The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
46
|
sequence length |
279
|
structure length |
279
|
Chain Sequence |
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRNTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural basis of tropism of Escherichia coli to the bladder during urinary tract infection.
pubmed doi rcsb |
source organism |
Escherichia coli
|
molecule tags |
Chaperone/cell adhesion
|
molecule keywords |
CHAPERONE PROTEIN FimC
|
total genus |
46
|
structure length |
279
|
sequence length |
279
|
chains with identical sequence |
D, F, H, J, L, N, P
|
ec nomenclature | |
pdb deposition date | 2001-12-03 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
B | PF00419 | Fimbrial | Fimbrial protein |
B | PF09160 | FimH_man-bind | FimH, mannose binding |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Fimbrial-type adhesion domain | ||
Mainly Beta | Sandwich | Immunoglobulin-like | Fimbrial-type adhesion domain |