1KIUB

Fimh adhesin q133n mutant-fimc chaperone complex with methyl-alpha-d-mannose
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
279
structure length
279
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRNTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of tropism of Escherichia coli to the bladder during urinary tract infection.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/cell adhesion
molecule keywords CHAPERONE PROTEIN FimC
total genus 46
structure length 279
sequence length 279
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2001-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00419 Fimbrial Fimbrial protein
B PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1kiuB01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1kiuB02
4X5QA 4LOVA 3ZL2A 4AVHA 5IQMA 5LNEA 1N12A 4AUUA 3SQBB 4J3OG 1TR7A 4X5RA 4XOEA 1ZE3H 2XG4B 5FLUA 4X5PA 4XO8A 5FWRA 4X50A 4AVJA 4XOBA 3ME0B 2XG5B 2JMRA 2W07B 5IQNA 1PDKB 5AB1A 4CSSA 3JWNH 3BFQG 1KLFB 5F2FA 2UY7B 4XOCA 4CA4A 4ATTA 3MCYA 4J3OH 5AAPA 3ZPDA 4AVIA 5IQOA 3ZL1A 4AV4A 2JTYA 5FX3A 4J3OF 4AVKA 4CSTA 4AV0A 4AUYA 4XO9A 2WMPB 1N0LB 5AALA 4XOAA 4XODA 4AV5A 3BFWA 2VCOA 3BWUF 3JWNG 4AUJA 5ABZA 3RFZA 5FS5A 3JWNE 5JQIB 2UY6B 2J2ZB 1KIUB 1QUNB 5F3FA 4BUQA 5LNGA 1UWFA 5CGBA
chains in the Genus database with same CATH superfamily
4WO4B 4BFNA 2XWRA 3O3EB 4I87A 3LEYH 1OE1A 4PUBL 5DHYB 1QBLH 5EOQL 3IXTA 4KK6C 2M83A 3MRFA 4WW2A 3DXAD 2EH8L 3QJFB 2QZ5A 4L3CA 3HG4A 3L6FB 5DQJA 5ID0B 5HYSA 1ET5A 5AL8A 3IJ7A 5DFVD 2JKTM 2OK0H 5DQJB 2OI9B 4BQ6A 3BI9X 3SY0B 5JPNB 2F08A 1W80A 1HEJC 4XE5B 3N43F 3V6OE 5DMJB 2Y4SA 1BLIA 2QVIA 3HB3B 1NKOA 2ENQA 1PX4A 3EUDA 2JV6A 2KUTA 3NG5A 4G9FA 3QQDB 4Z7VE 4KK9D 1N64H 4IRZA 1MXGA 1CTOA 2ZXAA 4G9FB 1WP6A 3VJ6A 35C8L 2IWEA 1DQJA 1ZHBA 3EBGA 3VGAB 3LNIA 4P2RD 4IKLA 3DLQR 3AS3A 5K1JA 4BA8A 1G4RA 3L3OA 4S1SH 4JDEB 4CA4A 1AXTL 2NY6D 2QQLH 4JRWA 5I1EH 2VZ1A 4KWUA 2BP5M 1SOSA 2ZUYA 1IARB 4QXWA 4PGBB 3TWCL 4MD0B 4ODUB 3EJUA 2PYEB 4NJ9L 3ZDWA 4CUCA 1SM3L 3P73B 3MV7E 4ZSOE 3WFCH 1BD2E 4FN0A 1OARH 1XCQB 4UV7H 1UWXH 2GYSA 4P99A 4RGOH 4H20L 1QPXA 1AG0A 3K46A 3EZJB 3F84A 1T21B 1E27B 2ATPA 4M7ZC 1HSAB 3CFCH 2OMTB 4PJXA 2C7FA 3WNLA 5DEJA 3RNKB 3ZKMD 5KVEL 1U3YA 1EHAA 5E5RB 5DUML 4IOSD 1X4ZA 1XGRB 2W5PA 4FXKA 4LXFA 1QI5A 4NZFA 2IBZX 3NRQA 1CG9B 5E70A 1HHKB 1QNIA 1Z0NA 2YLHA 3BHBB 6TAAA 5HHOD 1CG9A 4D3CL 1A4CA 4NC2B 1AZNA 2DM4A 1RXLA 2GK0B 1GGIH 3DX1A 4ONHB 2P52A 1ND0A 1JI1A 5JHDB 1JHTB 2HRPH 1J8HA 1KJ3H 1TZGL 4KV5E 4IYKA 5EULV 1JK8A 1WITA 5E6UB 1QFOA 1RD6A 2A9AA 3CQPA 3PFQA 1G9NL 1FVCB 4Q4IA 2F53A 2G5BB 3BSHA 4JFQA 3MREB 4NBYB 3T4AC 1AP2B 4MQXC 5HVGB 3UJJL 3LNFA 4X4YA 2KKQA 3C60A 1ORQB 1IU1A 2ZKHH 4N2BA 1DLFL 3EJRA 4QXUL 1SXBA 1XF4A 3VDBA 4LU5H 3A4FA 2CDEA 3QT2A 2BNRD 4GAYB 1XF4B 5TQ2H 3FQRB 4GEJA 2CD0A 4R0LC 3MXWH 2NY2C 1XSIA 3FS9A 3GMLA 1X5MA 4L3ED 4JO4L 1PCSA 1YJDL 4HMCA 3DROA 1L0YA 2MKLC 1AGDB 4X9YA 3QJUB 4L29A 1MF2H 1CICC 3GSWA 5AVSB 3PL6A 1ITBB 1CDJA 2DLEA 4JKNA 4Y2DC 4H44C 1CXIA 4L29B 1R0AL 5EN2A 1XGTA 1L0PA 5ADPH 1KTJA 5T5FH 3EOAB 4N6QA 5B1CA 5C0IA 3OAYH 4LHQB 1M56B 1OCOB 2WO2B 3U30B 1RZFL 4F7MA 2R27A 3VD3A 4KH2A 5DO2D 4YHOL 3BESR 4P46A 5BMFH 1NGWA 1N2RB 2DWDB 3ECUA 5FO2A 2XWEA 2I5YL 3K2MC 4HPHA 2FJFB 1IAOB 2PTTA 3L3JB 3VFTB 2HMID 1A6AA 4NT6B 3HTLX 3OKLB 5IROC 3TIEB 1I1RA 3C5JA 5E2JA 1WBZB 1WDAA 4HIJB 1KJ2B 3K71A 4HUUA 3ORJA 5CLWA 2Q87A 3WUWB 4MCYA 4WWNA 4HEPA 2JJTC 1ZWIA 1YY8A 4ZSOA 4WUUB 3RL2B 3IDGA 1TR7A 2R56L 4WNQB 1J1XH 1EJFA 5B8CB 4AEHH 4ZMVA 2WZ0A 3LZNA 2ZNXA 4GP8B 4Y16A 1ZGLB 1ZLVK 4Z7UB 1JV2B 2FH8A 1PG7X 4PJIE 3APFA 1R34A 5DJDB 3NA4A 3I75A 4HT1H 3OQRA 2BP0A 4R9HA 4L0YA 4LLWB 4L18A 1H15B 2BNRB 3APDA 3CHXA 1SYSA 2P26A 3EXJA 3BUPA 3U6XA 1JCKA 3GM8A 4QD2E 2R2EB 4I3SH 3TPKA 4I0PB 5E1GA 2CH8A 3POCA 5JHAA 4H1LG 4EDWL 1SBSH 3ULVE 1A4JB 4NFDA 1QSFE 5ADOH 5D96C 4AT6B 3TEXA 4CRPA 3CFQA 4YHMH 1E7UA 3L1OL 3KNBA 4LSSH 3IMBA 5GGTL 2XNAA 4B97A 4XMLL 1DSFH 1W8EA 2YC1A 3WHXB 1PKQA 1MCNA 1MRCL 3NGBB 1YYML 3X1GA 2ITDA 4TLTA 4MJ5A 1FCCA 4OZFB 5F6IC 5MP6H 2LTQB 4A39A 4F5CE 2IH1B 3H9SE 2ITDB 3MRLA 2V9UA 2DPKA 3O11B 4M6NH 4Y1AB 4E5XA 2OSLA 1P4LA 5MERA 1C12B 3FH7A 1MNUL 5EU6E 2EZ0D 4G6JH 4L4JA 4LOFA 4GLRH 4XCYA 3AM8C 3P0GB 3G3LA 3VTAA 3BVDB 4EOWL 3MBEA 3RG1C 3T0VA 4A6YL 5IHBA 2V2WB 2N59A 3JYBA 2R8SH 2Y24A 3EGXA 2Z4TA 1U4EA 2WSKA 2XV0A 3KLQA 4ECNA 4OQTH 2BFVH 4GT7A 1AR2A 1OSYA 4V33A 5JPMC 3Q2LA 3EG9B 5FKAA 1L0QA 1JMXA 1Q0YL 2GC7C 1U36A 5DRZB 3NK3A 2AP2A 1FQ9C 5DI8A 5IHWA 1YHPA 5FKAB 3TZVD 1WICA 3UYOD 2F7QA 3P69A 1X5XA 2GTWB 1NGQH 1IKNA 5I2IB 2NZ9C 2AW2A 3C6SA 2A1WL 5SX5K 1BVLA 3ZUNC 3G9VA 3MRJA 2B1AL 5FHBL 4J4PA 4TSAH 3MJ9A 5C9JB 4XP5H 1YNTB 4BZ1A 5JUEL 2I27N 1NDGB 1PY4A 2HLEB 2Q3XA 2XXGA 2D31A 4CDGC 1A6WH 1A7PH 3AB0C 4Q9RL 4A7GA 3PQYD 4EDXA 5D9SB 1CFQA 1H6TA 3C8DA 3NFPA 5FGCB 3VVVA 1U42A 5D9SA 3TL5A 3VI3F 5A1AA 2DWTA 1CGSL 1GKEA 1XQ4A 2V5RA 3HMXH 4X4XB 2HFFB 1NGYB 2NYYC 3FDWA 5DMKB 5I6MA 4N8CL 1RZKL 2XOTA 1S78C 4JCWA 4XCFH 2GB2A 4MMXB 5FYKU 1L7IL 2BPBA 5F7MC 4JDTH 5LCVA 3B1UA 1T0OA 3FO9B 1INQA 4NNXB 