1M1SA

Structure of wr4, a c.elegans msp family member
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
109
structure length
109
Chain Sequence
HSMINVDPPTGNYPATGGNSTHNITSESDSRLAFKVKSSNNEHYRVRPVYGFVDAKGKSKLDINRLPGPPKEDKIVIQYAEVPAEETDPMAPFKAGAQQGEIIVKLIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords WR4
publication title Crystal structure of a C.elegans MSP family member
rcsb
source organism Caenorhabditis elegans
total genus 19
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2002-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00635 Motile_Sperm MSP (Major sperm protein) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1m1sA00
3LKOA 3UZVB 1BOGA 2OCFD 1MAJA 5GGVY 1X5LA 5AUMB 5F9JB 5T1LB 1A5FH 5EU5B 5HHOA 4I5BA 3DETC 5EORH 3RX8A 4R7DA 7FABH 2R69H 4CRPA 2GJ6B 4QRRA 1A1MA 3FB8B 3MRKB 5IW1A 4FZ8H 2A0LC 2BNQD 4M93B 2R0WL 1DLHB 4P48A 5HHMD 5E2UH 1NCAH 1NAML 2YD5A 4R4FL 4OKDA 3QRGH 5HI4D 4EDWH 1T80A 3WMSA 4IBLT 5IQ7L 1XF2B 1JNHB 5H94A 2WK2A 3WS3A 2AI0L 3KYOA 4Y16B 4MQ7A 5IMKB 5B38A 2QSCH 1FC2D 2COQA 3C6LB 4TVPL 2P5ED 4IRSA 4CU7A 1B4RA 1GPOH 4P3CH 3O4LD 1AGEB 4G8IA 5FKAA 1CBVH 1ITBB 5I1CL 4KHXL 4P23C 1MCPL 4KKNA 5FO7B 5DD0H 4ZNEA 5C07D 4PJHF 5FYLL 1KCSH 4H8WL 3WLWC 2FEEL 1OF2B 1TZIB 3VFVA 1L7IL 3FB5A 3NFSL 2XA8H 3Q6GH 5JOPE 2VIRB 4K8RD 2HKHL 4HS6A 4G6JH 5CMAA 4Y19D 2V5MA 5BRZB 1AP2A 1Q72L 3A6BH 4U1LA 3GFUA 3MA7B 2EH8H 1UWEL 1RULH 5EPMA 3AXLA 3CFDA 5DVNA 2P7TA 4XX1E 4M1CD 3SO3C 2FB4L 1MIEH 4NQCE 2GUOA 4OFYA 1NDGA 3CFCH 3P73B 3BH8B 1ONQB 2GSGB 3MLXH 1BZ7B 2XZQH 1M71A 2DQJH 3UMTA 3QQ9D 1A7QL 4FQ1L 1UB5B 2F8VA 4POYA 5HYSA 2PW2B 2ATKB 4OT1H 2FSEA 4DW2L 4OJFL 2VH5L 4IS6A 1OPGL 4LFHG 1MJUL 1I7UA 3FO0H 3MODL 3BRDA 4MAUL 4PB0L 3CU7A 4L9LC 1S5IL 3BGFB 5BOPA 4J6RH 1C12A 1QR1B 5IMOB 4OZGF 3GUTA 1U3ZA 3BEWB 1A14L 1INQB 2PYFB 1GZPB 5E08L 5T3XE 3HMWL 4NUGH 2BHZA 2A6IB 1ADQH 2EEBA 5EZJB 4CGTA 5DFTA 1JPGA 4ZOEA 1ZA6A 4KRNA 3C87A 4PRBB 4L4TB 2VC2H 4KK8D 3CMGA 5IFHH 2Q7NA 3TO4A 3NACH 3TBSA 1UH3A 3QJFB 2O93L 4QOKE 1Q9WA 1IILE 1R5VA 1X5AA 4GAYA 3KYAA 1IEBB 3QQ4B 3MNWA 2ADGA 1RI8A 3AU1B 2DRUA 3KYKL 4JB9H 4XNQA 3S36H 5I75C 2V5TA 1U0QA 1A6UL 3P0YH 4LEOB 4OAWA 4ZOCA 3E6HB 2OK0H 1WZLA 1AD9A 1BLNA 4YWGL 4YHNB 1FL5A 2FWOA 2RQ8A 4LCWD 4WUUA 3IFLL 1T2QH 2FYYB 3HZKB 1R24A 4LNVA 5C1MB 3T4AA 1XGPB 3QDGD 1PKQE 2NMSA 1IM9A 3MJ9H 4LVNB 4KRPB 4NN5B 3T09A 4N5ED 5DO2C 3C09C 3QI9D 3ARWA 1DTUA 2YUZA 3SOBL 1I7ZB 1H3TA 3TNMB 1TFHA 2I60H 1JFQL 1FFNB 1U8NA 2ZSWB 3L3HA 1LO2H 3Q5OA 4QWWD 5IVXB 2BOCA 4NJAH 1OWWA 1N0XL 2HKFL 5ERWA 2P24B 1G7PA 2Q1EA 3BESR 5MHSE 4XAWH 4LSQH 5LVEA 3NGBB 3MRHA 4J4PC 4XWOC 5DUML 1ZVHA 2KZ1B 2H45A 3FQWA 4JR9L 5F7MC 3RTQA 5IBTL 2B1AH 5TQ0L 3KHOA 1NJ9A 1I8IA 2XTJD 3QG7L 3RIFF 3STLB 2DQGH 5DSCA 4K71C 3WHE0 4GXVH 1QQDB 3W0WB 2E7MA 3ZTNL 5ALBH 5ID1B 1FFOB 4ZPVB 2XQBL 5CGYD 1QSEB 1NKOA 4U6VH 1A7OL 4MNGE 4ZAKA 5DUPL 3MRJA 3V4PH 1I1RA 5H2BB 4BUHA 3ZHLA 3QQ3A 2WAHA 4Y4HB 5IFAL 2EZ0D 1UB6B 1KB5L 3MLTB 1G9ML 1ZT1A 3ZT7A 4O5LH 4WW2C 1ZWIA 4LQFH 1UXWB 2A1WL 4TTDC 1W8NA 5JORB 4Y2OA 1MJ8H 3I50L 5DURB 3L5JA 4NQEB 4WW2F 3UTSA 5LGJA 1WIPA 3LS5H 3A6CH 3EJZD 2H32A 43C9B 3HC4H 4JFXB 4ZOBA 3D39E 1QSVA 1Q9KA 4TUJA 4GAJH 4G6ML 1PLGH 5C0AD 5HPMA 2AK4E 4P2QD 5DJDB 3BGMB 2BNUB 4CMHC 1QLRA 2DTML 5B8CB 4QXGH 3DYOA 4LL9A 2J4WH 5GXBB 5FGBC 1LE9A 3O3DA 1MVUB 1KTDA 2B8OT 3C5SB 1Q9LB 3VXRE 1FFQA 4YNYA 4DAGL 4JLRB 3GRWH 3LKNB 5C0DA 1WCBA 4JRXE 4Z7WE 1G9NC 2P1YA 3SJVD 3WFEL 3X13B 2AJUH 2D7NA 2QQNL 1EX0A 1AQDB 3F7RA 4B53A 5I30L 4MMZC 1EEUA 2H6PB 5E6IC 3C8DA 1N6UA 3D3VB 1OL0A 1S78C 2ED8A 1OSPH 3OPZL 4QY8B 4X6EB 1GZQA 1PQZA 2C1OB 4ZTPH 4K3GA 5CBEA 5ID0A 1P4BH 1TZGH 4EN3A 3T2NL 3QXDB 1O0VA 4JRYE 4LSVL 4YBQD 3RWDB 5E94B 4TVPH 3P77A 5F3HB 1LO0H 2I9TA 4NBXB 1N59B 1QO3A 2ERJB 3C60B 1IFHL 5I1CH 4KHXH 1CCZA 5SWSE 5EBGA 5HI5C 3L3OB 2Q7YB 3AAZB 1L7IH 2DM2A 3MROA 3V6OE 3QCUH 1G6RL 2ATPB 3N1QC 4P2RD 4Z5RB 1KG0A 3LQAH 3T0DA 4Y4FA 5CEZH 1DQQB 2W65B 2D0HA 1CD9B 5C6WH 4NKOB 3ALWA 3VJ6A 2NY6B 3FT2A 1UWEH 2G60L 3NPSC 4GAFB 1BQHG 2FB4H 4XI5C 4KZDL 5JHDE 1J0KA 4K55A 5MEPB 3GMMB 5DRNA 3HPJA 1OLLA 1I8LC 2J6EL 5HHVL 4LF3B 5CJ5A 2ADJB 4FQ1H 1D6VL 1RJYB 3UYOD 1IGCH 3U0PB 4D0BB 1HSAA 3KPOB 1NFDB 1S9VB 2DQHL 1UWXH 4YH6A 3NA4A 4JJHA 4LKXA 4DW2H 5EFIA 3IDMB 1I3UA 1KPRB 1MJUH 3MRFB 1X5FA 5JW4N 5ENWA 2R2EB 1TQBB 3WFCL 3QIBA 1OP9A 4ZQKB 4MCZA 5C9JA 3DUUB 3SGDI 3E8UL 2BOBB 1A14H 2KQNA 1UWGL 5E03A 4QRPE 5E08H 4N8VG 1HHJA 4GSDH 2YBRB 3JZ7A 4Z7NE 5L2KE 3CPLA 5T5NF 2D03L 5C0CE 3SE3C 4I0PB 4P5TB 3ALXA 3RX7A 1ZGLA 4WV1B 3BPCA 1HH6A 5MERA 4M6NL 3SE9H 1NCBH 4EUPH 1YNLH 5TGBA 4HXBL 4GKSA 2VL5A 1M7IB 2NY7L 3DYMA 3C6SA 1NC2B 5FUCC 1TCMA 2AV1A 1WFNA 5I76A 5EZLA 1CR9L 5DK0A 1CD1B 2WIMA 3I84A 1P9MC 1LNUB 2YWZA 2WM0A 3O6LL 5KTEL 1T89C 3QO0B 3R06A 4JFFD 1REIA 4Y5VB 3AS2A 1AD0B 1CDHA 2ZUSA 3P4NB 4FFYH 4E41B 1VA9A 5EZOL 3GSQA 5EA0H 2A6DA 4M62L 2I27N 1OOAA 3EDDA 4G6FB 5IEKB 1JYNA 5DGQA 4BQ6A 3HC0A 1YEDB 5I1EL 4FFZH 2WBJA 3V4UH 1T7VA 1IAII 4I2XB 1T21A 1T83C 4JDVB 3T0AA 3KPPB 4MA1C 1MJJB 3ARFB 5EOCJ 1A7PL 4X7EC 1LVEA 1IC7H 3JV4B 1UKQA 