1KIUB

Fimh adhesin q133n mutant-fimc chaperone complex with methyl-alpha-d-mannose
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
279
structure length
279
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRNTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHAPERONE PROTEIN FimC
publication title Structural basis of tropism of Escherichia coli to the bladder during urinary tract infection.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/cell adhesion
total genus 46
structure length 279
sequence length 279
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2001-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00419 Fimbrial Fimbrial protein
B PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1kiuB01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1kiuB02
3BWUF 5AAPA 4ATTA 2JTYA 4XODA 4AUUA 5FLUA 4AVHA 3RFZA 1UWFA 1KIUB 4X5RA 4XO9A 4J3OH 4AVKA 2XG5B 1ZE3H 4AVJA 4AUYA 5LNEA 3JWNG 4J3OF 5LNGA 5F2FA 2UY6B 3ME0B 2J2ZB 2UY7B 4XOCA 5JQIB 2W07B 4XOAA 1N0LB 1KLFB 5FWRA 4AV5A 2JMRA 4CSSA 3ZL1A 3JWNE 2WMPB 4XOBA 5IQMA 3ZPDA 3SQBB 5AALA 4X50A 4X5PA 5FX3A 5FS5A 4AV0A 3JWNH 4BUQA 3BFWA 4LOVA 5IQOA 4CA4A 4AVIA 5CGBA 4J3OG 1N12A 3ZL2A 3MCYA 4X5QA 4XO8A 5AB1A 4AUJA 4XOEA 5IQNA 2VCOA 5ABZA 2XG4B 1QUNB 1TR7A 5F3FA 4AV4A 1PDKB 3BFQG 4CSTA
chains in the Genus database with same CATH superfamily
5HGBA 3I50L 3NFPA 4FKEA 2Y1ZA 5HVWA 1JNJA 5AAMA 4GMTL 5FLUA 1UEYA 1X7SA 2XFXB 3AB0C 5FPIA 5C86A 5F7BA 3OR6A 2ODIA 4PB9H 2IDQA 4GG8A 4NQTA 5T3ZD 5DZOA 4G8GB 3IFPB 3ZDXF 4J6RL 3OAWA 4X5RA 3OMZA 1FL5B 3DSFH 4KKCC 3D0AA 4XNXL 1ZTXH 5I6LA 4EO5A 4WU7A 4YBQC 5IWLA 2B1HL 2IFFH 4MA7H 1X9UA 2Q5BA 2HVKB 4R5XA 1XAKA 2UVEA 1OSPL 1YEFL 3ARBA 3HZVA 4JFWA 2W65B 4TXVB 1ZGLB 3WIHL 1IBHA 3POHA 2GEQA 3OJ2C 2TRHA 2AVGA 2VZVA 2X9WA 4HT1H 1X5AA 1JZ2A 5DSCB 3DXAE 4KJYB 4PFEA 4MA1C 4F8LA 3Q0HA 3UAJD 4B97A 4IGBD 1YVLA 3ESPA 1L7TL 3BKJL 3QIWC 4YZFE 