3WXWH 1CU4H 4HK0A 3RWHA 1SHXA 4WRLA 3U4KA 4A2MA 4J2XA 4N8PA 2GSGB 4I1PA 3SDYH 2O5YL 5L2JB 1BV8A 4D0BB 1IGYA 2DLTA 1QO3B 3B9DA 3L1EA 4X42A 2DMGA 3I6SA 4M56A 2WYZA 1ASOA 3BWAB 4AGOA 2F61A 2DL9A 2XG4A 2BLFA 4O51B 2G5UA 4U05A 1TQUA 4KO6A 3L7EB 2XQYG 5H37H 3WKPA 2GHZA 3GSXB 4YSRA 4ZTPL 1QFUL 4XP5L 1AO7D 3LH2H 2CQVA 4HS6B 1BMWA 1A6VL 2GTZB 3CV5A 4NHCL 4K3HA 1USQA 1RH8A 5D6CB 5EC1B 3ZGHA 3LD8B 2A6IB 2OMVA 4U1IB 2W59A 3H3PH 3IE4A 1BQHA 3OKYA 3ZO0A 1ZEAL 3L3GA 3FUFA 1L9TA 1YEIL 3STZA 1IFGA 2JCCF 4PJGE 1NCCH 1ZHNA 3HW7A 3IF1A 1ADQL 1K6QH 3VGGA 1JZEA 3ZIYA 2H0FA 4UOZA 2WUBL 4N0CC 4KQ3L 1DO6A 2MRYA 2QR0B 5E1HB 4LSTH 5CZVL 4DW2L 1TEYA 4K71B 2D9CA 1I9IH 1KT2B 2J43A 1B88A 1TJIH 3V4UH 2G60H 3MDJA 4RGMC 4OFKA 3CVIL 1CXFA 4E36A 3LRSA 3JT2A 4HOMA 2EICA 5KAQF 5AYUL 1UUNA 3NCYS 4Y1TA 3VSTA 2NY1C 1GS7A 1NQBA 5LHDA 3MKGA 4EXKA 2IBZY 2G2NA 2HAZA 2HFTA 4L4VD 3D3VD 3VI4F 1HL8A 1TT6A 3HAEA 3PIQB 1HINL 3H9YA 4LLQA 4R7XA 3GKWH 4FQ1H 3HAEB 1ZDQA 3PHQB 2Q0ZX 3IWUA 4PG9B 4ZK8A 3V5HA 2AMUA 1WZ1H 1K2DB 4QDGA 2X4TB 1HCYA 2DBLH 1I1AB 2RHEA 1K2DA 1KLGB 3KS0H 4QJ4B 4P5TA 2YPVH 3MCLL 1JZ6A 3QZWB 1KLGA 2DICA 1FYTB 3QNZB 1NZRA 2MSPA 4JPIA 4M61A 2I9TA 1WISA 7CGTA 1GCYA 3UTSE 1X5HA 1FLTX 2OCCB 4OZIB 1YRKA 1KXVA 3CFKA 5E4EB 3HRZC 3MNMA 3LDBB 1S9KC 5ERWA 1AO7B 3HR5A 3EBAA 1U3JA 2E76C 3MYZA 4BFFA 1NEUA 1LMIA 3H4FA 3HKZA 4HJGA 5DJ6A 5FM5O 4JRFA 4B53A 1BQLL 1QLRA 4TUUA 1KTDA 4HJGB 4HIXH 5DD3L 3TH4T 3JWDL 2MPAH 4DZBB 1RZ7H 2Q5BA 3WSQL 3V4UL 3GMOB 4IRSA 3DUSA 3TYGL 2Z91B 3TVMB 2N1KA 4IRSB 5DGRA 5H94A 3DOSB 2Y1AA 3ZKND 4LSUL 2LVEA 3FQ2A 2AV1A 2J88H 3MXVL 1JIBA 4NQEB 2VAAA 2Y7MA 1F6FB 4M8RA 2IGTA 2QGDA 3NN8A 4KHXH 1BFOB 1O5DT 2AABL 2BJMH 5C0DB 2O61B 4BUGA 5DVKA 3ZDYE 1GL4B 1FAIL 1E3FA 2W07B 4BZYA 1AIFB 1K5NB 4IKIA 4K9EC 1OO2A 4F7EB 1YMMD 4YEEA 1S9XA 5BJTB 3DURA 2XRAL 4EJ1C 1T1ZB 1JD7A 3NSFA 4OIFA 5T1MB 4JDZB 2HRPL 4M5YL 2CCVA 4G1MB 3AVEA 3O6FC 4OI8A 5F96H 4WWKD 3PJLA 2YLKA 4LLYA 3OR7A 1HSBB 2NSQA 4JQIA 2X10A 3JWDC 5J3HD 43CAA 4PRAB 3VFVA 5EDSA 1HIMH 3ILDA 4U1NA 5CMAB 2VISB 2F6AA 2ATAA 4J3SA 1I1AD 2MEJB 2DL2A 3H55A 1BQLH 3R0MA 4AV4A 3ARVA 4C57C 1WS8A 2W88A 4NZRL 3NJNA 4Y9BA 2VH5H 1XHHA 3BVNB 3UYPA 4EVNB 2LT9A 5IJDC 4K9EL 5ETUA 2QSVA 4EVNA 3FU9A 3K72A 1DQQB 3KCPA 1HQ4A 5CN1A 4WWOA 1MQ8A 1DQQA 3SODB 3MRQA 1M9SA 4Q6KA 1OT4A 1D6EA 2JK5B 4RIRB 3AMKA 4ODTH 3VFUB 1DBKH 2YOAA 4Z3EA 4RAHA 1RHFA 5DYFA 4J3WA 3V6OA 3ARFC 1AE6H 1CFMA 5I24A 5ICXB 2KZWA 1IAII 2LVCA 4QAMB 4NQSA 4G7SB 1KCSH 1WQVT 4IRSD 3UPAA 3DX2A 3DVNB 1T5WB 1A64A 2ADJA 1EBPA 2X1PA 1HN1A 1WWCA 2CRYA 5I15H 2Z3FA 5IJCC 2A9NH 4PJFB 3C5ZC 5MEND 3DX6A 3UTSA 2X0WA 1P7KA 4Y4HC 3DJZA 3D52A 3U0TB 5I76A 1DVZA 4J3BA 4KK5D 4MJIB 1L7TL 4OF6A 3EGDA 4FG2A 3QR1A 1JUFA 1E5CA 1KTLA 3GLDA 3TCTA 1L5GA 5DHYA 1F56A 5ID0A 1TFHA 3GMMA 3GS4A 2CRIA 1U8CA 2G0LA 3OLIA 4KTDL 2VMCA 2GFBB 1OAUL 3LIZA 3ESOA 5IOPA 4J8RA 3DGCR 4OIBA 5HYSB 4IK6A 4L3FA 4I89A 1IMHC 5C71A 4OLWL 4HAKA 4KKAC 4OD1H 3BOVA 4TUOB 3B37A 1U91A 1P9MC 1RZJH 5L7XH 3QHFL 4GRWE 3A6OA 1SPDA 1GY2A 1R1CA 3HAEH 4EIUA 1NWPA 2OV0A 5KW9L 2WPGA 1A4KA 1O75A 4WEEA 4Q2ZB 1EA9C 4AL8H 4HJEA 4JAMB 4HCIA 1G7JA 3VJ6B 4WWKB 1KEGH 2FH6A 3CNKA 2ZAGA 4OJFH 4NQDB 2WAQA 4BXSV 5GGTH 3FCUB 2UVEA 4QRQA 5B1KA 4F8LA 5IW6B 5LNGA 1O5PA 1H8SA 2VO5A 4PGBA 5TE7H 1XSOA 2EUWA 3MNZA 3NCXA 5E9NA 3TCXA 3DTXA 3MNZB 5C0AA 3SKJH 3LKQA 4ZMZA 2DQGH 2AJXH 1BQRA 2D8KA 4HYTB 5JHLA 5BZZA 5D7HA 4XCEA 3H42H 2XRAH 5BV7C 4HXAL 2A73B 4GBXB 3WIHH 1HSAA 4XCEB 4LMQI 2DTML 5JZ7C 4IOSA 4W9ZA 3PWJA 5KS9F 1FG9C 3QHTC 4Z5RA 3RUGA 4FADA 2EVFA 4K8RH 4FQQB 1SHMA 5DT1L 1HHKA 2VZUA 3AG1B 3IXTB 3BHBA 2E7LA 3IJYB 5D5MA 4JGUA 2J4WL 4O5LH 2IQ9H 5HHQB 1EJ8A 4X6FB 3CVHL 5GIRA 2DIBA 1CFVL 1FL3A 3CZGA 3RTQC 2WY3B 5F7BA 3IKKA 3CK0L 1JDCA 1EVUA 4YXLL 5AAPA 3SY0A 4D9QD 1NGQL 1NLBH 2Z1PA 3M7FB 1QABA 2Y25A 3C2AH 4UQEA 1YEEL 3U2IA 1U30A 2MJWA 3IFOB 2WINB 1AANA 1E2WA 4IHBA 3ROOA 3MQIA 1FVCA 1NCIA 3UJIH 1EH9A 3BZDA 2VQUA 1SLXA 2ORBL 4G80A 4K3GA 3O41A 2Q20A 2WO3B 4JRLA 2X4RA 1GGUA 3BSZL 1AGBB 1DQJB 1ZHBB 3O41B 4LCWD 1ZE3H 5I1JL 4JFOB 1BJ1H 3NJVA 2R23A 3EUUA 3MRNA 4QTHB 1BVNP 4JQIH 1D5IH 1J1OL 3VYOA 3FQRA 4JPSA 4JFOA 5FGRA 5I23A 3BUYA 1JG9A 1YEGH 4KV5F 4PWKA 2YAFA 5HD8C 2V3FA 3GMLB 4FQLH 2YWYA 5AZ2L 4PJXE 4QLRA 1E7VA 1F4AA 5E08L 4XVSH 3VXRE 2LE9A 4OLVH 5J5EA 1ZGLP 2NLJA 1FVEB 4NO3A 4PWFA 4NCC1 2H7WA 1BBDL 4UF7C 1OHQA 4LRNL 1IGIL 5EN2B 1AQKL 3DX8A 5GZOC 3MO1B 1XTLA 3V5DB 3ARDD 3IBOA 4JO5A 3T09A 3EYQD 3GGWB 4OFYA 4Z7UE 3MO1A 5T1JA 4R7DA 2O6PA 5C08B 3UH8A 4K8RC 1G0XA 3L5XH 4KKPA 4NC0B 1NBCA 1P1VA 2XN2A 1Z3RA 4M8QB 1U9KA 3SDXA 2CK2A 4X4MA 4Y5YA 4FTVD 2PTTB 3S48A 1GOFA 3VFTA 2XXCB 4U6VH 5H35B 2EXWD 1MJJA 2DBJA 1LEGA 2RJMA 3CFDA 1CVSC 5H35A 3H6AA 3DX9B 1D5ZA 5CLZA 5LG1A 2YD8A 3CC5B 1J8HB 2WJ7A 3DX9A 2ZKYA 3EYOB 3LDBC 2F1BA 3W39A 1HXKA 1YY8B 5I6LA 1IKOP 4F5CA 2VQTA 3TJEH 5F1SA 3FCTB 3GRWA 4NCDA 3ARBD 3DBXA 4G8FA 4Y88A 5L88L 3OZ9H 2JH2A 1WJ3A 3QJTB 4WUUA 4G8FB 2CPCA 4YDMA 3V7AG 1RUQH 1BMZA 2IC2A 4X4ZA 4XI5C 3MGTA 1J18A 1NMBL 2WYTA 4I77H 3T0ED 2Z31D 1FI8C 3BP7A 4XNUH 4YLBA 4DGVH 4CDHA 2UXVA 1D6VL 3QG6B 1OCCB 