1KIUB

Fimh adhesin q133n mutant-fimc chaperone complex with methyl-alpha-d-mannose
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
279
structure length
279
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRNTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/cell adhesion
molecule keywords CHAPERONE PROTEIN FimC
publication title Structural basis of tropism of Escherichia coli to the bladder during urinary tract infection.
pubmed doi rcsb
source organism Escherichia coli
total genus 46
structure length 279
sequence length 279
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2001-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00419 Fimbrial Fimbrial protein
B PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1kiuB01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1kiuB02
3ZPDA 4AUUA 4J3OF 5ABZA 1TR7A 3BWUF 1PDKB 3RFZA 3ZL2A 5CGBA 2UY6B 5IQNA 4AV5A 4BUQA 5AAPA 2JTYA 4X5RA 3JWNG 2WMPB 5F2FA 4XOBA 4XODA 4AVKA 5LNGA 3MCYA 4AUYA 3JWNH 1QUNB 2XG4B 2JMRA 5FLUA 1UWFA 5FWRA 4XO9A 5FX3A 5AALA 4LOVA 4XO8A 4AUJA 2W07B 2VCOA 4AVHA 1KLFB 3BFWA 5FS5A 4XOCA 2XG5B 4XOAA 5LNEA 3JWNE 4X50A 3ME0B 4X5PA 4CA4A 1N12A 5IQMA 3SQBB 5AB1A 4XOEA 2UY7B 2J2ZB 4X5QA 5F3FA 4J3OG 4CSTA 1ZE3H 4AV0A 5IQOA 4AVJA 5JQIB 4J3OH 1KIUB 4AV4A 4AVIA 1N0LB 4CSSA 3BFQG 3ZL1A 4ATTA
chains in the Genus database with same CATH superfamily
1EHKB 1X4ZA 2WLJA 3PHOB 1NBVH 3QCVL 2WJ7A 1NFDF 3VMNA 4AENB 1TPXB 4O51B 5DHYB 5FO8A 4RIRB 4XPTL 4URTB 3VI3E 1NOFA 3O3AB 2XIDA 4G9FD 3D06A 5CILL 2B0SH 3QDGA 2X4TB 2VE6B 3B3IA 5E5LA 2W80C 5HI3C 4BQ6A 4YEEA 1MCNA 4TF4A 3EH5B 1DEEB 1FFPB 3T3MF 2A3TA 3SGKA 3DOIA 2DLHA 5LB1A 1CVSC 1MWAA 3ESVF 3GLEA 5LBGA 4JDZB 4Z76A 5LDSA 3MNVB 1JYNA 5F3BB 4QOKE 1AC0A 1CDBA 3KR3H 3C2AL 1PDKA 3D3VB 3OG6B 3SDYL 4UM9B 1OOAA 4WNQB 4HUMB 5I6XC 1UADC 4IMLB 3V0VB 3HCVA 4L05A 5TQ2L 2FBJH 1DVZA 1GJWA 5EUOB 5AW5B 3KAAA 1MLBB 4IW4C 1NCCH 4H1LH 4PWJA 3QJHB 2SEBA 3DMMD 3FUFA 3H9SD 4HHGA 3RL2A 2CO2A 1UZGA 3MRKA 3QCTH 4GUCA 4P4RB 2WKOA 4MA7L 4XNQA 1SVBA 4OQTA 5CJBA 3LS5H 4FMKA 1XF4B 2BP0A 4F7TA 2OX5A 4Y4KA 2CGZA 5ID1A 1OB1A 1UWGH 5GS2H 1QHPA 4OU3A 4MB1A 4DJMA 1NGZB 4HHAB 3F7YB 4NUMA 3WY1A 4F9LC 5E2TH 4B9KC 2ODIA 3VFVB 4JHZA 3GXPA 2EEXA 5GGVL 1G7JB 2N0MA 2GBUA 1IEAA 2Z0BA 3QDMA 3VH8B 3FRPB 4R5TA 4XXDA 3KEHA 4WLCA 3ULVL 5DVPA 2HB0A 2XFXA 1P7KB 4MQSB 1QR1A 2VDQB 4L9LB 4BFFA 5F6IB 4ZFQA 5DS8A 3BGMB 4DQAA 4QOKD 4HX1B 2YPVL 5T3ZL 4PJHF 3FB7A 1KV7A 3NEEA 2L4OA 2XBTA 4HWEH 3WS6C 5CSZB 1HQRA 3F62A 3MV8B 2YC1A 3QO1B 4U2YA 4WI6A 5D7KE 2V9QA 4R5XA 3V0JA 4UOZA 4TLSA 1AS8A 1IBHA 3FTGA 3CSYA 4Y2DA 4LASL 5IHUL 1UTDA 4KFMA 3P4MA 3F2LA 4MMXB 2JKLA 1S7UB 2XWBA 2VAAB 1KB9K 5JQ6L 1ET7A 1TQSA 1HXMA 3QXAB 4DFIA 5KBPA 5MP6H 2WXPA 4FQIH 3H54A 4S1QL 5D7SL 1U4FA 2JXMA 3IXTB 1JZEA 3TBWB 2D9CA 4P4KA 3T4YB 4LLYA 4BSVB 3AFLA 3T4AA 4PJ8A 1GAFH 1S78C 4G6KL 5CJXC 4H8WH 4NUJB 1MZZA 2VXQA 4Q58C 1KOAA 4MZRA 4X7SH 2CDGA 4LQFH 1KB5A 4F8QA 3MRGA 1KXVA 3UDWA 3KPOB 3ZKQD 2K3TA 3NESA 3EYSH 1FI8C 2QQLL 2ZX5A 3BH4A 3I6KA 5D7KD 3BHBA 2GCYA 3EJTA 3APDA 5DQDH 2N1TE 3V4PH 5C71A 5I1HL 3CMGA 2XPYA 3K3QA 4LOEA 1B2YA 3LNIA 1RK1A 1R3KA 3OPZH 4NWTL 3WN5B 3GPSA 4KRPC 1S3RA 4P46C 2AANA 3KM1A 2OSWA 1KIUA 1H3XA 1I1YB 2NDFA 3ULSA 5C86A 3VDCA 2CO4A 2Q7AA 1TYJA 3FZUC 4PRDA 1A14L 2B3IA 15C8H 4PJXA 4XB3A 3WFHB 5LVEA 3BYTA 3VGBA 1FZMA 4RAHA 2OXGA 4ZQKA 4FQHA 1ZS2A 3AREB 3LXBA 5I6OA 1L9TA 1ORSA 5HGBB 1YEFL 1IARB 3SE9L 4UOQA 1DANU 5DK2B 1T1ZB 5FS5A 4F7EA 4RZKA 1D9KC 2XG5B 1MJUL 4P5MB 5BCAA 1UGNA 3EYFA 5EUOF 4K15A 2HJFA 4L4TA 4U6VL 5DRZB 5F7LB 1EH9A 3B56A 4AQ1A 4BH7A 1BBJB 5JW4M 2PCXA 3ERXA 2HSIA 5DC4B 1AKJB 4M43H 1IEHA 1EEQA 1RJYA 3H4FA 5LUMA 2QMKA 3D39E 1S6NA 1MFEH 1B0GA 1T7WA 4G8AC 3D87B 4UINL 4P9HH 2AKRB 3GMNA 1T1YB 3KLAB 2A6KA 4ODSH 2VN3A 4J3OG 5SX4I 1KTCA 4WGVB 5ESQA 5CU5A 1ZE3H 4IJ3B 1LO5B 3OB0H 4KXCA 3GUFA 3VUAA 3TA3B 1JGLH 1OTTC 5H35B 1ORQB 3HAEA 3K72A 2JI2A 3K80A 1SYSB 5DK0B 5I71B 1HINH 4OF0A 2J12B 1L3NA 4QHUB 3SDAB 2GIMA 3BH9B 3EJCA 5D2LA 3WIFB 3PL6B 1GYAA 2KZ1B 3GMQA 1RHHA 3L08A 3LZPA 4JJ5A 4YGVB 3FCTA 5AZEL 4JO2L 3NABL 1K4DA 2CA4A 2CSPA 2ITEA 1DVYA 1JMZA 5AOLA 1JHKL 4IMKC 5ESVA 1U41A 4L1LA 1E43A 4AZ8B 2WXKA 4JQIL 4K5PA 1LEIA 4EQ2A 3ZL2A 4IBWA 4HFWA 4TS6A 3E8UL 1F90L 2DQIL 1MH5A 1T3FB 3FPYA 1QBLH 2V17L 2DI9A 3ASOB 4QHPA 2CR3A 3RX8A 4X5WB 3IETA 4PU2A 4PRID 3SD2A 3CFEB 5AW9B 1RFDH 1X9QA 2PP9A 4YLBA 3BCFA 3EOBA 1M1SA 2DKMA 2GUOA 5B7FA 4JPWL 2APWA 2ZD0A 3QFJA 3WIHL 4BCYA 1BFOA 4XNAA 3ULUL 3HB3D 3RWCA 1U95A 3MUJA 4KOBA 2FX8H 1B9KA 3INUL 3VGEA 3TNMA 3WFDL 1T1WB 2PYFA 1JHLL 3FO0L 3HBPA 1J48A 2N56A 2WB7A 3CTTA 3FUEA 4G11A 3MV7D 5AL8A 1BF5A 4FTVB 1I7UA 2IOIA 2ZKMX 3EHBC 3ARDC 1JZ8A 3ATDA 3C6SA 2WXLA 4KQ4L 4OTXH 3DJTA 2AGJL 1MHEA 2QELA 3MRNA 3MGAA 4D9QE 3H55A 4JO3H 4A67A 2C9UA 4GAGH 2BVQA 4M3HA 2X70A 5IB5A 5KVGL 2YD2A 3IK2A 2EKSA 2W0FB 4FFYL 2HVKB 1JZ5A 1UQSB 2BXZA 4B50A 4WRLA 1AQ8A 5KYNA 4MWFA 5IEHA 3EDDA 4YSRA 5GZOD 3BKJH 3D51A 1BBDL 4XCYB 1AS6A 2A0LC 2IBGA 4AXWA 3MX0A 4J3OC 4JHAL 4F7PA 2XJKA 1M6UA 3BKML 3AQYA 2QVIA 4CU7A 2NQCA 2E47A 1OSYA 