2I9LA 4Y4KC 2VR5A 3KWVA 4IDJL 2P5WA 3KYNA 3QEHA 3CD4A 3TO4A 4IBLT 4Y1TA 2ALAA 1UM5L 1JG9A 4L1HA 1RIVL 4ZUWA 3ZGIA 4WFGE 1F5WA 1RSFA 1G5GA 2GBAA 3HE6D 5LBGA 25C8L 4KKBD 1T1YA 3BEVA 1AFVL 1OW0C 5KSBB 4OF5A 4U7SA 1MHEB 3ZT6A 4FQLL 4IGBB 2XWCA 4Z7UE 1FZJB 2YGOA 3HI1B 4A63A 4YZWA 4Z0XB 4UF7C 3U25A 3PFQA 3TYFA 3VFMB 3U7YL 1JRHH 5C09A 1U93B 4GXVL 2VN4A 4PJHB 5T1DL 5DJ6B 3QPXH 4KRMB 3U0TB 2P47B 3CVIH 2F53A 4Y16A 1BMGA 1JCKA 5KSBF 4Q9QH 3OQRA 4K55A 2B5IC 3HE6B 1F4AA 2ITDA 1CO1A 3WO3B 3L3HA 1OCWH 3QUML 4A2MA 4YFLI 3K71A 1PF3A 4PJHF 4H0IA 1EJFA 2J20A 1SDDA 2CGRH 2IANA 3O3DB 4HXAH 2W0KA 4LP8A 4ZS7H 5H94A 1GS6X 1RIUH 2OLDA 5GGUB 3V8OA 5CGYC 3QA3A 3EO0B 4KK5D 1PDKB 3RDTD 4DEWA 5E9DD 3T0BA 4QRPE 2XA3A 2BRRH 5AAPA 1SVBA 4KNQA 4CKQA 1WC7B 3RIKA 2O61B 1E8ZA 3B3IA 4RFOL 3LHPH 3ZOAA 5D2NC 3ULUE 3T0EE 3GJFK 3UO8B 2OQJA 3L4UA 1UM6H 2YD5A 1A7RH 4IRZA 3RZWA 3QFJA 3NIDB 1A4KB 1RZ8B 2G5RA 2GSGA 4P04A 2CK2A 3RDTB 4OCSH 3OXRA 2GY7B 4DGYH 5E9DB 5HD8C 1QW9A 3JT2A 1E5UI 43CAA 3F5WB 3BIKB 3FONB 5MHSD 3TT3H 4NQSB 4FG4A 1WBZA 1JF5A 4YFLF 4KX8A 3NGBB 2GT9A 3C6LC 3T0VA 4OKDA 4OLVH 4OLXH 1AQKH 1XR8B 3NIDF 2J2ZB 4X6DE 3NJFA 1T1WA 4PVMA 3L17A 3LKOA 2J44A 3CNKA 3TC9A 4TS6A 2WGXA 3PP3H 4H26A 4C54A 2WTRB 5AG9A 2OMWA 1GJUA 1BW8A 1FIEA 5TF0A 1XZWA 3UDWA 4YOKA 3L48A 4QI3A 5HVHC 1MAKA 4L8BA 2BXZA 1MXGA 4EN3A 3DX9B 3CFEA 3LXAA 4PJIA 5K59F 4Z6AT 2CR0A 3US1A 2YEVB 2IBGA 4FFZA 2QHRL 1KJ2L 2O26U 2A9AA 2BIQA 4U1JA 3UCRA 5F89B 4LU5H 4TOYH 2RIKA 3BZ5A 2UY7A 4M1GL 4Q89A 1PBYA 3OKYA 4BEIA 5FYKU 4BSJA 1M7IA 4MA8L 4Z5RB 5KVDE 2VZ1A 4AZ8B 5EZJB 1MAML 2NSQA 3DECA 5F88B 4DW2H 3SOBH 1HQRA 4NP4H 5E8EA 4WAFA 1MCJA 1SXAA 4YDIL 4F9LA 4Z76A 4APQB 3BFOA 3BJLA 3HG1E 3H6JA 5EBWB 3QNFA 3BW9A 3FCBA 4MD0A 1DBJL 4X5WB 5C0ND 3RVWC 5EF1A 1NIDA 3VXSE 1LO4H 1KLGA 3PV6A 1KPUB 3CN1A 3M6DA 3FFDA 5CGTA 3EYFA 4MQ7B 3WFEH 3LV3A 3VDAA 3DIVA 3HZMB 5BUGA 4OZIB 5HGHA 1GH7A 4LCIH 3WY2A 2W1NA 3VB9A 1CBVH 