1DDHB 5EN2B 3WKML 1MHEB 1U58B 1UZ6E 1MVFA 2J8HA 5HHPA 4BYHA 4ODTL 4ZG1A 3DHMA 4XNUL 1EVTC 2EYRB 5CD5D 3HC3H 4Z76A 4YPGB 4CUCA 4ZFOA 4RAUB 3K8LA 3BDXA 4HPYH 2NTSP 1KN2H 1NSNL 3QG7H 3DMMA 4P3WA 4ELMF 3DURB 2IH1B 2HT2D 3SDDB 5HYQB 1TITA 2NZIA 4GRMA 3FHQA 1OTUD 1X44A 3QHZL 2ZUTA 5JOEA 4JFYA 1E4KC 1S9KC 4XXCC 2XQBH 1A7NH 3GBLA 5HGAA 2DI8A 4CMMA 4QCIB 3HR6A 3UTOA 3SDAC 5C3TA 3CUPB 4E42B 4XVUC 4Y1AE 4YDLC 3WS6A 5DT1H 3RHWK 1Z9OA 3J8F7 5JMRA 3U0WH 5T1KB 1T22B 4PP1D 2HJLA 2RGSA 5HGBA 1ZHKB 1ETZA 5ISZA 4I77H 1YMMA 3SDCD 1VGEL 5IB2A 4KTDH 4UBDD 4Q9RH 1KIPB 1IGYB 4OCYL 3MGOA 1FL6B 3G08B 4QTHA 1I1FA 3LEXA 5D7LE 3VU2A 5AAWA 2W1NA 2PO6A 4RFNB 4ZXBD 5HXMA 5IFJB 1QRNA 5FA3A 2DTMH 4GG6F 2V2XA 1RMFL 3OKEB 3H8NA 1A6VH 5T1LD 4R90L 3GJEA 2NNAA 2Q87A 3BD4A 3U9UA 1FGVL 1AH1A 4CN4A 3B9KC 3UYRL 4QOKA 3VFPA 1CLOL 1HHHB 3T0ED 3X3GL 1OAYL 1U8HB 5E7BA 1PEWA 5D9SB 5I30H 4NNXA 3LVEA 1FZKB 3DX9B 1MCCA 3QQNA 1MCDA 1HHIB 5DJYA 2AQ3A 1JV5A 5JXEA 3JV0A 1AGFA 3P4LA 4PGZA 4HWBL 4QRSA 2IEPA 2X89A 2YZ1A 4PJHB 1T2XA 1BM3L 4NDMA 3CLEH 2QSQA 1Z3GL 1I85A 2ZOKB 4M48H 4P23B 4JJ5B 3JBG7 2C9AA 3K7UA 3GMOB 3T2NH 3L7FB 5INDA 3CSYA 1OTTC 4HCRA 4ODXB 3SPVA 4NZUL 3ZT5A 2JCCA 1A6TB 3PP4L 5H37H 2X4SB 3P9WB 5C0NC 3BZ4B 1JF5A 1RUPL 2VLKE 2D9QB 4QHUB 2EH7L 3KXFB 2X4PB 1DUZB 1EZVX 1VB9A 2NZ9D 3FONB 3MO1A 3X3FH 4U1GB 3WIHA 1HIML 3SO3B 3IJSB 1G6RH 1N64H 1KXVC 2VDNL 3F12B 3BH9A 4YHML 3DXAB 4YFEA 4JAMB 1P1ZA 1RUQH 3IJYA 5CD3A 2FO4A 1YY9D 4W4OC 4AEEA 1V3JA 5DF0A 2NW2B 4Z95H 1U6AL 1W72B 5DMGD 4N0FB 5I2IB 4EOWH 4JY5L 4DOHB 5IGXL 2NR6C 4EI5D 4KZDH 1D5IH 4NIKB 3WDIA 1K4CB 4UDUB 4CN6A 5GZNC 2VLRA 4NNYA 4WI9A 5I1KL 5I17A 4MAYC 4L9LB 2IGFH 4MD5B 5HHVH 3DVNA 4MJIA 1AFVL 4U7KA 1QFWM 1MELA 3RAJH 3P11L 4G7VH 3AS0A 4GQPH 1JPST 1T6WA 3FO1A 1QFPA 4LDOB 2V5SA 1DLFH 2QSTA 2BMKB 3ARDA 3TFKD 4JHAH 3WFCH 5IK3A 5DD3H 3BKCH 5DK2B 4ZODA 4E5XA 1HDMB 3K74B 3KNBA 1WIOA 1LD9B 1PZ5B 5B4MD 4U3XA 2YK1H 3VXSE 3T1FA 1CICA 3JWDL 1UWGH 1A1NB 4QYOA 5FM8A 3TN0D 3V0WH 3PL6B 1BIIB 3D39A 4LRNL 3BUYB 2ZCLL 3OHXA 3NFPB 4M8QB 5DUBA 5LGHH 4Y5XA 5J57B 4YDJA 1YECL 1EHNA 3OGOE 4K7PY 4QRUA 4JDTL 3V5DA 1JWMB 5DI8B 3R0MA 2NY1C 1R6VA 3ET9F 3PWLB 4DTGL 4HFUH 1MCOL 1GGCL 4ACPA 3HZVB 3V6ZB 3H6JA 4HXBH 3TIDB 4GG8A 2NY7H 4JRXA 4UV4H 1PW3A 4Z7WA 2FJFB 4ZO9A 1MCEA 4XNZC 1XGQB 3ZDXE 2OR8A 4KJWC 4X8JB 3DECA 4RRPA 4GJTB 3LQAC 3VDBA 4M7LT 3MACH 3GHBL 3O6LH 5KTEH 1WZKA 5CJOH 3BXNA 5HYJD 3IU3A 5DEFB 1MWAA 2HFFA 3SGKC 3OZ9H 5HY9A 2LQRA 5KJRH 4LLQA 4F9LA 1XCTA 2R1WB 3OAUH 2GITA 1NANH 4NRXA 1CDCA 5I1EH 5T5FL 1P5VA 1NH6A 3TZVC 4L8CA 5DJXA 5E8NB 3TNNA 2BC4A 5TE6L 4OFDA 3B9EA 4HLZH 3I3BA 5TH2B 3S3PA 4KRLB 4LPXA 4PRPB 43CAA 2P4AB 3O4LA 1EUUA 1Q9OA 2VKWA 2VLLA 2K1MA 5AEAA 3PHOB 3RWHB 4XNUH 3T3MF 5IB4B 3UTZA 2DIBA 3FFDA 3K4DA 3I3EA 3SKMA 5CKAA 1ZK9A 3EYFA 3BKMH 1DE4A 3UTTB 3W0WD 2X40A 3O6FB 4FQQA 2XWTB 1NSNH 2CK2A 3VI3F 1CLCA 3L5WA 3H0TB 5D93C 1QSED 3K8MA 4U0QB 3UPRB 2ZOLB 4Y19A 4N1CA 1R3KA 3QHZH 4WW2B 2NY0C 3QDMB 4Y4HD 3SN6N 1OGTA 2ORBH 5D2LE 5DEZA 1CZ8H 2I07B 2NXYC 2GTZB 4OZHB 4O2FB 1RZFL 5LAXB 1F00I 2MWCA 1AR1C 5DURD 5KS9E 1EEZA 4NQED 4TUOA 4Q0XH 2ZUQC 3HNSL 4G6AD 1IJ9A 1UCBH 4AQ1B 1N4XH 2DYPB 4PJXE 1X5JA 3B5TA 3GBNL 3GMNB 5IIEA 2OSLB 3TCLA 2Z93A 5I1IL 2FH6A 3PNWA 4OCYH 5ANMB 3NCBB 4JGJA 4JFOB 1MCQA 4LCYA 4PJDE 4U4BA 4PGCB 3MNVB 1JGVH 2EKJA 3RVWD 9CGTA 3QNXA 1XF5B 3BZEB 5IV2B 4QRPA 1G1CA 4HCRL 1YQVL 3MLWL 4Z7VA 1ERNA 4BH8A 2CKBL 3F7YB 4HUXA 4AJ0A 4ZUWB 3O41A 5E6IB 3HRZA 1BVKB 4R90H 5KVMC 3FQXA 1A4KB 5DTFB 4NFCA 3QUXC 3D3VD 3RWGA 1R5IB 2GJ6E 2P8LB 4O2EB 5LG1A 1CLOH 1KLUA 4TPRL 4F7TA 3W9DA 2YA2A 2VABB 2OTUA 2I9LA 1KIRB 5I8OL 3RWCB 2D7MA 2DQEL 2MPAH 3QEUB 5JIKA 1RV6X 3O9WD 3BIKA 1UH2A 1GOFA 1MHPL 3FKUS 3FQTB 1JPSL 1C1EH 3NIGE 1BM3H 4HQQH 3DIFA 2RBLA 1Z3GH 4LCWA 5MENB 1RUAL 3QA3A 1QFUL 1YEEH 4G42A 3QDGA 1U2CA 4MA3B 4NM4L 5TDPA 3LKPB 4JHZA 3RGVD 1I1YA 2RAMA 2EIZA 3G6JF 1AJ7L 3NCCB 2QHRL 3H9ZA 2W0KA 2IALA 3Q6FB 1EFQA 4ELKA 1XF3A 4JM2C 1NCWL 2EH7H 2GY7B 2E7LC 5AYUL 1U41A 2AKRB 2ZNXA 3RNQA 4HH8A 5HJ3B 3V0VA 3NPSB 3FFCB 5BRZE 3BPLC 1JNNH 3GIZL 4LLMB 2NY6D 5SWZB 2YD6A 1MUJB 1DSFH 2YKLH 4MLIA 5C0EB 3UJJL 3F6IA 4YHMH 4KXZH 4IOFC 3E6FB 4JHWH 3P30L 1MHHA 3OWEA 1GSMA 1KYOK 1SY6A 3F7VA 3BPNC 5DRWB 3BAEL 4AENA 4YHLH 4M61A 3SBWA 3MRDB 4HS8H 5LXGH 4UQ3B 2R1XA 1T1WB 5A2IH 3OKNB 4WTZG 4M7LL 2E9BA 3BDYH 1WLHA 4HKXA 4YAQB 1RJLA 1CG9B 3SE4A 1KN4L 3FRUA 5BZWB 3CVIH 1F4YL 1RJZB 4X5LA 1E4XH 3VFRA 1I3GH 4OGYL 1E4WH 2B4CH 1PX3A 6CGTA 4L8BB 5BV7H 1QBLL 4AIZA 3ULUE 2VDKL 1YN6A 5TPWH 5I16B 2VXUL 2X9WA 2YOCA 3B2UC 4NZRL 1XF4A 2W60B 4I48A 4IMKC 1QFHA 3S7GA 4LCCA 1G9EA 1EBAA 4XCFL 2FBOJ 4ODWA 4J12A 4L4TE 1ZLUH 5C6PB 4GLRH 4S2SA 4BQBA 4UZGA 5HI3C 4LRNH 5F1NA 4PGEA 2VERN 1FJ1A 5TF1L 5INCB 1U42A 4UIKL 4O9HH 5EIIB 1QEWB 1LHZA 2GK0B 3HE7C 3HUJA 4KVNL 5EU7C 1FYTB 4BH7A 4NWTH 3U6RB 3LS4L 5CZXC 5K59F 1GGCH 1CDIA 1EBPA 4O2CB 4G8GB 1DFBH 5HHNA 3CDYA 4AG4L 2VXQH 3QIUC 4IOIA 4H88L 2DB8A 1EO5A 4KJQC 2L0DA 4JGUA 5DQDH 2VKXA 2A77L 4D9RE 4E41D 3X14B 5FCSH 1RUKL 4FXKA 2A2QT 4G6FD 4WDIA 2R29H 2P45B 2FD6L 2NW3B 2NXZB 1TQCB 