC 4ONFH 1I7TA 2I60L 4X6BA 1E28A 1G9NL 2IAMB 1T2XA 4X7EC 1GAFL 2NW2B 4YHLH 5HGAA 5T5NG 3X11B 5GZNC 1LO0L 3L6FA 4LCUB 1JGVH 4MNQD 1N6VA 4YXKL 5IFJB 5BZDB 1JI1A 1A3RL 1ZLWK 4MNQE 1T1ZB 4UT7H 4RX4A 1RUKL 1TNMA 3MLYL 3O3EB 4TTGA 3DROB 4F3FA 5JTWA 4FZEL 1SBSH 4JFXB 1IM3A 3ULSA 4F7CA 3DVNA 3DMMD 4JKWA 2W0PA 3ZSSA 5H2BB 3NZHH 1HKFA 2EEDA 1JGLL 3FN0L 1D5XA 5HHPB 2GEEA 5JOEA 2CR6A 2IBBA 3ILPB 1G7HA 2GK0A 1FZMA 1QBML 4GUPB 3FB8B 2BNRB 1Q9KA 5GHWL 2XKUA 4P23B 5TGBB 2PR4L 1MREL 4OI7A 2J5LB 1K2DB 4P49A 1VA9A 4P23C 3F12A 4XMPL 1G7LA 2J5LC 4GXUM 3VGDA 1HZHH 2E9BA 5HXMA 4PJAB 5KSAD 4HT1L 4CW1B 3ZKXB 5L88H 4OCWH 3IDMA 3MQIA 3WD5H 2ENSA 3VD5A 4YXLL 2D9CA 3ZKXC 1S5IL 5IBLD 2PYFA 4F9PC 15C8L 4G42A 2JIXB 4JO2L 1CBVH 1C5DB 4KXZH 2FH6A 4YHPB 4UMGA 2DQTL 4HS3A 2R0KL 4L4TA 5D7LB 2VLLA 2YS4A 4UIKH 1D3CA 5EBLA 1XGQA 3LKNA 3ES6A 4TUKH 1M7XA 3JV6A 3ARFA 3PWVB 1OAUH 3UBXI 5J12B 5JZ7D 4FFZH 3HC0A 1J8HA 5E56A 5D7IA 3DV4A 1N64L 2F8VA 5C0BA 1KIQB 1NLBH 1T83A 4U1NB 3GIZH 2Y6SD 1JWSA 2R1YB 3O2DL 3MA9H 3RWJB 5DDHB 4IIQB 3LQZB 3ZT6A 3D3VB 4D9RD 5CCKL 4EI6B 4Y4HA 1GGBH 4OJFH 5DC4B 2X1PA 4IIQC 1JV5A 5F7UA 5FUOL 3BGMB 3X13B 4D9RE 3O2DA 5IB2A 2MQ3A 1AP2A 3KYKL 2YMXH 5C0AD 1E4KA 2AXGA 4OQ1A 2DI8A 3WDIA 1AY1L 3TA3A 3X3FH 2VDML 5HHNA 1MLCA 5I1JH 2EC9U 1IAIH 5C0AE 3OMZA 5CD3B 4M5ZH 4TULL 4HQQL 1QKZL 3P3YA 1I1FB 4JQIL 3BZ4B 3RU8H 3WHE0 4PJFA 4GG6A 1Q1JH 5FHAL 4LSQH 5C8JA 1F6FB 3W81A 2D0FA 1T4KB 4MCYB 3D9AL 4CUCA 3CXHK 2XA8H 2F74A 5J11C 4ONOA 3VXRB 2J6EH 1IBGH 4U6VH 3CSYA 3OXSB 3LV3A 1FORH 4QHMB 5B4MD 4RBPH 1AE6L 5JHDB 4JY4A 3GMPA 1FC2D 2Y23A 4MDJB 3OR7A 1TFHA 2AV1B 3LRSB 4OLEA 3BXNB 1R3JA 4ZUUA 2CJUL 4C56A 3PHOA 4LQFL 1DQMH 3CLEL 4PRIA 5HDLA 1T21B 3HS0B 4U1JA 4GKSB 3VFMB 5I2IB 4XNZB 3TEUA 1H15A 5E8OA 1E6OH 2HTLC 5DHVA 3JV0A 3NIGE 1BOGB 3MNWB 2JB5H 3DETD 1DUZA 1SYVA 4GRWE 4LVNC 4BZ1H 1QPXA 5JQ6L 4ZUTA 1ZHBA 2X2YA 1RJYA 3WJJC 4YGVB 2Y07L 3ROOB 3OAYK 3GRWL 3QHFH 1UZ6F 2HA1A 3I3BA 2MKWA 2LFGA 3EYOB 3QUYA 3F5WB 2GJ6D 4WWKA 1X7QB 2X42A 3IJSA 1VADA 4M3JA 2E7LC 2WUCL 4XP9L 2R69H 2V9TA 4RAHA 3RZCB 3GRWA 2RIKA 3QIWD 4P2RD 4Y8AA 3HG1A 2EKJA 2GJ6E 1WZKA 2E8ZA 4JDVB 4H5SA 3TVMD 1XF4A 3HNVH 5E1AA 5A2JH 3RZCC 3MC0A 1L0YA 4M1GL 1JGDA 3EFDH 4P2RE 3SJVD 1QUNA 3C8HA 4UQ2A 4IRJD 2WUBL 4KHXL 1PY4A 1RK0A 1NGWA 2B1AL 1FH5H 5CGTA 2BVQB 4LLWA 5H35B 3QUZC 2Q8BL 3QUKA 5FAAA 5GS3A 3SJVE 5I1KL 2R2EA 4JFDA 4YPGB 3FB7B 5CBEB 3N1PC 1BLNA 1Z3GL 3F7PC 2DQDH 5D1XD 2MPAH 4H8WH 3HI6L 3P11H 1KXVC 4PJIB 5J13B 4W70A 5F7EH 1HH9B 2ITCB 1LNUA 5BVJB 3ARGB 3PNWA 1FL3B 2RB8A 5J13C 4QOKA 4J6RL 4U1SA 3TM6A 2DD8H 5E6ID 4KI1A 5EN2B 3LKPB 4JG1H 5J1AB 1CIDA 2P8MA 3WNLA 4ELME 5JW5A 5IIEB 4IHOA 5SWZD 5AZEH 1HEZB 2VQTA 4YR6B 4QKXB 1FFNA 4QHUB 8FABB 4K7PY 1X5YA 3S4SB 1IGTB 1TVDA 4X6CA 5SWZE 1CLZH 3U0PA 1FVDA 2G75A 3VFWB 4MJ4A 5C0FB 4BFBD 5GJSL 1R5WB 3OJDA 5JW4M 1FGVL 4NBZB 2Y7QB 2YSSA 1ZWIA 1QPPA 2VZ3A 5I1DA 4Y5VA 3F58L 3V6OC 3WHE1 3GM8A 3RUGF 1DZBA 1CGXA 4AM0B 7CGTA 3T1FA 5TE6L 1YEFL 2ED8A 4JRXB 2OL3H 5DJAA 5FA4B 4XNQB 4YJZL 2Q86B 4YEEA 4PLKC 3VFPB 4U3CA 2NNAB 1KJ2L 1UM4H 2Y36L 