3HZMB 4RAUB 2NY1C 2GSIB 5GS0C 1IL1B 5E9DE 4HOZA 2NY4C 2UY7B 4G6ML 2NZ1A 5L4IA 2VDQH 2FCBA 4YK4B 3B3BA 1FO0A 3V5DA 1EVUA 1BVLB 4HS6A 4NNPH 4U4IA 2F7OA 3N1MC 1AGEB 3I6GB 1DL7H 1GIGH 5EH1A 4NOFA 3MA7A 2X3BA 3O6KL 1FLRH 2MHAA 4L4VE 3MLWH 3MOBH 1QHOA 2X10A 4GT7A 2WSPA 5KS9F 4LT7A 1YMHA 3SCMC 1RLWA 3D52A 1VKXA 4N22A 2OYPA 3RIAK 4EN3A 2HXAA 4V1DA 4XBGB 1BMGA 4JQXC 5IWLA 4N86A 4NQCD 4D9QD 3O6FA 3KLSA 2VO8A 3TXAA 3FW6A 1F4YL 1NANI 3D85A 2H0FA 4F7KA 4JO1H 5CP7B 2D8KA 3OJ2C 2D2OA 2CJ3A 2YFOA 3FSVA 3VGAB 5F21B 3NK3A 1TZOA 3LXCA 1NUGA 2WTOA 3PGCB 4LCYA 4CN4A 1JGDB 3Q2NA 4DVBB 4FNLL 4FGMA 3KCWA 4MA3A 5HYIA 1TT6A 2C8NA 4P5RA 3VXOB 1AY1L 2G5BA 2OFQA 1XF2A 2BM3A 2WVTA 3LD8B 3V6OA 3IAPA 5HHMD 4J4PC 3CZFA 5E9DD 5IK3A 4Z23A 4N5ED 3JUZA 5A7BA 3CFBB 2CJUH 2F74A 4ZS6C 2VM9A 2C1PA 3E9TA 1HKLL 3Q3GA 4JFSA 1HXYA 3NFSH 2F53E 3H85A 5AVXB 4P2QB 25C8H 4WW2A 3HC0B 4XNBA 2JKIS 1H3UA 2XWEA 4L4VD 2AXGA 3MRLB 1SHXA 3VGHA 4B9IA 2NY3B 4N9GA 1DLFL 1SLXA 2JCCB 2VISA 5I1GL 4JFFB 1MW2A 4F37F 1FZKA 4UAOB 5KYYA 2EC9T 3O11A 3AXIA 2WB1A 2XWDA 1NL0H 3N91A 1IUZA 3ZMEA 3SDXE 2IDCA 4Y5VC 1Z0NA 4OZFA 1NCTA 3B2VH 4KDTC 3CN4A 5EU3B 1MI5D 3NFNA 4KJQD 1S7WB 3T77B 5JA8B 4AQAB 3V4VB 2DIAA 4JW3A 1I1AB 4M7JH 3DDFA 1UCTA 3CMOH 4Q9QL 2GTZB 3GSXA 2X4OA 3KJ6L 2G0LA 5CZXD 4GKOA 1OGAA 4LNVA 3WKPA 1UJ3B 1PPIA 2DEWX 1CF8L 1JSYA 3UX9B 3UTSE 1XDTT 4GKZA 1YECL 2R9HD 1T1XB 3F7PC 5DJXB 4G59C 4I9XA 1VERA 2IGFL 4JGMA 5IB3B 3SPIA 5I0WA 1SXAA 1W8NA 2FJFA 2F53D 1QW8A 1IAIH 4Y1AA 4LLWA 5D8JH 4GBXA 1E6OL 3CFUA 2CLZA 1LP9A 1BOYA 4OCRL 3ZDZF 4PPTA 4HD5A 3GUTA 2P5EE 3G04B 3JV5A 1B3JA 4X6DA 4JL2A 3ARBA 3V0EA 4QKXB 5B3NA 3VFPA 1Z3GL 4GRWF 3LN9A 3SDCA 2UWEA 2LQRA 4IRSB 4XCCH 1OAYH 1ZTXH 2FJGB 1BXAA 1WWAX 1A1OA 2BH0A 3TJEH 2DQHH 1GGCH 4LHQB 1I31A 4DGVL 1KV3A 2X0UA 1JYWA 3GSRB 5ENWA 2WY3B 1A2YB 2DZEA 2W9LA 3P77A 5CMAB 2FBOJ 2ZXWB 2DS4A 4M8RA 1FFRA 2Z3FA 2WAQA 2FLRT 4OF6A 3O2DH 1FC1A 1PZCA 1U8PB 2O5ZL 1YN6A 1NDGA 1A7BA 4EBQH 4Y2OB 1RK7A 1FL5A 4PR5B 4ZSOB 3CD4A 2P8MB 1KGCD 3TN0B 5F3HA 4C56B 3D33A 3VXSA 1U8MB 4GRMA 3S3CB 1A4AA 2F7IA 3HC2A 1HILB 4LPXA 4PRBA 4QRTB 1AHWA 5CWSA 3TWYA 4AQEB 2R0KH 4AIOA 4OAWB 1FVEB 4Z7QE 1ASPA 4P9MH 5LCVA 3COOA 1FFOA 3X1EA 3RG1C 1ACZA 2ITDB 1OL0A 3EIFA 5TDPB 1FHGA 5I75B 3KWWA 4XAKE 3FT2A 2XQYG 1E28A 4A63A 5A2JH 2W8CA 2X41A 2P5ED 2AFNA 5D6DA 3OHMB 2QPDB 4JO4L 1YEHL 3VXUB 4MCMA 2IEPA 4OBRA 5DMGC 4Y9BA 3P3TA 1ROCA 4CILA 3QIWA 4QRQB 3RWDB 3PE9A 3KYOB 3TV3H 4KUCF 2O93L 1DDTA 4AYBA 4JREC 1EQWA 5I6PA 3RPIB 3T0EE 1LK2A 3RX9A 4OR1A 1I3RB 5ITBL 2FYYB 2IANB 4NO0B 3FFCE 4DWHA 4UILH 1TVHB 1WG3A 1ZVSA 4IS6B 3L3JB 3VXNB 1EHNA 1X5ZA 2AQRA 4NQDA 4W9EC 2XA8H 1PAMA 2J56A 3VXQA 2XFGB 4FD0A 4H25B 1QSEB 2AQSA 4UM8B 1FNEB 1JNNL 2Q76A 2AK1L 4F9PC 4KKBC 2GJPA 3T0DA 2BOCA 3MRBB 5F8RC 4TPRH 6CGTA 1DHKA 3CPLA 5EZPA 3QORC 1XF5A 2NY0B 2BSSA 3SDDD 4CA4A 4K9EC 3STZB 3VFSB 3HRPA 3ZSTA 5D7JC 5DQ9B 3TA4D 3LKSA 3MJ9L 4MAYD 3ZXAC 4H0LC 1IC7L 4JJHA 2PLTA 3SJVD 4AGOA 4AI7A 1A7QH 4FHJA 2VABA 4JFEB 5E2VL 4QPEA 1H3TA 3IFLL 4NRZB 5A2IH 3OGCB 5DRNA 4K71B 4MJ4A 4GRWH 3RA7L 2K6ZA 5ES4B 4AV0A 3PS6A 2CAKA 3R06A 1YA5A 2GG1A 4OFIA 3ZUCA 3EZ8A 3N50A 3NPSC 4X7EC 3LXUX 5GISH 4EDXB 1KJ2A 4P5SA 4BSWA 4E9SA 2WQRA 1OXYA 4MASA 3KWXA 1SEBB 5IB1A 5T1KA 3T0ED 1BW8A 4KC3B 3RX5A 2LAGB 1OAUL 1B88A 1L9SA 2OTWA 5FYLH 5AW2B 1EBPA 1JK9A 3X12B 4AIXA 5E5MA 4YBQC 1SM3H 1F2QA 4Y16B 1G94A 3L5HA 4GQ9L 3TBCA 4L8SB 2EIZB 3KPSB 2G9HA 4XMPL 1OM9A 4PI0A 1S7RA 2ZPKL 1MJJB 1UD5A 3BMVA 2VUOA 4G8IB 4G42B 4D0DA 5D2NA 4DNLA 3PP3K 2ZUXA 1JDAA 3FCSA 4JY5L 4A6YB 2FQDA 1JGVL 4PJGA 5CHNA 5TE6L 5KZCD 4UV4L 1YNLL 4NIYE 3S35H 4XMTA 3WNMA 2A9ML 1IE4A 1SGKA 1NFDE 4FABH 5BMFL 5KSBB 5JHDA 3E6FA 1I4FB 1A3RH 3WTWA 1BGXH 4N8CL 3EO1A 2PWEA 4OCWH 3DXAB 4TSAH 4GO6B 3JWOH 1TOXA 3QJZA 2Z31A 3HPLA 1MRDL 3V0HA 2UVFA 3LMJL 2VQTA 3LQAH 4M8QA 2C9PA 5LKNA 2YD6A 5LNGA 2PPEA 3DVNB 1TU2B 3G6AB 4X80L 4WTQA 4WV1A 3U6XS 2XVLA 3LEYL 3OKDB 3Q7JA 5TDOB 4BFJA 5AYQA 3RGBA 3T3ME 1JVLA 4S1DD 4W9GC 2WLZA 3FB6B 4FXGB 1IBGL 2E8ZA 4FNQA 5M94B 3UAEA 2H26B 1ADQH 4KRNA 4X6CA 1OE2A 3G9AB 4QTFA 1YNKH 2ZJSH 1XBRA 4AYFA 3GB7B 3ISYA 4NAMA 4NT6A 2A83B 3C9NA 3GD1C 3GJFK 2X12A 3IJ8A 4FF9A 5K93A 3V0GA 2V17H 2HTKD 5L8KB 5ETUB 2W94A 5HHOD 5FKPA 3P69A 3V4VH 4NFCA 1NFIA 2BPBA 5I17B 3BIKB 1E8XA 3CHRA 3QNZA 1U3HA 5F7HA 1ZCRA 3HS8A 5G5DB 4KVCL 3OF6A 2NYKA 1YEGH 4LRNL 2DQGH 3WL9A 3IDNB 1IE5A 4Q6KA 3VG9B 3PWNB 2XETA 4WUKH 2PW2A 4IRJD 3ZW3A 3HUJA 3NZSA 1Z32X 4FQ1L 3OD3A 2DLFH 3CC1A 4MHHG 1G84A 2NX5B 4C4KO 3L4XA 4J2XA 3HI6L 3QQ9C 1BQLH 3O0RL 2G60H 1DBKL 1ACXA 5KJ7E 1YNTA 1MAML 4FXKC 1TEGA 2A99A 3VXRE 3QDGB 5D72H 3T2QA 1H0DA 5AVSB 3B3IB 4H1LG 4U7MA 1T66C 1JYXA 2GJ6E 2BJMH 3GIVB 3JWDH 4IBLT 4R4FH 5T3XH 3MR9A 1KTDB 2Y2TA 4PTTA 4YDJA 2Z34A 3K4ZA 3QRBA 1V54B 1MWAB 2EYSA 4LOUC 4QJ4B 5I26A 4HJTA 2C7FA 1PDKB 3NEXA 4MBOA 3PAZA 1MFDH 1NUFA 1FIGH 3KHQA 2BOLA 3HCVB 3QDJA 2NNAA 1AE6H 1CFMA 4PRPA 2R4SH 2RH0A 5I2IA 4IK7A 2XPGB 2DIJA 3BW9A 3RL2B 1AXTH 1NSNH 3DV4A 4Z7NB 3MRKB 1NEZA 4EKJA 2AK4A 4YWGH 3ZOAA 1SBBA 3WNJA 3OKLA 2RCSL 3MLRL 1I7ZB 2BP0B 3RRQA 3WEAA 3S35X 4DP2X 1WZ1L 2OX5B 