2BNRA 4MNQD 4EO5A 5KSAA 2Z65C 1IGMH 3ULUH 3ARRA 3GD1C 3ALWA 2FUTA 4J3UA 4JRYB 3H9SD 2X2JA 3TONA 4WHTB 1OLLA 2HSIA 2AJSH 4B95C 1LK3H 3X11B 4PEEA 2BY2A 1TJGL 1MY7A 1N0LA 1UENA 2RQ8A 2BNQA 4X6EB 4OLZH 1A7NH 1A4JA 5D6DC 3UEZA 4X6EA 3ZHFA 4HS8L 3TCLB 1JGUH 3L8QA 2R2HA 4OUOA 3LH2L 4BWWA 3B9EA 2VLJE 4S10A 5CEZL 3P1VA 2HT4C 2PTUA 4UM8B 4R84A 3D0LB 5LDUA 1N2RA 4E5XB 1IQWH 3GXPA 3L16A 5GGTA 1HZLA 3DX0A 2DKMA 2UZPA 3L3JA 4MAYC 3BPCA 4PGJA 1ZOXA 2NX5B 3KYMB 3TJPA 3UZVA 5TQ2L 3V0FA 3P0YL 3C5JB 4HJSA 4V11A 1WBZA 2VN7A 4H25A 3FUIA 2A99A 5ISZD 4M02A 3GJFH 2TSBA 4AUYA 2XVBA 3K8KA 1D9KB 5EU6D 1N18A 3T5WA 2H6PA 4HOXA 3GIVA 2J2ZB 3SDAD 3WIHA 3ETBF 1H3VA 4OD1L 4YHPA 1OTUC 2V2WA 3HZYA 3A6CH 1KYAA 1ET8A 3DO3A 2NW2B 3DXAA 2J1XA 4NQXB 3TU6A 1MH5A 1SMOA 3GI8H 2LW3A 3WEOA 2XQBH 4PJAF 3I75B 4OW6A 2W92A 1P6WA 2XVGA 4H0HB 4YSEA 1K4DB 3CVHA 1H15A 4PJHF 4AV5A 1LM8V 1BVLB 1RUAH 5B4MC 1YNTA 4KHXL 4QYOB 4DETA 1LP9F 3QC5X 2XUWA 1BYPA 2FBOJ 2GPZA 2J56A 2A74C 1T7ZA 3IJ9A 1PD1A 4YE4L 1BX2B 1JGLL 1NAMA 1VZIA 3QDGE 4E0RA 4YDJA 3EH1A 3QQNA 4YDKH 3FB6B 5F3HA 5TK2A 1IZKA 3TA3A 2DQ6A 1L3NA 4UI2A 4WAFA 4IIQC 1A66A 2IPKA 2FYYB 1RP8A 2AJUH 2VQ4A 1OCWH 1DUYA 1T4WA 3RP1A 1KB9J 5IQOA 2IPKB 1BM7A 2QQKH 3IK2A 4MMXA 2Q6WB 1NMCC 4XTRD 2R0KH 2WQAA 3OB0H 5BRQA 1NGYA 3F83A 3ZVVA 3NCEB 3O11A 1HL9A 2PO6C 3ZKXB 1JOIA 4K23H 2NRDA 1MI5A 1XGYH 3FT4A 4JZNB 1P4LB 4LESA 3N3EA 4FQCH 2FECL 2GAZB 5MERB 4I18B 2ADFL 2XY1A 4FFZL 5JZ7D 5LGKA 3O4LD 3V6ZB 4X83A 2Y5EA 4D0BA 3O3BB 4FNRA 2EABA 1UT2A 2ZX8A 1R3IL 2ESVD 2XWXA 1S7RB 4YJZL 1LWJA 3E2HB 3DIVA 3O3BA 5SWQB 2V5MA 2EKSA 3O4LE 4KROD 1QSEB 3DRTA 1EXUA 3L9BA 1XX9C 5SWQA 2IMNA 1U8MB 2ZXEB 3ZL1A 3MRPA 4IRJC 3KLAA 3CFEA 4PS4H 1P7BA 2HCZX 4KNSA 1H3PH 3NDYE 4M43H 3T3PF 3WAJA 3HG1D 3L7EA 5GS0H 1RUQL 3TTSA 1W72L 4O2CB 1NEZG 1YYLH 4P9HL 1KGIA 3VXSA 1KDIA 1UM5H 2R15A 3LHPH 4P04A 5GRYA 3SPCA 5I18H 1MLCB 4U1JB 5IZ7A 5A2IH 4HS6A 1X5KA 3RI5F 1GZPA 1K9TA 4AJ0A 1U3NA 2FBJL 4RNRB 1ZXKA 3PHSA 4WKXA 5C9JA 3GXMA 2VDOB 2RR3A 3QXUA 4WEBH 1BPVA 3EOYG 2X53A 2D31B 4HIEB 5CBEB 3MRMA 2DQIL 5D7KE 4ENZA 1PY0A 2YZ8A 5DZPA 2HP4A 2DLFH 3OQ3B 3VM7A 3FSOA 3GRWH 3D48R 3HZVA 4M7KH 4QHUB 5JXEA 2YRBA 1KT2A 3QIWD 1LWHA 4U3HA 3RGVD 1YEFH 5TDOA 4AGMA 1WAAA 2WYIA 1C08A 4YPGB 1HNYA 4F2EA 4NXKA 1MRFL 3QUGA 1U93A 3FHEA 1C08B 2ZX9A 1IEBB 1BQSA 4ODBD 2J8UF 3U7WL 3CSYB 3ASOB 1IEBA 4JPWL 3MJ8A 1C5BH 1T5XB 1GW6A 1OSPH 4HAFA 2QLYA 3QDJB 5JQ6H 5DRWB 2CM5A 1MREL 1OTSD 5HPMB 2Y36L 3BP4B 4TQEH 5F1IB 2X1XR 5I0WA 3MV01 2AQQA 1M2VA 3BPLC 3TGXA 4OCRL 2DMCA 3ARGD 3BAJA 1Z1WA 2N3JA 4A66A 3LB6C 4LKCA 1DJHA 3I2CH 4KRLB 1BZOA 2X4TA 4OZHE 4WFEE 4BK4A 4P8QA 3SYOA 3CDZA 3KPOB 2AXFB 4EN2A 4PJEA 3MROB 4R97B 2VXVH 2OR9H 1BBJB 3VRLE 5JIHA 4HJUA 5JYLA 5MEPA 1RZQA 4DP9X 2E6QA 3UO1H 5IHLB 5DK2A 3EBIA 1KYDA 3C5ZA 2FR4A 3L4VA 1BG1A 2G2RA 2ZOWA 4G5ZH 1C8QA 5FYLE 3X1BA 4N6RA 4B9KC 5C0JA 4IU2A 5ERWB 4ZUWB 2YAMA 1PTZA 2G2RB 3TBCA 3SY6A 3I50H 3T6XA 3U36B 3T65B 2A6DB 3IF1B 4ZX3A 1Q9OB 3EKCA 1MVUA 3V9CA 1Q72H 3FSVA 5DZVA 1PEWA 2AV1B 1WZKA 2BWIA 1YPZF 2YEZB 3L08A 3LXAA 2W1NA 5D71L 1I1AC 3UYRL 2Z91A 1BFOA 3TVMA 1U8NB 2F8OA 5PCYA 4UQBA 5I73C 2NY5L 5CR1A 1CLZH 1X9UA 1ITCA 1U8NA 5KTEL 3ULVH 4NZUL 5E7BA 2VXTH 3IWVA 1ILSA 4PRIE 1Z66A 2X9WA 3UBXI 4Y2DB 3VNZA 1TUPA 1DN0A 2J7LA 2W07A 4LVOC 4XO3A 4GG6A 4LARL 1N26A 5DD0H 2QHLA 4RGOL 4P2QE 4WSKA 4PG2C 1BEYH 2ZYRA 1L9SA 1RSFA 2GHWB 4J3OG 4LLQB 5C07E 3SGEI 4F2FA 4ACTA 3X12A 2IADB 4MZRA 1V5JA 2B4CL 4XB3A 3QHZH 4CSSA 3B7RL 4AIXA 4IIZA 4CC0A 2QPSA 3JV4B 3FT1A 2BSEA 1RUPL 2PYEE 4TSCL 5IT2H 3T2PA 3EFDH 2DJ4A 5DVPA 3U9WA 3GNMH 3BEWA 2HJKB 1JXKA 3N41F 1KYFA 4XNMA 4WWPA 5CMAA 3WNOA 3T0AA 4PGCB 2JWYA 1OAZH 4ZO9A 3V95A 2PCFA 2ZJSL 4LDOB 1BZDA 5EOCJ 4M6NL 2OXHB 2H26B 1JTOA 4ODVH 3SB3A 5AB9A 5IQMA 1HOCB 1D9KD 2R0ZL 1RPQA 4DP5X 5F97E 2JKLA 5F7HA 3S37X 5DJ6B 4EI5B 1J9RA 4PJIF 4ZNCD 3EF7A 5J7CC 4DGYL 1JGUL 4LCUA 1I3VA 1YPZB 4RRPM 1MN4A 2FJHB 2BVOA 2EINB 2DQUH 4JFDB 1UFGA 1CE6A 4D7BA 4PMEA 5H94B 5JHDE 4ANXA 3DOSA 2IPTL 1K3IA 3O2WH 4LMQE 3TZVA 1CDBA 2E56A 3RVVD 3AREA 2E59A 4N1HB 2VZ3A 3MRDA 1T22A 4U1LA 1A1MA 3NSJA 1WUNT 5LKNA 1IGCL 1YN6A 4KMLB 4ZUUA 3MCKB 3DVNA 4H0LC 3X1EA 5E4EC 3W2DL 3ARQA 3C75A 1S9XB 4QCIB 8CGTA 3IVKB 5SX4H 4Y7OC 4N0YL 1KXVC 2J6EH 4Y9CA 2J1YA 4PWJA 4BK5A 5MEOA 4AV0A 2B14A 2P49B 4NNPH 1ZLDA 1YECL 2AJYH 5HHPA 4HIIA 2FEDC 1DEDA 3MZGB 5GSVA 5HHPB 2E74C 1FA4A 5TGBB 1O9WA 2DMHA 3AFLA 2UX7A 3OVUB 4GQ9H 4O58L 3UGEA 1Y6KR 2FQDA 4NUQA 2G2PA 4MZ2A 5FW7A 1JXDA 3AB0B 4LSRH 2E27H 2EDWA 2IAAC 2QSTA 2VLKD 2VMFA 1OP9A 3OXRA 3JWNH 5DJ8A 4NQQA 3RKDC 1OGTB 5IBUG 3FOMA 4ABUA 1TITA 2F0CA 3EJPA 5BV7L 1WBXA 4LAQH 1YEHH 5BQ7B 4AG4L 3Q44A 2R29L 5AKVA 2VMJA 4ZPVB 4DK5A 2WQVA 4NN6B 1S4IA 3BKMH 2GG1A 4J27A 3RPIB 5KJRH 1YLBB 2DKUA 3EW3B 4UQDA 4ETQA 4HWBL 4AI7A 4AYEC 2NXYB 4BYHA 3NCCB 1A4KB 4ETQB 2ZYIA 2R0KL 3H7BA 4JO3L 1MCKA 1G7JB 5IFAL 4PHZA 1CDYA 4JN1H 3DUUB 3NJXA 4CVXB 3HPLB 1QWUA 2E46A 1LQBC 5A6IA 3ETTA 1DR9A 1X44A 4WO0A 4ALAH 2WWNA 1AQDB 3MLXH 5GRXG 4IDJH 3OF6D 3P73A 3GTVA 3PWUB 3BPOC 3LKQB 5F6HJ 4EDWH 4OV5A 1P7KB 3K5SA 1E50A 3I6LD 4JRYD 2NUPA 