3D1MC 3QDGB 5FUCC 2D7PA 1B90A 1KYOJ 3JZ7A 4DKAA 4D8PB 3ARBB 2XQYG 3L5IA 5CJ5A 2Q76B 5BVPH 1T7XA 2E7CA 5DQ9A 3ARBC 5FYKU 4DEPC 5TE4L 1ZT1A 3EYQC 5JPMB 1HHGB 2AI0L 3GMLA 4MCZA 1BECA 4I5BB 5FKAB 3TJEL 3OHXB 3QA3A 4K71B 4EDXB 5F88A 1YNTA 4DTGH 5FEBA 3WFBH 3L7FB 5K59E 3Q5TA 3T4YB 2W0KA 2ZSWB 2IANA 4WEUD 2P5EA 4OZFG 1JNJA 43CAB 4HW6A 4PS4L 3FT3A 1S5HB 3F65A 5ANME 3GSUA 4D2NA 1QQDB 2OZ4L 3LZFH 1MLBA 4Z76A 3GSVA 4PRHA 4LPTA 2P42B 1UWEH 3H6JA 3P4MB 2DJUA 2WBWB 4GG8B 5AYQA 2BFVL 4M7LH 4CU6A 2EZ0C 1W72B 5LXGL 1TTFA 1K4DB 4ZTPH 2NYYC 5A16B 5KVEL 2P45B 3KYAA 3PJSA 4NCC1 4L8BB 4AH2B 1KPUA 1V3MA 1CI5A 2G9HA 3TZVD 4U6TA 2CIKA 1SEBB 1VESA 4UDTA 1GC1L 1ZHKB 1OPGH 2Z31B 4KAQH 2D31A 4OLYH 4HIXH 3TBWA 4G8EA 2WIIB 3TIDB 1OF2A 2Z31C 4PJGE 4N0FA 1UYWL 3IT8D 2VDRH 4U7KA 4AG4H 4IOIA 2UWEE 1RJZA 3D39B 1UM6L 1B6DA 4Y19A 3NIGF 3E6HA 1SM3L 2MNUA 3S35X 1N2RA 5C7XH 4LGSB 3MZGB 4U6YA 1KB5B 5L7XH 4GRWF 1YJDL 1A1OA 4U33A 1N8ZB 1ZHLB 4HC1H 4LBEB 5ITBL 2EYSA 2V7NB 1L7TL 1P4BL 1OVZA 3ARPA 4NRYB 5CD5C 4R9HA 4MAYD 1YY8A 4F33A 3RIAF 4XCYA 3V8OA 1XF2A 1MFCL 1IC5H 2OSLA 3UPCA 3QUML 3EDEA 5B21A 3O2WH 4R4FL 2DN7A 1QOKA 1FZKA 3D0VB 4GBXC 4K3EL 2XWTB 1AGBA 2XWBA 4L3CA 3VXNA 5EBMB 1IRAY 4LHJB 5KTEL 1JJUA 2FO4B 4R6UA 1BVKA 2HVJA 3QUMA 3DXAD 3VFNA 1Z6JT 5T33H 2PN5A 1F90H 2Q8AH 3AUVA 4HWNA 1FJ1A 2VZSA 1J1XL 4KK5D 4HKJA 5F6IB 3F7YA 2ITDA 4JM2C 4K9EC 5D2LB 5DYOB 4UTBL 4PRNB 3KNBB 1E0OB 5MERB 3T2NH 5BMFH 5F6IC 3SGKC 4JG0L 1UENA 3L3JB 4HUKB 5I8KL 3TT3L 3CFCH 4DFIA 3H3PH 3QXTA 4Q0XH 2IBGA 4ZYKB 1DANT 4NNXA 3FN3A 1X4YA 2YD9A 3MZTA 4A2LA 4O2CA 4KY1L 3RUGA 4WTXA 4ELMF 5IG7A 3LY6A 4WHCA 1UJTA 2WMPA 4MAUL 1A3QA 5DTFA 2O61B 1LP9B 5TFSH 2V7HB 4WNQA 2J3SA 4BH8A 3BRGC 4JB9H 4Z7VB 4NOFA 1NCBH 2FJGA 4NO2B 1VGKA 4Y7MA 2BRQA 3GMOB 1GH7A 5GJTL 4PRAA 4YNYA 3S36H 1R3IH 4J2XA 1U8MB 3LEYH 3QNZA 1IKFH 1E27B 4JO3H 5HYQA 2IQ9L 3SDDB 1EJOL 1K8IA 1MHCB 1XGRA 1HINH 2DYPA 3MBEC 2I25N 3HPJA 4PG9A 3SDDC 1NSNL 3DIFB 2DRUA 2VDLL 4POZD 4XPFH 5T5NF 3U82B 3VXMD 4Q74A 1JF1B 5A3ID 5BW7A 1QRND 1S9KC 4KGJA 1PKOA 3HMWL 3QDAA 3KPOB 3VFOA 1TZHA 2VLKD 4I13B 3MLRH 3PF2A 4LMQE 1VFAA 3BT2H 4LPYA 2V9QA 1AKJA 3T09A 1EEYA 1WBYA 3VXME 3WNNA 3ULUD 1QRNE 4PG2A 3GHBH 4RDQG 4MNGB 3NCCB 3UC0H 5AD0B 4FQCH 3EJJX 3GJEA 2ZCKH 2VLKE 4AEIL 1YMMB 1WT5A 1S9YB 1KUMA 4LGRB 2L0DA 3UJIH 3ULUE 2R0ZH 4HFWB 2HFFB 3QEHA 4F37F 3I2CL 1CGWA 4OCNC 5K59F 1D5ZA 3TYGL 4E5XA 1OP9A 1PX4A 3MRJA 1SMOA 4P48A 3CVHL 3HNSL 4XBPA 2A6JB 4QXUH 4HUVA 4AK1A 4HSQA 2VE6B 1LO5B 4CJ1A 2FLRT 3DWTA 4Z7WE 1Z2KA 4YAQA 1R3HB 4HWZA 4X7SH 4HPYL 4HH8A 5EC1B 3CVHA 4DFHA 3O41A 3TO2A 1K5NB 3BH8A 3UTPD 1QFWI 5GQBA 4AQOA 3IVKB 1CGSL 4JZJB 1XF5B 1T0NB 3E1F1 5F7FA 4WEMB 1AO7A 3QNXB 3FONA 1KF9B 4JZJC 3UTPE 4KVCL 1CFBA 1NGYB 1E4JA 4ZDHB 3C60D 4DW2H 4UBDC 3SPVB 2E7HA 1HH6B 3LB6C 3HCVA 3PP4H 2QL1A 1T03H 1YNKH 4B5EA 4HEPG 4LLDA 3ELAT 1BFTA 1UEYA 3RDTB 1YYLL 4PJ7B 4HEME 4E0RA 3DVIA 2F53D 2A1WH 4NZUL 4ZXBA 1YC7A 3HMXH 4BFEA 3CPLB 1UXWA 4PJGF 5IBTH 3GB7B 4P3CH 3RWHB 4Z8FL 1MUJA 2UWEF 4CNIB 2F53E 3GK8H 2VL5A 3CC5B 5ADPL 4ZFZB 3LPFA 2ZUUA 1WBZA 1MRCL 