1BZ8A 5D1XA 4ZS7L 4YIQA 4Y4KB 3U4BH 2WXMA 3IF1A 4FNUA 5E6ID 4E41E 4ZMPA 5AB2A 6FABL 5ID1B 5L8JB 5IFJB 1N5YL 5I1DA 5KVFH 1NC2A 5CKAA 3O4LE 3CN1A 2ZCHL 2ZUYA 4N0RA 4UCFA 3ZTJH 2C3VB 3P2DA 3S5YA 5L2KB 4JANA 5DWPA 5KSBF 3NJFA 4HPYH 1RJCA 4Y4HD 3HI1A 2GJ6D 4F1ZA 3PWPD 2BY0A 5JPMC 3II1A 2XFXB 1EV2E 1R46A 4ZOAA 4KFZC 1BLIA 4PN6A 5C9JA 4NN6B 1QR1B 2Z1KA 3P0VH 4JKWA 3QPXH 2FL5A 2Z65C 4NGHL 4PJIA 32C2A 4YE0A 3RFZC 2Q2LA 2GK2A 1GZPA 4TOYL 3BT2H 4OT1H 4N2EA 4KI5C 5ALBH 3D4ZA 1KACB 4JHVA 1XGUA 1BIIA 2GIXA 4RH4A 4DK6A 3QS2A 4WI5A 3FAWA 2HKFH 1NMBL 3D3VE 4Y2DB 3GXTA 4X9HA 4YDMA 5JIDA 2AMGA 1PGRB 3BUIA 3IJSA 4JCWA 3AY2A 3P4MB 1RURH 5I1IL 5E08H 2P5WA 3MBEA 3FCGA 5HGHA 2X4RA 5EUOE 3VXTA 5HSFA 1LGVA 1HDMA 4UTAL 2XOTA 2XN2A 2H2PC 4PJ7A 1O9WA 1HXMB 4P59L 1FAIL 1BPVA 1MCIA 1Q9LB 4ZMAT 4GQRA 4XZUA 3REWA 1TTAA 5C2BL 4M9OA 3H9HA 3OHXB 4RX4A 2WO4A 3LRKA 3L5JA 4P4KB 2QKIC 4LLYB 1GKEA 3T4AB 4HIXL 2BVUA 4L2YA 1UUSA 1PU0A 4I18A 4P2RE 4X7FC 3U4AA 2VM4A 4QRRB 2CDGB 2UZYA 2FIKA 4Y1SA 1EDQA 1G87A 1TZGL 1KB5B 2G9KA 2AJYH 2K7PA 3G08B 3KJ6H 3P2BA 4BA0A 3MRGB 5DT1H 1DBMH 1N6UA 4PYHA 3TM6A 2K4AA 2M26A 3QXVA 1B4JH 4EEEA 2NY2B 2OMUA 2YS4A 3U6XA 4YHML 2FYVA 1CLYH 3I6KB 3NGBC 3BHBB 1DSWA 2GCYB 3N06B 2XVKA 2KMWA 3UAJC 2NSMA 1Q72L 2ZT9C 1DYZA 5IROD 2VXTL 3D3VD 4UM9D 3OR6A 5I1CL 1NMAH 5DO2D 2PWFA 3CXDL 1RK1B 5HYJD 3GLDA 3MV8E 3DX4A 5EORH 3CLWA 1MCHA 1NBCA 2KYIA 4OM0L 2DH3A 4BZYA 4NHCH 5AENA 2VLKD 5C3LD 1QKZL 4FQ2L 1WEJL 3ZDYB 1UKSA 4XO5A 4A6YH 2CDFA 3DO4A 3UTPE 1FZMB 2E27H 3BQUC 2BO0A 5B1JC 5E8EA 2HJKA 3GRGA 5DJAB 4EVNA 2CMRH 3ZIMA 5J11C 4DW2L 4UANA 2P4AB 1XR9A 4ELMA 4M7LT 1QSFB 2JLLA 4H8PA 4QAWA 4G7SB 3HE7C 4GMTH 4S1SH 5HD8D 3ZJAA 4WDIA 2ICEB 2XN1A 3DIVA 4N1CA 4TUJA 1MXGA 4F7EB 3GXIA 5D70H 2IF7A 5C1MB 1P1VA 3I02A 4P2RD 2GBTA 2C3WA 3S3SA 4ZAKC 3I9AA 1AZVA 4UQDA 4Y7OC 1NIBA 2EDXA 5GIRA 3HZYA 2F5AL 4LSUL 1U58A 1M57B 4C54A 5C2UB 2WBWB 1RJYB 1BJ8A 2J6EL 4AM0B 1NMCB 2IH1B 4JHUA 3PRZA 4OLXH 5KVEL 3LQMA 1BZ7B 2A6KB 1DZ0A 3OSVA 4ONFH 4XB7A 4UQ2A 5EWIL 3VACA 2AEQL 4LSPL 3BN3B 3AM8C 2RJMA 3MV8D 3CQQA 5ESQB 3K71B 2C9RA 2MOQA 3P4NB 2QR0A 3LNHA 4ZPVA 4DESA 2YXFA 2OKMA 4YR6A 3HJEA 3T2PA 1J8KA 2NUTB 3UTPD 2X9ZA 3K72B 1N18A 1UH2A 1H15A 2EECA 3N85L 5JXAH 9PCYA 1QFUL 3CG8A 5I9QB 5EEZA 1XQ4A 5D2LB 1U0QA 2Q8BH 2WCSA 4HMEA 2XXMB 4RGNC 4BQ8A 4WK0B 3GMQB 1RHHB 3QK0A 1DBJH 1DUYB 3FCTB 2MEJB 5FM5M 2DYRB 2DLIA 1K4DB 1ZXKA 2FDBP 2GKIA 3FN3A 3BVTA 4FG4A 4M7LL 4PGDA 1NCGA 1QOKA 5HI5D 3IGAA 5ESVB 2V4LA 4ONGH 4BK4A 1CCZA 2VLJD 2YAHA 1J9SA 1T5KA 1LO0H 4N1EA 1DCLA 3GJEB 1NCJA 4WSKA 1BYNA 4KGLA 1MH5B 1WCQA 3EFOA 1AO7A 4NN7C 2E7MA 1CL7H 5EDXA 4YNYA 4NO2B 4MNQD 3IETB 5KEZA 3QWNA 4NPYB 1FGNL 1D7DA 1YLBB 2OJ1A 1JZ3A 3EOBB 5TPWH 4F8PA 2GUOB 2R0ZL 5FO9B 3RP1A 3D4CA 4WHYG 3QFJB 1K85A 1BFOB 3MUY1 1LDPH 3RWCB 1ZGLB 2D7TL 1U95B 2FO4A 2ARJQ 2XUWA 4UIKL 4Z95H 3TIEB 4M7KH 4MMZC 1CZ8L 4I0PC 3T1FA 1J5DA 3CFQA 1ZTXE 2IDTA 1VEOA 1U36A 3NJIA 4PJFA 2NT1A 2JTYA 1TZ8A 3VFUB 1J5IA 3H4HA 5F96H 1YAZA 5E6ZA 2AQPA 2ZUSA 3ARED 3VWJD 4Z0BL 4O5LL 2BP5M 2EE0A 5B38A 2NY5L 1A6WL 1JZ2A 1MHEB 1PYWA 2RIKA 4M61A 3VU1A 1JYVA 3FRPG 2LAAA 2BVQB 2OXHA 5C09A 2X70B 3PWLA 4PTUA 5IB5B 5C7ZA 3WKMH 1B3IA 4AMKL 3C87A 4O2EB 3TBBA 1N6QH 2CBPA 5CSGA 2WOYA 1OZUA 4OLWL 4R4NC 4G5AA 3BKCH 2VXUH 3M86A 1GGIL 2JKRM 3WEXB 3ZDYF 1MAKA 1OTSC 4KHTL 4MZ2A 1HI6A 4MWFB 5IEHB 1AKJD 2XBDA 4M4PA 1RD6A 2ZZUT 3G5XA 2V3FA 4AXWB 4KO5A 4F7PB 3MX0B 1LTXA 1NEPA 1R24A 3H7BB 1GGBL 2E9BA 3MLVL 4LKCB 1RP9A 3FSWA 1NOAA 4KXZH 1EA9C 4QHMA 1OM3H 5I1AA 3HZKB 3VWKA 5AW3B 3N43B 3KD4A 1FO0B 3GI9H 4FFYA 3V5DB 3QUZD 4FQLL 1NPJA 3EO0A 2E86A 3BDYL 4HS6B 1KGUA 4GSRA 5KJRL 3TA3D 4HZAA 3MA7B 3ARZA 1AQHA 2PWDA 4LVNB 2RACA 4U3HA 1YMHB 1N4XH 3QUMB 1VKXB 2O5YL 5DRWB 1INEH 1XH0A 5HY9A 3WIIL 4V1DB 3TVMD 1EHLH 4FTVE 3PL6D 4POZC 4MVBC 4PCSA 3D85B 4JQVA 3RTQA 4AK1A 5GRXG 4PM1A 2A5UA 4KTYA 3MCLL 4LLUA 3FTWA 3H8NA 3RVUC 5T3ZD 3GFUA 3H0TA 4GY4A 4YFDB 1GPOL 3AUWB 5AOKA 1IGCH 4LCYB 3K6OA 3OXSA 4TQHA 3VX0A 1WZLA 2ZX7A 1IGFL 1OGPA 2WLKA 4MA3B 5AAMC 2G5BB 3QCUH 1FL6A 4PLJD 5C0CD 1XF2B 4GUOA 1M7UA 4DCQA 1JF5A 3CZFB 5IK3B 1QR4A 1KBKA 3D0VA 2F74B 1EVTC 1S7QA 5HHXH 1KB5H 4Y9FA 4EIUA 3TONA 2C1PB 4HK0A 3LAFA 3VFOA 1HXYB 1NOLA 1JN6A 3VD1A 3IKKA 4XWOD 1PNDA 5PAZA 1S4IA 4G5ZL 4OD2A 2EXWC 3TU6A 2AXGB 1AC6A 3OAUL 4PG9B 1YUKB 4N9GB 3KH4A 4OLVL 1NGPL 1YEEH 2VISB 3B9DA 3HKFA 3MHZA 4P23A 4M93B 4WNJA 1FZKB 5ICYA 3VD4A 2X2YA 3LDBC 2AXHA 3WO4B 5KYYB 5FYLE 3WHE1 2TRHA 1YJDL 5C6TH 1R3JA 3LS4H 3RQ3A 3EYQD 4MJJA 4OZFB 4KV5F 2X9YA 1SHSA 1T4WA 3A6BL 2OK0H 3O3EA 3UCRA 1T7XA 2VDMB 3GSXB 2X4OB 4NP4H 3CU7A 3O9WD 2ZUWA 3OB8A 3BZFA 3NCWA 3VTTA 1JZIA 3V0AC 3T08A 2XNAB 3WDIA 5BVPH 4LBAA 3HFMH 4XCFH 4Z0XA 4GKZB 4NKIH 2JELH 2HN7A 4L3CB 4LXFA 3GWJA 4MMXC 1RPQA 2O6DA 2J8UA 2YGPA 3T09A 2D03L 2YUXA 4H2CA 4BXVA 4Y1AB 2XG4A 3MJGX 4LLWB 2ZE0A 2L7EA 2R2HB 4LKXB 2CLZB 5TE7L 4HBCH 4NJAL 5EOQL 4L37A 1GTFA 1H8NA 1LP9B 4AL8H 5D4HA 4P2QE 3CN3A 3GUTB 5FYLD 1BM7A 4HF5L 4QGYA 4X6DB 3ARBB 4G6FB 3VFPB 1VFBA 5GGVY 2RB8A 5FW6A 2JCCE 5F72S 1QYGH 2YO3A 3GSVA 3SDCB 2E7BA 4MA8H 6FABH 4F8OA 5K5YA 4I85A 