4I48B 4FULA 5F70A 1CVRA 1IC0A 2E27L 2C3HA 1HS6A 4JJHA 4RX4D 5J1AA 2A0LC 1AVAA 4KO7A 3VFWB 3OSKA 1G4MA 4IRJB 4HJTA 3MAWA 1DVFA 5GISH 4FQQA 3A47A 4WW2B 3GMMB 1Z32X 4ZMPA 2EEFA 2P24B 4M1GH 3IJYA 5D5MB 5HHQA 2HT2D 1FNHA 2VXSH 3GSNH 5HHVH 2N01B 3QO1B 4F80A 2VDRH 1MW3A 3QO1A 1B4JL 3B5TA 2VLKA 4LHUG 3VI4A 4OJYA 2DYRB 2FB4L 2VDNL 4OM0L 4ZFOL 4XXWA 4G5ZL 3QZLA 1DVSA 5AVVB 5CJ5A 4NCC2 2WN3A 1ZSHA 3BUYB 4QRPE 5EU6B 4K5OA 3FN3A 1CS6A 1JWMA 2HUEA 4MCMA 5KBMA 4XP1H 3WFCL 1YAZA 1R4XA 2CDEB 1E42A 4G6FD 4NKIH 4CGTA 2XZCH 3DTXB 3RUGE 1RIVH 2SEBB 3WL9B 4ISVA 3AW5A 1ESOA 3KLLA 5GGQL 5HGAA 3QFJD 3VMPA 5LGHH 1XCWA 3DIDA 1MUJA 1Q1JH 2B20A 4JB9H 4R26L 4R7DB 1BXUA 1C8PA 1D7FA 2VDQH 1W8OA 3PGDA 3FK3A 1EX0A 4I5BB 4Y4KC 5HJBA 3FN0H 3V5DA 2WBXA 2OMTA 5DS1A 2R1XA 3KGTA 5EZLB 4Q56A 4DFHA 4ZMNA 5CCHE 2R1XB 4CC4C 3UAFA 3BE1H 2XJKA 1MJJB 3QJQB 2BP8A 3J8F7 2HMIC 3VXNA 4RX4A 4AY0A 2JXMB 2OJ1A 3QCUH 4Y5YB 5AZEH 2VR7A 2V33A 2ZUVA 3F6IA 2GJJA 2XTJC 3UJJH 2VXQA 2H6UA 1VZHA 1TPXC 2QV4A 5F7NC 5AD0A 5BRPA 5IFHL 3RVUD 1OWWA 4XP6L 3MOBH 1JK8B 4PI2A 1KACB 1SY6L 2CIKB 4UM9B 1K85A 2VLJB 3TNNB 3V5KB 2J6EA 5A3ID 5FIEA 3H0TB 2OSXA 3WUWA 3MR9B 3ZQXA 2H3NB 3C60B 4ZW8A 1A9BB 3DYMA 4XTRC 4ZSOB 4AYID 3RL2A 1KPVA 1XEUA 3WS3A 3QAZC 1A9BA 1WFJA 2G3MA 1CLZL 3RYMA 4FQJL 5B8CA 5TF1H 5L4MA 4GAYA 4M7JL 3MGTB 2FNBA 3KLKA 4LEOA 4P2RA 4TULL 2IG2L 3Q2WA 3BRFA 2VSMB 3UTPD 4WI0B 1QTYT 2VLME 2IQ9L 3T04D 1TXKA 3S5ZA 2DQCH 1MCRA 1RUKL 2G5RA 3U4EA 1FVEA 4NO3B 4JO4H 1SLWA 2B5IB 3OL2A 4AIZA 4NERA 1KGUA 2AXGA 2HJLA 3U4EB 3AY4C 3GSWB 2DYSB 5CFHA 3RURA 2APSA 3S35L 4B7IA 3UCQA 3AQYA 3WLWD 3QEQE 2NSMA 1IL1B 3NIFF 4KY1H 2BHYA 4AENA 2J72A 3IKCB 4G1EB 1YEGL 1Z2KA 1ZKAA 5FGSA 1F1DA 4XC1L 4XNZC 4UM8A 3QXAA 4PD4J 4NO0A 5BS0E 3PDOB 4FTVA 3OJ2C 4F8OA 1CGSH 1A6AB 2C3GA 3K8LA 5IESH 2N4IA 5D4HA 4XMPH 1U95A 2O1AA 2CHZA 4ZMWA 5TTRA 4P0DA 2IAMC 2X5PA 1RURH 2NNRA 2R2CA 4HUUB 3CHSA 3W39B 2JIXB 1BAFL 4RWYH 3OHXA 3DA0A 5IK3B 5I75C 4QGTA 2JIXA 4URTB 4PW9A 4RISL 4PJ9A 5CJXA 3QQ3B 1CCZA 1NIAA 2Q7AA 4X6BA 4FG4A 1FPTH 2C9UA 1GVIA 2C26A 3BH4A 4Z7UA 2BNQE 4YO0A 1JK9A 3BP7B 2YK1L 3CHOA 2R69A 1K4DA 1FV1A 5C3LD 2CPUA 4FMFA 4GIPD 4YLCA 1XD0A 2WVSA 4MNQA 5KSAD 4FZEL 1VENA 1KBKA 3VDCA 5EN3A 1KXQE 4XPBL 2ROYA 5DRXA 1IC5L 4C56D 3HBGA 2P7TA 2BSRB 15C8L 3L95B 2JKSA 4R0LB 4PJCF 3HE7C 5DJAB 3BWUC 3FB6A 4ALAL 3O81A 1A6UH 5GRZA 4DERA 2FYYA 4S11A 3S2AA 2BRQA 1SXZA 1TJXA 2MCPH 4MJ4A 4UILL 5F3HB 2PP7A 4EN3A 3JBG7 4HGMA 3M86A 4AE0A 4UOW1 4MJ5B 3CJJA 2HFFA 5T1DL 5GS0L 2HX8A 5B1JA 1MPAL 2FX7H 2EDLA 2GAZA 5DJ2B 4EBQH 1HEZB 3SHSA 4G72B 4TKWA 1N4XL 1HEZA 2ZYSA 5KVGH 3CFBA 1TJIL 3CFNA 5JW4M 2FT7A 4WIQA 1GMIA 5DMGD 1CE1H 5DURB 2SODB 4QRRE 2J2ZA 5EF3A 5FDYA 1ILUA 2Y7LA 3GDCA 3HZYB 4FYSA 2QQKL 4NKDB 2OCFD 3MRPB 2R83A 2WXLA 3KPTA 5FGBC 4JM0A 3HG5A 1NCTA 1ZS2A 3EO0A 4XVUD 5ENWB 2WZPA 4U1JA 4YH6A 1I7RA 4ZNEE 3ZPDA 5IWLC 3F85A 5I2IA 1GZPB 2AQPA 2QSCH 1QFWM 3IJ8A 2K0RA 3ESPA 2Z8WC 3QJSB 2XCMC 3HN3A 4QYOA 3FBQA 3WE1A 1V7ML 4EF3A 2A6IA 3KPLB 3FZUD 2ZPKL 2WBJC 4LSTL 4N22A 2WVTA 2O72A 3QORA 5GGRB 5CIPH 3D9AH 5JXED 3SBQA 1M9WA 3ILEA 2ESVE 4JRXA 2KI6A 5LG6A 4HIEA 5CBEA 1MLBB 3NTCH 1JDDA 3HZVB 1UA6L 3KCWA 2ZIDA 1U8QB 2Q6WA 2F7IA 3VD5A 3FHAA 4R83A 3QULB 5KG9A 5ITFB 2K45A 2QVTA 3ZMRA 3PABA 3WHE0 2F8XC 5KG9B 4YHOH 4WENB 4JZNA 4M6ML 3ZDXE 3T77B 5F7FA 4V1DA 4GI9A 2YD2A 3K6DA 5AWNL 3SE9H 3T2NL 2H3KA 2PPFA 2HJFB 3PNRB 4IBLT 4NYLB 4LL4A 3HNVL 1R5VB 1G6RL 4PG9A 1U8MA 3QCVH 3NJMA 4KRNA 4OIIL 4X6CB 4P57B 3V5HB 2AJUL 4TOYH 5HP5A 2DMKA 1R5VA 5C0BB 4KKQA 1SJVA 2ITFA 2MHAB 5DUJA 3AREC 5C0BA 3FNKA 3GEFA 3NSDA 2K3HA 3MXWL 3EJYD 5FR3A 1ETA1 4HBQA 3SDAB 3HG1A 4B7LA 1Y07A 4PJEB 2YD3A 1IZJA 3L9YA 1KEML 3HN8A 5F3BA 1KLUB 1UACL 2AQ1A 4MYPA 1KPUA 5EZPA 2WNXA 1A3QA 1DVTA 5EC1A 2R4RH 2WQWA 1KLUA 4XPAL 3CMGA 4TL5A 2FR4B 1W8NA 1PPIA 1W91A 4PP2A 4WV1A 4X99B 3PGFL 2D3VA 4A7GF 4IU2B 1Q9OA 1WA1X 4ZUWA 4JFYB 1D5RA 5CEYA 3RWJB 2X12A 4JFYA 2VMEA 1ZLUK 5I1GH 5KN5B 1H3TA 1WZMA 2QV2A 3Q8BA 4LNRA 4X9IA 3IRPX 4IKKA 4OQTA 1FFRA 3HUJA 3O2DH 2DB8A 1P1ZA 4NO5A 2YEZA 4PFEA 4AGNA 5KYNA 3PWPA 1BQKA 2LAAA 3EDEA 3U9UA 3TJHC 4JKPH 1UA3A 1ZTXE 5KVEH 5K59E 3LRSB 3CG8A 3COOA 3EOTH 4N2MA 1E6OL 6PCYA 1ODAA 4FG6D 4Q6IB 1K5NA 1YPZE 3TFKD 1ASQA 1DN0B 4RMRA 1CGXA 3WIFB 4B0MM 4CNIA 8FABB 2XN9E 3G5WA 8FABA 3A23A 5I1KH 4BZ1H 4PP1C 3ISWA 3DGGB 3NIDE 3Q48A 4G1MA 2OL3B 1I1CA 2BK8A 2MTAA 1AYOA 1JWUA 3ASNB 4LKCB 5DHEA 3Q5TA 4RFOL 4KAQL 4XAKD 4EOWH 2WZ6A 2P3YA 3QVAA 3CDZB 3KPOA 3QC6X 4XNMB 5DHVA 4BDVA 5I75B 43CAB 3ZRSA 4MD4B 4JPIB 3QAZB 4K23L 3V8OA 3CAFA 3KPSA 5GQBA 2FZ3A 2IAMB 4R2GC 5DD6B 4PGDB 2GUYA 3A67H 1HOCA 3KPSB 2LU5A 4N8VB 3MLYL 5DK2B 5B21A 3VX1A 1TZIB 5LCVH 4ALAC 1AO7A 1FLRH 3HR5B 4KKBC 4A7UA 2D4DA 1N6QH 1MIMH 4OCYL 5DLLA 2PWEA 2XA8L 1QLRB 4OCXL 3SJVE 2R29A 4X8JB 2P42B 3RVUC 3VXME 1E4KA 4WFGE 4XE0A 3MBWA 4S2SA 3G08B 2XTJD 1R3JB 3TVMC 2AJYL 4G8AC 3BCFA 5IMOB 2L7QA 2EIMB 3MBWB 3MVSA 2ZWKA 1MWAA 3U2SA 1KN2H 3P0VH 4APQD 1QPKA 3VD7A 5J6SA 2CNZA 2HFGL 2JE8A 4JM2F 3ZR6A 3F7LA 3NN8B 2YGQA 5I5RA 1KTRL 3BISA 1UXSA 2O5XH 3GSNB 4DGIL 3P11L 3L9EA 3MRDB 4MGXA 4PS8A 