2CDFA 3C8DA 3LDBB 4UU9B 1I8LC 1CLCA 4OCSL 2GJ6A 3AS1A 5D5ME 3LDBC 3QIWA 1AFVH 1DBAL 4TUJB 5F97E 5K9OA 3Q3GB 4ORGB 5LWYL 5DQDL 2GITB 4JN2A 4I0PA 1A5FL 2AABL 1GJIA 1I9JL 4XXDA 4DKEL 3P4LA 2HWZL 1KJMB 2N7BA 3BWAB 1OW0C 5HJ3A 1ZLSL 1N4XL 2C3XA 1NLDH 2H9GA 2AJUH 1A7NH 2PYEB 5IFHH 4HZLA 1KFAL 1WEJH 4LNRA 1J87A 5D93B 3G04A 4DOHB 1B0RA 2C7UA 4YHZL 1CK0H 4HJGA 4MSWB 2X70B 3I50H 1YPZE 2AXFB 2EH8L 5D93C 4APQD 5C2BL 3FAXA 1C5CL 4O9HL 1I85A 2XPGB 5GISL 3X14A 5E6IA 2AJVH 1AI1L 1N5AB 2VXSH 4O2FA 3SE3C 1IC1A 3I6GA 2DWEB 1Q9OA 1RZJC 3ARYA 2ZKHH 2F19L 4GS7C 3G9AB 4A6YL 5IQ7L 1JRHI 3T2OA 1TNNA 2CDGA 3OPZL 4YDVB 4XPTH 4KJQC 2HJLB 2XWJA 4FABL 1ERNA 1TCRA 2VISA 4PFEA 5A1AA 3IXAB 3AMLA 5J9PB 5D7JA 1IC7H 3CFJB 1EX0A 1BQHG 4HUXB 4OFKA 4HGKC 4UINL 4A6YA 4CVXB 2ZCLL 3BUTA 3EW3B 4FMFA 2DWDA 2IQAA 3MRBA 4NDMB 5T1LD 4F7PA 3DGGB 4WO4C 5EUOF 4RMSA 1AQDA 4NPYA 3DRTB 1VCAA 4QGTA 1FN4B 1MCIA 1FL5A 2KQMA 3SDXE 1JUFB 3IGAB 5FHBH 4QRPD 4WW1B 1CU4L 3PIQA 4D94A 4UOW0 3WFCL 1R6VA 4MJ5A 2B2XL 1ZKAA 4QHKJ 3HAEH 4QRPE 4TSBH 3ZMRA 4FTVD 4V1DB 1Q0XH 4GW4A 1HIML 3MV11 5E8DL 4IRSA 1KPRA 2EE3A 2Z8SA 3NFSL 5DSCB 1FNFA 2NY5C 1KTDB 5IGXH 4I77H 3B9KD 4WI6A 4FTVE 5EOCH 1TZGH 3WFDL 5FV1L 3CFIC 3O3AB 1TQBB 2XZCL 2Q87A 3UPRB 5CGYC 4U1MB 1A6WH 2CIIB 1G9MC 3ULUF 2X4NB 2VDOH 3IDIB 1S7WA 2BP3A 3ZKNC 4P9HC 3O6LH 2ADIB 1KLUA 1MWAL 4GLRI 5JXEC 2YBRB 4NHUB 5MP6H 3SO3B 4NO0A 5CBAB 3VXSD 2NY2D 2GFBA 3L5WA 4POUB 3BGAA 4R0LB 1CQKA 4Z7WF 1EBPA 3UTSA 3VXSE 3KPLA 5T1MB 3TZVA 4R0LC 2VLRD 3MGAA 2ADGB 4OF8A 1T2QH 4PJGA 4NHCH 4RMUA 4FQ2H 1JTOA 3D85D 3S3SA 1NC2B 1BZ9B 1O7VA 2C4FU 3V0VA 2AJXH 3HFMH 4XHQA 5GGRA 2VLRE 1QBAA 5EPMB 3PDOB 3V79C 4UV4H 3F8UB 2DQGL 2HVKA 4NUJA 4P4KA 3FCTA 3HPLB 3QCTL 4XNMB 2BOCA 4X6EB 2ESVD 1YN6A 3QDJE 1EFXA 1J18A 1GHFL 2QQKH 3AC0A 2JB6A 2EDFA 3QPQC 1JE6A 4M6NL 4XMLH 4Z0BL 1BX2A 1PGRB 1DQJB 2ESVE 4EZMA 1KB9J 1EEZA 5T1DH 3MRQA 4L5FH 2X4OB 4NFBA 5F7MC 4HF5L 1QSEA 3LS4H 1T7VA 3GSXA 3VFTA 2IMNA 2VUOA 4E42B 2VAAA 3BP6A 3CZJA 4TNWF 4L8CB 3AB0B 4PGDA 1MOEA 4RIRA 1A4KB 1NUGA 5D5MF 1D9KC 5IB1B 3MLSH 4BJLA 1RIUL 4NO3B 1MRDL 4U2YA 2RHEA 3VD9A 5ILTL 5TQ2L 1S7XB 5IK3A 3C6SB 5BRZB 5KG9B 3SKNA 4HMEA 4JPKL 5CFHA 1JPGA 4AEHH 4GRLB 3CFKA 2ZPKH 1HYSC 25C8L 4IM8A 1FV1A 3K4DA 3WSQL 1DBJL 2FJFB 2X4UA 1KEMH 1R5VA 1VENA 4K9EH 2QV2A 1WFNA 1WFUA 2IMMA 2G2RA 2DM4A 4KKLD 3DI3B 1RZKH 1PEZA 3QI9D 2J2ZA 1N59B 2DBLH 3EHBC 1WCBA 4DVBA 1CGUA 3VFVB 1U92B 3REWB 1ZT7B 4D0BB 4LPWA 1YPZF 1WUNT 5DRXB 1D6EB 1MEXH 4MA8H 5IHLB 3OGOE 4KKAD 3I84A 3NFPB 3P2TA 4O51A 4GAJH 3WIFA 3MFGB 1A9EA 4FG6C 1MJ8H 3LN5A 3IKCB 1JGEB 3QG7L 3RVWC 2BHUA 3PWLA 5DLML 1DBBH 5T1KB 5FDWB 5HI4D 5EUOA 3GKZA 5TPWL 5JDJA 1BFOA 3GKWH 3MYJB 4XNUL 4WRLA 2HRPH 1S8DB 3B4NA 2X1XR 1AD9A 2RGSA 4HHAB 5D1ZA 3OSKA 4R2GB 5F8QC 5DUMH 1UACL 2FJHB 4KJYA 4QHNA 1Q9LA 1VSCA 2ZUXA 3MRFB 5GSVB 2OK0H 3T2QA 1ADQL 2EDYA 4ZAKA 4WFHD 3F7QA 4RQQB 3NVQA 4R2GC 2B7DT 4CVUA 1XGPA 2QHRH 4FQXB 3SCMB 4HGWA 3QJHB 5C0EA 1PKQE 3ABZA 4WFHE 4FQXC 1J5OH 1X6LA 1UB5B 4YXHL 3HNTH 3SCMC 3ULUL 1CL7L 5LKNA 1PAMA 1ADQA 2GT9A 1CVSC 3VXMA 1PSKH 