3D30A 5CIPA 3PIQA 1AGDA 3QIBA 3QIUC 1KDJA 1OM9A 4OR1A 3O4OB 3HA0A 4YX2L 4KJWD 3ULVD 3GUFA 4XCNA 1A4CA 5E2UL 5C0CA 1G7IA 2XN1A 1RUPL 4R9HA 4PUBL 2C1OA 1NEPA 4Y7OC 1KYOJ 4WQOA 1E9PA 2DBJA 4MYPA 4I5BB 4YLCA 5DC4B 4ZTOH 2I9TB 1NJ9B 5CM1A 4L8SC 3VXRD 3HZYA 1YN6B 1ZHBA 3K6OA 3EZJB 4Y9GA 4R4BA 4DQOL 3OXSB 1AGCB 3BPOC 2NXYB 4NDMA 2C7UB 5BZWA 3TGXA 1I1CA 2DWEA 4ZSOE 3O11A 2E6JA 5EULV 2VH5H 2GABA 2WXJA 4YQXH 3DOSA 1LEKA 2QFPA 4P5MA 4QO1B 1USZA 4H0HB 2VWEC 1IBGH 3PHQB 4AL8H 5E4IA 4JFXA 5F1NB 2GKIA 2VIRB 3SBWA 3CBJB 2DTSA 2BHZA 2WO4A 3FBQA 2VZTA 5EU6A 5H37G 4JN1H 2Y36L 3GIZL 3OF6A 3NTCH 4ZTPL 2WZ0A 1NCWH 2A77H 4PGEA 5I5IA 2JCCF 3AQXA 3ARFB 2LAAA 2OI9B 4NN6C 3BI9X 4OUUB 4JQIA 3ULVF 3GQFA 2ZSWB 3ZUCA 2HLFC 2OMVA 4P05A 2DI7A 2GJZA 3ZO0A 4HUWA 3MA9H 4LEEA 3GF8A 4YE4L 3RVVD 2NZ9D 2W95A 5FYLD 1MHPH 2BPBA 5C2BH 1ACYL 4PJGB 1HEHC 4NC0B 4FP8H 2FZ3A 4WSKA 2N1KA 1IEBB 3EJZC 2ED7A 3ERXA 3O6ML 3VWJC 2W0PA 3JYCA 1CS6A 2VM4A 4POZD 1XF4A 3L5WA 5B7MA 1RJYB 3C5ZD 3QZBA 1OTTC 1ET7A 4LNRB 4YSRA 4TPRL 5EZIL 3UXFA 3FU9A 1OXYA 3UEQA 5I30H 5C0AA 3IJHA 3V0WL 3IWUA 4YXKH 2D31B 3LKNB 1M1XB 4PJGF 2LU5A 4PPTA 2XQ0A 4IKJA 1QPXA 5GGSB 1HSBB 1PKQE 1DHKA 4JVUA 3UAAA 4NYLA 5GRVK 3P9LB 5I6NA 4ETYA 1AXIB 3MCYA 1ADQA 4TLKA 2OBGA 3TNMA 4TQ8A 3I9AA 3RTQD 3C5ZB 4JFUA 5AVVB 4XH2B 4RRPM 1XSJA 4XO5A 3UAEA 2OZ4A 1O6TA 4N5ED 3DIFA 2AK4A 4FQJH 3D4GA 1VB9A 1JZDC 3GDCA 5T1LD 3I9IA 2PW1B 5F1SA 4TUKL 1K4CB 3D48R 1KSRA 5CJXC 5E95B 1ETJA 3IU3B 3JTTB 3CQQA 1QKZL 2B20A 2HJLA 4NSKA 2AMGA 2APXA 1ZTXE 3AQDA 2NT1A 1F86A 3IFNL 2WINA 4KVPA 4XC1H 4QWWC 3TURA 5C6TL 4AI7A 3RTQB 2A9NH 3P2BA 2IDSA 1IKNA 12E8L 3KVQA 4EUPH 4OFDA 4LQFL 3QUZB 4I18B 4XXWC 4F7TA 1F6AA 3IJ8A 3C5JA 1PL3A 3P77A 3QHFL 5T1LB 2YMXH 4GP8B 4NQEB 1A1NB 1WICA 3OHXB 4HAGA 3RKDC 3V0EA 4OZHE 5AOJA 1GGYA 3TCLA 4EPSA 3B2VH 5I16A 3O6LH 4MNHB 4WI0A 4NZ8A 4E9YA 2JKRM 5FB8B 5FOBB 2BH0A 3K5SA 5AOKA 1R3HA 2C4FU 2F8OA 4RWYH 1CLVA 2Y25A 35C8L 