3ZTJH 1HZHL 5F9WB 2EECA 3VRIA 1U8PA 3EAKA 4XVSH 2OTWA 4P46A 4F7PB 1LMKA 5T5FH 3KLHC 4ELMB 5KZCB 4I18C 5GPRA 1CGYA 1UVQA 1HXYB 5FUZH 4KI1A 4NPYA 5GS1C 1TJGL 4QKXB 5JPMB 5JW4R 1NGZA 2Y07H 4U31A 2R2BB 1IT9L 4KKBC 2ILLA 3RWIA 3ZYZA 5CEZE 4LFHD 2YR3A 1J5OH 1A7BA 1TENA 3SDDD 3V8OA 2Z31C 3QUYC 4GW5A 2H2PD 4X4XA 3HMXA 1FE8H 1INEH 1I1AB 2GTWA 1P7KA 4AL8L 4P2RA 1X5YA 2E5EA 3SDAB 4RGND 4WCYH 3U30C 1Y6MR 2CLZB 4JZOB 5LQBH 3IDUA 4I3SL 4X4ME 3D48R 3TVMC 3H2WA 4JFDD 4ORGB 3S5LB 3FT4A 3S88H 4HJGA 1XGRB 3RVVC 3MGTB 4LEXH 1CT8B 1N5AB 2KZWA 1G7IB 1A4JB 1N26A 1KCLA 2H2SD 2HTLD 2MFNA 3OB0H 4BSWB 1T1ZA 4WWKA 4XPAL 4E0RA 3F58H 3HNSH 1S7TB 1YUHA 4FFWD 4CN1A 1GCFA 3TPUA 2LABA 2Z35A 2XG5A 2YSSA 1MI5E 4U0RC 5ILTL 3GBNH 2F53E 1ORQA 2YD8A 1D6EB 4R7NB 5B39A 1T03H 3U1SL 4RCAA 5FGRA 1EMTL 4P0DA 1HILB 2X4QA 3MJGX 4AIXA 4ERSL 3FQUA 4KPHH 3NCEB 3L6FB 2AQ2A 5F89B 4R4BB 2UV3A 3VXSA 4F15B 3TYGL 4J8RA 2IQAB 3DETD 3CGTA 5TE4H 3B9KB 4F3FA 2EC8A 4RISL 4XGZB 3VDAA 4MB3A 4ZS7L 2A0LD 1QTYT 2WSKA 3AVEA 1Q0XH 3B43A 2ZCHH 3OAZK 4JN1H 3PGFH 4K23L 3CVHH 4L1DA 4PJ8B 4QXWA 4WFHE 4MJ2A 1X5XA 3TA3A 3GMQB 5I1AA 2G5BA 1L4IA 2X70B 3MRNA 3MXVL 5CJBA 4TPRH 2KKQA 5DS8A 1IL1A 3EYSL 1ZHNA 2Z91B 4GKOA 5CSGA 4NNPH 1KNOA 4NOFA 4XPBH 4NQVA 5H37G 3TBVA 1RZ7L 5IG7A 4E9LA 3IETB 1UQSB 4IRJA 1BX2B 3SCMB 2LTQC 4ZO6A 4P23D 4K3JL 1ZTXH 2MJWA 2BVOA 4FOMA 2Q6WA 1CL7I 3WLWD 3EYUH 1LP9E 2AJYH 2H9GB 4JFFA 4WI8A 2PTTB 1AXTL 3GJFB 1T5WB 3VDCA 3M17B 5IB3B 4MNQB 1S5HB 4NM4H 2BVQB 3I2CL 4NHUA 1LK2A 4MHHI 5I71C 1GJIA 4YZFE 3KXFD 1AJ7H 4N0CC 1WF5A 3G5VA 2HFTA 4WEBL 4L8DA 3DRTB 5KSBF 4D0CA 1NBQA 3IF1A 4EVNA 4QHNA 2PW1A 1ZT4B 4P99A 5AYUH 3VFOB 3UAJC 2R0LL 3K80A 2FX8L 2IG2H 1U3YA 1U8KB 3TH3T 3IDGB 2VQTA 1I7RB 4M3KB 3BE1H 2EKSB 3VXPA 3UJJH 4OLZH 1A6PA 5CIPA 2VDML 2GAZB 3ZE0E 3P30H 4NO5A 4P2OC 1OB1B 4MD0A 1NC4D 1J9CT 5HVFB 5D1QA 2C3HA 3AB0C 3STZA 1YN7A 4I0KA 1V7NH 2DQTL 1NEZA 3RY5A 2IFFL 1FBIH 1UGNA 1QYGL 3CDCA 3JV5A 5JLZA 1Z9LA 1DQJB 2DLIA 4M7LH 4LNRB 2DBLL 3WSQH 2A83B 5DC4B 2EDXA 3H42L 5LCVH 4HEME 4ONGL 5KG9A 4IOSD 1JGEB 1MLBA 3HAEG 3GSOA 2HTKC 3RI5F 2EDTA 2CXKA 3QBTB 1DVFC 1SBBA 2JB5L 3NCMA 5EC2A 3RIFK 5KS9A 4D9LH 1NAMB 1QBLH 1KIQA 1KJ2A 4IEFB 1FVCA 1NGWB 4TRPL 3U82B 3PIQB 2NQCA 3OKOB 5EO0A 3VXQA 2AJSL 3V2AR 3GI8L 1YEJL 3MTRA 2NY1B 3BX7C 3WNKA 4HX1A 1K4DA 1ZLVH 4NO0B 1YEGL 2BRRH 4U1HA 3IDJB 3QFJE 5TF1H 4BSVA 4UIKH 4WRLA 4LHUB 3QG6A 4ZXBA 2C3GA 2GJZB 5KVDL 3WD5L 4K3DL 3QXVA 2UWEB 4PG2A 2JJTC 4PJCF 4DJMA 1MF2L 3ARBC 3LS4H 1U8IB 1BEYL 2BNRB 2F8OA 4K9EH 5DO2D 1MLCB 1T66C 5F9JA 5AUMA 5T1LA 2DBJA 5EU5A 4GUPB 4O58H 1CU4L 4YC2B 3HMXL 4CVUA 5AAMA 3U4BL 5KVFH 1JGLH 5IVZB 2GJ6A 4HLZG 2A77H 3T0EA 3FB8A 1PY9A 3MRKA 3ZYJA 1RUKH 1MHCB 3S96B 3KPRD 4X99B 5I18L 4OQTA 3CZFB 2LU4A 4U3HA 5J1AB 2FD6H 4I2XE 4Y1AD 1HZHH 25C8L 5EU7E 1XF2A 1JNHA 2CQVA 4J4PD 2IWGA 4XWOD 5C0JB 2Z8WC 3SE8L 3BP6B 4FQ2L 5D2NC 5IMKA 3C6LA 3O3EB 2YRLA 4PRDB 5E5MB 1AGEA 3JTTB 3RIAF 5I9QC 4WI3A 5FO7A 1EUTA 1I4FB 1ULVA 2JELL 1CFVH 5AWNH 4HC1A 1OF2A 5CJQL 2B4CC 1CD8A 1TZIA 3UTTD 4YR6B 2RFXB 4U6YB 5E4EC 4X4YB 4LKCA 2GSIB 4MJ4A 4OLWH 2VIRA 5BV7C 1FDLH 1T0NB 4U1NB 3RPIB 1WZ1H 2X4UB 4KI5C 1ZS8B 4HGMA 5BRZA 1UJ3B 4AL8H 4TTDD 1CIUA 2N56A 3GSXB 4JFEB 2IANB 3JV6A 4PGBB 5GZOC 5I1HH 1U9KA 1B88A 4KI5F 4DGYH 2ZUQB 2QEJA 1DQLH 3P73A 5GGVL 3BH8A 2GSGA 4EUPB 1BZ7A 3DLQR 4DK6A 4ONFH 1F11B 1EO7A 4O02H 4HUWB 3K4ZA 1HE7A 1UB5A 3U4AA 1EEQA 5HVHC 2PW2A 2ATKA 4OZ4B 1QLFB 1QFWI 2DYPD 3H9HB 5EO9B 1JCKA 4DVRH 3U9PH 3UBXI 4YBLC 4A6YH 1FVDB 1LILA 1YYLL 3DX6B 3VA6A 4PJ9C 8FABB 2CLVB 1QR1A 5IMOA 1IAMA 1P2CB 1XIWB 3PGDB 4NRZB 3BEWA 1INQA 1GZPA 1EMTH 2XN9B 3VMPA 3REVB 3F7PC 2A6IA 2WUCL 2UZIL 5EZJA 3QDAA 2N1KA 1WAAF 5T1MB 2VLKD 2PN5A 3QCVL 3QUXB 5E6ID 4PRBA 4L4TA 1S78D 2CPCA 1GC1L 5KAQG 1L7TL 1HCVA 4RISH 1VACB 3QJFA 5BVPH 1T0MA 1JWUB 2OJZL 5FF6B 3GZKA 5FYKL 3QQ4A 1IEBA 4M02A 4XP9H 3MNZB 2ICES 1Q8MA 5T3ZD 4LEOA 2QJDA 1AXIB 3E6HA 1EDQA 4HGWB 5MEND 3ZKSD 4NM8H 5BW7C 1CIDA 3LKRB 2FYYA 1VFAB 5H8DA 3HZKA 3OB0K 5KSAC 3GI9L 4K07A 2J5LB 1XGPA 4GO6B 5L7XH 1XR9A 1J1OL 1MOEA 1KB5B 1PAMA 1I7ZA 3TNMA 1G7JB 5HHOB 2JK5B 1UCTA 5B3JF 5GS0L 2XZAL 4PRIB 1NDMB 1FFNA 5DMIH 1RIHL 4HULB 4UTBH 2ZSWA 4QRRB 2CUMA 3DROB 5F9OL 1JZ5A 4WEBH 3W2DL 3LPFA 5IVXA 3FFCD 3R8QA 2L4OA 1UT9A 3R1GL 4UOJA 3SDXF 2CIIB 2FEDC 3T4YB 4XI5D 4OLXL 3ZE1F 1KJ2L 1RZKH 3BKYH 3QPXL 5SWZD 2P24A 3LQZB 2OZ4A 1IQDA 4HJJH 3KYOB 4GQ9H 3BYTA 5B38B 5MI0C 3CIQA 3PF2A 4DOHE 4BFGA 3STLA 2VDMH 3VGHA 4PP2A 4OFPA 3VWJC 1QQDA 3AC0A 4OGXL 3W0WA 3HKFA 5ID1A 3GKWL 1FFOA 4ZPVA 4OFKA 3RWEB 1H3GA 2ZG3A 1QSEA 3RVTC 1QYGH 2Q3ZA 4X4MA 4X7FC 5H2BA 4DQOL 4JGMA 5FFLA 4Y4HA 4U1JB 2X4TB 3RDTC 5FGCE 1GAFL 1UB6A 4ONGH 5IHZB 5FK9B 3OSKA 3O2VL 1UXWA 3RGHA 5I1DB 5JORA 4L5FL 1A02N 4XPHL 5BVJB 5IHUH 2PTUA 2XY2A 4NQEA 4N0YL 5C0BB 4KU1A 4PJIF 1M71B 2W0PA 43C9A 4JFXA 5GIRB 2VZOA 1HCFX 5F1IB 4AH2B 1DBBL 4G5ZH 1YEJH 2FEEI 5JW4M 1ZT7B 4D9QE 4F7CB 3BGMA 3VH8B 1BQSA 5B8CA 3CFIC 3VI4E 3MV9D 3KPNB 5GSVB 5AG8A 3C5SA 1Q9LA 4G8GD 5I1LB 3WD5H 4JLRA 3VXUD 2OXHA 1V05A 1G6RB 1NMBH 2M26A 3LKNA 4HK3J 1MF2H 3X13A 3PQYE 