4N0UA 3V4VH 5F71A 1KN4L 2H32H 2UYLA 4YPJA 1L9NA 1ZGLB 3SDXF 2AEIT 2J88L 2A0LC 3B9EA 4KKCC 4YX2H 3M07A 3GMNB 2OTUA 4XAKD 3G6AB 5DUPH 5ESAB 3GJFK 1MI5B 2JCCB 4OGYL 4UOJA 5I1LA 1FP5A 3MCLL 4P46D 3S35H 2CMRH 1YY9D 5FB8A 2C3HA 3JWNC 4OF5A 3WJLA 4WVRA 4XAKE 3A6CL 4HGMA 2J4WH 1MQKH 5I1AB 3ZYOA 2YPLA 3EUUA 1P6FA 5DD0L 1IKNA 2BOBB 4DAGL 1FL6B 1BIIA 1IEHA 3UTTB 3MLXH 1C7SA 1DQDH 4DZBA 4XCNA 4YDLB 4MQTB 3FQNA 4Q6IB 1G7MB 2BXZA 1XCQB 1BM3L 4YC2B 5B38B 1I1CA 4YDLC 4NNPH 2NCMA 4NBYB 2DIBA 2IC2A 4NQVB 3V5HA 1FIGH 1CD1B 1ND0B 1MCKA 2X1OA 1DDHA 1EAPA 1NCDL 3MXVL 4XNYL 3UBXG 3HE6D 1V3JA 3RVVC 1M05A 4R4BA 4XB7A 4IOSD 2Y9RT 3O8XA 4WHYH 1JGUH 5K9QI 1MCWW 5HI5D 4WHTB 2EKSA 3MOAH 4OLUH 4CGTA 1KLFA 1NBZA 5FCUH 4U3HA 3OB0H 4FZ8H 5KAQG 4OZHE 2HJKA 5T3XH 1ED3B 5EU4B 3I9GL 3MCKB 1TTGA 1U93A 1E6JL 3OJMB 3T0XA 2NY7L 2PETA 4ZOAA 5E08L 2BVPA 4N68A 4L8DA 4MX7A 4LSPL 4PJHA 1YEGH 5D5MA 5F6HI 1ZT4A 3ZHKA 2B4CC 5CINH 3CXHJ 1UVQB 1XZ0A 4PJBE 4K7PX 4RRPG 1WIOA 4HX1A 1OAKL 3U1SL 4QF1A 2VLJD 4GW5A 2W0LA 2I07A 5LAXA 4MQXD 3GSRB 5FF6B 2G5BA 3EDFA 1G7QA 4D9LH 1A7RH 4QNPE 1X5XA 2VLJE 2W59A 3S96B 2NY4D 1F4XH 4I2XE 5EOQL 2IPTH 2PCPA 1DQQB 5I17A 4ONFL 4RDQF 4Y5XB 4ZSOA 1VERA 5ICXA 2J8UB 1I7RA 5HVFB 1N26A 1EVTC 1IGML 4YEFA 1YEDA 1AGCA 3ZDZE 4YHLL 4OAWB 4Y5XC 1EIBA 4AMKL 4DGIL 1F58L 2WQ8A 1JGVL 1N6QL 2OP4H 1AIFA 1BEYL 1CD8A 3HUJB 5F1NB 1QA9A 1RZ7H 4P5KB 5GZND 4AIZA 4LPCA 5LBSH 1YMHB 4P59L 4S10A 3TBSB 2PW2B 2DLTA 4X7TA 1L9MA 2VITB 4S11A 1QSFA 2EIBA 5FO7B 1MCBA 1GOFA 2NX5A 1U42A 2QR0B 1QLRB 4QRSA 3NZHL 2V2XB 7FABH 3FQRA 3OKOA 5F9WB 3RGVB 3TV3L 4XVUC 1IMHC 3V9FA 5IQ9B 2Y5TA 3U36A 5DRZA 5F9WC 3RGVC 1QFWH 1VFMA 4KRPD 4X98B 1SYSB 3HAEG 3HR5A 2VKXA 4G6JL 1U91B 4JDZB 1U58B 4UZGA 3C2AL 3WS6C 3FZUC 4GKNA 2HH0L 4LSTH 2EE6A 3C5JA 1XR8B 1KXTB 2HKFH 4ZPTA 3MRNA 4P23D 4NKIL 3DJ9A 2WW8A 3CX5K 5L88L 4LLQA 1PLGL 4RNRB 4F3FB 4UB0L 1WFOA 4OFYD 3VXOA 4U2ZA 2BNRE 4QRUB 2X4PA 4HCRA 4LRIA 4A2MA 1N5YH 4O5LH 2BC4A 4UIMB 1XEDA 3NFNB 5D6DC 1I4FA 2NZ9C 4PJCB 5FYLH 5I30L 3GGWB 2ICWB 1XF3A 4TUKL 1IGJB 1EO8H 4G8GA 5CILH 1NDMA 1Q8MA 4JFFB 5CJQL 1UADC 2FWOA 2OCFD 4F7EA 4K94H 4PRPB 3I3EA 4UAOB 3R8BB 1EDQA 5DR5L 2AK4D 3B9KA 5EO0A 2V17L 4EBQH 3CZFB 5IVXB 1CDUA 5KS9E 5D7LD 3GIZL 4UAOC 3KPTA 2Y06L 4ELKA 2YD7A 3T0ED 3DHJA 2AK4E 3KYNA 5AWNH 4D3CH 4JFYA 2FR4B 4MZ3A 2OR9L 5D7LE 1G7IA 4N0YH 4OZIB 1GGBL 4OJFL 3UO1H 2FX8H 3N1MC 1M6OA 3MUJA 2XRAH 3WFHB 5HYFA 3T0EE 1HHJA 1GCFA 2A9ML 4KDTC 4AZ8A 5KVDL 4PJXB 1HHHA 4X9HA 3NZ8B 4OLVH 4PJDE 2F15A 1OM3H 5EBWB 4Y5YA 5E8EA 4LDLB 4XPBH 3X3FL 4BFIB 4RFEB 2P24A 1HDMB 1WWWX 3BO8B 1QVOB 3ZYIA 3D69B 3GJFH 4Z78A 8CGTA 5DJCA 1ZANL 3OR6B 4ETQB 4TOYH 1S3KH 4D0CA 3RU8L 5HVHB 3OKMA 2PXYD 5DJ0B 2IPKB 4FA8A 1OAXL 3HE7C 5DMIH 5EZLA 4U1LA 2V5YA 2OM5A 1G6RH 2GTWB 1PD6A 1TENA 3EGSA 3I02B 2XA8L 2YXMA 3QDJA 1IILE 4KMQA 1P1ZB 3TCXA 1JRHH 1IBGL 4O4YL 1K4CB 3FT2B 3SGEI 3U7WL 2GKIA 4Y4KC 4OZHF 1FORL 5DXWA 4DN3L 1C8PA 4KRLB 4HZAA 2H3NA 3QFJD 5TF1H 1R3LB 4P5MA 3QG6B 1C16B 1BBJA 3QPXL 3TA3B 3S5LG 1JPTH 2XZZA 1FNGB 2QSVA 1NL0H 3ORJA 2DQUH 2O5YL 3QFJE 4MLIA 3HC4H 