1A1OB 2LTQB 1DEDA 2YBRB 5FFGA 1KB9J 2E9IA 5ENWB 4KAQH 4Q74A 2B4CH 2CHNA 3AU0A 3IDXL 3P77B 4YZFF 3CVIL 1P7QD 4U1NB 3BESR 4QXGH 5I28A 2FJHA 3K81A 5DXWA 3DX9A 1MCWW 1YN6B 1NDGB 1GW0A 3WNIA 4AJWA 1G7QA 1IEBA 4X6EA 5JNYA 4HQQL 5F3HB 4CSSA 2VDRL 3VXSB 4GRMB 3GNML 4PP1D 3VTMA 5DD0L 3W11C 3DHPA 1WIPA 1QLRB 2L0DA 2YMXH 5LDUA 2D7MA 4KUCD 4Q8BA 1EO8H 2QADD 3HS0B 1USQA 2V5MA 1H9VA 1UKTA 2BIOA 3FT1A 3PHQA 3L17A 4NXKA 5DZNA 5IQ9B 4Y8DC 1JZFA 4FFVD 3KWWB 1HK6A 3SEPA 5I30H 4S1RH 3ZDXB 1E28B 3BSGA 1OW0A 4BH8A 4TQEH 3G7TA 2NY3D 4WI4A 4HIIA 4JDEB 4JHBA 4IOSA 1HL8A 3QIWB 2AEPL 1Z2KA 4LCUB 1XSKA 2Z9TA 4MNGE 5C2BH 4PJEF 3CXFA 5T3XE 1LK2B 4OCLC 5I1JL 3LOWA 2X44D 1KCRH 1EEYA 2A73B 2VL5A 4ISVA 5ISZD 2LLNA 4N68A 1PD1A 1CTNA 1ZVSB 1I1AD 4G2AA 1RIHL 1WSST 1YEIH 1CF1A 4NQDB 4XMLH 5KSAD 5HYSA 3IAGC 2VWEC 1DJXA 2R2EA 1BWMA 3FB8A 3UYOD 2IAAC 1UD6A 3FUDA 2BOCB 3RYMA 3PV7A 5DVOA 1CI3M 1QNIA 3DRQB 3HI5L 1Y18A 4OKDA 5AYUH 1U6AL 4ETQB 5DLML 2WMPA 3KPTA 4AEIL 3ZTDC 4NAJA 4S0TD 5LG6A 3VMPA 4ZSOE 4G7RB 5E4AA 4ZFGL 4RETB 4Q9RL 1DBBH 4K3DH 2A9NL 3JVGC 3LKSB 4C56E 5I71C 1RMFH 4M03A 3WE6A 4ZTOL 4UAHA 1I9RH 2X4PA 3SDAC 4Q6IC 1HE8A 3ARXA 5L7XL 2PXYC 4JK0D 4OM0H 1FNHA 3HNSL 4N8PA 4FQ2H 5KVFE 2Y3AA 4A2LA 1Z5HA 3KH3A 3R06B 2K9UA 4YUEH 1D6VH 3CDZA 2NOYA 1G43A 3RPKA 1M05A 2X87A 1N64L 1USZA 4LU5L 4L23A 1VGKB 1KJ2B 2R51A 3MJ9A 5T3XD 3VXUE 4BSWB 5T1KB 1TFPA 4UBDC 3WJMA 5I0YA 4OIAA 1SJHA 2ATPB 2HUEA 5F71A 1ITBB 1E9QB 4QT5A 1JK9B 4WJ5A 3NIGB 4PAZA 3TV8A 2Z8SA 5E5MB 1I1FB 3JYBA 1QI3A 1S9XA 3QUXD 5KYWB 2E4TA 3QUMH 4C59B 2IANE 5KOMC 1M6OA 1CG9A 2IMNA 1S7RB 1ZTMA 5GS3A 1WGOA 4QRSB 4M7ZB 1MCOL 4D0DB 1QSEE 3CZKA 5D2NB 3I2CL 1RI8A 3VW3H 2BSEA 4UT9L 3OMAB 1OK8A 4WTWA 1ZIBA 1UM5L 3CZGA 1MFUA 2RAMA 2LU3A 4RQQB 5D1ZC 3MUHL 1WBZB 2BS9A 5EZJB 1K5NB 4UB0H 4XNXH 2VDLH 1WC7A 2Z31B 5ESAA 3P0YL 2BSBA 5CZVH 5CAYB 5BOPA 4LARL 3D69A 1MELA 4YDNA 3T6WA 2WGNB 3VYPA 3BSZA 4WV1B 3N85H 2WXIA 3NZUA 2YXVA 1WAEA 1SY6H 5LGKA 2Y22A 4LP8A 1E9PB 4NQXA 1MVFA 3PAVA 4A38A 2F8XC 2P24A 4JRYA 4Y5YA 5KYXB 3RJQB 2V5YA 2I27N 4PJDA 2YZ8A 1G0DA 1U8JA 3NJNA 4X6CB 4M7LH 4N20A 3DVIA 4R7NA 4JFTA 5I19H 3B5HA 5IBLD 4JM2A 1GC1H 4AYFB 4NO0D 2AZAA 3HNVL 4NT6B 3BO8A 1MFAL 3C9NB 2YBGA 1AXSA 5HPMB 3BFOA 1TKWA 4MS6A 4KZDL 4KUZH 4OZFH 3C5SA 4KTDH 3KPSE 4ZFZA 3LNFA 1EJ6A 2YD7A 4YK4C 5F97E 1MF2H 1C9SA 1F97A 5D1QC 1T5WA 1UM4H 5FKPB 4JPIA 3IDYC 2RFXA 3IU3A 4WO0A 5EN3A 3GS4A 4FFWC 3CDYA 3TJHC 2VDMH 2Y1VA 3U30C 5AD0A 3L3OC 3QNZB 1NZRA 1U3HB 3BEVB 1PAZA 3S8GB 3SPVB 4BZ1H 2DMHA 1K6QH 3GEFA 5KSBE 2P46B 4W9DC 5DZAA 2J57A 2Q20A 3ZIYA 4TSCH 4GFXA 1G4RA 1OARH 2OR8A 2PW2B 3DXAE 5E99L 1FN4A 2R2BA 3HUJB 2F54B 2D73A 1XGRA 1DR9A 2HLFC 2WM0A 2YPKA 5FK9A 3ENEA 1SJEA 1IJ9A 4TMPA 4W9HC 3HS9A 2VXSL 4Z0BH 2BNQB 2FX9H 2OW7A 1A5FH 5GRVL 3VGAC 1AJ7H 4BKLB 1Y6MR 4MB3A 4MKMA 2Y5TA 1NDTA 3HW7A 2B5IB 1QLEB 1E5UI 1YNTB 1UB5A 3IFNL 4OCYL 1UWXK 3ZN6A 3II2A 1H0DB 4DP1X 2EDOA 1P4BH 4XPGL 3LD8C 1ULVA 2GSGA 4OLWH 2I60H 3K2IA 3MR9B 1JERA 3CUPA 4YDJB 2E59A 2AAVA 4FNSA 3F64A 2EH7H 1UOLA 3LKQA 3MRQA 2W92A 3DJRA 1PKOA 2H4EA 5F1SA 2QV2A 3F3HA 4JBSA 4YHZH 4OKVA 3U9UA 3GZKA 1L0YA 3P9LA 4GP4B 5GRJH 3P3SA 3QDJB 1PY9A 4V11A 1S5HA 5B22A 5IBUB 4PRPB 1U3NA 1TQBC 2DMCA 5I2IB 3AXLB 4XCNB 4LIQH 1GYWA 4UAOC 3O6LH 4FJYA 4WSGA 1KC5L 2E6PA 3HC4L 5IBTL 3NIGF 4ZJ9A 3RY4A 2DQUL 1BWWA 2YEZB 4WEUD 4ZD3H 1NEZB 1TR7A 1QBML 2AK4B 2D31A 3QRLA 4NNYA 4XP1H 4GAYB 4V33A 4GAFB 4HFUH 5TF0A 3HJ0A 1MFMA 1HSAA 3VG0H 1ZHNA 5H37G 3L1OH 1CXIA 1FH5L 3CNKA 5C0AA 2XN9D 5LCVH 2OMXA 2ZAIA 1SPDA 2H41A 1TTFA 5LXVA 2ZX8A 3VVVA 3SGEI 1HHGA 4RFOL 3KGSA 5JXEC 2MPVA 2NX5E 2AJUH 2Z64C 4LF3A 3ZKMC 4EO5A 1SVCP 3T2LA 4JANB 1S7SA 4ZZFA 3TBTA 2FEEI 3CHOA 3AAZA 3L6FA 1U3ZA 3HI1B 3QIUA 4AGNA 2H8PA 2GHZA 4XN2A 1N0XL 4FL4B 2OP4L 5C9JB 3BRGC 3QDGE 1HCVA 5TQ0H 2FL5B 3B9KC 4PJIB 5ANMA 3E0GA 3TO4A 4FP8H 1J1XH 1I3GL 1GZPB 4GNKB 2XSKA 4YLCA 4KDWA 2XY2A 3SE3A 3VJ6A 4ZFOL 1K8IB 2VLRD 1XGUB 1BIIB 3MNZB 3NCYP 3VB9A 2WNGA 3F5WB 3QH3A 4FZEL 1RSYA 1ZPLA 1RKRA 2I85A 4OZHA 3FO1A 4HLZH 4FULA 4X6CF 4WGWB 2G3XA 2JJUA 1BVKA 2XIIA 1J86A 3MBEB 3QNXA 2X4RB 4R4BB 4IRSC 3U1SH 2ADJA 1HDMB 4U6HA 2ERJB 4Z7NE 2B8OT 2IWGA 4Q2ZA 12E8H 2Z8WC 1ZT4A 1FGVL 5F70A 4UOW0 5MENA 5LGHH 2NX5D 5D6CA 1O6SA 2H32B 4TRPL 4HGMA 2MCMA 4DKFH 4K94H 3NRFA 4HWBH 5GZND 3A4EA 4I18B 1TTRA 3PXHA 2V2WB 3BZDA 3ML8A 1N7ML 5L2KE 2FIKB 4PW3A 1TJHL 4XC3H 2MNWA 5F0PB 1OT2A 4LVHC 4M00A 2O30A 4Z7UA 3US1A 1MCBA 1BOGA 4BM7A 4HUXA 1BQ5A 4UF7C 2D0HA 4GI8A 1QI4A 2Y5QA 4GJTB 3LH2H 1KENH 3NVQA 1SXZA 1ZHLA 3QYMA 4K3JL 1SFDA 1HJCA 3OR6B 3SKJL 3DK2A 2HMIC 3TIDA 3WLBA 1JHTA 1P84K 5F7EH 2D3JA 4IK6A 2YKLL 1MY5A 1Q0XL 5A2FA 5KSUA 3QRGH 1FAKT 2YJQA 2CDFB 1KTBA 5TH2A 5E8EB 2HJKB 4AK2A 4E9QA 1BZDA 5IEKB 1IIKA 4EVNB 1THAA 1KPVA 2VDPL 4HF5H 4ELMB 3IJYB 2CZNA 1FL3A 4N3UA 2BVEA 3FBKA 1DE4B 4WDIB 4F2EA 2WW8A 4TUJB 5IP4A 1NCWL 5FF6A 5I23A 4WFGE 3RNQA 2OMTA 3I02B 3WNNA 1AZZC 4JLRA 4NUGL 3NBNA 4WTZA 5L2KD 4WWOA 2R69L 3WFBL 4X7CC 5GIRB 2QSTA 4FLSA 5EU7C 2W1NA 2K0RA 3A67H 4GW1B 5KAQG 1WCBA 2W65A 1U58B 1MFCH 2NY0C 2WLHA 4TULH 2XIBA 2Q9OA 4QRRE 3UGEA 3AGVA 