5M94B 3QYCA 3GBML 1PZUB 1AQDA 2VXVH 4PV9B 3TWCH 1FZJB 3U4BH 2H6PA 3BP4B 3VE0B 3WIFB 3D3VA 1FO0L 3FB6B 3X12B 4LIQE 2BSED 4QY8A 4X6EA 3MUJA 3QUZC 2C1OA 2YMXH 4X6DF 1ZLSL 3OJDB 1TTFA 3DHJA 4HH9A 4AT6B 4GAYB 3UP1A 4XNQB 1MFCL 1OW0C 3RY4A 1JYXA 5KZCD 4P49A 4P4KC 3MRPB 2YUXA 2IMMA 3QXDA 2V9QA 5SX5H 3RWDA 2WINB 5E94A 4PRPE 5F3HA 4KWUA 1AD9B 1NEUA 2AW2A 4F8TA 1N59A 2ICWB 3C60A 3WHE1 3QUYB 4XT1C 4YX2H 5L88L 3U48A 5FOJA 2V7HB 5C6TL 4GMSL 3L3OA 3U30B 2Q7YA 3EFDL 4ZUTB 1AKJD 3MUY1 4P4RB 2NY2B 2ATPA 4PPTA 5TE7L 3QXTA 5D8JH 4QXUH 4Z5RA 3SDAD 3VGAB 1VADB 4C58B 3ZDZE 3S37L 2W65A 1DQQA 5EOQH 4NOBA 2FJHB 2KBGA 4NKOA 4K94L 2X6MA 4KZEH 2BOCB 3ILQC 4WFGD 4OZHE 1NBVL 3AM8C 4MXQC 4YUEL 5MEPA 3MV8D 3AMLA 3KR3L 3L9RB 5MP6L 4LAQL 3BWUC 4LF3A 4APQC 5J56B 2ADJA 2F5AL 1RJYA 3MOBH 3U0PA 4WO4C 4U0RB 3KPOA 3HPLB 1LK3L 1NFDA 2FX7L 5EOTB 1S9VA 2BHYA 1ORSB 3S3SA 1KPRA 3GJFK 3MRFA 4K9EC 2R2EA 3RL1B 4JO4H 4DZBB 4ZQKA 3TBYA 2VDPL 3DUUA 4L3EE 3O45B 3GDBA 2BOBA 5EU3B 1PSKL 5EOCL 5CP3A 3B9KD 2WUCH 2R4RL 2YBRA 1MCJA 3NIFF 1NCDH 4FQLL 2DKSA 5I1GH 4TSBL 2YWYA 3QCVH 1G7QB 5HYIA 1KCRL 3Q5YA 4IIQC 1KJMB 4W4NA 5E8PB 1AO7B 4I0PA 4P5TA 4PJ8D 4WV1A 4FTVE 4Z7UF 2FIRT 1CF8L 3MRLB 4AEIH 4TUJB 1X4XA 5FYKH 5CEXB 1WISA 1M7IA 5HPMB 2NCMA 4G3YL 1I9IL 4UAOB 3GSVB 4OZFH 2F5BL 2WBKA 1QLRB 3DVFA 4L4VD 1CD1A 3CFKB 1LNUA 4JG0L 4JFQB 4WNQA 5CUSL 3QO0A 5KSBB 5BO1L 2C3XA 1TPXB 4Y5VA 2GW5A 1AD0A 1WCBB 3P4NA 4E41A 1YMHB 3QUML 4RMWA 3FB7A 4QEGA 5J8OA 1FLRL 1MCKA 2PR4L 5IEKA 1UM4H 4MXVE 4D3CL 2IAMC 5GS0H 4I2XA 1TVHB 2YXFA 4JDVA 4ETQB 2OP4L 3KPPA 4ONHB 4F33B 4KQ4H 1MJJA 1N7MH 1UFUA 2GJJA 3ARFA 1IC4L 3JV4A 2E6JA 1XAUA 2DLFL 1GZQB 1MHEA 1U58A 2DWEB 3MRCB 5DC0A 1WWCA 1U8QB 3BGAA 3GEWB 4BFBD 4G9FD 2XTLA 2NR6D 1YNTB 3ZKXB 4OLXH 2VJXA 3P40A 4P2OB 5CBEB 1C7SA 1FAKT 1WBXB 3CFJB 4KVCH 5GZND 4ALAL 4YPGA 3AB0B 4RAUA 4B0MM 4HK0A 5FDYA 3IJHB 3HI5L 1MFEH 3SKJH 4U1IB 4CJ1A 4TQEH 1FPTL 3DURA 2IH1A 2OTPA 3SDDA 5HYQA 5CINL 2ESVB 1LDPL 3P4OB 5HGHB 4PS4H 1PKOA 4KK9C 4P2YA 1MH5B 4K3EL 4TNWK 1GGUA 3UBXG 1F13A 1SJHB 5EUOF 3HG1B 4Q6YA 3CUPA 4E42A 1MAKA 5DVLA 5A2FA 3HN3A 2BCKB 5FV2A 1KYOJ 5T1KA 3I02B 2Q8AL 4M4PA 1T22A 5BS0E 2HYMA 1GH7A 1FSKC 1P84K 1ZHKA 1M6OB 2RCSL 2VQ1B 4N0YH 3FTGB 4TVPD 1ZLWH 2NY1D 4PJCB 1KIPA 5I6XB 1JN6B 3V5HB 3QZWB 1IGYA 1ZHBA 3CLFL 2J2ZA 1FL6A 3G08A 4NO0D 1HSAB 3EOBB 3ROOB 4FZEL 5DVKA 5L9DH 5EFIB 5TF0A 3ARBB 3SGEI 5IFJA 1FYTE 4BFIA 4U1MB 2F54D 5FYJH 1XH3B 1VESA 3I9GH 3MXWH 3PWVB 4OM1H 2R56H 2J8UF 3OKEA 4MJ6B 2H32H 4JY6A 5CJXC 5JZ7C 4DKEH 2UUDK 2BDNL 2V7NB 1NGYB 5CAYB 1HHHA 1PEZA 1FLTX 3QDJE 5T3XL 1RZKC 1U8HA 5D9SA 4XPTL 1FZKA 3DX9A 3LEYL 5EU6B 3TZVD 4PFEA 5JA9A 4HBCH 3CCHB 5D2NB 3BPCB 3S4SB 3H9YA 3GGWA 4PJHA 3UDWA 5KVEH 4IJ3C 1ZLSH 1MNUL 1W8OA 3Q5TA 2ZOKA 5IP4A 4P23A 3U7YL 4JJ5A 1MPAL 4ELME 5IVNA 3GMOA 3L7FA 5ESQA 2FCBA 4DFHA 1UA6H 3LRSB 3NIDE 5E4EB 4ODXA 3EFFB 3C8KB 1A6TA 5L6YL 1WZMA 2DTSA 2VSDA 2X4SA 4NWUL 3RNKB 3SGJC 3BZ4A 4N1HB 3CDGB 4QHUA 4ZSOB 3KXFA 2X4PA 3QIWC 3FMGL 2XPGB 1DUZA 4D2NA 2CRYA 3FONA 3GSQB 5F93C 5JHLL 2A6DB 1MRCL 1FRGH 2BVYA 4DEPC 3IJSA 4Y5YC 4BA8A 3O2DH 1UENA 1RZJL 4JFED 4JKPL 2WBJB 3F12A 4P2CG 2IAND 3DXAA 1CXLA 4DCQB 1AR1D 4IMLB 4JO1L 1JL8A 1K5NB 2V6HA 5KN5B 4A2MA 2NW2A 3RWJB 1W72A 5HVHB 5I2IA 4N0FA 4KV5F 4OM0H 2NTFB 1I8MB 1C5DB 3IAGC 1B2WL 4M6OH 3BKJH 2LU7A 1NBVH 2JJWA 4Z7OF 4YUEH 4KDVA 3WUWG 5GISL 1E6OL 4C54A 2HJKB 4YBLB 3MZTA 1FL3B 4GRLC 4L9LA 4MD5A 2M1KA 1SM3H 1VFUA 5DD1L 3UZQA 4MDIB 4PJ9B 1EHLL 2O5XH 2JB6B 1OM3H 1T20B 1LK3H 2CMRH 2FX7H 3MUGB 4C4KO 5IMLB 2GI7A 4Y2DC 1HHKB 3MRGB 1QBML 4ZS6D 2AERT 1XIWD 2QV2A 2BMKA 1LGVA 5IW3A 2WMPA 3BZDA 1YEKL 5DK2A 5K9QI 2VDPH 1HDMA 3NZHL 4JFHD 3P9MB 3O8XB 1LD9A 1PZ5A 5EULV 4FG6C 3RZCB 4LLVB 5E2VL 5F7FA 5EUKA 1A1NA 4PBVC 1HI6B 3QUXD 5EOCH 1NBZB 5HGGS 5FB8B 2R4RH 3PL6A 1BIIA 4MDJA 2ARWA 5D7JB 5M95B 4FQLH 2VWEE 1EJOH 3BUYA 3IDNB 3NFPA 4M8QA 2QR0B 1OP5K 4JPIB 1N6VA 1JWMA 5DI8A 1CF8H 3PWLA 1MFBL 4W70A 1EAPB 5DZNA 4KDTC 4TN9A 4H1LB 3TJEH 3W11C 3HZVA 4LVHC 3V6ZA 3WDHA 3EOYG 1VGKB 3TIDA 3MV7D 5CLWA 1WFTA 1AHWC 3BEVB 2FJFA 5ADOH 1XGQA 5E2TH 3H3PL 4X8JA 4UDTB 1NAKL 4AEHL 3L1OL 4IRSC 3SDXB 2KPNA 4JG0H 1JRHH 5CUSH 3KGRA 5IWLA 2NNAB 1OD9A 1MY5A 4MYWB 5DEFA 2NY3C 3QUMH 4MNQE 1NUFA 4PRID 3LD8B 4NRYB 5HGDB 3ZHDA 4NC1C 2R1WA 4MXWL 1S7WB 1C5BL 2FBJH 1AE6L 3MA9H 3QISA 1F97A 1GVIA 4UT6H 2OP4H 4IOFD 4J4PA 1R0AH 1AGFB 3DJ9A 1Y6NR 4M6MH 5E8NA 3O2WH 1MCBA 3HNTL 1AIFB 4YHYC 1R3IH 5FECB 3BSZL 4PRPA 2UZYB 1BGXL 5J6GB 4QTIL 1CGWA 1WCQA 3PHOA 5EO1B 3RWHA 3JXAA 5IB4A 4H0GA 4ALAH 3BWAA 4WEMB 1F8TL 4YEFA 1ZGLP 4ODSH 5EH1A 1JTPA 1A0QH 4J3VA 4XP6L 3UTTA 3VA2C 3O6FA 5E8DH 2XWTA 3H0TA 2CKBB 2ZOLA 4KAQH 3LQMA 4MJ5B 5BMFL 1HYSD 3PWPE 1LDPH 3QXAB 4WW2A 1CLYL 3QDMA 2X10A 4PJIB 3CMOL 5F1SA 5FO8B 1P6AB 1DN2A 5FA4B 2B0SL 3PP3K 5DHYB 2I07A 2GTZA 4HKZB 2OL3L 1V3KA 4O2FA 5C08B 5LAXA 1RUML 4PJFE 5E2JA 3T2QA 3HI6L 5HI3D 5C0BD 4X7SL 3IXTB 4XAKD 3O4OC 4WEUD 1A6AB 2DQCH 4HS3B 2DYPA 3HE7D 5D7KE 4FS0A 2RCSH 3GMNA 3VRLE 4QNPE 2OSLA 4M7ZB 5EC1B 4NNYB 3RUGE 2WV3A 4OZIE 4RGMC 5FGBA 5ANMA 5CZXD 3OXRB 4JFOA 5F7UA 1SJEB 