1UB6B 2QTEA 3BN9C 4MWFA 5C6TH 2BMKB 3KYMB 4WDIA 5C0CA 1AD0B 4PJBF 5C0DA 4ZFFA 4HWEL 1E6OL 3KWWB 3WUWA 1P5UA 5IMKB 1CFSB 4OM0H 3KDMA 5DEGB 4AL8H 2FB4L 2JB5L 4QT5A 1XH3B 3MRKB 1FG2B 1CICD 4N8PA 2I27N 2I5YH 4QNPF 1JN6B 4FP8L 5GRUL 4PR5B 3V4UH 3RWDA 1M4KA 1T89C 5D70L 5DC0A 1MAJA 4HAGA 2F58H 2UVEA 1KJVA 5EC2B 4NKDB 4X4YB 1UCBH 1UH3A 4JY4B 1M7IA 3PHQA 4MZ2A 5MEQB 5I8CA 3UZEA 4WFGD 5HDBE 3ZDZF 1U95A 4FXGA 1GGCH 3T8XA 2A73A 5IBUG 3QRGH 5C07A 2X4RB 3BD5A 3CCHA 4WFGE 2IH3B 4P2OD 4Y16C 3DVGB 3FFCB 3TYFA 3G6DH 3K8KA 3EFDL 3C6LA 4QHLB 3QAZB 1ITCA 2H26A 1J05A 5E8NA 2FHBA 2MKLC 1JMXA 4GLRH 5E8PB 3BDBA 3TPUB 4ONGH 2EDBA 4XBGB 4P2QB 1RU9H 5IEHA 5DD5L 2L4OA 4JFEB 1U8OB 3DBXA 5FKPA 2R0LH 3BQUB 2DQDL 4S0TD 2YK1L 3P11L 4MJ6B 4AEFA 3VRIA 4S1QH 5F7EL 5J0BA 1ZE3C 3DTXA 3QUZD 2CXGA 4PD4K 5BZWB 3BQUC 1NEZB 1OGAA 2HT2C 3RWGA 5J89A 4Q9BA 2QSQA 3GSOB 2JJUA 4X0KA 2UZIH 5EU3A 5D2NE 3VFSB 5BV7C 4G7YL 4QRQA 1IAIM 3L5JA 1DBMH 3GSQA 3TBTB 2NMSA 4LSVH 3UX9B 4M00A 2ARWA 3P4NB 5AZEL 2WBJA 4WGVB 3MUGB 2M1KA 2W1NA 5DHYB 4JFZH 3ESUF 3HZVB 5HVWA 4FQIH 5CSZB 1CLZL 5C92A 1K8DB 5I0ZA 4N1CA 1F4WH 3MGOA 3MRHA 2GTZB 3EDKA 1RUPL 1UJ3A 4HIHA 2AEPH 1OQXA 3LN4A 1CZ8H 4KQ3H 1TJIH 4KRMB 5FM5O 1A02N 4P46A 4LARH 3DGCR 4LFHG 4WI9A 4H0GA 4WTZA 3QXVA 4KVNL 3KPSD 1LEGB 4WHYG 1YDPB 2GSGA 1HHKA 1GZQB 3P77B 5KS9F 2LTQC 1EHLH 4Y1AD 2WAHA 4ZTOH 1MCOH 3OKKB 4PLKD 2NTFA 3T77B 3T4AB 4U7MA 3VFUB 2COQA 3OX8B 4JY6A 3AGVA 4Y1AE 1CXFA 3PL6A 4NQCA 2VDKH 4PJ8B 3V2AR 5DJZB 2APBA 4J3TA 4M5YL 3VWJA 5IHBA 5L9DL 5F7HA 2R4RH 4JRXE 1CXKA 3IDJB 5GGSA 4MXWL 4PJ8C 1A7QL 3ZKSD 3SGJA 5FUCE 4DTGL 4HS6B 4PJDF 1QP1A 2A6KA 2A9NH 5H37H 4MA7H 3EYQD 3GIVB 1NBVL 4XGZA 3IETB 3K81A 3MJ7B 4OD2B 5EIIB 4HIJB 5C0RL 1DANU 3PQYB 4EN3D 4NT6A 4Y2DA 4JR9H 3H9SB 1S7SA 5SWSD 2BX5A 2BY3A 2HG5A 5HHVH 1JPSL 5F9DC 4ZS7H 5A2FA 2D7OA 2DDQH 3B9AA 4Y4FD 5DMGC 4G9FD 3BZDA 1FDLH 2YZ8A 5SWSE 4KTEH 4E41B 1KJ2B 1NQBA 1T3FB 2FYYA 3ULVL 3KPRB 2EZ0D 4HBCH 2E6PA 4G9FE 2FEEL 3WXVH 5F88B 3KJ4B 3TN0A 5D8JL 4DKFL 4I48B 5L8JB 1P9MA 5DEFA 2F54D 4BSVA 1F4YH 4HIXL 3D2UA 3IFPB 3RTQB 1T5XA 32C2A 3KJ4C 3HB3C 3L9RA 2XY1A 3L3IA 3M1BB 2LU3A 4I2XA 5D9SA 3MJ9A 5HDOA 3RTQC 1HSBB 2P49B 2F54E 4NN7C 1YEJH 4GRMB 5H94A 1A47A 3OKNB 3DECA 1HQ4A 4P5TA 5FECA 2J7LA 1M1SA 5C7XL 1MRFH 4K07A 1A1NB 1KBGH 3WUZA 5HHOB 4JJ5A 4ODXB 2ZUWA 3HLAB 5ADOL 3CFDA 3CK0L 5HYSB 3BKJH 5EZJB 3ALWA 1OLLA 5L6YL 4NN5B 5MENB 4IJ3B 2IAMA 3VXUD 3WIHH 5HDBF 5BS0D 2NW2A 4G80B 3SDCD 5HGHB 3X11A 3I6KB 3O2WL 4LCUA 4PB0H 5DMJB 2ZSVB 4GAGH 4KROD 3VXUE 4P0DA 5IFJA 5BZDA 1BD2B 5BS0E 2EYRB 1IE5A 5LCVL 1F11B 2ZUTA 1JHLH 4F7MB 1T1ZA 4F57H 3O3EA 2ED9A 4NP4H 5KBNC 3DROA 4JY5H 9CGTA 3E6HB 4MD4B 4GBXD 4JFXA 2DBJA 1F90L 3BDYH 5KSBE 1WBXB 2EH7L 5H2BA 2P1YA 3GNMH 1MFEH 4MNQB 4O58L 5BMFL 2GIYA 4YLQT 1EFQA 4G43B 5HHPA 1TQCB 3ILPA 5KAQF 4JM2D 1YY8B 3L3OB 4GUPA 3FB8A 2BNRA 4OD1H 1OARH 1Q9WB 4IDJH 4P23A 4I3SH 5TGBA 4HK0B 5DD3H 1JZ2A 2P5WD 2OX5A 3FO0H 3KPQB 1K2DA 4R7NB 2H1PH 3DMMB 3W2DH 1C7TA 1PFCA 4BUHA 4MMXC 2VZTA 2VAJA 4XRCB 2P5WE 5ID0B 3DMMC 2IFFL 4I0KA 5EB9A 5HY9B 2V2TB 