2RA1A 1XEDA 3C08H 4YDIH 4X8CA 4MJIB 2JCWA 3LKRA 1XTMA 3V6ZA 3B2UC 4PB9H 4UQ2B 5EF1A 3FU0A 3MRDB 3HMXL 5DD0H 2EUVA 4RWHA 1NTDA 2XRAH 2XLLA 5BV7H 4UT6A 3QW9A 4PJ9B 5TE4H 3LZQA 2IAMD 2QR0B 4AQOA 3ZTNL 4R3SA 4ZPVB 5EV7A 4YR6B 2KDGA 5INCA 1IM9A 1VCAA 4N2KA 4TQIA 1KFAL 1CGSH 3N41F 3WTVA 1H15B 1GZHC 2J6EA 3OX8B 4AG4L 1B6DA 1ZOXA 2C3XA 4HUKB 4RESB 4JZNA 1IC0A 3ZDYE 2HT3C 5JORA 3NJJA 2Y9RT 4OJFL 4GI9A 1CFQA 1SQ2N 3IWVA 2JQMA 1M53A 4OGYL 4Y16C 1DQDH 1I82A 1RQ5A 4OLYH 3IT8D 4YL9A 1QSFE 1VFOA 3K2UH 5I1EH 5C7XL 1O5PA 1RUAL 3WY4A 3IGAB 1V55B 3LKPA 3QIBC 4FN0A 1GTNA 1YY8B 5A6MA 4EI5D 4GRLB 4QRRD 5EU6A 3OXRA 4ZT1A 3GSNL 3EXJA 4WI3A 5EBWA 3EFOB 1AO7B 3NP3A 4YNYB 3ZGHA 4N26A 2EVIA 1PZ2A 4ZMXA 3HZVA 2NY2D 3DETD 1QLEH 4H4NA 4BK5C 2E46A 4GXUM 2ADIB 1QA9A 4PRHD 1QEXA 2BERA 4K3EL 4IU3A 4K23H 3BRDA 5TK2A 3D2UA 2NR6A 2FO4B 3D18B 5I1KH 5C0JB 3QG7L 5JR1L 4CVUA 3WE1A 4GS7B 5L0QC 4FXGC 1RU9L 4NQSA 1T83A 4PJFB 1Z9NA 3CVCA 1RZIB 2X4UA 4XWGL 5F0JB 2X7LA 1CD9B 4MCZA 5B38B 2CK0L 1QSFD 2KLTA 4QYOA 5I18H 1PYWB 5D2LE 2XWCA 4K5OA 1WIUA 5C09B 3MRJA 2K45A 2KI6A 3PWLB 4PTUB 4RLDA 1RV6X 4UNUA 3PJSB 4LLAA 4NO3A 5A7EA 4K7PL 3N42F 3UTTD 3NQIA 1OZTG 2A6JA 2WZAA 3WUWA 1CB4A 2OSYA 3PQYA 1KCUH 1PMYA 4ERSL 4Q9BA 1HI6B 2DW5A 2OMBA 3G5XB 4RISL 1R24B 5FHAH 1RZJC 4CUCA 4ELMF 3DGGA 4H88L 3T8XA 4LCWD 1KZYA 3VG9C 4QHMB 4HCGA 1LE5A 1KTJA 5GGRB 3RL1A 1L7IH 1UXWB 3QFJE 4OF7A 1TQVA 2J55A 3M17B 1G7PA 3JTSA 4M6MH 2H2SD 5FC9A 3LSOB 3CVHB 4TLKA 2F0CA 3GRWH 5F7WC 1N68A 1NJ9A 4JO8A 2DD8L 4Q0XH 4EXPX 1G7LB 2B1AH 3AG3B 3R18A 5HY9B 4MCYA 3MLSL 3B1UA 4Z3IA 4W81A 3HB3C 3S5ZA 4HS8H 2DWDA 4X50A 1OSEA 1XWVA 2HWZH 5JW3L 2Q6WA 3RTQB 3SGKC 5IMOA 2H1PH 2APBA 4LLUB 1CGTA 2L7JA 3WCYA 4PQXA 1TJXA 2PMZA 3H0TB 2R1XA 4PYGA 3S98A 3DX7A 3WKQA 1CGWA 3GK8L 2G30A 2H32H 3Q8EA 4N2CA 4XP6L 5EA0H 4KZDH 2MPAL 1W72A 4S0HA 2W60B 1T2JA 3DLQR 4NAQA 4O02L 5LNDA 1FL6B 4I3RH 4N85A 4APQD 3LEXA 3V55A 3VFTB 3O3UN 4Y4FB 4WFHD 5AG9A 4QNPE 1QSZA 4HKXA 4HK0B 3VFOB 1QACA 3L3IB 1JN6B 4TNFA 5BZWB 1DVFA 5J06A 3RKPA 1R5IB 1CQYA 1CE6A 3NAAL 2N7BA 3AJ7A 3N0AA 4OGAC 1HNGA 3RGVD 3W9DB 2V0AA 5F9WC 3OZLA 1BEXA 1OCCB 4P23B 5ICYB 4AUUA 2FEEL 4HCIA 3BAEH 1BAFL 4U3SA 5CSBA 1Z9SB 2FEDD 5DMKA 1UWEL 5GGTA 4L18A 1IU1A 3LTVA 3U0WL 4G1MB 4L1HA 3FTZA 3RWHA 1CLOL 3BWAA 1PY0A 5EC1A 2W9DH 4PMEA 2H0PA 2J1ZA 3AACA 4V1DE 4XMWA 2DIBA 5G4MA 3O3EB 3ZRSA 2HZHA 1DJWA 3FRUA 1TF4A 1MHCA 2QQNH 3Q48A 2R29L 4JG1L 3Q1EA 5LQBH 3RWJA 3BZFB 1OTUC 3SCMA 3BLBA 3VFRB 3VSUA 2ZP9A 2FJUB 4ENED 2A1WH 1VFAA 3CK0H 3Q8FA 4HIJA 5DUPH 2X6AA 2HN7B 1NCDH 1TEYA 1AS7A 1B0WA 1HU8A 2LLLA 1EGJL 3KLHD 5GRZA 1MJ8H 1XIWB 1ODAA 1JPGA 3BAKA 4O58H 3V6OE 2D0GA 4GIPD 1F02I 3VGGA 2XG4B 3QUGA 1LM8V 3VXMA 5DK3A 3HAEG 2VDKL 5AKVA 4FLOA 4ATWA 4TM9A 4P4KC 4I8DA 3T4AC 5IG7A 3O41A 4PJ8C 3WU1A 1XH1A 2PPDA 3K91A 4H5SA 3NIFB 1VFBB 4KZCA 2E9WA 2XTJB 3MGTA 1G9NH 2DWEA 3GSVB 4N5EC 4RBPK 1KYFA 5BUGA 5HHPA 5K1JA 1OV8A 4GW4B 3BUYB 4XHJD 3S88H 3BE1L 1A66A 1E8WA 1KXVC 4MD0A 4HEPA 3UDWC 4G3YL 4JFVA 1E90A 3D85D 1BPLB 2XQBH 3J8F7 4KXAA 2XWTB 2BSTB 2FE0A 4OJCA 3RGHA 5DD6A 1KLFA 2ARJA 3MBWA 4NKOA 5CU9A 4CDHA 2FJHB 3P11H 4KTEH 1Y1DA 4PSPA 2BRQA 4P8QA 2JNZA 5JNYB 3FTYA 4OSUH 4LVOC 2D7QA 2ADGB 1DQIA 4I1PA 5DJ8A 5GGSB 1MG2C 2A6DA 4NKDA 5F88A 4UYQA 3PV6B 3W1ZA 3K6IA 4PWGA 1DFXA 1NBZA 4BA8A 3CJJA 1A7PL 3PHQB 1IQDA 5CZXC 4ZUTB 2B2XL 4GXVL 4JPVH 2LE9A 3MGOB 1C1EH 1GZQA 1LO4L 4Y1AE 4PB0H 4XMKL 4GSDH 1E42A 4Y1TA 1W0YT 3KL5A 2R9HC 4P06A 4BH8B 4I4WA 3GLZA 4HIIB 3PIQA 1LP9E 3RJDA 4AQ1C 4GMSH 1SBSH 3R1GL 4X6DE 2HG5A 2V7HA 4P2OA 4DKAA 1I8UA 4OZIA 4LCCC 3FF7A 3MQIA 3V0WL 1EEYB 1DVTA 2VL5B 2DLEA 1NMCC 4KNSA 4GAJL 1NGQL 1N7MH 5HYSB 2HUHA 4U1MB 2DQCH 1H5BA 2OMYA 3J07A 3VD9A 2R2EB 2SODB 1KCBA 3FB8B 4F58L 4R84A 5BQDA 4A2HA 4BZ2A 5F9JB 1Y18B 1CUOA 3L7FB 4FNRA 4LIQE 1D2OA 2WMPB 1CE1L 4QKTA 4YEFA 3ABKB 2A4ZA 4Y9CA 2ZWSA 4M5TA 4APXB 2B1HH 5AVTB 4JFWA 3BCDA 3CGTA 3VXSE 3S5LA 3O3BA 2F61A 2AQ1A 3TZVA 3BAYA 2X4PB 4UNIA 3UYPA 1KN4L 1OALA 5E1HB 4PUBH 3LX9A 4KJPC 3LZRA 3BH8A 3RVXC 5CCKL 1H8OA 1M9WA 3NDYE 2CPUA 3U9PL 3STBA 3ZDXE 3CDZB 4A7UA 1DSFL 1NKGA 1KN2H 1M05B 1OWRM 1NLBH 4N1HB 4WWPA 3RI5F 3T04D 2IPUG 5GGQH 3FK3A 5E8NA 2R1WA 5LWYH 3WJMB 3KYKH 3IXAA 3DX0A 5DEGA 3CVHH 5J6GA 4N4YB 2FECI 4QT5B 1OP5K 4NUGH 1NC4A 5IZ7A 1S9XB 1FYTB 5A40E 1DQML 3IFOA 2EDKA 5IGXH 4N6RA 1M6OB 1CG9B 2QGDA 3LRHA 4A7TA 1R3HA 4NQDE 2GW5A 3LN4A 4O2CA 2V37A 4N90D 4QXTB 1OAJA 2ESVA 3NIFF 4QJ3B 2Y6SD 2LFEA 1ZDQA 3VXSD 4NFDA 4XH2A 3WD5H 1TQCC 1V7NH 5DZPA 3HMXH 2GFBB 2F19L 4HXBL 3FQ1A 5A6LA 3G6DL 2EXTA 5JOEA 1FHNA 3S6CA 5C0BA 3N0PB 5ESAB 2X2UA 3WXVL 4WHTB 4B7IA 5A2LH 5JDJA 1NAMA 1SMDA 2C3HA 5JW5A 4KJYB 5C08B 1HEJC 5B7EA 4UT9A 2VC2L 1DBAL 2XV6B 1OVZA 5E00B 1KIRA 4JFXA 2CKBL 4OZFG 4DSYA 4NQXB 1Y07A 4KNQA 4NJ9L 1WZAA 2RBLA 1YYML 1KJVA 4JRYB 1Q9KA 4Y5YB 2QJDA 1IGMH 3TYFA 4JGNA 3EJZC 1ZY9A 4KNUA 4PJDB 4TUKH 3MRRA 1U8JB 1Z3RA 3FXIC 1P2CA 3X3GL 3PG2A 4R7NB 5AG8A 4JM2B 1QPPA 4RWYH 4HK3J 1XGYH 3GIZH 3TWCL 2AERT 4IHOB 3NIGE 2C9AA 1IJNA 3SKMB 5DQJA 1TKWB 3CZUB 1AH1A 1IBYA 4XPBH 3C5SB 4ZFZB 1X5IA 4YXKL 4QRUA 4HPOL 4MDRA 2XA3A 3THML 