4XAKD 3OQ3B 1Q9OA 2YA0A 4PJCB 2ADGA 4KPHL 3UGXA 4YHPA 2QDVA 1QA9A 1T1ZA 3D52A 1CGTA 1E0OB 3FTYA 4XMWA 3PWJB 4RESB 4NM4H 1OM3H 4IEFA 2VDNH 4PW4A 4HOMA 1KZYA 2Y24A 3N1MC 4EAEA 4CVWA 4FQXC 4L2LA 4X9GA 2VDLL 2HX9A 3DRQA 3GJEA 4X4MA 2XV0A 5I2IB 1YEEH 1RKRA 5F7WC 3WELA 3PGFL 1JPSL 2B59A 1PZCA 1YG9A 1IGJA 1OB1B 2NQDA 3E1ZA 3Q2VA 2G9HA 2V2WB 3U1SH 4KOCA 2E9IA 1TZGL 4PLOB 2VLKA 3KWWB 3FN9A 4HOXA 3KD4A 3CV5A 3RAJH 3L4ZA 4F7EA 3VW3L 2TAAA 4RMWA 3H0TB 1JV5B 1TOXA 1ZRUA 1AJ7H 1CICD 1G7LB 3RVUC 4BQBA 3RZCD 4FN0A 4Y2DD 4TUUA 4WGKA 3Q1SL 2CA3A 1UD3A 4YHOL 2IDCA 4DEUA 1TVBB 4U1KA 4A2DA 4AT6B 1E8XA 2FX7L 4YDLB 3SKJL 3U6XS 5CCKH 4UIKH 3D34A 3WHXB 2HJKB 2Q20A 3O3EB 3G5XB 3VI3E 2LV4A 2OKMA 4P5TA 4WHTA 1A7BA 5HYQB 2DJUA 2K8MA 3ISYA 4FMFA 1HHJA 1JPFB 2DQHL 4X9YA 3GI8H 4KKCD 4M5ZH 3TA4D 1CICB 3BMVA 2J8UB 1B0RB 4Y2DB 3T3MB 4P49A 5I5MA 3TNNB 5BRPA 2Y3NA 3QQ3A 4NAQA 3ROOA 4BELD 1QLEH 3BHBA 2ZZUT 2WXQA 3GHPA 4UAHA 1RJLB 3U9UB 1JWUA 3THMH 4WFEE 3WAKA 2F7OA 2MNJB 1KN2H 1VKXA 1Y6MR 1NGPH 1RZ7H 2V8LA 1QG3A 4H8WC 2AXGB 2H1PH 5DHVA 4DPRA 1LDPL 2BNQD 3DSNB 4HLEA 1S78D 4Y4KD 3SDCA 3JV6A 2EDRA 3EYSL 5M95B 1XH0A 4PN6A 3Q48A 3FRPB 5B22A 2OMZA 1R47A 3EUDA 4XPAL 4XMPL 1G7QA 1KNOA 3GWJA 3P4NA 1U8KA 3TBTA 1NEZG 4J1UA 4IOSA 3K2IA 4OF6A 4PVNA 5D93C 2N3JA 1BEXA 1Z5LA 4JRXE 3MGOA 4C55A 3L5XL 4HEPG 2EZ0C 2B1AH 4MA1B 2HFFB 4XNYL 1OHQA 3QJUB 5JA9A 3PXLA 3H9HB 2EUXA 4XP1H 4TULH 3BPCA 3F85A 3QIWB 4Y4KB 5ICXB 1Y07A 5D7LB 2LW3A 4W9DC 1B3IA 2CRYA 2E59A 3FN0H 3QPXL 3S98A 2X4QB 5CCGE 5JW3L 1QSFE 5A2BA 5DD5H 4QXGH 5CEZH 4NRZA 2BWQA 3MLYH 2OSLA 1SHSA 3S35X 5AB2A 2FGWH 3V7AE 3EOTH 5HYJD 3O4LE 3FCUB 1RMFH 3K91A 3VVWA 1MCIA 5I6OA 4RSVA 5IVXE 4LLVB 1HILB 3GBEA 3HG5A 2M8XA 3VXPA 4XT1C 4AEFA 3NFNB 4HXAL 4JGJA 5FF6B 3KPNB 1Z9LA 5M7QA 4K3EH 3H56A 5CGYD 5IR1A 1SZNA 2MMXA 1WK0A 3X1EA 5IB2A 2B5IB 2J1XA 3DUHA 1MI5E 2VXVH 3EG9B 2OSYA 3U7WL 2C7FA 4ABVA 1YNKL 2MHAB 3E0GA 5HYJB 4PJ5A 1P5VA 4R8WH 