4PJAA 2O5ZL 3VDAA 3TBYB 4CW1A 4JB9L 5FXCH 1BVKB 4F9PA 2HTKD 1NCBL 5GGVL 5GRJH 6CGTA 4XP1H 3ZDXE 4G8IB 5C08D 3S36L 3QQNA 2JIXA 1R3IL 1SJHB 1C5DA 4Z6AT 3LEYL 1R0AH 3K8LA 5BO1L 4YHPA 1IKFL 2P44B 4HKZB 4JO3L 5D7LA 1WC7B 1WGOA 2FDBP 5C08E 1LEIB 1A7OH 1HINL 3PWVA 4K7PH 3E3QE 1BQSA 5KSAB 2ADJB 3H42L 2W60B 2HN7B 2YR3A 2CR3A 3TCLB 2A77L 2APWA 1AHWC 4CMHB 3MBED 1KIQA 4U1NA 3BPNB 2R1YA 3QWOB 2VO5A 1SJVA 2R23B 3MLRL 4G9DB 3X12B 3RWJA 4EUPH 5DDHA 4IIQA 4NQDB 2VZOA 3LQZA 5IBLC 5CAYB 3D3VA 3BPNC 3GHBL 1IGYB 4FQCL 1OY3B 4R3SB 4EI6A 5EU5B 1QEWB 2VLMD 2AQ3A 1QO3B 3UJIL 1MIEH 3BKML 3BGMA 3X13A 3RGHA 4B7IA 2YUWA 2VLME 5JIPA 5I1HH 4JPWH 1FFPB 1TPXB 5GRYA 3ARDD 3O6MH 5JZ7C 3MRMB 4X9GA 1HHIB 4HPOH 5CD3A 1TPXC 3AM8C 5F93C 2Y6SC 4DK3A 3NH7L 3DX8B 1I1FA 3WFZA 3BZ4A 5IHZB 5F3HB 4X7SL 2IG2H 5DA4A 5CZXD 5C0AB 1UKQA 1T4KA 4MCYA 3IS1X 3VXQB 5EZIL 3DLQR 4LRNH 2VXTH 3VXRA 3D0LB 4U3XA 1T5WB 3B3IB 5GGTH 5SWQB 1FE8L 3FO1B 5E4EB 3LMJH 4DW2L 3OXSA 4QHMA 1VACB 3P0VH 1DL7L 5JHDA 4DUWA 1P4IH 1W8OA 5E4EC 3MRPB 3S3PA 3M8OH 4MDJA 5IEKB 3UMTA 4CU8A 3GSNH 4LFHD 1NCNA 2AV1A 3IRZA 3LRSA 4UBDD 3BXNA 3LB6D 3CNKA 5F7WC 1T21A 4JHBA 3HS0A 4XBPB 1H5BB 3VFMA 4GKSA 4X8JB 5I2IA 4HIEB 3R4DA 1MFAH 3TH4T 1H5BC 1VGEH 2HJFB 4KGLA 3PV6B 5T3XD 1BOGA 3MNWA 4Q9CA 1IJ9A 4H20H 3WJJA 5B4MC 4YGAB 5GSRB 4WHDA 1AFVL 1CDYA 4YGVA 3ROOA 2ZNWA 2MQ0A 4HWBL 4WCYH 1RD6A 3QJFB 1B6UA 1KJ3H 5JW3L 3EYOA 3F5WA 3O45B 4K8RH 1X7QA 4GRWB 2CLZA 5D71H 4JPVH 1NLDL 3RZCA 2AJUL 3LKSB 4X5WB 4HWBA 4JDVA 2M8XA 5C71A 4S1DD 1NCAH 3DETC 3BIKB 2KDGA 1WEJL 1O0VA 2R56H 5I74B 4V2BA 5HBBA 2ARJQ 1CK0L 4RZCB 3I50L 3VGFA 4JQVA 5I74C 2BVQA 5H35A 5KSBF 3V6BR 3BN3B 5BV7H 3G5YB 4YPGA 2AGJL 3FB7A 1HI6B 5CBEA 2AJVL 3QIWB 1X6NA 4P2RB 1N7ML 3P0YH 4PJIA 2B0SH 3TVMB 1HH9A 5IV2B 4B53A 2ITCA 5BVJA 2DIJA 3ARGA 1G1CA 2KQNA 2YKLH 3ZT7A 1FL3A 5C09D 3SJVB 2VR4A 4JCMA 5K33A 4B7LA 4IRJB 1QLFA 2AW2A 4IOFD 4JM2F 1NCWH 2H9GB 5EN2A 3LKPA 5J1AA 5C09E 1D5IL 3B5TA 4N8VB 4RA0C 5IIEA 2AS5M 4XPHL 1HEZA 3MROB 4YR6A 5D1XB 4M61B 4QHUA 2DQIH 8FABA 1GPOH 4MXVF 1YEHL 4H1LH 2OYPA 5CUSH 3S4SA 1IGTA 4UT6H 1Y6NR 4PRDB 5H37G 2KL6A 4I8DA 5D1XC 5TDPB 3VFWA 3ZDXF 3SDYH 3V6OA 1FBIH 5C0FA 4RAVB 4ELMB 1R5WA 5EIVA 2VN7A 4HAFA 3CMOL 2Y7QA 2QADD 2VH5H 4J8RB 4ODSL 5E2VL 1QFUH 4AM0A 4WO4D 5SWZB 4PGZA 2EC9T 4JRXA 3Q6GL 3C09C 1NANI 4KH2A 5FA4A 1MCPH 4XNQA 2Q86A 4OGAC 4XCFL 2CDGB 3WHXB 4ZFOB 5IJKC 3VFPA 1JTPA 2NNAA 4U0RC 3QDGA 5JHLH 1BGXL 1X5AA 5FYLD 4D8PA 1FIEA 3ARBA 1G0XA 5I9QB 4OLXL 3HKFA 2BHZA 2WNGA 1IGFH 5I18H 5FOBB 5I9QC 1A6WL 5FYLE 3BZEB 3KAAA 5T5FH 4EOWH 5JPMA 1HHGA 1QBLL 4LU5L 5FKAA 2OI9B 4P9MH 3OHXA 4EDXA 1ZEAL 3MRCB 3L7FA 3T4YA 2ZSWA 5D6CB 5DRNB 3O6LL 2FEDD 3SE8H 2OI9C 2VDNH 1JNHB 43CAA 3BUYB 4I1NB 1S5HA 4LVOC 1KN2H 1LVEA 2WBKA 1QQDA 2BY1A 5JXED 4DVRL 1K85A 3ARRA 1RURH 1G0DA 3O6FD 3P4MA 1AC0A 3T1WA 3LAFA 4GG8A 1VFUA 5DC9B 3O4OB 2D7TH 2Z8RA 4NHCL 4FQ2L 2Q3AA 5ANMB 1JP5A 1OCWH 2AJSL 1W72A 4MVBD 1K4DA 4OBSA 3HFML 1SBBA 5A16A 2CQVA 1JYVA 3KYOB 2B5IB 4L8BA 4XMKH 4AH2A 3GBMH 2R4SL 4WWID 2HLAB 5ACZB 3FN9A 2NLJB 1SEBA 2B5IC 2MCPL 1RZIA 