3EKCA 4JPIB 1WF5A 2RFXB 1MPAL 1DTUA 2YK1H 1G1OA 5D2NE 3W5NA 4N6QA 1GCYA 3UTQA 1WITA 1HZLA 5K59F 5AD0B 1DJIA 3KW8A 4FKKA 2FX7L 5GSRA 3H3PH 3HHMA 4EI6B 5FECA 2X4QA 3T0WA 4JKNA 3GKWL 4EN3C 2Z92A 1ES0B 2Y07H 3O6FC 1FN4B 4HJ1A 5FUCE 1U3YA 2BHFA 4HJIA 1LO2H 5LXGH 1INDH 4ZMVA 1XGRB 1CICA 5F44A 4LOVA 2YPKB 5FK9B 1A7OL 1RULL 1SJEB 3MBXL 4CW1A 1XTLA 3ATAA 3ATEA 5J56B 4HJEA 3OKEA 5E94A 2J71A 1F5WA 2CPCA 5I82A 2NSXA 1A7NH 3GTNA 2V5TA 1AP2A 3BP4A 3RNKB 3DTUB 1BQUA 4X6CE 2O1AA 3V6OC 3DIDA 4HJJH 2GSGB 4LPYA 3C8DA 1V10A 4LEXH 3CUPB 3P1VA 4YGAB 3ATBA 3LKQB 3MRQB 3U9WA 4J3VA 2OMVA 2X6VA 1D5XA 3LY6A 4K3GA 4J3SA 4WW2C 4YHPA 1ID2A 3N04A 3P9LB 1IFHH 3ZVVA 1S5HB 2QL1A 2CGRH 1MCSA 5C07A 3TEWA 4HCFA 1D7CA 3FQWA 2D31B 3CFCH 3WV0A 1CO1A 1UYWH 4MSWA 1EJ8A 1ZLWH 3IMVA 4EOWL 4DP7X 4HVBA 1HSAB 2EH8H 2I9TA 3UYRH 1J8SA 4OI9A 2LHAA 4TNWF 1A3ZA 2DJ4A 1D5IH 4D9LL 2EEDA 3HUJE 2F54E 1SDYA 4GG6F 4WW1A 3SODB 3T6VA 4TVSa 4LF3B 3S34H 3ZY7A 3WSQL 1MDAA 4JG0L 1S7SB 3BXNA 2BNQE 3TBTB 4QXUH 1WFIA 4GQZA 3L6FB 1BM3H 3MNDA 1Z9LA 2H8PB 5G55A 1AZCA 4IGBD 2VR7A 2JIXB 3GHBL 4D3CL 4ZNEE 5ANMB 3CIAA 2XZQL 3II3A 2OULB 3TO4B 1QLFB 3BUTA 4PJ5D 4AIEA 4H20L 1T03H 4WU7A 4GBXC 3VJ6B 5IHHA 1O6VA 1FPTH 2TSBA 5IVNA 3NRPA 1WIOA 2BX5A 3ZZQA 5T33H 5CEZH 4OZHB 1AI1H 4PJDF 3FO1B 3MMEB 4Z7IA 3QDJE 4OZGF 3BAJA 3QNXB 5CD3A 5HHQA 4JM2F 3SDCC 2CU9A 3OKMB 3LRSA 1MNUL 3BVNA 1NBYB 2AK4E 3T71A 1KG0B 5ILTH 4Q2ZB 4ZFOA 5I6XB 4GSQA 2QEJA 1ZT4B 2F54D 1FH2A 4PJCA 5MENB 3WFCL 5AB9A 4XO8A 1T20A 5D6CB 5E95B 1O6SB 1VESA 5ABAA 3GXNA 4PVNA 5BUPA 2BNQD 2VR6A 3DTDA 2BHZA 1IKOP 1ED3B 4CSZA 4XPAL 5SX5K 1A22B 1NICA 2X6BA 1H3WM 2FZ3B 5ID0B 1IM3D 2ZKHH 1OPGL 1EBAA 3H42H 4N0CC 4ODVH 5FYJL 2VN4A 4QTIH 4Z7UB 2KBGA 4D7PA 1AHWC 1BOGB 2A9AA 4DT2A 4HUXB 1JGEB 3UTOA 2CE6A 2CIIB 2YPLD 3L3HA 5DHEA 3CQFA 1WE5A 4FMFA 3LVEA 4FJ6A 3LNGA 5BZZA 1LHZA 2R83A 1JPST 4OD3H 4WZ9A 5AW4B 4PJIE 5DO8A 5AKSA 4FC3E 2YAMA 3NMEA 1ESOA 5BUAA 5FA4A 3B43A 5CR8A 4B27A 4KWUA 1C8QA 5D6DC 4DPRA 5JPMA 3TIDB 3FCBA 3HE6D 1J0YA 3WLBB 4ZW3A 1JHTB 4M5ZH 2WUBL 2PCFA 5E1QA 4JRXD 3QIWC 5GJTH 3IKCB 5KSUB 5EZOL 3RE0A 1MNNA 5DTFA 4JFZL 5TH2B 1D5BA 2O72A 4IRZH 5MHSD 1HSBA 2D3NA 2TSAA 3FSZA 3GI8L 5GRYA 1FL3B 2UUDH 1G9EA 3VA6A 4JMXA 3IDMA 5IQ7H 4UU9A 3VQ2C 2VZ1A 1AQDA 1HL9A 2UZPA 2OMTB 3RNQB 4ALAH 4ATTA 1IAMA 1HN1A 5DUMH 3I9GH 4JRFA 4JLRB 4JKPH 3MLXH 3BSZH 1EXUA 2YRZA 4UQAA 5F8QC 2YGNA 3BWUF 4MAZA 3UERA 5B1KA 1ACYL 3TTSA 5IJBC 1WCBB 2YGOA 1F41A 4HUNB 4MQ7A 5DZJA 5SV4A 5EU5A 1G7IA 4F24A 4Z8FH 4AT6A 1P53A 4XVJH 7FABL 1PD0A 1EANA 4F57L 1AYRA 1UENA 2Y06H 3LKRB 3EH1A 3DJZA 4U1KB 1G4MA 2YUZA 4ZX3A 5CBAA 3VRJB 3VFGH 4NM4H 4BQCA 3ZMRA 3QR0A 4PGZA 3TCTA 2YA0A 4R3SB 4IBZA 4L1SA 1FNSH 1KNOA 5E8PA 4AKQA 5INCB 1RZFH 4L9DA 1IM9B 4JM0A 1ETZA 1PCSA 4BFKA 4HH8A 4XCEA 3BVXA 3MV9D 1E6JL 2X09A 2PUQT 1QG3A 1RAMA 4LGPB 2FECL 2DI7A 2P80A 3UAJA 1DQLH 4JZNB 3M1BA 4LCIH 3ZL4H 3E6HA 5JMRA 3GTVA 4MD4A 2Q86A 5IROC 3T1WA 3UG4A 4XC1L 1UWFA 1AG0A 4KRPB 1W0WB 3DV6A 4NRYB 2OL3B 2O6CA 5JIIA 2NYYD 1MREH 1NIAA 3C60D 1FLTX 1GS7A 3H2PA 4UTCA 3ZYZA 4ELME 1PSKL 4WI0A 5D71L 5CFAA 1PLGH 3GGWA 4M7ZC 3LKPB 5LBSL 5AOIA 4W9LC 5D2NC 3DJ9A 3W2DL 3BQUA 1IQWL 2CDEA 2GI7A 2KZBA 3CZJA 1QRNA 3GSUA 5F93C 5EU6B 1MCWM 3RVVC 1KTKE 1G9MC 4O2FA 5EBWB 1MRFL 1FFQA 3EJUA 4YSSA 5HD8C 3FMGH 5FUZH 4PBDA 3OAYK 4PS7A 1D9KB 1JI1A 3HZVB 4XN4A 4NWUL 5IBUG 1WV7T 2Z31C 5FUCC 5IT2H 4ZAKA 1LE9A 1QA9B 4F37K 1JZHA 4MJIE 3BEWA 3AS3A 1FRGH 1R17A 2AXFA 3D7PA 4IU3B 4OM1H 3CC5A 3D2UB 3KYNB 3U2IA 2J43A 1R5VA 1L7TH 1NEZG 1T2QL 2GY7B 4PBVC 1RZ7H 1UGKA 5E0FA 5L2JA 2HTLD 2HP4A 3GSNA 5IJVA 3DUUA 2C7UA 3T6QC 1KN4H 4TNGA 1EUUA 4M1DL 4LDLB 4F2MB 3X3FL 4NQSB 4JNXA 1WFOA 4QCIA 1SHWA 2X4UB 4FI8A 4LPVA 3VD0A 2EZ0C 1H19A 1WYJA 3QRFM 2X7LB 2Y2YA 3AY4A 4HKBB 1GXEA 5ECJE 2ZUUA 1H6FA 2NXYD 3UC0H 3QPQD 3VNYA 1JNLH 4MQTB 4OIIH 2CHZA 1I9JL 2EQDA 2VM3A 3TH2T 4YHOH 3MVSA 2H5UA 4X2UA 1EMTL 4D7BA 5D4QA 2A6JB 4FOMA 4U7KA 4TN9A 2WWOA 1FZJA 1SYVA 4XNYL 3VQMA 4AYDC 1I7TA 3HNTH 3VI4A 2D2CC 5BO1H 4FA6A 4K5LA 1EJOH 5L9DH 1AO7E 1R5WB 4LEOA 4BGDA 4MJID 3ARGD 2PF6A 3DGGB 5T1LA 2WQWA 2VJ0A 1G5GA 2I9LA 4OD1L 5HI5C 2NDGA 2ZOLA 1LE5B 2KHAA 4FQQA 2IO5A 2J1XA 3RL1B 2E75C 4PJBF 2UZIL 1GGYA 3S37H 3ZO9A 4PJ9D 5D7LA 3DSFL 4LB8A 1VFMA 1G7PB 4F92B 4H26B 5L88L 3GF8A 3MRCB 3VCLA 4HKZB 4G8FA 3I85A 1EAQA 1JGUH 3QJRB 3FCUB 2PR4L 3RPBA 8PAZA 1NJ9B 4HIHA 5F1NA 2DBJA 3I3DA 2BP8A 1TJIL 1LNUA 2YAFA 3KDPB 3X14B 4GQQA 4N2DA 4I77H 3VD5A 3EG9A 5FIEA 2J6WA 1Y0LA 2WLYA 1BQHA 1J88A 2DWDB 3C2SA 2R56L 2Q6WB 3ARFA 1AZNA 4EUPA 2A77H 3T2NH 3VU2A 1IZKA 1BG9A 4OB5H 3FT0A 3PPEA 5TGBA 2BNRA 1E5ZA 2R1XB 3DX7B 4AGLA 5C09E 2Y1YA 4JRLA 1CDYA 2LU5A 5BRZA 5ECGA 1FBIH 5BS0D 1IMHC 3TJPA 1YEJL 4GRLD 1RUKL 3D4YA 3EHBB 3VWJC 4UQIM 5KBLA 1L6ZA 1W72B 1F11A 4OJAA 2WCPA 4J2QA 4DAGH 1BQKA 1M7DB 3CZEA 1YN7A 4P5TA 4A7SA 2PO6A 5DDHA 2M1KA 3SB3A 3Q8CA 1HXKA 5D1XC 5JIHA 2LV4A 4ORGB 5CEXA 5IJDC 5J1AB 2A4EA 2YLKA 5JZ7C 3N9GH 1DVFB 2NW2A 4Z7OB 4MHHI 4IU2A 1CE6B 2DQTL 4NSKA 3UO1H 3MZTA 4GI6A 4F33A 3WTTA 5KSVB 3KWUA 4C58B 3KZ8A 2W59A 2EIEA 3FO2B 2D4FA 2WUCL 5DMKB 2UZXA 2BVOA 2NY4B 