1TZOA 3S3JA 2EE0A 1CXEA 1U41A 4PJHA 2W81C 1TYEB 4YUEL 1FYTE 1PD0A 4P5MB 4WHYH 5B38B 4P4KC 4YXKH 5TE4H 3R1GL 2O5ZL 3KH3A 2BVUA 4FKKA 4HIIB 4P5MA 3UTSB 4EZMA 3WNMA 2UZIL 1W16A 3QFDB 1ERNA 2WTPA 3ZHKA 4YVUA 3WKML 5I76B 1ZDSA 1HSBA 1X7TA 4DZ8A 3ARTA 4FKEA 3ZL4L 4ABVA 2JTYA 1ZRUA 2D7TL 4J1UA 3OXRB 1KCVH 2VISA 5H37G 3FUNA 4MJIE 1Q72L 2ZXDA 3MKKA 2R9HC 5D1ZI 1ZAGA 3LQAL 1MXDA 5DT1H 4ODSL 4CC1A 5D70L 3DNKA 5DS2A 5DURD 2OAAA 1N9PA 1BVKB 4MQXD 1DQDL 2I7SA 3ARDC 1SM3H 4XO8A 2IDTA 3KPSD 1IE5A 3VGDA 2BMKB 3D18B 4GIAA 2VDLH 2JB5L 4L5FL 2V7NB 5TK4A 3FQYA 2BMKA 3O9WC 4IBSA 2VXVL 5E2WL 1VHPA 4GRMB 4HPOH 4JHWH 5MHSE 3RX5A 2APBA 4OZ4B 3OJVC 4Q2ZA 2XWZA 2R39A 4RQQB 2AAVA 3FSAA 4EZKA 1BZ7B 3O6FD 5T8IA 1J8HE 3SCMA 3DUUA 4QEGA 3GXUB 4Y4KB 2ORBH 1FNSH 1F97A 4JS7A 3VM5A 5B39B 3MRBA 1SF5A 1YYMH 2JCCE 2ZICA 1IGML 3V4VA 5I74B 3NIGE 1DSFL 5GS0D 4IGBC 2KQNA 1PIGA 1SZNA 3D39D 3IDYB 1XBRA 4ZUUB 5C0AB 2WLLB 4C4BA 1HI6A 3EYFB 3GSNL 4LSVH 4JY5H 4NQUA 5HHVL 3CVIH 5FF6A 1J9QA 3KWWB 5IVZA 1RP9A 1A0QH 3KL0A 3PWUA 4HLJA 3KWWA 5HVHC 4XAWH 3FUKA 1G94A 3ARUA 3GRBA 4OBRA 2F18A 5GSVB 2C9XA 1VFUA 4DO6A 1DQLL 1JUFB 1P4IL 2P24A 1BQUA 1QG3A 5HDBB 3DYOA 4N2DA 5C09B 1WAAF 4HUMB 2H6OA 4OQTL 4FXLA 5TDPB 5C09D 4J8RB 1IEHA 3TA3C 3SKOA 3HA0A 4A2GA 1Y18B 1LP9A 2DQDH 4PJBE 1DFBL 4I9XA 4ZOBA 3SKOB 3L7FB 5DS8A 1OSZA 3ROLB 2W9LA 1D5BB 4QKXB 4YL9A 3L7FA 5DS8B 3NH7H 3ROLA 4WY7L 2VXQL 2UX6A 1WS7A 3U79A 4R5XA 3VI4B 3RPIA 5G5DB 5CEXB 1IV8A 4FS0A 5E8DL 1J1PL 4ZMYA 5IKCB 2X4RB 5SWSD 3SDCB 3A22A 2KLTA 4LGPB 4UILH 3LTVA 2MCPL 4BELD 1E2VA 1T7WA 5DEGA 1JWMB 3B9KD 5D2NC 3QSKB 5EEUA 1CT8B 4L1DA 1UM4L 2OSYA 4QXGL 1CFTA 1KN4L 1ZE3C 4KVPA 1YEHL 1HU8A 3O8XA 1NFIB 1I9JH 2Y7NA 7FABL 6FABH 3KWXA 5F0LB 5HGAB 4HBCH 1MCQA 4ODWB 3CDCA 2ARJQ 5E03A 3MMEA 3AAZB 4J2QA 1B2WH 1S7VA 2HWZL 2AFNA 5KVEE 3Q3GA 3FYIB 4TYUA 1B2YA 1H3GA 5EZLA 3AAZA 3SZ6A 5GHWH 4MAYA 3RUGF 3N2JA 2ICWI 4Z5RB 3TP4A 4IRJA 1HNFA 3V0JA 1ADQA 2YKKA 4TNWK 2V17L 5KVFE 5BO1H 3RIFK 3OAWA 2D7TH 4UQCA 1JPSL 4XH2A 3QPQD 4M8QA 1JZ2A 4GP4B 2E9IA 5CJ8A 4UINH 2HH0H 1SEQL 2YKLH 3K4AA 4G7QB 5TF1L 3WEAA 4JQXC 3H53A 1YJDC 2BP8B 2CE6A 1XF1A 4OZHF 1JGIA 2VDNB 1P7QB 2VLJA 3TNNA 5I6XB 1D5ZB 5I1JH 2X44D 1IRAY 4K8RD 1QBLL 2BVEA 5EOQH 3MR9A 4GYBA 5AB1A 4AIEA 4OGXL 5CP3A 2G5BA 2XT1B 4G80B 3UTTD 3V5KA 1UCBL 5TFSL 4AK2A 3HNSH 3KGRA 4KJPD 2J88L 2X6BA 4PPTA 2R23B 4CJ1A 2GK2A 3D85B 2GI7A 2KPWA 2VJXA 4UAHA 5ADPL 3C8KA 5KVGL 2A74A 4LDCA 3SE4A 4YE0A 4F7CA 2AKRA 4DOHE 1CN4A 1JZHA 1WA2X 4N1CA 1MNUH 3FSZA 4ISVB 3Q2VA 2IOIA 3C6LC 1QI3A 2VERN 2CLRA 3LNEA 1Q9LB 1R3KB 1TU2A 1AGDA 4XMPL 1IC4L 4DESA 3CZJA 1SOQA 3CZEA 5LBSL 2XTJB 3VW3L 2P8PB 5D7LE 2JKRM 4WHTA 4PJ6A 5D7JC 5IFAH 4ZI8A 4O9HH 4WI6A 3PGDB 4HX1B 3UIZA 2BNQB 2EJ1A 2FQFA 3GT6A 3EZ8A 1MCFA 5AWNH 2VLKE 2E7MA 4L1TA 3F7YA 3LPPA 4F7MB 1KBPA 5JORB 1AZCA 3OMIB 2HTLD 3FTYA 1TCRB 3ZSTA 4AENB 1NGWB 5D1QD 1TCRA 5HVWA 4FFWC 4EUPA 2ZKHL 1MCEA 5EB9A 1U8JB 4NP4L 1GC1L 3T9WA 4FA6A 2NX5D 1IGFL 2JXMA 3F62A 4OZGF 3HCVA 4HS3B 1H0DB 3B2XA 1F45A 3CFDB 3PDOA 3RDTD 4DKDC 2DI7A 5GS3A 2CUHA 1ML0A 2VYRE 3RX7A 3QI9D 5F9WB 5JHLH 4ONGH 5IB1B 3IPFA 2WWKT 3FMGH 1IBBA 2EXTA 1KXHA 3UJTL 4FL4B 5EZOH 3JWNE 2NYKA 4FG6C 1E9QB 3PXLA 4S0SD 2M1KA 4GQZA 3IDGB 3MOQA 4JG0H 4UM9D 4H5SA 4Z7WE 3U30C 4D3CH 5IQLA 1HKLH 5F0JB 4F37F 4PVBA 5AYUH 1CPUA 3IDJA 5J13B 4UT7L 5I8KL 2LGNA 2NW2A 1PDKA 4AMKH 3UBGA 4UNVA 2UY7B 3BVUA 3H4HA 1KBVA 1MG3C 4FFZA 3ZKNC 3O0RL 4ATTA 5KSBB 2R0WL 4Z7QF 5B4MD 5F8RC 4WI0A 3ATDA 1USZA 2UUDK 2X0UA 5E2VL 4PJCB 3BJ91 4MNQB 3KM2A 2WLKA 2ZWZA 5A2LH 4MMYB 3AZUA 5D72H 4ZD3H 1J9SA 1TQCC 3RDTC 2YQ2A 3UMTA 1K8IB 5D1XB 3X11A 1C5CL 4W4OC 4Y1SA 3WLBB 1UT9A 3GZPA 4IBUA 1LO3L 3EH5B 2F1EA 2EIKB 1S7TB 4JY5L 2R2HB 4ZS7H 2Y2TA 1PX3A 1WFOA 4S1RL 3BFQG 3VXMD 4YWGH 3BQUC 1IBGL 3O6KH 5DJ2A 2B9BA 4NKMB 4NO0B 4QIRA 1LEIA 1E6JL 3RQ3A 1PLGL 3W37A 5AOJA 2ZG3A 1JRHI 5BOPA 5I6XC 2AZAA 2VW7A 3AUWB 1T7XA 4HVBA 3DTUB 3IJHB 3KDMB 3HNTH 4I7ZC 4OTXH 3OKEB 5LGJB 1HKLL 1EXGA 4NLAA 3KEDA 3RILA 3N42F 5EUOE 5LGJA 4M29A 5IR1A 2I60L 3WTWA 1TQBB 2JKNA 3RU8L 3HI6H 4UV4L 2PPDA 4XOCA 4CU6A 2IGFH 3FKUS 4K9EH 4B50A 2WZPD 1NPUA 3HE6D 3TT1L 2HRLA 4KQ3H 5L0QC 3KMDA 2KS0A 3EG9A 3KLAB 3T71A 1RMFH 5E2VH 1OL0A 1QSEE 5C8JA 4YO0B 3PHOB 4PREB 1R3LB 2NXYC 3QQ9C 1B4LA 4D0CA 4NUJA 1HHGA 3KPQA 4N2OA 3CFUA 3PHOA 3BZFB 2VQ1A 1DDHA 4PB0H 3W82A 6CGTA 5SWZE 1KJVA 2VQ1B 1GGIL 3QXVA 4LVEA 1AOHA 3VAEA 3NYKA 2BSRA 2ZKWA 4DH2A 3IMWA 3L95A 4UTBA 5D2NA 1BQHG 5C0BE 2NY3B 3RPKA 5CN3A 1UOKA 2V5SA 3BUDA 4G6MH 4RGNB 1MJUL 4YDJB 1GRWA 4FNSA 3PYCA 1DZ0A 1MELA 4MBOA 3G04B 1JERA 1YC7A 1BOGA 3E8VA 3MRMB 5LXGL 2AZUA 3C5SA 5EMYA 1DUYB 2CO2A 3G6AB 4LEXH 1MLBA 3C5SB 3MOAL 5DMKA 2NNFA 2X38A 2ED6A 1Z6JT 3FU3A 1NBVH 4O02A 1IAIH 1R3IH 1CGWA 4MJHA 4OGYL 3BRGC 2Y22A 2YIHA 4DO5A 4U3XA 4NKIL 2XG5B 4S1QL 3FT4B 1INQB 4B9YA 3TEWA 4MXWH 2D03H 3F05A 3PABB 1G5GA 3RWEA 1YG9A 2IGFL 2CKBA 4OLYH 3CSYA 3TLRA 1X6LA 2DI8A 1DFXA 3HUJE 5JOFA 2PWGA 3HZKB 4ODSH 3QDJA 3ELQA 2YPLD 4BKTC 4HP5A 2EKSB 3BWAA 5EEWA 4C4KT 1X3DA 5DHDA 2NY4B 3G5ZB 3OMNB 1TJHH 3SDAA 5KW9H 4WUKH 1ANUA 3MI6A 3V0WH 4RDQG 