4NC2B 4KPHL 1ZHKA 4LCCB 4R26H 2Z31A 1RIVH 4KV5F 3UYPA 4AJ0A 1EGJH 4O2EB 3WLBB 1PQZB 2WIIA 3TIDA 4LCCC 4XMLL 1KB5L 4L5FL 3D39A 3VG0H 1MWAB 3TZVB 4LPUA 1KB5A 2BCKB 4C54A 5K9QG 2NW3B 3MLSL 5I66B 1MCHA 2UWEB 1KIUA 1N8ZA 1ZHLA 1PG7L 4U0QB 4LBEA 1UWXK 2V7NA 5E99L 5E94A 2BDNH 2VABB 2DLFH 4NRYA 1D9KD 1UGNA 1W8NA 1AXTL 1NBQA 3FCTB 1TJHL 4AEHL 4YHOL 2F9BT 3UXFA 1WZMA 4NQXB 2ZPKL 2ZWLT 1LQSR 3VU2A 4L9LC 4K9EL 3O6KL 1KEML 5DEZA 5AYUL 1UQSB 3D0VA 4LKXB 1NMCB 2XWTA 2CKNA 1AGDB 1JHTB 5EBMA 3OKLB 3HI5L 4YDKH 4XP4L 2FO4A 1NMCC 1XCTB 2DTMH 4TVPL 4MAYB 5JMOC 5IESH 1CDCA 1MEXL 5EA0H 5JIKA 4MA8L 3EHBD 1MCFA 4MAYC 2DI9A 5D2LA 5DYOA 1VEOA 2XT1B 4PRNA 3KNBA 5MERA 1NGPL 2XTJB 3L3JA 1A6TB 4KHTL 4G6ML 4LDOB 2WZPD 5J6HB 1NKRA 2XTJC 4EUPG 3GKWL 4N8CL 2EEBA 4ZYKA 3DXAB 3GI8L 2HRPL 4DQOH 1T1XB 1IM9D 4X6DE 4XP6H 5DUML 4RWHA 4YWGH 3A6BH 2OK0L 2O61A 5F1OB 1WZLA 3DV6B 1LP9A 4XNXL 4KK5C 5CEYB 2V7HA 2QHRL 2BNQD 1NAKH 3JWOC 4Z7VA 1ZOXA 1BAFH 4NO2A 4PBWD 2FZ3B 1PVHA 1J5OL 4Q9QL 5INCB 3GMOA 3HNTL 2GJZB 3F7RA 1AGFB 1YYMH 1U8MA 3S34H 3V4VL 2QBWA 5FOJA 1E27A 4U6XB 3L3GB 2ZG2A 2AV7B 3IU4H 3U0WL 3NCMA 3SDDA 3CX5J 4LDEB 1MHCA 1OAQH 1QBBA 4YX2L 3UAJD 5IMMA 4M6MH 5DJ2B 5DUPL 2IEPA 3DIFA 3G5XB 4PTTB 2A0LD 4K55A 5LGJB 3GMRB 1JF1A 2CMRL 3KPOA 5LGHL 3GUTA 2HFTA 6FABH 4L4JA 5HPMB 1MQKL 1FVCB 1FO0H 2VOTA 5AD0A 4MNGA 2AEQH 1FRGH 5F9OH 4JGUA 4OSUH 1LK3H 4HGWB 1YMMA 3MLXL 2G5RA 4FMKA 4NQED 1S9YA 5HTSA 4HFWA 2HFFA 2X89A 1RULL 4NNPL 4YDJB 1QRNB 4NQEE 2CKBB 4LEOB 3NACL 1FIGL 2VLKB 4POZC 3B2VL 4BELD 1T04B 2A6JA 4ZUVB 2VE6A 1NUFA 3WE6B 3UROR 1LO5A 3QZWG 4M6OH 5KW9H 5DFWH 5CIPH 4OM1H 1FGNL 1JGUL 1R3HA 1IQWH 5EC1A 1CIUA 3RRQA 3H7BB 4J3XA 3IVKA 1K5NA 4ZO7A 3SEPA 4JZJA 1XF5A 1T0NA 1MJ7H 1HCFX 3QNYA 1U8KB 1MAKA 3QNXA 4Z7WB 3GO1L 5KOMC 3QEQD 3I6LE 4XCNB 1NGYA 2AK1H 4ZDHA 4LP4A 3SPVA 1D7FA 1HH6A 1SEQH 1NFDB 3QEQE 4Z5RB 5DJYB 4FN0A 3RDTA 4LHUB 4PJ7A 3BP5B 2NY0D 1I3GH 1YEIL 5IUSA 1INDL 1ZLVH 3QUXC 1JF6A 5J7CC 3CPLA 2CH8A 4UNTA 5IP4A 3GB7A 4JO4H 5ENWB 5C0GB 2BVEA 4BUGA 3RWHA 2E27H 1PZUB 4CNIA 3CC5A 4ZFZA 4D9LL 2IGFH 5DFVC 3C60B 3PGFL 4IMLB 3QIUC 4PPTA 4OZGE 3P73B 5KJRH 3ZO0A 1F4XL 4UU9A 3C60C 2DKUA 3MV7D 3BHBB 4XC3H 4F2MB 5DZLA 4XPAH 3P0GB 2YD4A 4Y8DC 1EPFA 2F53B 3TF7C 3FHQA 4TSCH 2QQNL 3QXAB 4TUJA 1UG9A 5GIRB 4WI2A 4N1EA 3MV7E 4BSWB 4ORGA 2GITA 5JOFB 3RKDD 1OW0A 4MX7B 4KUZL 3ZTJH 2VQ1A 3L5XL 4XP5H 3OG6B 1KJMA 3BWAA 5E2TL 3WFEH 3OXRB 4H1LG 4XWGH 2PYEA 3RKPA 1ZA6B 3MOBH 4LNVA 3WDJA 4GW5B 2E3VA 3W5MA 4MYWB 1RZJL 4TSAH 3LRHA 1UWXH 2BSTB 4MSWA 2X70A 4CDGC 4OZFB 2XIDA 2AXFA 3IDXH 2ICEB 3D87B 1NJ9B 2FIRT 4RCAA 3JWDH 4G6KL 1RZ8B 3HHRB 2FBJL 3L1OH 3WDHA 1CFTB 1QFWL 5CJ8A 1N5AA 2XZAL 4OFPA 5ERWA 2KUTA 5DWUL 2DWEA 1YPZB 3QEUA 5EZOL 3ZZ1A 3LH2H 5B39G 1MNUH 5CKGA 3VD3A 1P7HL 1P7QD 4YDVA 2E9WA 2HJLA 2HKFL 4APQB 1WK0A 3E6FB 5IHUL 3FZUD 2FL5B 3IXAA 4X6DF 5J9PA 2CK0H 1AJ7L 3CFJA 1QLEL 4APQC 4HUXA 1H9VA 5HSFA 1MHHB 1KCUH 4OI9A 4CVXA 4PD4J 1L6XA 5EOTB 1T0MB 4X80L 4J3SA 1ZGLP 5B8CC 5F7LB 3ZE0F 4PV8B 4EDWL 5K9KB 3LIZH 3DGGA 1QNZH 1LILA 5CILL 4Z7UB 4NWTL 2APTA 2NY5L 