3V5HA 3F7VA 1LD9B 5DJDA 2MOGA 4FL4C 5DSCB 2APSA 2MCPL 4FTDA 3BWAB 3RWHB 1MW1A 1HEHC 4J3BA 3WKNA 3WN6A 3NSDA 1XF1A 2GUYA 1MHCB 4NCC2 5C09D 2AVGA 4DP0X 1HJBC 1YPZF 1FSKC 5A2AA 2Z91B 4HT1H 3RWJB 3SCMB 4IEFA 2XTLA 1NINA 3A22A 3LEVL 3ZX1A 2X6CA 1VFAB 1X7SA 1IC4H 3PHAA 4XVTH 4I3SL 4M1GL 4JFDA 4NQVA 2I7OA 2MQ3A 5FW8A 3TVMC 3ULVC 1RZKL 1GL4B 2OYLA 1FNAA 1JPEA 1CURA 3MBEC 1P4IL 3C5ZA 2IXQA 1QVOA 2MOVA 3OQRA 1PZSA 1JXKA 1QFWM 4Y19B 4ZXBA 2ERJC 2Y1AA 2HVBA 2R29A 1LK3L 3RDTD 1QATA 3VXMB 1U4EA 3UGUA 2LU7A 3L9RA 3H3KA 3U2SB 4LRIA 3OKKA 1YEDA 2OZ4L 4EPSA 3DRTA 4DKDC 4A04A 5IG7B 3O41B 2CIKA 4FEMA 1ZT1A 4WIQA 4UT6H 1EGJA 3S37X 5IW6A 2DWEB 4Z3GA 3IU4H 4Z3TA 5FM8A 2Y7NA 1PZ3A 2FEJA 5EBMA 3V79C 2KDYA 4PD4J 5I6LA 3V4UH 2BSRA 2DDQL 3QXDA 4MD0B 2WXRA 4R90L 4WI8A 5FX3A 5EC2B 1XBDA 1U8NB 1AR2A 1MY7A 3H2WA 3PREA 5DD6B 3PWUA 1KLFB 1WZKA 2ARJB 1L9MA 3MBWB 3RVWD 2EDYA 3TL5A 4DEUA 4G6JH 3CFIC 3HIZA 2OL3H 5EIVA 2ZUVA 4NKQB 3L5WA 4UT7H 5EEUA 3BPCB 4LCVA 3RWGB 5J89A 4JM4H 5E2WL 5KWYC 2VR4A 1F00I 4Z7WA 3HHSA 3ZO0A 1AHMA 2C3GA 3FPXA 4NKDB 5F88B 5I66A 3FYIB 4Y4FD 4IBUA 1IQDB 3EZJB 2BWIA 2V7NA 5AUMB 3VI3F 1GRWA 1KJ3L 4ELKB 2I07A 3DK0A 1GZQB 2R39A 3KBFA 3BP5A 4YXLL 1RL1A 4KMTL 3ZR5A 5J3HC 2VMEA 1WFNA 4I4WB 4Y7MA 4DUXA 1RP8A 3SOBH 3UJJH 5B38G 4P23D 5IQOA 1Q9WA 1T22B 1D5ZA 3KPNA 3PWJA 4MXWL 4KKCC 4OGXH 1KWGA 1P84J 2HG5B 3O2WH 3NIFE 3EBGA 2XTJE 4XZ4A 4PWIA 3KS0J 4UUJA 3ZBMA 4F91B 3MLYL 1WAAA 2HFEB 4DZBA 4XVUD 3BGFC 1HX0A 2FQFA 1A64A 3GBDA 1CGUA 3W56A 4WY7L 2OMYB 5FYJH 4YDVB 4G71B 4J3OF 5ABZA 1MCRA 5K9OA 3H9ZA 4C83A 3QZLA 1KCSH 1WVZA 2MQCA 3CN0A 2J44A 3D34A 4KU1A 4XMVA 3UROR 2EUWA 2OSLB 1A7RH 1NCBL 3WO3B 5IFHH 3GBML 5E1GA 4QI3A 4LDEB 4YX2L 1TTBA 3S5LB 1QPKA 1XIWD 1I8KB 3UYPB 2V6HA 5ACLA 2BZDA 1K72A 1S9WA 5AFAA 2MCAA 2N01B 3V52L 4Q52A 1F4WL 4IYKA 1FQ9C 1DJZA 1OSZA 4A7VA 2ZP0T 4K8RL 1AHKA 2JB5L 1E30A 4WEBH 2O5XL 5DR5H 8FABA 5I5JA 3GZOA 2G75A 1TNNA 1JFQL 2RTTA 4K9JA 3V9FA 2VNCA 5E8NB 1QUNB 3ARPA 4G1EA 1BFVH 5DEGB 3IXAB 2EVGA 1E4WH 1DN0A 1NC4B 1X7QA 4E9VA 4N0YH 4XPFH 3SPHA 1YDPB 3QISA 3C6LD 3HPJB 2OMZA 3IFOB 4N6RB 2WVSA 1AQKL 3DUHA 4U1SA 4NC2B 3ZU8A 3RIKA 4AX3A 3O8XA 1R3HB 3D07A 5CEZE 1AGDA 3LN4B 4BWWA 1GS6X 3NCMA 4DKEL 1YZZA 4JREB 3RKDD 4UOW1 2DPKA 5CZKA 1CN4A 4FJZA 3IJEA 4GS7C 5B39A 5I73C 3NJGA 2X5PA 4J8QA 2EUXA 5AB0A 1JPSH 1JXDA 2EO7A 5C0RL 3N44B 5KSAC 2PKDA 5C0BB 1OQOA 1W72H 3DNKA 1XCWA 4LFHG 4OVUA 3ULUC 4HXAL 3BDXA 1NAMB 3PXJA 4F15C 5JW5B 5A2KH 3IMRA 1HHKA 1AR1D 4GXUN 4DO4A 4YDLC 5JHLL 3PNWA 4FCHA 5L6YL 4IOFC 4UZSA 3WEBA 3DX8B 4XC1H 4K7FA 4BUHA 5JOPE 1KJVB 4HJUA 1YVLA 3PGDA 2PPAA 2PXYA 2ZOTA 4J3OH 4WI9A 5DD5H 5ADPH 1X9LA 4XAWH 1BF8A 1TTUA 4UQ3B 4XN9A 1FJ1A 2GK0A 3UL4A 3A6CH 2GTWB 5GS0H 1C5BH 5GGTH 1CLCA 1O7DE 3RY6A 3NPSB 5CEZD 1I8LA 4YOKA 4M6OH 1FYTE 5DQJB 2CKBA 5F7BA 3VWKC 1MUJA 1ZLSH 1IKFH 2IVFC 4NZDA 4QRUB 4YSAA 4CL7A 1YYLH 3MNMA 4UI2A 3ZHFA 1XSIA 2X9XA 3FFDA 4AH2A 4KK6D 3CSGA 3S8FB 4HH9A 1KGIA 2HJLA 4B3EA 3BLKA 1N8ZA 4LLQA 2AJXH 2JSFA 3QUXC 4P57A 2OJZL 4U31A 4W93A 5FECB 2X4QB 1SQMA 3D2TA 3PABB 5CCGE 4FFZL 2AJSL 2VDNB 2P9RA 4JN1L 2Z92B 4KI1A 2WCGA 2VR8A 5HJBA 4JQVC 3RTQC 2D4DA 5K9QI 4WWNA 3JQOB 1CICB 4L3FA 5DVLA 1N6VA 5JOPD 2HFTA 5C08E 2WZPD 3GMRB 5IFAL 3L4YA 5D1ZA 2UY6A 4K7PY 1G7HA 4U0QB 4CW1B 1NBVL 4P49A 5E94B 5FYKH 3PJLA 3QC5X 2Y7QA 3BVDB 1KELH 4JRYE 3POCA 1UATA 5C9KA 4PJDE 5FWRA 3WOVA 1VZGA 1FYTD 4R7DA 2B0SL 1PF3A 4P0DA 5FDWB 1AMYA 1L6PA 1UC6A 4YDKH 4W9KC 3LRMA 1D5XB 1OCWH 3FQ4A 4NENA 1TETH 4MJ6A 3L81A 4YHPB 2VSMB 1NCNA 1M7IA 4XNDA 3QGVA 3KR3L 4NPJA 4PSRA 2F8IA 3E2HC 1WP6A 4DUVA 2B3RA 1OT1A 3MROB 4AC4A 4XP4H 5ICXA 5MEOA 2EXYC 5IR1A 2FBJL 3Q6GH 1ZHBA 4N0UA 1NCCL 2FO1A 4PWKA 4MSWB 3K74B 3QCTL 4NQEA 2PYEA 3AU1A 4O9HH 4EZKA 2I9TB 5B1BB 2VT0A 3LS5L 3NEOA 2P49B 2J5WA 4FQXD 2DEXX 5C08D 4BUGA 2Z7YA 4YSUA 2HX8A 2F15A 4BFIA 3T0AA 5D7IB 3V7AG 1SMOA 2TRYA 3W0WA 1NWOA 1C08A 2YGQA 3ETBF 4WW1B 3FBQA 1UWGL 3RWFA 3HHRB 3L2LA 2BSDA 1UACH 4LSQH 5CGMA 5HYSG 1AFVH 5HDWA 1PBYA 4A7GF 5E2TL 4FA7B 3MCKB 2BIQA 4UDTB 2I32A 4AITA 3MOAH 4UV7H 4XR8C 2FBRA 3J7HA 4JM2D 4LHUA 1T0NB 3QUYA 3GINA 1NLDH 1XGQA 4KBPA 5B8CA 1J8HA 4V2BA 3RZCD 2HFGH 4NDMB 3W3BA 3K0WA 3ZPDA 2J4WH 4WU7B 1WTLA 3S2CA 4ODHH 2VDOB 1X9UA 3GHEL 4GYBA 1BECA 2KLSA 1C16A 5F7FA 2EDRA 4ZX6A 4HWEL 3TPKA 2HT2D 4XN8A 4R97C 3ZT7A 3D5OF 3TO2B 4W9IC 4BZ2H 5CD3B 5HHQB 4ESKA 3E80A 3OJDA 1EAOA 4NZTH 1HZHH 1A4KA 1YUHB 2WINA 1KY6A 1XSJA 1VPOH 2KH2B 3M6DA 2AXJA 4L48A 5H2BB 3LRSB 4BD4A 4FADA 5L8LB 1VACB 3BVNB 4ANXA 5J13B 4KKZA 4LK4A 1N3NA 1R47A 1F3DJ 3PGFH 1HESA 4BFBD 5FB8A 3QEQA 4PJCB 1IAII 1T20B 2H1LM 3X1GA 2DM7A 3A4FA 5MP6L 3ZYJA 4FQIL 4PV8A 4PRAA 1VJSA 4LLMA 1U8LA 4WTXA 3FN9A 4NXSA 4G7QB 1MFVA 1RVFL 1DQQA 4P5KA 1JD9A 1L9OA 3ZR6A 4AGMA 1GAFL 3WXWH 4H8WL 4QF1B 5FCUH 4X7SL 5M95B 3OKNA 3X17A 4M3JA 1XL4A 3PP4H 5HGDA 3L3HB 3H7LA 4LQFL 3ILDA 1XZWA 1F18A 1FDLH 2NXZC 5DS2A 3UEZA 2BCKA 3NCJH 4HUUA 5ANME 2HX7A 3EYSL 5CJQH 3SYQA 5FA4B 1F1DA 3GLAA 2NLJA 1ECZA 2WBJD 5JPMB 2X89A 1IC5H 3EJYD 5DQDL 3V4PL 2PCFB 4NKMA 3OPZL 4FI7A 4OZHE 3ZLQC 5CD5C 1LL1A 5SV3A 1N12A 4BFOA 4MXQD 2OZ4H 4NP9A 