5I5IA 3D50A 5ENWA 4H2AA 5JDSA 1WO2A 3JYCA 4Z3FA 5BO0D 1I7RB 3VU2A 3GBNH 4NDMA 1OAXH 2GTZA 2MQGA 5JDSB 2Y72A 3IFPB 1R46A 3GMNB 3N5AA 5IJKC 3EFDL 5D6CA 2EEDA 4U1GB 3MBEC 2WB1A 1JZIA 3NIDB 4KZ0A 2DQJH 4U31A 2OMVB 4XNBA 2ZXGA 4KITB 3PQYE 4N24A 2VZTA 4PP2B 1NCDL 3EDKA 3CX5J 3C09C 2YD5A 3FO1B 2FAUA 2YA1A 2YD6A 2R59A 3QUMB 2G4GA 4JRXD 3W0WE 4C8XA 4GUOA 1HK6A 5E99L 3U9UB 5HDBF 5A6MA 5IF0A 3WTUA 3GUFA 1SDDA 4JVUA 5A2KH 2JI1A 2NY0B 3QULA 3NSCA 3Q01A 3R8QA 4XN2A 4XWGH 3FN0L 1IILE 1NCWL 2PW2B 1IBDA 3GSRA 3OLDA 4Q6IA 3GZQA 1NANH 4RETB 1N6QL 2D2CC 2E3VA 4CNIB 5C0AD 3GF8A 3UC0L 3Q5OA 3ZHNA 1I8LC 3K3QA 3DGGA 3LMJL 2OMYB 2OL3A 3WMPA 4BDVB 4ESKA 5CHNA 1AE6L 1BFVL 1I7ZB 2WXGA 1Q38A 4P5TB 3MUY1 1G1YA 3KXFE 3T4YB 3C9NB 1B4RA 1HHIB 1BBJA 2WQ8A 4P5RA 3NIDF 5JIKA 2JJTA 4NUPA 2FZ3B 2B8OT 1ZLSL 4P23B 1VRSA 4BBWA 5KWYC 4N8VA 3VG9C 1E0OB 2B15A 3CBRA 4X50A 3U7AA 5KUKA 4FEIA 4O9HL 4QF1A 2J8HA 1FDLH 3MV9E 3DO7A 1SEBA 2NDGA 2A6DA 5DA0B 3KLHD 1CDIA 3L3DA 1WFNA 4QF1B 4UDUB 1YN7B 2CCLA 2I7OA 5IUSA 1YPZA 1IFHL 3RI5K 5J6GA 4TPRH 2OTPA 4UDUA 3G08A 3BDBA 3QH3B 3RVVC 2W65B 1I85A 4KVNH 1U8OA 3T8XB 1E65A 1J10A 5J6HB 2W65A 3PWPB 1DVYA 4PRPE 3T8XA 2BSCA 5JW4Q 3MTRA 3PWPD 1T2QL 2EE2A 5DWUH 4BHUA 2EXSA 3KBEA 2MPVA 1P2CB 1SN2A 2WXRA 4MDJB 3S37L 5FUOL 3UG5A 1NCBH 3OR6B 4Y2DA 5T3ZD 4EIBA 5ABAA 4PJHB 1GOHA 4YHLH 4L3EB 4UIMA 4K73A 2VC2L 3WIFA 5B3JE 1SN5A 2FGZA 2QJDA 5B38A 5C08D 4HIPA 4ZMAT 5MEOB 3BP5A 2P80A 4NWTH 3N85H 3GXNA 1JWUB 3TBYA 3V6FB 5HY9A 3BEVB 4PRAA 4KKRA 3EYQC 4K71C 4G6JL 4H8HA 3QJRB 3CHRA 3CFCL 1MEXH 5IIEA 2LOEA 2PCFB 1TPXB 1O7SA 2BC4B 4M43L 5DMGC 1PCXA 5I1IH 1B2WL 3F58L 4MAUL 3FTXA 4JGMA 4QI3A 4NS0A 3AABA 4UQAA 3UYPB 3D18A 3WIHL 3S4SB 2ARWA 3KZ8A 4FQIH 3K72B 4ZPVA 2QGBA 4NI3A 3WKMH 3MCLH 3S4SA 1V7NL 2OLDA 4GSDL 4CN1A 3BZEA 3ZY7A 4RQQA 4PM1A 4RA0C 1DJSA 2EDRA 3NACH 4L8SC 5IMOA 1HZHL 3VDAA 3ZU8A 3BZEB 3IJEB 4XMWA 4KTDH 2H0JA 4K3EL 4LSPH 3V4VB 2BM3A 2UZXA 3ATBA 5SV4A 1BZ7A 4WWKC 5F9OL 2V2TA 4Y4FD 4A37A 3S3SA 3MA7B 5LXGH 1QYGH 5D1ZD 1OSEA 1NFDF 3M88A 3U82B 3KXFA 3I9AA 5IVZB 3IVKA 1I75A 1LO4H 2XYCA 3UIYA 2WLLA 3RWDB 4MNGB 2MIZA 4W9HC 3QZPA 3WFHA 3QFDA 5I16A 1UEMA 1CD1A 4MDIA 4OLWH 2QVKA 3VI3B 3VACA 2PTVA 5DJZA 3O2DL 3DJ9A 3H9SA 3EGDB 4Z23A 4DZ8B 3VI3A 5B1JC 4A63A 3DKHA 4W6YB 4UQ3B 4FABH 3K81A 5C09A 5C6TL 4KDTC 3F7RA 3SE8H 1REIA 3IU3A 4HJ0C 4P3CH 1U8CB 1DVFB 4UYQA 3K6SA 2WB7A 4ZG1A 1NIDA 3WEXB 5CO1A 5HHNA 1OSZB 1GAFH 1KGJA 4S0TD 3PS6A 2FNWA 2BS71 5BMFL 2CJ3A 2H47C 4FKHA 2E75C 5BQ7A 2D7QA 3QNFA 4NN6C 3LOWA 4JQXA 5EIVA 3RLSA 1EHNA 4RFOH 5DRNA 1C7TA 2EYSB 3GUTB 4B9ZA 1E90A 4FERA 3CXFA 4HDIB 1CFBA 5BS0B 3R7RA 5IKCA 1AYRA 4HDIA 3I6KB 2K70A 4GRMA 2AAAA 4PWIA 1N64L 2WNWA 5JLZB 4GSUA 4JAMA 1PGRB 4YHZH 5EBMA 2VGLM 2FD6H 3K6IA 4PVNA 2AHIA 1FL5A 2IALA 3K6NA 4NQDA 5IBTL 3WTSA 2FWUA 4DKTA 5LCVL 4FJ6A 4QRQB 4JPVH 1Z5YD 5HHMB 1UURA 1UZ8A 2YWZA 4XX1E 4HAGA 4X9HA 2P5WE 4YWGL 5C2UB 4RFEA 3VB8A 4GSRA 4JFZH 4ODUA 4BFEA 4AUUA 1CT8A 2QVMA 2V2XA 5LBSA 4GJTB 1THAA 4NQCD 1NFIA 5FF6B 4B5ZA 1E4WH 4DW2H 2A73A 5K93A 1QAWA 4MAYB 3AU1B 4QYAA 3ZOAA 5GS1A 4KQ0A 5CINL 4HWZB 4ZAKA 1ZTXH 5EORH 3ZW3A 3AG3B 3TS8A 5AOMA 2Z8SA 3KPRA 5GS1B 4ZFGH 5BNXD 5KYWB 2R0WH 3VWKC 3P4MA 4U6TA 3TX4A 3V8CA 2LU7A 3X3FH 3BDXA 3KEHA 4XNUL 1YY9C 2PETA 3KJ6L 3DVFA 4EXPX 1GGTA 1VGEL 2VDMH 4JFEE 1EANA 3M8OH 1JHTA 4PB0L 5SWSB 5FM4A 2WXMA 3QJHB 4PLNC 2VLKB 5I1AA 1Z5HA 3Q8FA 3ARBC 5I6KA 3MUZ1 2X6MA 2AEOA 5LB1A 2HRHA 3MREA 3IDMB 1QQDB 2BOCB 4K8RL 1GYUA 3M1CA 1JPEA 3IDMA 3A6BL 5EEXA 3GMRB 1BJ1J 2IDQA 1KIQB 3MRNB 2DTMH 4IM8A 4QTHA 3TT3H 4MS8D 2B3IA 4KQ4L 2OZNA 3MFFB 1AI1L 1CXKA 2ZUQB 2YMOA 3OWEA 4KXZH 5K1NA 1N10A 3HJEA 1Y0LB 1I7UB 3PP4H 5DJ0A 1EO5A 1Z9SA 1CFTB 2YBRA 4NEHB 5SX5H 4F1SA 2A4CA 2A77H 2YAOA 2YSTA 4KNUA 3CSGA 4BFGA 2FT8A 5HYSG 5JQ6L 4HHWA 4I5BA 3GGWA 4FD0A 3Q3GB 4LCYB 3KYNA 4ZTOH 1OT2A 4MJID 4LCYA 3DJRA 1RIUH 4HFUH 1AHWB 4KI5D 4EUPB 5JORA 2G60L 1F4XL 2X6AA 5LBGA 3O2VL 3SDXB 3LKRA 3NPSB 4I3RL 3HCVB 3Q0HA 4HS3A 5KJ7E 2OYPA 5GZNA 1N0XL 1LTXA 4L4VB 1H6FA 3V0EA 4WHYG 5EU7E 5H4ZA 5IB1A 3UCRA 4M00A 1U95B 3GRWL 3MNWB 4UM9A 1TQVA 5LWYL 3ULUL 3MACL 2FSEA 5DDHB 4DUWA 1DDTA 3QRBA 3LXUX 2IBGA 4CILA 4M03A 3ZDXB 4TLUA 4DPCX 2ZUQC 2GIYA 1J1XL 3O4OB 1J87A 4Z7QB 3FL7A 5D71H 3BWUF 1BOYA 1G9EA 2WOYA 5KSAB 5TD4A 4F7CB 4LF3A 4PY8J 5AB2A 1VACB 2FJSA 2IF7A 2UY7A 2BIQA 2N0KA 2B5IC 2C9AA 1VACA 5ABDE 4UQ2A 5DU7A 4CSZA 1MQKL 1P69B 5IVOA 1SXAA 1OHZA 4PAZA 3WLBA 3TM6A 2RIKA 3QUZD 2MOQA 1X4XA 1WCQA 3MTXA 1NMAH 4E41A 1CBVL 5DUPL 3T2QA 3WU1A 4ZX6A 3HG1E 3MX0B 3CFMA 1OCRB 3G5VA 2JB5H 4L5FH 2OR9L 3MX0A 4BQBA 1P84J 2YUVA 4G6AC 4F58H 1TCMA 2XKNA 4HALA 4PLOB 1ZLWK 3WHXA 3MGOA 1CBJA 4ZW5A 1NC2A 3TO2B 3KD4A 1GZHC 3UTZB 5I8CB 3INUL 1BXAA 5TE7L 3VXOB 4J3OD 2A4EA 5AENA 2H2SC 3P02A 4XBEL 2VN5A 3WCYA 2BSBA 3MZTA 2NX5A 1S7QB 2IH8A 2GJ6A 3R0NA 1MAJA 4XCYB 4P23C 3UACA 5LBSH 2NCEA 2ZONA 3QJZA 4F9PA 1MIEH 3ILPA 4OFPA 2IV8A 4F37K 1AAJA 2OCJA 5KJRL 1XD1A 3OKEA 4P2OA 3ILPB 1DQVA 4CADA 4ADGA 1RUAL 4CADB 3IMRA 2F53D 3KL3A 1YQ2A 1JV5A 4ZFOB 5C8JB 3FT0A 4NQXA 3ZL2A 3L2LA 4DO4A 5JXAL 4HJIA 4NKDA 1U3HA 2O30A 