1MRDL 4PGCA 3W39B 5HHXH 1F58L 3MNVA 1F42A 4U49A 1JE6A 4FZEH 4X83A 5FYLE 1BD2E 1XF5A 3MYZA 3BZEA 5IV2A 3QIUD 2FO1A 5AZEL 4KJQD 1TTUA 1WJ3A 2UWEE 3GMPB 3J7HA 1PYWB 5IK3B 4S1RL 5E99H 3TBWB 1DQDL 3F7YA 3MLPA 1I9EA 2DLTA 3NA9L 3KNBB 4ZUWA 1XT5A 4X6DB 5E6IA 5L2JB 2BDNH 4X6CE 4ZTOL 5IROC 1A4KA 1DN0B 1NUNB 5DTFA 1JTOA 1AI1L 2ITDA 3QNYB 4X0KB 4PJAF 1R5IA 2P8LA 4O2EA 4PY7B 4XRCB 5T3XH 1FH5L 2VABA 3K0WA 3UPCA 1KIRA 5I8KL 5JIIA 3QEUA 3KLHD 2SEBB 4KROC 4YDJB 1D5MB 1BF2A 2PYEB 4XC3L 3T3ME 1CE1L 2X1PA 3FQTA 4EKXA 4R97C 3UJIL 2ZCKL 4XNMB 3Q3GA 5MENA 1MNUH 4J3SA 4P57B 3IXAA 4RNRB 1EH9A 5B38G 3EYVB 4LMQI 4ZFGL 4U6XB 1NLDL 2Z31D 4MA3A 4MA8L 5MEOB 3QUYD 4FABL 3DSNA 3KJ6L 3Q6FA 5CP7B 3RTQC 3WJLC 2EICA 4XP5H 5J1TC 3UO1L 1NCCH 3EHBC 5JMOC 2NY2D 1CFTB 1I9JH 3TVMD 2ZPKL 3FMGH 3IFNH 4LLUB 3T1WA 5HJ3A 2BNQB 2HRPH 3FFCA 5JHLH 3RVVD 5HHMB 3LZFL 2NX5B 2HT4C 4LLMA 1CDUA 5SWZA 1MUJA 4AMKH 3FRPA 5C0EA 5IESL 1SVCP 5GGTH 3MCG1 4ZAKC 3NOIA 1D5BB 1C5CH 3DVGB 4HWEL 3E6FA 1F3DJ 5DJXB 4NN6B 2I24N 4NKDB 4HWUA 1KEMH 1YY8B 5TDOB 1KEGH 3MREB 4WO4B 2OR9H 4ODVH 5DRXB 1Q1JL 2P5EB 1ZA3B 3QR2A 4LSUH 3MRDA 4X5XB 4ESKA 1U93A 3TJHC 1T1WA 1YNKL 3OKNA 2D0GA 1J18A 1E6OH 4H20H 4YAQA 5C07B 5HYSG 1H0DA 3HR5A 3HTLX 1VSCA 3WNNA 2D7TH 1CG9A 4M7KL 3MX0A 2E9JA 5BZWA 5CGMA 4S11A 1RJZA 1X6LA 5E8EB 4YK4C 1U36A 1U95A 3AMKA 1P7QD 1QHPA 2EE9A 1QBMH 3IGAB 4B50A 4L8BA 5GRXG 2XN9E 3WFDL 1YEKH 4Z7UB 3K2UH 5FHAL 5A16B 2IF7A 2W60A 2QHLA 3SE3A 3QULB 2RB8A 4OD1L 4PJGF 1UZ8B 5AZ2H 1CI5A 4HPOH 1EEZB 1QSFD 5ICYB 1DBAH 5E9DE 2VZ3A 3FO9B 4S0TD 5INCA 2F74B 5ICXB 2GT9B 3RKDC 5EIIA 5FEBA 1QEWA 2GK0A 1SEBB 1YEIL 1KC5L 2GY5A 1BFVL 2BVTA 2HFEB 2Z93B 3U6RA 2HRLA 1BAFL 1P9MA 4O2CA 4G8GA 4KUCF 2H1PL 1K8DA 5DDHA 2VLJE 3G5YB 3D9AH 4OCSH 3DGGA 5DEGB 4EN3C 3VXTB 3H3PH 1GRWA 3T0XA 3HNVL 2Y5TB 4LU5H 5HDBE 2IAMB 1U3JA 3UJTL 3RFZC 1T83A 4JPVL 5HHOE 2WNGA 1OSZB 4Z0BL 3FQXB 2NW3A 3UAJD 5JOFB 4F37K 3CXDH 3EOTL 3RWGB 1JHTB 5FCUL 3BT2L 4QRRE 2IPTL 2Y7QB 4MXWH 2VXTL 4F7PA 1AE6H 4S1QH 1H8OA 2AXHA 3AROA 4ELMA 1A6WL 5A3IC 1HXYA 4Y4FC 4P2OD 5D1XC 3V95A 1SEQH 3MQIA 5JPMA 1CQKA 2W9DL 5AD0B 2DI7A 1ZOXA 2R2BA 3MJ8B 4XHQA 4H0IA 4TTGA 5EUOB 1ADQA 4LARH 3LDBB 4L3AA 1F8TH 1E4KA 3VFGL 4D9QD 4PY8I 1I1AA 2ESVD 3V5KB 4ZNEE 1AKJA 3QI9B 2HTKD 2W92A 3WXWL 1G9NL 3SDAA 5F21B 2CLZA 4JZOA 1DVFD 2Z92B 5BMFH 3UTPD 5BJTB 4I1NB 1ZHLA 4ORGA 3S5LA 5AYQA 1XGRA 1U2HA 3WO4C 1QVOA 1CT8A 1N5AA 1CFNA 2OL3H 2VISB 5I1JL 3FZUD 4RAVB 3QCTL 1G7IA 2J88L 3MV8A 1A4JA 4OIIL 3HA0A 3TGXA 4K8RH 5D96B 1OCWH 3KPLB 4BSWA 3HI6H 5F44A 1S7TA 4N90D 1NLBH 5K9JL 4GG6A 2XTJB 5T3ZL 3I6KB 1I9RL 3BD5A 4YHKL 2R1XB 3H9SB 4XVJH 5F6IB 1WV7T 1H5BB 1LO4H 2Z0BA 1KPVB 1D6EA 2EXYC 4HDIA 1LEKA 3ARBD 2YD2A 3ZE2F 1HILA 1KELL 2CDFB 4HK3N 5IR1B 2OMNA 2VRAA 3L6FA 1JJUA 1T66D 5F89A 5EWIH 1F58H 3EDKA 3PUCA 4R4BA 1H3XA 1CLZH 4HIIB 5IMMB 1PFCA 1KBGL 2IQAA 5GRJL 5J13B 1SYSB 2W91A 3B9KA 3UTQA 2FX9H 4XGZA 4JQXC 4S1RH 1DQDH 5EBMB 2MCPH 1MFAL 4UQ2B 4X6BA 4JZJC 4I48B 4OF5A 2PUQT 4LCCB 1WC7B 3DSFH 4PJ8A 5GSRB 4ZTOH 4GMTH 3LHPL 4UV7L 2OI9B 5EU6D 1LE5B 3HE6C 3O11B 3MJ6A 3BRFA 1T4KB 2PCPB 1QG3A 3B83A 5L0QC 2Z91A 5C0AB 3BYYA 3WN5B 4NP4H 5I8KH 4R96B 4P2QB 3IETA 1UQSA 4LASL 5KOVC 1BX2A 3SCMA 3EOAB 4YHZH 5D7IB 4BH7B 1I1CA 4UI2A 2ZUVA 3NTCL 2AXJA 2WUBL 3FT3B 2X1WL 4CNIB 2AJVL 3VD5A 2H9GA 1A5FL 4PJBB 3AS1A 2PTTA 3SJVB 3MPCA 4WUUE 1T5WA 5IB3A 3M17A 2HWZH 1NLDH 5EORL 1S5HA 3SHSA 4KI5D 2BVQA 4FABH 7FABL 5DZLA 2R69L 3ILPB 4Y5YB 3OR7B 2Y5EA 4FZ8L 3D25B 4UUJB 1JZ4A 3DRTA 5GZOD 5E2UL 1NCAL 5SX4I 1SJVA 4W4OA 2ZPKH 1KPUB 1ZT4A 2YPVH 4HV8B 4EDWL 2L7UA 1U8KA 3SQBA 4WI4A 4PREB 3IDGA 3ZKQD 1I7RA 5DFVD 2QSCL 1A8JH 2EKSA 4P3CL 1DEEB 4X9FA 2GAZA 1YZZA 3KJ4B 1CBVL 1RZIA 3TIEB 3OG4B 2HLAB 1MFNA 3WS6C 2DMKA 1OB1A 5ADPH 4KK5C 5DD0L 1QRKA 3QDHA 4KHTH 2W0FB 1TCRB 2NY5H 1X5ZA 1CFQB 4PJ9D 4Q9QH 2XA8L 3HHRB 4HAFA 1DQJA 2ZG2A 4LNRA 4PJ5D 3BJ91 4GBXC 2A83A 1S9XB 4LK4A 4G6JL 1CTOA 4X4XB 5CGTA 4M7KH 3B4NA 5M7QA 3U2SB 2JE8A 1X4ZA 3KLAB 1SY6H 2EH8L 2DJUA 2PO6C 4JO2H 1P4LB 2DM3A 1NAMA 3WFDH 3MLXL 1IE5A 2EDEA 4PBXA 1NGWA 2DQJL 3FT4B 4KMTH 5FDWB 5FHAH 1AC6A 2P5WB 2CRZA 3PIQA 3OKOA 5F7WC 2BJMH 1JHKH 4WI7A 3AS3A 4FQIL 4GW4B 3D6GA 4Z77B 5C71A 4OT1L 4OD1H 1RSFA 4DGIL 4KTEH 3N9GH 1AO7E 3VFTB 4BK4A 2FNBA 3FOLA 5KSVB 4E0RB 4NO0A 4XVTH 4ISVB 3IDJA 2O61B 4LDLB 1BIHA 1J87A 2AJZA 3C5ZB 4LHUA 1AHWB 2PTVA 3I6LE 4J6RL 2GJZA 4XPFL 3BD3A 5JXEC 1ORQB 3K4AA 1YEIH 4OD3H 1K2DB 4LAJH 4Q6IB 1BFVH 1T3FA 3RVUC 4LVOC 4HUVB 4WU5B 1U8IA 4G80B 4J3UA 2BNRA 4NUGL 1ADQL 4QLRA 1MLCA 4JKWA 5I8EB 1I85C 5GRUH 3VRJB 2EDNA 1NKRA 4GUPA 1MQ8A 2NY3B 1RVFL 1D7FA 1EV2E 2VC2L 1L6XA 5IVZA 2MQ0A 3QWRA 4GKNB 1HQRB 4CADA 1D5XB 2O5ZH 3GKZA 1MHCA 3UJTH 3S96A 2FEDD 2GCYB 1CE6A 1NGXB 4X99A 3TZVA 1OLZA 3CZFA 5TFSL 4R26H 5J1AA 4JB9L 3S36L 5C09D 6FABH 3ZKNC 1N3NB 3BT2H 5FCUH 5C0JA 3FQNB 1CYGA 3BP6A 4CW1B 5BS0D 4WY7H 3O3EA 4Y8DC 4PRDA 5E5MA 3JTTA 3NCJH 4QT5B 4GS7C 1MJ7L 4RWYH 3DO7B 1I4FA 3S35L 2W9DH 4WVRA 4RFOH 3MJ9L 5D5MB 4POZD 3L3JA 3RVTD 4YR6A 2RFXA 1F3RB 4U6YA 1DR9A 2GSIA 1Z9SA 4R4NC 1T0NA 1NUDA 3VFGH 1C16B 4U1NA 3RDTD 