3DRTA 2JJSA 2NZ9D 1BZQK 5C3LD 1FN4A 5FM4A 3BKYL 3NN8B 1JUFA 3IGAA 4PUBH 1J7VR 4I3RH 4WW1A 1U3HD 1I9IH 3VFRB 4GXVH 4Z7QE 3D5OF 5L8LB 3TNNB 2EE9A 3LQAH 5J57B 2OLDA 5T1LB 4NZDA 1MCEA 2VQUA 4V1DA 2ZNXA 3H9ZA 4L4VD 4ZQKB 3FB5B 3SDXB 1CVRA 4N0YL 3RWCB 5DSCA 3UO1L 1KTDA 4P9HL 2FX8L 3VE0B 1T83C 2LVCA 1NEUA 5DMYA 5T3ZH 5HGDB 5KOVC 5TQ0H 2YC1B 4L4VE 2XNAB 5J3HD 3O3AA 1T7WA 4QRPB 5GS1B 3CLFL 5FGBC 3UPRA 4OLVL 1OM3L 4U1MA 4ESKA 2CIIA 3RVTC 4OF6A 3MRDB 3IDIA 5IVXE 1I1AD 3S88H 4PLNC 2JCCF 4JZNB 4FTVB 4O00A 3JTSB 2ADIA 3FKUS 3H2WA 4Q6YA 1S3KL 1DLFH 5HYJD 2YBRA 2GY7B 2ZJSH 3B9KB 4NHUA 5DFTA 2JJVA 5CBAA 4ERSH 5ALBL 5HYJE 4R0LA 1G6RL 2WLYA 1MJUH 5GXBB 5T1MA 4LKCB 2ADGA 3EJZC 3HE7D 4GW1B 4Z18A 3LPWA 1YEEH 1NC2A 3DO3A 1BZ9A 5E4IA 2CO6B 3WMSA 3QEGH 5M94B 5EPMA 3VXSB 4GKOA 1JPTL 3PDOA 2NY2B 4Y4KD 1U8JB 5KZCD 1P69B 1MCLA 4XNMA 3HPLA 3GM0A 4X6EA 2NY2C 1QFWM 4M4PA 3AROA 3ESVF 2VLRB 2GQHA 3MSPA 3D85B 1JK8B 1DQJA 2NY1B 2AKRB 2X4OA 1A6ZB 2Z4QB 2DJ4A 3WN5B 4DZ8B 5DVKA 4E42A 1KCLA 1NANH 4GMTL 1JPFB 4L8CA 2NY1C 4XWOD 2DMCA 1JNNH 3INUL 4NGHH 2YPVL 2F58L 1A4KA 1R24B 3WN5C 2ESVB 3BPOB 3VW3H 3NCJH 4HWUA 5IB1A 5F7KC 3OAZH 1ODAA 4PJ9D 4NO3A 2P4AB 4YIQB 1F8TL 1S7XA 1NDGB 5E9DD 3C6SA 3VDCA 5BRZA 5IROA 1K6QH 1MY5A 5KG9A 4WUKL 2X1QA 3EO9H 2GK2A 4KTDL 3EYFB 5E9DE 4U49A 4GRLA 4WDIB 1EEQA 3B2UD 1UKTA 2FJFA 3MA7B 4IS6B 4M43H 2YUZA 2Z92B 2ZG3A 3O9WC 3NTCL 4FQ1H 1ZS8B 4Y16D 3OAUH 1N59A 2OJZH 3TBVB 3VFVA 1U92A 3AY4C 2VSDA 1FYHB 3REWA 1ZT7A 2EDWA 4D0BA 4N5EC 5DRXA 2HT3D 3NIFE 1D6EA 4K8RD 4X6DA 3TNMB 4XC1H 5E00B 3LCYA 3NFPA 4JEGB 1SY6H 1NAMH 5DQJB 3QXWA 4JHWH 3IKCA 2JELL 2UZIL 4TPRH 3VMNA 1JGEA 1W0YT 1IFHH 4JM4H 5T1KA 3QI9B 5FDWA 2YA1A 2Z8VC 3MMEB 1DBML 2DLEA 2IPUK 4KKLC 5I75C 4LSVL 4ODUB 1RK1B 5FGCE 5J06A 3MYJA 2JJTA 3QI9C 5FYJU 4BZYA 2WM0A 1GOHA 1S8DA 4OQTL 1B4JH 4HHAA 4RISL 4JFZL 2FIKB 3JUZA 1KNOB 2FJHA 3MRFA 2DMBA 3OKEB 5EU6D 5GSVA 3S9DB 4N90D 4OGXH 5I71B 5INDB 2A74B 4RQQA 1F4WL 4KKAC 2Z93B 4FQXA 3VGAB 3I75B 5IEHB 5JW4R 3SCMA 2CRZA 4OQTA 3QJHA 1R5IB 5EU6E 4EVNB 3CDCA 1N0XH 2AEPL 4N90E 4HDIB 3VGAC 3R0MA 1UB5A 1LK2B 4NJAH 2XG5A 3Q5YA 4G7VL 1LO3L 4EKXA 5HI4C 1DQTA 2O5XH 4LARL 3U46B 1T20B 4KK8C 2BRRL 4QXGH 1A6VL 4YHIB 1ZGLA 3SOBL 1G7PB 3BW9B 4ZUSB 3WS3B 1PKQB 1S7QB 1OLZA 4U7SA 4Z7QF 1EZVY 3GMNA 3EZ8A 1MVFA 3G6AA 5ESAA 3FRUB 1MI5A 2JCCA 4H8WC 4ZTOL 4W81A 1E4WL 1MAMH 5I8OH 2VDKL 1ORSB 3HI1B 3A67H 1CWVA 5I1AA 1BBDH 1NMBH 2C4FT 2BOBA 1FL6A 3KGRA 1RMFL 3UTTA 4X9FA 2QHLA 1I8IB 2A9NL 3OJ2C 3BX7C 5IVXF 4RWYL 4MD5B 5CJXC 1CF8H 1G7MA 1XCQA 5B38A 4P46B 5F96H 3IDNB 3IJYB 5FYKH 1S9WB 1T66D 2A38A 4XVJH 4NQVA 3UDWC 4QO1A 5IT2H 1CD1A 1ND0A 2EDOA 1Q94B 4AENB 3UCRA 1A1MB 3PGCB 1H3PH 3FL7A 1HSAB 4JR9L 2B1HH 3NABL 4UQ3B 5HHVL 4JGMA 2OL3B 3O4LB 3PWPD 1KC5H 1U9KA 2DDQL 5IW3A 1L0QA 5L0QB 3MGTB 1XAUA 4WHTA 4KTEL 2EICA 3PQYD 1W0VB 4QYOB 1OAYL 4MD0B 2G60H 2DF3A 3PWPE 4TUOB 4UDUB 4JJHA 3H9SD 5DMGD 1ED3A 5EU4A 3U30B 3MCKA 5F89B 3WXVL 3ZTJG 3PQYE 4ZFGH 4JLRB 5EIQA 3HE6B 4OUUB 1IT9H 4KU1A 3H9SE 3U30C 4E41D 2AXHA 1HKLH 1BQHB 2FH8A 1LD9B 2NXZD 3HE6C 4I4WB 5GRVL