1JK9B 3BZFA 1LO2H 4LPYA 2F58H 5IUCA 1Q0YH 2XV3A 3REVB 1F58L 3F12A 3OM3B 2ADIB 4XR8C 4ENEC 3P77A 1R3LA 1OB1B 1P53A 2IANE 2J21A 2H5UA 5JHMA 1UJ3A 1I3UA 1JF5A 4QOKD 1E40A 1UHVA 5I1CL 1QSFD 4N0RA 2GJPA 3DETC 3SE3C 1FORH 4PRDA 4R0LA 4U6YB 2VRAA 5DJAA 4IRZH 3BZ5A 3SDDD 1BXXA 5AUMB 4X5WA 4FNLH 1BX2A 3G04A 4N2EA 5I0YA 3OKKA 5BZWA 25C8H 1TQSA 3QORB 1JZJA 3SO5A 3OKKB 3BAIA 2WSPA 3LS4H 1KDJA 3N06B 4ZTOL 4EN3B 4MB5A 1BOGB 5DD3H 1ZXQA 3GO1L 2M2DA 5CUSL 2TAAA 1NCGA 1AGFB 2EILB 4KK5C 4WV1C 3SJVB 2EE3A 2NY5C 5FFLA 4NKMA 4IOFC 1UD5A 2H1XA 3AG2B 2G4EA 3ZUCA 3FO9A 3PDDA 3MYJB 4KOBA 3FQ4A 3PRZA 4PJ8D 4Y4HB 3RWIA 4YDLC 1VERA 1A7NL 2X42A 2JKJA 3CFBB 3RWIB 4WLCA 3T77A 2GSGA 1HHJA 2WHVA 2YUXA 3V52H 2QZQA 5I0ZA 3TF4A 5KS9B 1LO3H 3UMNA 2YPVL 5K59F 3HZKA 3M1BB 4E5XG 2X3BA 4WHDA 1I8UA 4F57H 3M1BA 3NCFB 5I74C 2VWEC 4OGAC 2ARJA 4MZIA 1B0RB 4EI0A 4JX0A 2VR3A 1B9KA 3KVPA 1UWXK 2UYLA 3L9RA 3N50A 4K7PX 5GGSA 3IFPA 2EADA 3GMNA 1XH1A 2GSIA 4NUJB 3BN9C 2A9ML 4OCSL 2P47B 4W1TA 3V55A 4FQJH 4PJDE 4L37B 4UWQB 1T6BX 5A2FA 3FRUB 4JG0L 4PJEE 3MBXL 1CF8L 5EZOL 5HYIA 1EDHA 4WV1B 1ZHNB 1DQML 2FX8L 3NUKA 4GMTL 1H6UA 2OMBA 4C59B 4JRXB 1EZVY 1T04B 2MTPA 3FO1A 4QWWD 1A3ZA 3BWZA 2I5YH 1BD2B 4MJ2A 5FOJA 1U8QA 3QORC 1U8KB 1S46A 4X5LA 1P1ZB 3D34A 4I1RA 1UXMA 1KSRA 5ITFA 2NY3C 1GA2A 4O4YL 3O6FB 3M46A 4OGQC 3VO0A 2DQJL 1FZJB 3NIFE 1OTUD 1V7NH 2CDGB 2OZ4A 5E94A 1YEJL 1P5UA 2VNCA 3LZQA 4V1DB 2P45B 3CLFH 4XVTL 2F54A 3L5XL 3QW9A 5E94B 3T1FB 5JOFB 1DJGA 3NCMA 5DEZA 5AW5B 2C3WA 4JN1L 2CUMA 3BWSA 1JJUA 2F74B 5J57B 3X3GL 5H2BA 4NPJA 1CIUA 3QG7H 3T3PB 1TENA 3CIAA 1FFNA 3N40F 5H2BB 2IWGA 1I85C 4X0NA 1I7ZA 1FYTA 3UBFA 3LB6D 1G1CA 3RGVC 4K94H 1LO0H 3KHOA 4W9LC 1DLFH 5IOKA 4P23A 4WTXA 1CK0L 1QATA 1BQ5A 1YMHB 3ZTNH 1MW0A 2QTEA 5J12B 3HNSL 2VM4A 3D08A 4OBSA 4U1SA 1I3GL 5JW4N 3CXDH 3I9GH 3T0WA 1ZPLA 5LN8A 3S35H 4PS3A 2JJVA 1IEAB 2IOOA 4MAZA 4WUUD 5CEYB 4DCQA 2XKSA 4IBZA 2F1AA 1KCUH 3GMOA 4ZOEA 1YQVL 5KN5A 1O6SB 5AAMA 1W0WA 2ENSA 3EOTL 3PJNA 3DX7B 1R3JA 4S2SB 1YN7A 2P5ED 3CBJB 5J6GB 1F90L 3S8FB 1J48A 1MWAB 4UMGA 1H3XA 5IMMB 5FYJL 3Q6FB 2B59B 4KC3B 4YXKL 4XGZB 1OF0A 5GGVY 4CSTA 3LXBA 4F7EA 1M3JA 3BW9A 4XHQA 1P2CA 1LYQA 1VEMA 4WEMB 2DLFL 1PZUB 2AQTA 3JWOH 4OM1H 2BDNH 1ECYA 1JZ3A 2YMXH 4JPKL 4B9CA 3OLGA 3FUMA 3ZE1F 4HZLA 1KFAL 2NY1B 4HA1A 2UXTA 2FGWL 3HIZA 3TBYB 2GBAA 3BKML 3BO8A 3MSPA 5ISZE 3JV4A 3O2WL 3OR7B 4GRLB 1J05B 1SMAA 3BVXA 3BO8B 1CI5A 3MNVA 5CHNB 1CK0H 4FXTA 5DHVB 1HCFX 4Y5XA 1FGVH 3ARWA 3T4YA 2HJKA 4LSQH 4M1DH 1G7LA 3GSVA 1MJ8L 2IAMA 2NQ3A 4JREB 4OCXH 1E8ZA 2K7PA 1G7LB 3VSVA 1KIRB 1XCTB 2HLAA 3LEVL 2NQDA 3KGSA 2BC4A 3AXIA 3OKDB 2VZSA 1W6LA 2FTAA 1OXYA 4DP0X 5ETUB 2DWEA 3LD8C 4UV7L 2BSTB 3QUYD 2D9QB 3W9DB 2Q2EB 4K0OA 2CO6B 3ZXAC 1WAEA 3ZZ1A 3B6SB 3GIZH 2BSTA 2EO9A 4L2YA 1JFQH 4F58L 2EP6A 2M8XA 2BVOB 4PJBF 4YHML 2J6EL 4K9JA 3KVQA 4QT5A 1IIIA 5DLML 5GGUA 1ZCRA 3D2UD 1QD0A 1FHNA 1NIEA 1JZ8A 2WUBH 1NA8A 4Z7VF 3SCMB 3MV7D 4Y4KA 3CH1A 3LMJH 2B9AA 3IRCA 1FYHB 4TVPE 5EO1B 1UXSB 2F7OA 3GSOA 2B2XH 2C9QA 3LEYL 4PUBH 3TFBA 5AVRB 3GSOB 4PB9L 3K6FA 1MFBH 5CU9A 4PJFF 4HMEA 5E9DB 4L3AA 4EMZA 3V0DA 2VUKA 3VG9B 1JZ5A 1VKXA 4L3EA 3RX9A 2E9JA 1CD1B 4MDIB 2O6CA 2JJUA 1SJEB 4NZTH 1GZHA 4TLSA 1S78D 3PU7A 1X5JA 1RIHH 1ZT1A 3U0PB 5KVGE 4WI7A 4ANVA 3VQ2C 4FYTA 1FDLL 1EAPA 3AS0A 4TM9A 5LXVA 2W91A 2J57A 5CR8A 5BVPL 4FFYA 3F64A 5GHWL 5EG6C 1CL7L 1CGTA 1Z0MA 2GFBA 3Q9PA 3ZSSA 4F57L 3BFOA 4K4KA 3ECVA 1W2KT 3FOMB 3DO4A 5FYJE 3H3PL 5ACMA 4TUOA 1U91B 4WTZG 2AITA 5C09E 3SYPA 5GGQH 3F8UB 3LKOA 5IT2L 1V3LA 1DQKA 3N9GH 2X2YA 1NIFA 3ZRCC 2GT9A 3LKOB 5FM8A 3I6KA 3S3PA 1J1OH 1S7XB 3QWQB 2D0GA 4PJBB 5LAXA 1R0AH 4N68A 3A3YB 1AMXA 4PJBA 2XFXB 1FL5B 2IALB 5E2UL 3TO4B 4JFEA 3QDHA 1I8IA 5CUSH 3IJEA 3VI4E 4JFEB 1G5AA 5GS1C 2WIMA 5IW6A 5KVMC 2EXYD 5B39A 1GIGH 5SWSE 2V2TB 3FU0A 3HPLA 1SRDA 3OPZL 4NXSA 1B4JH 4UDTA 4J23A 5INCA 5F7LB 5IMLA 2Z31B 4JKPL 4MASA 4PLKC 1KXTA 2NYZA 3AU1A 3QQ9D 3VWKD 2KPNA 3FB7B 3RWDA 4X7DC 4BZ2L 1RPUA 1QBBA 1NFKA 1PL3A 3WFHB 3GM0A 1S7VB 5JIDA 3QUZB 3C08H 3CLEL 4J7RA 4QO1B 4PCTA 4MNQE 3UG4A 4YSDA 5FUOH 5GXBB 5KVDE 2C9PA 1Z5LB 3HUJF 1TETL 4Z3TA 3IPEA 3IU3B 1XGQA 4X6FA 2BIHA 2FWSA 1Z5LA 5DR5L 3TN0C 3S8WA 1BYOA 3E2HC 4M6OH 2PXYC 4TNVK 1Y18A 4GT0A 1A6VH 3ZE0E 1ZLWH 4XCCL 5BZDB 1JL8A 2GSMB 1QFUH 2X41A 3CK0H 1TSHA 2AJ3B 3ROOB 4HIXL 5T33L 3V4PH 4G11A 2K6WA 2EYSA 2V5YA 3GUTA 1QQDA 1V10A 4CKVX 4JO1H 2D2OA 4V2BA 2RTTA 1DVFC 4YBLC 4CAGA 4DP8X 4TUJB 1MRCH 2YRLA 5FX3A 1M53A 4Q9BA 5E6RB 3P2DA 3VD1A 4GAGH 3HZMA 5CSGA 4XMLH 4ZW7A 1CLCA 4NN5C 1UZ8B 1GGCH 4RDBA 4ANUA 3D85A 2CJTA 1OD7A 3GINA 3QZNA 5DJ0B 4CMHC 2CXGA 2A4ZA 1JGDA 3LN9A 4GS7C 2A74B 1UQSB 4AYDC 5E6IA 4HC1A 5FFOA 3PUCA 3IYLW 4KGJA 4FL4C 4UIKH 3LXCA 4MHHI 3S98A 4J3OC 3IM1A 2KT6A 1E4JA 2YBRB 5HDBE 5JR1H 4YSUA 2GC4C 2YGNA 3UDWC 1MUJB 1RCYA 2QQLL 1G6VK 2FCBA 4L9LC 3AY2A 4QR7A 1WF5A 4YR6B 2ZAHA 3JQOB 4MQ7A 3TZVC 1SOKA 4DEPC 2QPUA 3KPRD 4YR6A 5DVLA 3P4MB 4HPYL 2X28A 3F7YB 5DMIL 1ZJBA 3BT0A 3T6WA 2P1YA 5T33H 1FSKB 3LKRB 4XNYH 3X1NA 1TQBC 4UYPA 3DTDA 5LAPA 4YSTA 4MXQC 4PY8I 4L4VA 2YOCA 4LPCA 4W9DC 3BIKA 1DFBH 3NJFA 