5CFHA 4YXKL 3RPIA 3DOSA 1ZS8A 4NQSB 1UJ3A 1LO2L 1WITA 3WXWH 3GSXA 4JFEA 2XWBB 4RMSA 2IANA 4PTUB 4NJAL 4AM0B 4PGBA 3HG1E 3IF1B 5F70A 4Q9CA 4EVNB 5C08D 4XX1G 4XAWL 4LSQL 2EDLA 4EUPA 4R8WH 4RMUA 3ARDC 5FO9B 3PDGA 1F11A 4HUWA 3SEPA 2E3VA 4OZFB 5JUEL 2B1AL 3QCTH 4WFED 4OZ4A 3OKLB 1EO8L 1MCSA 3MLSH 4OIIH 1QLFA 2DQGL 5EB9A 3ARGB 4RGMB 3H9HA 4OCMC 4GXVL 2CKNA 5EO9A 5DJAB 2Y9RT 5J12C 5ALBL 2HG5B 1GL4B 1FVDA 2ZSVB 4HGKC 2FIKB 1NEZB 4KJPD 3HS0B 2A73B 2CLVA 4N0UB 2KL6A 3QAZC 5F96H 1P2CA 1XIWA 2FJGB 4NKMB 4NRZA 1QNZH 3V4PL 1C08B 2UYLB 2BFVH 2XN9A 4PRNB 1FGNL 4LHQB 1KELH 3VGEA 3REVA 4O5LL 4ZFZB 4PGDB 4RBPH 1KBGH 1JIBA 1P84J 3HZYB 2Q8BL 5GRJH 1MJ8L 3QUXA 3QEHB 2KUTA 5DFWH 1VACA 3LY6A 3LS5L 3MV11 3A6CL 3QUZD 1JWUA 1A3LH 3HC4L 3IS1X 4KROB 5FF6A 1IKFH 1AXSB 4K7PX 5F9DC 1F2XK 1PLGL 2VYRE 2EC9U 3SDCB 3IRPX 4Z7WF 3RQ3A 5E1HB 3DARA 3LHPH 1RURL 3MNZA 1F4XL 1IAKB 3G6JA 4QXGL 2J4WL 2D4DA 3DUSA 4BSVB 1F4WH 4WU7B 2H3NB 5IBLD 5JDJA 3LKRA 1VFAA 3FJTA 2K9UA 3GRWL 2XKSA 3F5WB 2WUBH 1PG7W 2AJUL 2AJVH 2R8SL 1B6DA 1FVEB 1L9MA 1KB5A 2ZG1A 3MLVH 4UU9B 5I73C 1G7JA 1TJIH 2JK5A 3OR6B 4PRIA 1NDMA 3CH8A 5D71H 5DWUH 3H7LA 1OSPL 4G6KH 3T0EB 3DROA 1LO3H 1JUFB 3ARVA 1FIGH 3V6OC 2X44D 3ILQD 2CIIA 4ZTPL 2NX5D 5J11B 3T4YA 5HD8C 4HUUB 4K8RC 4MXQD 3TH2T 4HMDA 3D0LB 3LKSB 4LRIC 2FHCA 3LQZA 3WFHB 1P4BL 1BOYA 1TZGL 3FN0H 2FL5B 1DL7L 4APQD 1H3WM 3VGFA 4CL7A 2X4RA 5D1ZB 1B90A 4WO4D 4BM7A 1IARB 1LO0L 3AREC 4M7JL 1W2KT 4HF5L 2VTFA 1EHXA 1IAIL 3RWEA 3VWKC 3QCUL 2EXWD 3KPMB 4LKCB 3IDYB 3LQAL 1OP3H 4PJGB 2X4TA 4U1JA 5CEZL 1GHFH 5IHZA 5CIPH 3RL2B 1E4JA 5FK9A 4Z8FL 2I26N 3LOWA 4IMKA 4DK3A 5LBSH 4PG9B 5I1DA 1ZXQA 1FO0B 3KVQA 5BVJA 3JV6B 2C4XA 5DRZA 5KBNC 4XHJD 3ULVH 3BN9C 4XPGH 5EZIH 1BQLH 5C0BA 3RU8H 5DYOB 3PE9A 5DJ6B 4WGVB 5GIRA 1IGCL 4EI5B 4FQIH 3PWUB 5F1IA 4AH2A 5DHVB 5J4MA 2JLLA 4DGIH 5ISZE 4ZUVB 1YMME 3WO3B 1ZT7A 4Z7NF 4DKFH 4F7CA 4JFPA 3VH8A 3GNMH 4U3CA 3OX8B 2VLME 4I9WE 1FYHB 3KPNA 5GSVA 4H0HB 4NQDB 4XPFH 5I1LA 1UM6H 4JDZB 1B9ZA 3WBDA 1J10A 1G6RA 4FQXB 3V7AG 1QRNE 2RJMA 4N8CL 1HQ4A 4PB9H 4AQOA 1G7LB 2HJFB 4GSDL 4PV9A 1FZJA 4TULL 1EPFA 2B5IB 2IAMD 4YQXH 2APVA 4RRPG 1RVFH 1A9BB 1OAXH 1OGAB 3BP4A 3TN0B 3VE0A 3WFBH 3WIFA 3VW3L 5J6HB 1ITCA 3FB6A 3CSPA 3X12A 3BQUC 2E7CA 1T0MB 4WHYH 2J6EA 2Z8RA 3L3KB 3SE9L 2HH0H 3OJDA 5FHBL 4AT6A 5TFSH 1NCBL 1YNLL 1FZOB 3OF6D 1EGJL 1P5UA 3MRPA 2NY5C 4J3OC 4XMLH 2WINA 3MUHL 3SO5A 2WQ8A 4V1DD 2MHAA 1E27B 3SY0B 2BSSB 2ICWA 2Z31A 3BPOB 3QUYA 4IM8A 1MJ7H 3PGCB 1X5GA 2V7HA 3S35H 3OJVC 1G84A 4FFYL 5DK3A 1F6AB 2DMCA 4KK9D 1XR9B 3I6GB 5EA0L 2CSPA 1EERB 4ZUTA 3VXMB 3B9DA 3G5ZA 4QHKI 2JCCE 4P4RA 5HYJB 1VADA 4FFZL 3WJJC 4BZ1L 2JKXA 3V4UL 2NYYC 2O5YH 1T2JA 3M1BB 4UILH 4YXKH 3N0PB 3IVKA 2FJHA 4D0DB 4PV8B 1IC7L 3EO0B 4NQTA 3FO2B 1XGYL 4L1HA 4C56D 4HC1H 2EZ0C 3L9RA 3HC3L 1IQDB 2Y06H 3NH7H 1CDJA 2DICA 4U2YA 1MQKH 3U7WL 4HPYL 1CDYA 1LDSA 3HPLA 4C83B 5JUEH 2R1YA 1KN2L 1RD6A 5EOTA 1EO8H 1QPPA 4YHPB 4PP2B 3H9SD 1ORSA 4PRHD 1PDKA 2OQJB 3B6SB 2VLRE 2YZ8A 3RL1A 3EGSB 1T6VN 4MJIE 4DZBA 1A7NL 3QUMB 5DMKB 5JZ7D 2BVPB 3I75B 3O45A 4NGHL 1EAJA 5EU3A 1OTSD 2EE6A 1FGNH 1PG7X 5DT1L 4JZJB 4TSCH 3U0WL 4XCNB 2VZVA 1CQYA 1XCQB 3EKCA 5F7LB 5ESAB 2Q8BH 1K8IB 1G7QA 3EYOB 3KYNB 4I77L 1KJMA 1KGCE 5E8PA 1AO7A 1KCUH 5IUSA 5GGSB 3T2OA 4KTDL 4MX7B 5L0QB 4Q9RL 4N9GB 3MRLA 3KPSD 1LEIB 1NMAH 3ULUH 3TF7C 4IDJL 1S7RB 4MQXC 5CEXA 1HKLH 5JNYB 1BZ9B 1JGUH 1RURH 3SGDH 2PYEE 1F4XH 1N0LA 4HMEA 3GSVA 1T7ZA 4LGSB 3NZ8B 5ESVB 1URLA 3EUUA 4HUKB 4P46C 5F71A 3CFKA 4X7TA 4JFQA 5DD5H 3V7AE 1A6VL 2X42A 1YPZB 5KSBA 3PXJA 1SVZA 4NKQB 1IGFH 3QIWD 1YMHA 4YBQC 1N5YL 1MCHA 2R8SH 2YPKB 3L5HA 4EIZC 3PWNB 4RMRA 4CVZB 1T1XB 2IBZY 3U0TB 5IKCA 4XZUB 1TVHA 4ETQA 4ONHA 4F33A 3P0GB 2AEWA 1Y0LB 4R6UA 2UZXB 2BNQE 1Y18B 4RBPK 5HHME 3MRCA 2DWEA 4HEPG 1U8QA 2DDQL 3S6CA 1QKZL 3CLEL 1YNTA 3O9WB 4HH9B 4M48L 4P2OA 4ENEC 1WBXA 3CFJA 5GRWA 5J9PB 1J8HD 3RKPA 1KJVA 1DL7H 4GRLD 5IF0A 2P5EE 1HOCB 3IJHA 5C9KA 3O4LE 4U1IA 3TT3H 4M7JH 4Y2DD 4GBXB 4HF5H 3UCRA 2ESVA 3RGVB 2C1PB 5C07E 1VFMA 3P4OA 1RHFA 1IAIH 1HNGA 2ICEB 4WWKC 5HGHA 5A2JH 1MH5A 3X3FL 3LPWA 1SJHA 1N64L 4FG6D 3HG1A 1ZV5A 4LCUA 5CSZB 3MLZH 4KJYB 1CFBA 4OLYH 4Y19E 1OHQA 1RUQL 3U36B 2BCKA 4Z8FH 2E27H 3I02A 3MUZ1 4Z95L 3T77B 1CDGA 4EOWL 4HWBA 2P5WD 3RY6A 1KLGB 1M6OA 4M4RA 4J2XA 1D5IL 1WEJH 2VQ1A 3DTXB 3FTGA 1PJ9A 5B3NA 4PJCA 1B4JL 1JN6A 2IGFL 2LFGA 3QZWA 3V5HA 3C5JB 3W11D 2VZTA 3EOBA 3RAJL 5L8LB 3ROOA 1HINH 2QADC 4G7VL 3C5ZD 3JWNC 3TA3C 2VITB 4LVOB 3ARBA 2HVJA 4U1MA 1DLFL 1CGSH 1XH3A 3PWVA 4JHAL 3MOAH 5DD3L 3BKCL 2QQKH 3TBYB 2YUVA 4IRSD 4MJ6A 2D31B 2YK1L 1EVUA 4IRJC 3DNKA 1U8JB 2NY3D 1PKQB 2V7NA 5GGSY 4N8CH 1NGYA 1G0YR 3V0WL 2Y1VA 5KOMC 4M3JA 4Z7VE 1G7HB 4TULH 1QA9A 1DUYB 5LGHL 5EU6A 1OP3K 1ES0B 4XMKL 1H15B 3ZDXF 3VW3H 3QO1B 4NSKB 3CCHA 4GXUM 3ZO0A 5D2NA 3S4SA 1E28B 1MRFH 1FNEB 4TSAH 4HFUL 5FHBH 4G43B 5IM7B 3QB7C 1TETH 2BY2A 1EGJH 4OFYD 2ZWLT 1IC1A 3HB3D 4UV4L 3WNLA 5J7CC 4GRWB 5F7EH 3ULSB 3LRSA 1FG2A 1T7XA 3EFFA 4XP1H 3C8KA 1GGTA 4LCWE 4F8QA 3RNKA 3MACL 2AXGB 4WNQB 3TBTB 5CD5C 1BJ1J 1O7SA 5EUOE 3N1PC 5CJOL 