2HRHA 1D5BB 5DZOA 4N2OA 1BD2D 5J5EA 4KY2A 15C8L 1LQSR 2FAUA 1HSBB 4G9FA 4JPQA 5IMMB 2ZCZA 3K5RA 4QO1A 4UU9B 3VE0B 3MUGA 4N87A 1AQDB 4QRPB 2M8XA 4TTDC 3F85A 2ZCKH 3HG1B 3TGXA 5MENE 4KO7A 1NAMH 3L5XH 5CUSH 1FF5A 5DYFA 1URZA 2KC0A 1EXUB 4L8DA 1F3RB 4JY4B 4X8JA 4K9EH 2DV6A 1HHIB 5EU5B 1G7IB 4MDJB 2EINB 2JIXD 3GXFA 4AT6B 4EZLA 5GRUH 3CHPA 4M43L 4Z7UE 1TQUA 1RUMH 1A1MA 3BPLC 3DMMA 3UTZA 3H9SA 5D7IF 4BDVA 4ADJA 3QJFA 1MFEL 3CAFA 5CBAB 1CU4H 3LIZA 4A55A 5LHDA 3VYNA 3PWVA 4P9HL 5A16A 4DHLA 1JDDA 3M7OA 4ODSL 2C1OA 4HOMA 1S9YA 1TTGA 4LAQH 1JWMA 5E8PB 1IO4C 3AWEA 3REVA 4N8UA 2Y7SA 2ILLA 4HALA 2FT6A 5F9DC 3VYOA 4PGBA 4F7CA 4GSUA 1JGLL 5CBEA 4ZUSA 2WYHA 1MIEH 4LSTL 3M1BB 4XNMB 1S3KH 4ZO7A 1QBBA 4MD4B 2IFGA 1HINL 2EDTA 4JB9H 1OSPH 3BMWA 2IH3B 3GJFB 5EDSA 4E9YA 3DV6B 2FRGP 1EHAA 5CP3A 2VDNH 2Y3NA 3ZT6A 4GUQA 4WI0B 5BRQA 5I8KH 5D4JA 2GT9A 5JIPA 4FZ8H 2KPNA 1KJMA 3BQUB 3NOIA 2CDEB 3A0OA 4PBWD 4QLWA 1BXVA 3OWEA 3GSUB 1J05B 1QRNB 4WU5B 3WTXA 3SHSA 4L3ED 3LHPH 2QSQA 1U8IA 4O2FB 4WY7H 4ETYA 3HE7B 4F7MA 5C0EA 9CGTA 5LGJA 5D5MA 5ERWA 1YC8A 1XL6A 5EIQA 1H6TA 3RWIB 2R7EA 1QBLL 2HA1A 3IBEA 1KXTA 1NBQA 4AIZA 1UB6A 4ZAKB 1CYWA 1GHFH 3TX4A 5DI8A 3BEWB 1RFDL 2X6MA 4MQXC 1BZQK 1NH6A 2AXFB 5HDBB 1SEQH 5LBSA 3VD3A 3CC5B 1R5VB 1FE8H 5I15H 3SD5A 3HZ3A 5BZDB 2I5YH 5L2JB 5IVXA 1I8MA 5SWZB 2AC0A 3DUUB 2C7UB 4XN5A 3ETSA 1DLHA 2FX8L 2GSMB 3AUVA 3QJSB 1ECYA 1GGUA 5DMYA 1XCTB 4QCIB 1OP9A 1WFUA 2FWOA 3H53A 1CJYA 1JV2A 3IEAA 3VMOA 3FJTA 3ECBB 5K1VA 3BWZA 5EBGA 1KBWA 2GTQA 5DVMA 3ARUA 3B2DC 4UWQB 1UH3A 1B9ZA 4OTXL 3QWOA 1T0MB 1M56B 3L9EA 2ENPA 4BIKA 2WJ5A 1GZHA 1F4AA 1XSOA 2WP3T 4JO3L 4GAGL 5C0DA 1BZEA 3FT3A 3GTTA 2MKWA 4HCRH 4XP9H 4FXLA 4KVPA 2IADA 5DA4A 4HW6A 1FZJB 4HEMA 4KI5F 4RGNB 3MKGA 4WAFA 1I7TB 1A8ZA 3VI4B 5JO5A 2V2TB 5EU6E 1G0XA 1CDCA 1F4XL 3JV0A 1P5UC 4CGTA 3X11A 4PP2A 1CPUA 3M1CA 4LEOB 4OFKA 1MCEA 1QTPA 3BKJL 1RERA 4M48H 5T1LB 1JK8A 2VN5A 5CEYA 3WGUB 4PVMA 4WO4D 2K3HA 2ZOLB 43CAA 5C0GB 4YE4L 4U1IB 3UOAB 4JCLA 1UT1A 5TJWK 1E7UA 1F6AA 4NN7B 2DWSA 4XVSH 2VDQL 1ZV2A 5GJSH 3VCLB 4G8FB 4XE5B 4GG8A 4MGXA 2VDOH 3NTCH 2E7HA 4NNPL 5JIQA 2MTPA 2HRPH 1HYRC 5ANHA 4HIHB 1XV8A 1DL7L 1KYDA 2CRIA 1ILSA 1KGYE 2OM5A 2BP8B 3EGSA 1GSMA 4LL4A 1LNUB 5F1NB 2WZ0A 4F2ME 1FLRL 2R4RH 3MOBL 3QO0A 3EG9B 4FG2A 3TF4A 4YSOA 1Y0LB 4FXTA 2Y24A 4F2FA 4KKNA 4NZFA 5AVQB 5KTEH 2AV1A 3CFJB 4EUPB 1L0QA 3ARFB 4P46D 2G3ZA 4QTHA 2ZUTA 3EO9H 4MRCA 1J12A 2LU4A 4W70A 3S96A 5TGBB 4NBYB 3FZUD 2BNRB 3NSJA 1Q90A 3F6JA 4JO1L 4ZX5A 5BRZB 2X9WA 3MSPA 5BQ7A 2E56A 5HHNA 1F11B 2G2NA 1IGIH 5IMLA 1IFRA 2CA3A 4DUWA 4OIFA 4G8GE 1D9KD 1YN7B 4YHNA 2J73A 1MZYA 2FH8A 2VTFA 5CEXB 3QHZL 1BQSA 1ZV5A 2CJUL 4PV9A 1NM4A 2NMSA 5FM5O 5DC0A 1CDJA 2NW2B 2OJZH 2ZYSA 1GY1A 3NFSL 3QQ4A 4M4RB 3ZTCC 3KLDA 2XPZA 4JN1H 25C8L 3SE8H 3ULAB 3ILQD 2VERA 2TAAA 2VLMD 4B97A 1UEYA 2UZXB 2BVOB 3GC3A 4B95C 3B5TA 4DK5A 2X0VA 3QIUC 5IHZA 2AVFA 2YMTA 5FYJD 4WTZG 1NL0L 1IGYA 2C9SA 5DFAA 2YJLA 5HDBF 3O0LA 3OLEA 3PHSA 1MW0A 4R96A 3TO4C 1KIPA 2Q8AH 1OTTD 3B2VL 4X99B 2H2SC 3C8HA 3U6RA 4AJ0A 4PRIA 1MCJA 2EVHA 1JCVA 2DJUA 3SE3C 3QJVB 4M7JL 3CMOL 4IEFB 3P54A 3WJJC 1K3IA 5IIEB 3AMLA 2RR3A 3ALXA 4JFDB 3V5KA 3BUBA 1ASOA 4G8GD 4B9GA 4Z7VF 1WFMA 4KROB 4P2AA 2IXQB 1QVOB 4RVBA 4TXVB 5E7FA 4TL4A 1YMMD 4N8VA 5ICUA 2YOCA 4ZUUB 3MV7A 3VAEA 3P3RA 2RQEA 3OC8A 5IVOA 1IAIL 5J6HB 3NA9H 3LVTA 5E2UH 2HFFA 3OKKB 1YEDB 4OLUH 2YZ1A 5D8JL 1UZ8B 3Q9PA 1IB5A 4I0CC 1GW6A 3RU8H 3DRTB 4Z7OE 3F7RA 5A43C 3PAUA 1F45A 1G6RA 3MFGB 2E5EA 1HT6A 2CIKB 2FSEA 3IDUA 4WUUB 4HMDA 4WSJA 4APQC 1BVNT 2MH4A 4ODXA 5IW6B 1HS6A 4HBQA 3VQLA 4ANUA 5DLLA 4UTBA 3QXDB 4XCCL 1OAYL 1ZTXL 1A9BA 2P8LA 4Q97A 3TJEL 2DQHL 1GGCL 5GZOA 5KVDH 4XMZA 1B4RA 5F1OB 3PWUB 2DYPB 3CCHA 3LDBB 4D9RE 3GJFH 2FEDC 1PFOA 4HGWB 2P7TA 1ZA6B 5J6SA 3O2DL 4MMYB 3EHBD 3ARDD 5FUOH 3L5WB 1N0LA 1ICTA 2IDSA 2ZG1A 3P30H 4H0HB 1ZLUK 4EBQL 2ATKA 2HLEB 2IQAA 5E4EB 3G6JB 3D0LB 3LKOB 4Z7WB 3GHEH 3HHSB 3V8CA 2J21A 1KLGA 2O61A 2R0KL 1KXQE 3UADA 2V7NB 5DURD 2O6FA 1B0RA 4Y19E 4ENEC 2ZKWA 4P9ML 1NUNB 2I07B 3PFUA 3U48A 3SO3C 2AP2A 3BP5B 3AITA 4NQCA 2OYMA 1TCMA 1RZ8A 2A0LD 2E7LA 4J3OD 1ZRUA 1KPUA 3FUKA 5FYKE 4OIBA 4F5CE 5EO0B 2VERN 2QDVA 1Q9WB 2NY1D 1T7VA 4N0FA 5GS0D 1J0HA 2NY4D 2F6AA 4QHLA 3ZQXA 1EFXB 2Z8RA 3QYCA 4UUJB 4Y88A 4XOEA 1TZHB 5CN2A 3TV3L 1T04A 2XKNA 3WUWG 3CHXA 1H3PH 4D9RD 2VXVH 1RVFH 1OCOB 4Y89A 4KH2A 4UILL 4L29A 5E9DA 2W0LA 2O6EA 5ADOH 1QWNA 2XA8L 4C83B 4LZKA 4UQ9A 1LILA 5IKCA 4HAGA 3FC8A 4LLVA 2W38A 1WA0X 3SBRA 4DVRH 3GS0A 3RHWK 3AWFA 3NCCB 1KYOJ 2EJ1A 5KN5A 4TPRL 1G1KA 1U8HA 3AC0A 4L4VA 2R27A 3UZEC 1WTGT 5MERB 1ZJAA 3A24A 1LDSA 4Y19D 1CIUA 1S9WB 2ORBH 1OGTB 4KZ0A 1IVLA 4ZO9A 5F7DB 3AT9A 2UXTA 4U33A 1A7QL 3RLSA 2DRUA 5FYKD 1OF2A 2AW2A 2LOEA 4XNZB 1OSZB 1F58H 1MI5A 1PNCA 1VADA 2FB4H 2F5BH 3QFDB 1U3JA 4J4PD 3S3PA 2XXGA 3K2KA 4NFBA 2G3NA 1GH7A 2G75B 4QR7A 5DC9B 4PHZA 4ZS6D 4PEEA 3ECVA 3FQ2A 4GXFA 2BSCA 3CZLA 5GISL 3MUUA 3RTLA 5HI4D 1EHXA 5CIPA 3ZKNC 4I2XA 4HJGB 3B9AA 1DN0B 1T89A 1X7QB 1HVXA 2A74C 5LAPA 5B3SB 4PGJA 5FYLL 2Z8VC 2OMZB 1TTCA 4U1SB 1SM3L 4HSCX 4RSYA 1XZ0A 1AGDB 2F53A