4J3OH 3T8VA 3VWJC 1QKZH 1P7QA 3BIKB 1FNEB 1LVEA 3QJHA 3V0VA 3EYOA 5I1AB 1YCSA 2ALWA 3PPEA 4YAQA 4YHLL 1FNEA 4PMFA 2FJGA 2H1PH 4PVLA 5IQ7L 2EKJA 3RIKA 5E51A 2FWOB 4D8PB 5E95B 1A3RL 1GGBL 5DZAA 3FT9A 1E9QA 3CXHK 3QXTA 4M93B 1KPVB 1BVZA 5D6DA 3T3ME 4M7LL 5I0VA 1A9VA 2HTKD 4OLXL 4BWTA 1I9RH 5TH2B 3MFFA 1RZPA 1PDKB 2Y9RT 3EHBC 2WWMD 3MA9L 5LDSA 4AL8C 5DVMA 4NIYE 4GAAA 2IVFC 4EBQL 2CHXA 2YD7A 5MP6L 5AOIA 1TQCB 2FEEI 1BIHA 4XNDA 3BGFB 4PJCA 4W4OA 3Q05A 4UQ2B 1NTDA 2NR6C 2BZDA 4FNPA 4AIZB 3QZBA 4E41B 1PYWA 3QWNA 5I17A 1RZJC 1SVCP 2YAHA 4FEMA 3G5VB 1PYWB 2CGZA 2MOVA 4DVBB 3ABMB 4NP4H 4RZCA 4MB1A 1A25A 4NQCB 1MFVA 3E7JA 3L81A 1JDAA 3D33A 3SGDH 4A2LA 1B4TA 4HULB 3IKCA 4I1NB 5AVXB 5I8CA 1AHWA 4H40A 5D1ZB 3E1ZA 4MAYD 5HDQH 2BCMA 4MHHG 5FYJD 1PAZA 3R7QA 5D1ZA 2ICEA 1JNHB 1ZVHA 2VC2H 1F86A 3UTZA 2LLLA 2ICEB 4BXVA 4BFOA 3KXFD 1JNHA 4NI6A 5T3XL 1H0DA 3LKNB 4LEXL 3KYMA 3UZVB 2WVUA 1UVQB 1IC7L 2ZOOA 1OE3A 2VDKH 1N7ML 2GJ6B 1HH6B 4ELKB 4NM8L 2Y7QA 4GKNA 4E9TA 2G3NA 4XOEA 3TTYA 3O3AA 5K69A 3U7WH 4G8IB 3B2PA 4IOIA 2E86A 3GS0A 1CGVA 2XZAL 5IR1B 4A04A 4H5SB 2HVKB 1C1EL 3SOBH 1JS4A 5G4OA 3HMWL 3DXAB 5ILTH 2JCWA 2G3XA 1AHWC 5DCCA 5DUMH 3W81A 1RSYA 1YUHA 1OB1A 3I85A 1JZFA 3CZSA 1CL7I 5IVNA 5E5LA 3EDDA 3QGVA 3FTSA 4D0CB 4KZEH 2X7LA 3REVA 1TMCB 1DDHB 3B2UD 5DRXB 4KJQC 1UJ3B 3RWFB 5AUMA 1WIOA 3UDWA 3P11H 4UT9L 3DSFH 3C6LB 5IQNA 3HC0A 5BZWB 5T5NF 2GCYB 3V4PA 4E0RB 5HDQL 4JKKA 4KKBD 1P4UA 2JVUA 2GCYA 4ETYA 5CP3H 1T20A 3TA3B 4K94L 2AEQH 2CR0A 4GRLC 3EJQA 4P3DB 3IRZA 2OR7A 2J3SA 2H3XC 5D8JL 4YSAA 4AMWA 2A6KA 4J6IA 2Z4QB 1F2XK 2JSFA 3ET9F 4IK7A 4RGNE 4I2XE 3S34H 1FLRL 2OTUB 3SPVA 4CW1B 3ARZA 2P44B 3NA9H 2MWCA 1MIML 4OCYH 2N0MA 3MLRL 3VXOA 4O02B 2XWDA 3WGVB 1LEIB 4ADIA 1MI5B 5DTFB 2DQTL 3FSWA 5CJOL 5ANMB 4APQA 1S7QA 4HC1H 3N1FC 2A2QT 3IPBA 4JR9H 3LV3B 4Y4HA 4W9KC 3UTSD 4ZXBA 1KUMA 4YFLI 1AG6A 2COVD 4R7NA 4U49A 1THCA 3QHFH 32C2A 4FA7B 4L8DB 1OY3B 3KG5A 4XN9A 5IEKB 3ETSA 1QTPA 32C2B 15C8H 3NCJL 3Q8CA 4JG1L 5ABZA 5B22A 2XWJB 2NUTB 4K3JL 5D5MF 3L9RB 2NXZB 4ZUVB 3G5ZA 4LSRL 5HPOA 3UC0H 1B0RA 1MPAH 3VXSB 4OM1L 3UOAB 1TO4A 4DP2X 2PCPA 4C56E 4EUPH 4NAQA 2JKXA 2X05A 2VDNH 3QORD 4BJLA 1NMBH 3FC8A 1KJVB 4I77L 3P3SA 5ACZB 1UM6H 4IGBD 1ZLUH 2PR9A 4GIOA 5ACZA 1QACA 2R56H 1N3NB 1J0YA 5DQDH 1AZVA 4U0RC 3BUQA 3WXVL 5A2BA 3C87A 3BAWA 4XAKE 5GGRA 5KANG 4M5YH 3GMQB 1ACYH 1KZQA 3VFMA 4EKJA 3VFRB 1DL7L 3MJGX 2PF6A 5K5YA 1ACXA 3ML8A 3VFRA 3CN2A 1S9VB 4Q8BA 3E8UL 1EEUA 3VNYA 4DP6X 2EUVA 1U0QA 3G6AA 3GBLA 2DQFA 4PJGA 4PRID 1DQLH 5CLTA 1FWXA 1BD2A 4PJGB 2AC0A 3SJVA 1VPOH 1RL1A 4GFXA 2CDGA 4TN9A 1J11A 4XXCC 4NPYA 3O6FA 2AQNA 2F54B 1QHQA 3QXDA 3QYMA 1SBBA 1ZMYA 1T5XA 1XMWA 1BIIA 1BM3H 4P2AA 4I0PC 4WU5A 4XPGH 1QZ1A 4AC2A 1HC1A 1A3LH 3D05A 1XGZA 2VB5A 3FF8A 4HWEL 4ONOA 4XPTL 4DFIA 3T1FA 2GIMA 5T3XE 3V0WL 1A6PA 1QNZH 2YBGA 1A6TA 5DZJA 3QIBD 4YNYA 1A6TB 4BCXA 3V4LA 4F15C 2OMYA 4LP8A 3LIZL 3ARFA 3DV4A 3LH9A 3VH8B 4RZKA 3U2JA 2Y06L 4XBEH 1H6EA 2C4FT 3LS4L 1OEZW 3QS3A 3RB5A 2GSIB 2EZ0C 5F3BB 5EF0A 3THMH 4A38A 1DBJL 3LQAC 3C5ZB 3T0EE 3VG0H 4N5ED 1TJGH 4FG0A 3FRUA 2XQBL 3PNWA 4KVCL 3LRGA 4ZXBC 4X99A 4YUEH 2XBZA 1A47A 3PNWB 2BVPB 1PZCA 1WWBX 1A7OH 1IEAA 3LY6A 4N28A 2QDWA 3V6OC 1S7WA 3FQXB 1T04A 4IGBA 1F58H 3QQ4B 3L3DB 3JTBA 3Q6GH 1PS3A 3VXRB 3VD0A 4R96A 4B9IA 3HUJB 4KUCD 3GPSA 5D96B 4IW4C 3HOGA 4NO5B 4U7SA 2E8ZA 2EDMA 3ZL4H 2YXFA 4MXVE 1U8KA 5J6HA 1Q90A 3IMTA 4ELMB 1JPSH 3BW9B 2NNAB 1ID2A 2X4NA 4QRAA 5BO1L 2M26A 1J8RA 1SEQH 3Q6FA 4L5FE 2OJEB 4NRZA 5KSBF 1FE8L 4MDJA 2PCYA 4FLRA 4U1HB 2PW2A 3GSRB 1WFIA 2ZXBA 1QEWB 1PLGH 4JK0D 3ARDA 1RI8A 3K2UL 4RDQF 4EUPG 3FQNB 1I8MB 4M7LT 3U1QA 1LJMA 4MS6A 5E0QA 3PAZA 3FQNA 4NBZB 4X4ME 5K33A 5I66B 1F6AA 3HFMH 3NCJH 2XXFA 3BP5B 4Y5XB 4E9LA 5CKGA 4TQPA 4G8GD 5AW0B 5J11B 2YO3A 4QXGH 4K3JH 3V6FA 1GPOL 3WJLC 5BV7H 4MD4A 3EJSA 1I9JL 5E9DE 4ACPA 3ZE1E 2OMNA 4JLRB 2BVTA 3S5LA 5DD6A 4OZGA 4HLZG 4IRJD 3FHQA 1R17A 5J89A 2K8QA 2YAQA 1WZ1L 1VJSA 1WT5A 3GJFA 4OI7A 4ODVL 3JV0A 2P5EB 1JTTA 3DHPA 3G6DH 5IGXL 3TJHD 5KZCB 2XZQL 1ZK9A 3PP3K 1IC4H 2F15A 2Y69B 4X8JA 4ORZC 3SYAA 5J8OA 1Z9OA 3W9DA 2CO6A 2VDRL 1O6SA 4JFDA 2W95A 2WW8A 1XIWD 3MJWA 4Z7VB 4FXKC 4MLSA 1EXHA 4JO2H 5E99H 5HDRA 3AREB 1EEZA 5IMMA 1FNAA 3FXIC 5F2FA 4HFWA 2FEJA 1WRFA 5HGBB 3M07A 3GXDA 4FFWD 1YN6B 2EEBA 2A38A 2OSWA 5DVOA 5HGBA 1VKXB 2HG0A 4WCYL 3LZLA 4HJ1A 4WK0B 3KXFB 2EDEA 4DQOL 4ES9A 1IGFH 1MCBA 3ABZA 4UIMB 4KO9A 2KQMA 1XB8A 2JQAA 3DMMC 1AZRA 3RX8A 1KV7A 1R5IB 1IJ9A 3EFFA 4R2GB 1OAJA 1SJEA 3II1A 5BCAA 1WC7B 4GRLA 5DTFA 3V79C 1F90H 2G30A 1M05B 4MZ3A 5TGBA 4DQAA 2AXHA 3IJSA 5A7BA 4PBWD 1UKQA 2W94A 2EYTB 2QDVA 1YQVH 2NSXA 5JMRA 4FJYA 3GSVB 5HHOB 4KNTA 2CLVB 1MFEH 5AW3B 3K6SB 5EU3B 3T6QC 2P4AB 1MOEA 4GKSA 4XT1C 3TEYA 1KIRA 3SDDC 5HHNB 3VGBA 3MLUL 4BUQA 1BBDH 2P5WD 3ZTCC 4KH9A 1E67A 2QQNH 3GMPA 4OLVL 1KGCD 4YSOA 2DEYX 3NJKA 2R8SL 5B1AB 4PRBA 1YYCA 4HBCL 4UTCA 5J0BA 5E23A 1BYNA 3QFJE 3NEEA 4HUWA 4LASH 5KUMA 3B6SA 2RAMA 5FDWA 3T2LA 4GSDH 2J5LB 1YUKB 2XQ0A 3SDCD 5LAXB 4JM2A 4QT5B 3H7BB 5GGUB 4L3EE 2F5BH 4HJJL 1A21A 5EBMB 4HISA 4J4PD 4JM2B 4Z3IA 3P2TA