3CDGA 4ZSOA 3LEVH 3E2HC 3QDGE 4M1GH 2D7PA 2XPGA 4FQPA 3OZ9L 3FB7B 4OGAC 5KJRL 3MMEA 3PG2A 5D1QC 4YXLH 1J1XL 4MNGB 1G6VK 3V4VH 3ULVC 3OAUL 4P5MB 5DMYA 1F4HA 3BDBA 3X11B 2WP3O 4BZ1H 1OTUC 3W9EB 4DCQA 4IMLA 1K5NA 4MD4B 5KN5A 2EDYA 4LSRL 3RWJA 5FYKD 4LPUA 1TZHB 2NTFA 1I8MA 1A7RH 15C8H 1C5DA 1XGYH 1RU9L 2XI9A 4EEEA 1GGBH 5JR1H 2B2XH 4PLNC 1H3PH 2V17H 3DX7B 2HJKA 4M8VA 3OJMB 1FL3A 3ARGD 5D2LF 1OAZH 1K3ZA 4HK0B 3BKML 3QHFL 4MDIA 4PJ9A 4PP1C 3U7WH 2JB6A 1MFDH 1T20A 1ACYH 2XTJE 3G5XB 3QAZB 2AK4B 3MUGA 2MTPA 5IMLA 1HHKA 1M05B 3MRGA 5BCAA 2DQDH 5IJKA 4L9DA 4YFLF 1TJHL 5DJ8B 1VFBA 3ZYIA 4RGNB 4PJXF 5B39G 1MREH 4R0LC 1O7VA 3VXRB 2ORBL 5GS0D 1CZ8L 4U7SA 4ODHL 2AK1H 3P9MA 3O8XA 4JFDB 4LLVA 4NGHH 3RZCA 4WUUD 4ZXBC 3M45A 3BHBB 3MFFB 3OQ3B 3GIVB 1HI6A 4MB5A 4PG2C 1NBZA 4PJDF 1XGTB 1YYMH 4B41A 4P9HC 5FB8A 4Q0XL 4UTAH 1IM9D 3O3BB 5D7JA 1U8MB 5FYKU 1N2RB 1UCBL 3EBAA 3IDNA 1IGIL 1N4XL 2QR0A 5D6CB 5CSBA 4KROD 3VFMB 4JPIA 4UT7H 2MQCA 1NCUA 1NCNA 4TYUA 3JSSA 5E5RB 1EAPA 2R23B 1ZHBB 4H1LA 4M93C 5BW7A 4IDJH 1YEFH 1EK3A 1VGKA 2CR6A 1JGVL 2EIBA 5E00A 1WFUA 4JKMA 4P2QE 5AG9A 2XA3A 3BEVA 3HUJE 4JRYB 3PWJB 5D7IE 4QRQA 4BFIB 4FFVC 2ADIA 4NQXB 4Y16C 5HVGB 5C0IB 4P59H 5I73B 3GSRB 4UDTA 3RTQD 3C6LC 3SDXA 2YD7A 3RHWF 4JY6B 3EHBD 4PJBE 5K9KB 3NIGF 2OL3B 5TQ2H 1N5YH 4NRYA 5HGDA 1S7QA 3BVNB 3UC0H 3K46A 1IRAY 3FAWA 2CH8A 1S7WA 3JUZA 5C09A 2MPAL 3NAAH 1TNNA 4YBHA 4FP8H 4TOYH 1AIFA 5FECA 1C1EL 3GGWB 4HQQL 3AREB 2DDQH 3VG0H 1QKZH 4LIQL 5D1ZD 5J6GA 3QPQD 5JHDB 4FHBD 5GGRY 5EO1A 3TJHD 4Z6AT 3KYMB 5FYJD 1YEEL 4JPWH 3W82A 3UTSD 1PD6A 3MLYH 5ESQB 3VWKB 3DV4B 3LIZH 5SV3A 3ZKMC 2XXMB 5TJWK 3RA7L 4X5WB 3C2SA 1MIMH 3ARUA 2CKBA 4NKIL 4OLUL 1KTKE 4MJ5A 1NEZG 3QXAA 1TNMA 1HNFA 4PJIA 4GKZB 2ZNWA 3F7QA 5FO8A 3GM0A 2R0KH 3E3QE 5FA4A 5DHYA 3H3KA 3BGFC 4NZJA 4P2RE 4HKZA 1AQKH 1JNNL 4HHAB 1HWGB 1JZ3A 3F62A 3P9LA 3HRPA 5C08A 1DSFL 2YKLL 1TLKA 3BMWA 2F19H 1JTTA 4JHWL 5IB5B 3ULUC 2I5YH 3IXTA 4YHLL 4OUUB 4MZ3A 4HS8L 1A6AA 2FGWH 4HS3A 5LXGL 5C0CB 2Y36L 4KUCD 4OZGB 5EC1A 3BDYL 5FYJU 1NC4B 1VCAA 2BSTA 1B4JH 1J0ZA 3OXRA 3IT8D 1SJEA 3W39A 1CGVA 4XP4L 4PLKC 2EC9T 4PJ7F 3CVIL 1DQMH 1E4XL 1I3GL 2YPLD 5BQ7B 1D5ZB 1A9EB 1E4WL 2VDQH 2B4CL 4NQDD 1JYVA 3GMPA 2ITCB 1OQXA 1PYWA 3INUH 4EN3D 4FQXD 2I25N 4N0RA 5BV7L 4OCXL 2G2RA 4WFFD 3TBWA 4J3XA 4WHYG 5TPWL 1BMGA 5ITBL 2IH3B 4X6DA 5L2JA 3W5MA 2ZKHH 5FUOL 2GFBB 3WNOA 1PGRB 5EUKB 4JQIL 1DN0A 3BQUB 4M5YH 1OGAD 1ZE3C 3QNYA 4X0KA 5J89A 1F90H 4DKAA 4LP5A 3K8KA 4WI2A 4PY7A 4XRCA 4LVNC 3RVXC 4KRPC 4MDJB 3HAEH 5BXFB 5JQHC 1YC7A 1IKNC 7CGTA 2Z4QB 4X7DC 4HT1L 5I75B 3QEQD 2SEBA 2OBGA 4O9HL 4AEFA 4XMKH 4OLVH 1D5MA 4BKLB 2PYEA 5A3ID 4Y4FD 1A6ZB 5D1XD 1L0YA 5C0GB 4KDWA 4NWTL 3FAXA 4PY8J 4XNMA 4KKCC 4P57A 5CCKL 3CC5B 3JVGA 1DFBL 1TIUA 4RNRA 2VN4A 1VPOH 2VXQL 3EYVA 4WUKL 1KXQE 3KDMB 4U6XA 3NGBC 5MEOA 4DKDC 1JP5A 5DQDL 3C09B 1DZBA 2APFA 5D5ME 5CP7A 1MEXH 2ED9A 1J11A 3T2PA 3GSNL 3VXMD 1CGUA 4JFFE 1CFTA 1J1PH 2R29L 5D7SH 4OCNC 2A74B 4LLUA 1ODAA 2BNQA 1J1XH 2VMFA 2NX5A 4XVSL 1TXKA 3KPRB 3AM8A 5GGUA 1HH9A 1KCVH 4Y1AB 2VE6B 1D5BA 3DVGA 1K85A 3MZGB 2YD3A 5A40E 4APQA 1BQHB 1RK0B 4NKDA 4NN7C 1YY8A 5FUZL 4Y0GA 4LSRH 5TDOA 3VCLB 3MREA 1DBMH 4WO4A 5DRXA 4M5ZL 2P5EA 1ZA3A 3DYPA 2Y07L 1RU9H 4HXAL 4X5XA 1OARH 1QPXA 4HJ0C 4K71B 2APXA 1J5OL 2EXYD 3BWAB 5C07A 3O6KH 1FE8L 1INEL 3QHFH 1NGPH 2P42B 3ULVE 4EBQH 5E8EA 4WCYL 1WBYB 4LCIL 4EDXB 1IGJB 1JNLL 2JF1A 3OAZH 5LQBL 5D6DA 4X80L 3IGAA 1TJHH 5DJ0B 1BJ8A 1JYWA 5ITFB 5MEQA 4X9IA 2D4FA 4Z7UA 3V6BR 3S88L 2DAVA 5B8CC 4LEXL 5A16A 2EIDA 2UVEA 3ARTA 4N8VB 4ODHH 3JUYA 4IIQA 3QULA 2XRAH 1JMZA 3A67H 1UZ8A 3L3IB 3HE6D 2HVKB 1GXEA 5DGRA 4HWZB 5ICYA 3F58L 1WUNT 4DN4H 3FO9A 2F74A 1IGIH 3CK0H 2GT9A 5ICXA 2O26U 3KS0J 1SEBA 1B0WA 3MRQB 4CMHB 1T03L 2HFEA 1IAIM 3IKCB 4MS8C 5L8JB 2WANA 4JKKA 4KPHL 4M1DH 1J0IA 2Y4SA 3G5YA 3SDYL 5KANI 1NCTA 5TE4L 5DEGA 3VXTA 3TV3H 2Y5TA 3MV01 2IAMA 3UXFA 2C26A 2VLKB 3WNMA 2ZJSL 1Q0XL 2ZCHL 5JOPD 4JN1L 3PGFL 1EHAA 3CVHL 2ERJC 3C60C 5F7HA 1Z0NA 1OSZA 5JOFA 4HKBB 2ITDB 1A3QA 1LP9F 1JHTA 3T0EE 2Y7QA 1QACA 5GJSH 4U2ZA 4XCCH 5TDNA 1IEAB 4FQCH 4NNPL 4XPBL 3OF6A 2IADA 4A6YA 4NQCD 5C7XL 3DX8B 4YZFF 2PXYC 1PVHA 2K7PA 4XBPB 1ZTXL 5JQ6H 4FXGB 2BY1A 2DLHA 5AD0A 4Y8AA 4LIQH 3Q3GB 3EYUL 3MJ8A 2AJYL 3IXAB 12E8L 2QTEA 5EUOA 1MY7A 3ES6A 2CDGB 4GBXD 3V5KA 2JJSA 4AZ8A 4DVBA 1WT5A 2VLMD 3QI9A 3RA7H 1H8SA 3ZE0F 2DF3A 3LPGA 1ZVSB 4NKIH 4OLUH 4D8PB 2PO6D 2Z92A 4G9DB 4HKJB 4OB5H 2AS5M 5BJTA 4CBPA 2XNAB 5T3XD 2IG2L 3OL2A 4KMQA 5DQJB 3U46A 5T33H 1TQBC 4KKLC 3F65A 1JZ2A 4C56A 4JM2F 3BE1L 2VISA 4RAVA 3O81A 1BREA 5EU4B 4OLZL 5J3HD 1QLEL 3KPLA 2APTA 1JGDB 4QOKD 5ABDE 1IBGL 3TPKA 2FRGP 3ARPA 3I6KA 5F7YC 5B22A 1V7NL 4LSTL 3RBSA 4YE4H 1FBIL 3H9SA 1U93B 2Y36H 3B3IB 1HEZB 1H5BA 4W6WB 5JXED 1KPVA 3X17A 3G6AB 4I0PC 2N4IA 4P5TC 4UB0H 1H0DB 3HR5B 3RVUD 3TT1H 3WSQL 3N85H 5LCVL 2CDFA 5IR1A 1FV1B 3HZMB 4XBEH 5GRYA 5K9OB 4XP4H 4NZTL 4HIIA 1N6QL 1VEMA 5IMMA 4OV5B 4NCDA 1U95B 1PG7H 1MAMH 1SYSA 3QT2A 3QWOB 4HIJB 4D9LL 4OCXH 3KLDA 5EBMA 1I3VA 5ITBH 4UQ2A 5DJZB 1V7ML 1A3RH 3LN4B 3ETBF 3S3JA 3RX5A 5FUOH 2J8OA 1WC7A 3M8OH 2E9WA 5GSRA 4JQIH 5I15H 1F3DH 4Y5VC 1LE5A 3O11A 4JZNB 5F6HI 1T4KA 1A1OB 1UACH 3VFUB 2PCPA 1KENH 2BRRL 5C0AA 4JCMA 4YDKH 3WN5A 4HT1H 4KGJA 5JO5B 4K3HA 4P2QA 4R96A 4I3RL 4OQ1A 5MHSD 3EOAA 2C7UA 4RGOH 4OBSA 5D7IA 3OTTA 3ARFC 3UPAA 5E5UB 2IC2A 3ARQA 1FC1A 3FT3A 1J0JA 3MV9B 4CNIA 4K9EL 5CCKH 1BFOA 5IQ9B 2P47B 4U6HB 1K8DB 5DDHB 4PJBA 3VXUB 4WUKH 4O58L 3SJVA 4R4ND 2YEZA 1IVLA 4NZDA 5KVFL 3DGGB 3ROLB 4L8SC 2PNDA 1JGLL 2Q3AA 3ILPA 1PBYA 4Y5YA 3OR7A 2DQIH 1JWSA 1K6QH 3D25A 3GSNH 1DANU 5BZDB 4UUJA 5HYJE 1FHGA 4MA1B 5HDOA 3SDDC 1KPUA 4HV8A 2HN7B 2D0FA 3ARDD 5D2LB 4PREA 5GRVK 3T3PF 5IVXE 1CDBA 4Y4KC 1X3DA 1CL7H 3OJ2C 3S34H 1DEEA 2YHGA 3QXWA 4OI8A 3LSOB 4GRLA 3NCYS 3TIEA 2HLAA 4M5ZH 1WFOA 3D39D 1CFVL 4HXAH 5AWNL 1TCRA 2W0FA 2OX5A 1CFQA 2IBGA 2X4OB 1KTRL 2IPKB 4R9HA 3OGCB 3IKKA 1UXSB 2AK4D 4OLWL 1FDLL 2FATL 1S9XA 1IZKA 1WZ1L 4PJDB 4R0LB 3W0WE 1BVZA 1AKJB 5F7KC 3U2SA 3KLAA 4OSUL 1QSEE 4LCIH 3VXRD 1JNLH 4YDLB 4BQCA 5KW9L 3IB4A 5I1HL 4RFNC 1P4LA 4X80H 3EYQC 4DGYL 4JRXD 1ZHLB 2PF6A 1I3RA 3K2MC 1DQLL 1ZVYA 2AEIT 4YLQT 1F45A 5FDWA 1QVOB 4ONFL 2P5WA 3I85A 4O02L 1CFNB 2P48B 3C2AH 4GW4A 3CX5K 4KRMB 5E2WH 4Z77A 3MV8B 5K33A 4LDEB 1RK1A 2FECL 2NPLX 4JQVC 3VFTA 4NQEE 2AEQH 4TUKH 1I75A 4KDTA 5KSVA 4DVRL 1FFRA 2EYSB 3U9PL 4ISVA 4A6YL 4GG6B 2O61A 4PJEF 4XC1H 3C5ZA 1AHWA 5IEHB 2VQUA 4OCLC 3OAYH 2ZZUT 3QEGL 1K2DA 1JBJA 4Q6IA 2ADFL 4UNUA 1LEKB 4HDIB 4JRYD 4HUVA 4WU5A 4G80A 3UDWC 4NT6B 5I8EA 4I0CC 4K7FB 2IMNA 3VRJA 1WQVT 3SDYH 2XFXA 1YPZE 3H7BB 5SWSD 2YRPA 4CVXB 2M2DA 1DBJH 3CU1A 3UTQB 4GKNA 4PLOB 1HQRA 5BVPL 1D5XA 4IHOB 2CRMA 4X6BB 4MA7H 2ZJSH 2GCYA 1NGXA 5HD8D 5IW6B 2A9NL 2AV7B 3AGVA 5I8CB 3U4EB 1KT2A 4H5SB 2AP2A 3PV6B 3D3VE 4XP9L 2XZZA 4URTB 3NMEA 1N3NA 3BJLA 3FQNA 5A43C 4C59B 4CW1A 4U1GC 2B1HH 2GEEA 3MLUL 4OI7A 3ARED 3LCYA 3D18B 1A21A 5C7XH 5JHDD 4NM8L 4QT5A 3GMLA 2CGRL 3WUZA 3DO7A 2MKLC 5DQ9B 1MCLA 4L4VB 5L7XL 5D5MA 3VWKD 1KJ3H 12E8H 4X98B 1C16A 3KHQA 4V2BA 4JVUA 2BK8A 4JEGB 3BUTA 4NQSA 4LLAA 4Q7DA 5DMIL 4UTBL 4FMKA 4NUJB 1P6FA 5JDSB 2XWBA 4X6FB 3FOMB 2AEPL 2WIIB 4PTUA 4YEEA 2UVFA 2ARJB 1KFAH 4OBRA 4AM0A 3BN9D 1RZKL 3BKYL 4QRPD 4YDIH 1S7XB 4Q9BA 3V8CA 1FNSL 4D94A 4K2UH 5FO9A 5IT2H 4HJJL 3BZFB 4G9FB 4GQ9L 3ALPA 2H8PB 2DOCA 4OZFA 5L2KD 4PJ7B 3QJHB 3OKLA 1LEGA 1B0GB 4OGZA 3ARGA 4MAYB 4ETYA 5C0CD 1QLEH 1RZIB 5DJAA 2WWKO 3PL6C 4TNVF 4M43L 2HG5A 1IBGH 4MWFB 2ZSVA 2FIKA 4LSTH 3HS0A 2A73A 1NFDE 2EDKA 4N0UA 1A64A 5FKPB 2FJGA 4NKMA 1C08A 2UYLA 32C2B 4PRNA 4PJAA 4F57H 3ARXA 4ZFZA 4PGDA 4NZTH 1N6QH 3O3AB 3MCLH 5IROA 5IHUL 3HZYA 1BBDL 1U91B 3QEHA 4KTYA 1ZEAL 3VI4F 1QFWH 5EIVA 3BQUD 3VG9C 2FLRT 5KANG 4N1EA 1R5WB 1V7MH 1NL0L 3MRIB 3IDIB 1AXSA 4G5ZL 4PR5B 3SDCA 1EEYB 4R3SB 5IWLC 1U3HC 3EO1B 1HHGB 5GJTL 4ZOAA 5KSUB 3FOLB 4C4KT 1IAKA 3ZT6A 1OVZA 5GS2H 3MR9B 5F9AC 2AQ1A 4RDQF 5KAQF 2AJZB 4WU7A 2H3NA 4I3RH 4RA3A 4QHKJ 4XNZB 1RIVH 3SKNB 2F54B 3MFGB 2GYSA 4XTRC 1NMBL 1YJDH 4ZYKB 3F5WA 1T3FB 2JJUA 3NABH 4Q74A 4GRWE 5IVOA 4L29B 5E24E 1FVEA 4MNHB 3WJLA 3OMZA 4WHCA 2VXVL 3CJJA 3TWCL 4UU9A 3GO1L 3MGAA 3WNPA 2NYYD 3OR6A 1HKFA 2P43B 4HW6A 5DR5L 5I0ZA 4G7YH 2C3WA 4E41E 2NLJB 4CADB 1JUFA 1FNGB 3O6FC 2YMXL 2W9EL 1Z5LB 5IOPB 1CE6B 4HUUA 3TZVB 4NN7B 3D0LA 3LKSA 3WFHA 1BBJB 2FL5A 4RFEA 4YFLI 3GJFH 3IFOA 1T04B 5D1ZA 4Q97A 3ZDYE 1XEDA 4BZ2H 3ZDZF 1J8KA 3GB7B 1X5IA 4YX2L 2EDHA 3WXVH 4OZHF 2GQHA 1MI5B 1UH4A 3L3JB 5D7LD 5D93B 3VXOB 4WWID 2F53B 4WHTB 3KPMA 3D0VB 5D8JL 4QXUL 3D69B 4YIQB 2NY0B 5C0RL 2FATH 4PJGA 5EOQL 3RL2A 2NXYB 3LAFA 4PG9A 4OSUH 4RGNE 1FO0A 4KZEL 2YA0A 3UYPA 5KW9H 4JFDE 2YUWA 1AY1L 5DYOA 3TYFB 5DJ6A 3BOVA 3MOBL 4DUWA 1ED3B 4EI5A 3PWUA 2XWJB 5DHVA 4MQXD 4OKVB 3TC9A 1FCGA 2CJUL 2CDEB 2BY0A 4NBZB 3U7AA 4ZUVA 2YD9A 1Y6KR 2R0WH 4P5KB 2QKIB 4X7CC 3OX8A 4JO4L 1NAMH 4P46D 3GSUB 2YPLA 4R4FH 5JW4Q 3OKYA 4NQDA 2P8PB 1T7YA 3Q1SL 5IQ7H 2IJ0C 4JDZA 3QEGH 2AI0H 4FQXA 3CAFA 2ADFH 2X41A 3O2DA 4UIMB 3W5NA 2XQYK 1LP9B 3CH1B 2VNCA 1RZGB 1G7LA 2HJFA 1DJSA 1Z0MA 3ESUF 1NCDL 1BP3B 4FQHB 3ABZA 5I1GL 4RZCB 1MCPH 1A9BA 1OGAA 1VERA 3DBXB 2G75B 3TN0A 4RDQG 5FYLH 5J6HA 4H8WH 5HHQB 2RHEA 3NFSH 3AUVA 3OXSB 5D70L 4AEIL 3QEQA 3L3KA 3DV6A 2A9NH 4Z9KB 2HKHH 5D1XA 2PXYB 4ENED 1FZOA 5IBUB 1Q72H 1G7MB 3L3DA 3DI3B 4I4WB 4A2LA 3EJYC 4MXVF 5F1KC 3RJQB 4PJHE 3G6JB 3MLUH 1QUNA 3DUSB 3MV7B 1E27A 3SY0A 3UROR 2BSSA 2CGRH 2DQFB 3GSWB 3PGCA 2AABL 3A6OA 1A7QH 4WWKD 5HI5D 3OB8A 1F6AA 2X5PA 3RZWA 4G8FA 5C0FA 3E0GA 3I6GA 3VXMA 1UM4L 4JM2B 5HYJA 4OJFH 1BQUA 2VH5H 1OPGH 3OAYK 3M1BA 3MODH 4MAUH 2J3SA 4PB0H 1TVBB 4KQ4L 1N7ML 4XH2A 3KXFE 1S5IH 3B2VL 3BPLB 4D0DA 4PV8A 3EO0A 3S8WA 1WVZA 3FO2A 1ROWA 2AEPH 2Q86A 2Y6SC 3D2UB 3VXSD 3WLBB 1JK8A 1RIUL 3DXAE 3HMWH 3BPNB 1FNSH 4KVCL 2X4RB 2X05A 1X5HA 1A2YB 2IBBA 1MFEL 3GMRB 4C83A 3SKJL 3HLAB 5CILL 2QADD 4TQEL 4YHPA 3TA3D 1WWAX 4OZGE 4Z0XB 2OQJA 2UUDH 3B6SA 3L95B 2EIEA 3QFJB 4EI6B 4M43H 3EGSA 4PS4L 2D9CA 1S7UB 2X2YA 1CGXA 3KYKH 3QUMA 5DMKA 4WIQA 2BVPA 3I75A 3DO3A 1A6UH 4FNLL 3MJ7B 4IRJD 1FNHA 1VENA 4JQXA 1CTNA 3AY4A 4AK1A 4JZJA 4YWGH 4EQ3A 1KTLA 2C3VA 4XCNA 2A6JB 1JHLL 1XCQA 4N8PA 4ODUB 5ESAA