3SKOA 3MOBL 2RBLA 2XVGA 3BDYL 5CN3A 1TJHL 4XMZA 5LBVA 3RBGA 1NUDA 1UM6L 4D9RD 1A7RL 3A47A 4JN2B 2EDNA 2VXTH 5DDHB 1SYVA 4JREC 4QHLA 2ZXWB 1CVSC 2ICWI 4CSPA 5HHXH 1U95B 5H37A 4DGYL 1FPTH 4HIXL 4BSWA 4NNYA 2AXFA 5F1IA 3MUZ1 1K3IA 2WKOF 3BZEA 4EJ1C 1VFBA 3G08B 3NH7L 2XYCA 3X1NA 4G71B 3ILDA 2GK0B 5D2NB 1HC1A 4FYQA 5LHDA 5AAMC 3PDDA 3ZDZE 3ZDYE 4NCC2 1MCCA 2VM9A 1N2RA 5SWZE 1FE8H 2XG4A 1CJYA 2UZPA 3WXVH 3WTVA 3WUWB 1EZVX 1YYMH 5JPNA 4JFZH 1XQ4A 2G3MA 2XV6B 4G1EB 2ICWB 3L3KB 2C8NA 4WFHD 5IY5B 2WLKA 5IWLC 3C6LB 5JHDD 2Y3AA 3ARBC 2VQ1B 3QWRD 4DVBB 4GP5B 4TOYL 3UG5A 2WO2B 1P7BA 4LU5L 5CHNA 5ICYA 1U8HB 2KZBA 4K23H 1DFBH 3AS1A 1AC6A 1OPOA 2C3VB 5LQBH 5J6HB 3ZMNA 4MNGE 1PG7H 2ADIA 1KGUA 2GI7A 2CO7A 1N68A 2WWMC 2DN7A 3NFSH 4FNLH 5GGVH 5HVHB 1KIRA 4JE4B 4ANWA 1UH3A 1KB9K 2VERN 1TQBC 4LF3B 3HC0B 5ISZA 4LLAA 4CUCA 4P2OC 4ZBJA 4AYFB 4HS6B 2FSEB 1FG9C 1JK8B 4GG6E 3LXUX 1LO4L 1Z66A 1P1ZA 1REIA 2WJ7A 1ERNA 3OGOE 1SQMA 4OD1L 3BD4A 1A7NH 1GY1A 4K3DL 3GMOB 3T2LA 2O72A 3BEWA 5CN2A 2OMNA 4LCIL 3ZK0A 3G6JE 3DBXB 1QATA 4FXKA 5HJ3B 1H6FA 3DJSA 3FH5A 1AQDB 1AS7A 1WSST 3LZFH 4FNRA 2VDKH 2PW2B 2GTZA 4QKTA 5C0JA 5ID0A 4BDVA 5GRZA 5GZOA 5KYXB 5F3BB 4RFEB 5CUSH 1AQMA 1T7WA 5INDB 1H0DB 4P2RE 1I7RA 1KIQB 1WFMA 3PF2A 1OD7A 5T5NF 3BUBA 2BHFA 4GAJH 3ZHKA 5IW6A 4KZDH 3FB7A 2XLLA 3DK2A 3U48A 2J72A 1O7DE 1N64L 2VSKB 2BP8A 4PLJC 1SY6A 3MRLA 3ZL4H 3VRIB 3VG0L 5CWSB 3NYKA 4QD2E 3KPPB 3QIUB 1G7JB 2ZUYA 4V1DA 2VRAA 4Z7OE 1HNFA 4Q4EA 2PCPA 1KCUH 3AT8A 3B9VA 3U4KA 5C0FA 3UTQA 5CO1A 1E4KC 4KKRA 4ZW7A 4L29A 4WCYH 4M61A 4Y4HA 5H35A 1QRNE 1DSFH 4OU3A 3TZVA 3UJJL 4L8SB 1A3ZA 3RJDA 4PD4K 3UTSE 1MW3A 2A77L 2Z9TA 1ZCRA 2HTKC 1S7UA 1MCHA 2R2HB 1LL1A 3BPOB 2Q7YA 3D8MA 3PHOB 5KSVA 3UTOA 1PJ9A 4MQSB 2HLFD 3X13A 1FBIL 4Z78B 1KB5L 4Z8FH 2GW5A 3CAFA 4GFTB 2EACA 1UD6A 3U4BL 1S9XA 1CQKA 3RWDA 1URIA 3CSTA 5HDWA 5IGXL 3EJZD 3VWJD 1KN4L 4HIQA 3D87B 2XU9A 4HKZB 1CFTA 1TTCA 4N2BA 1A3QA 2ZYIA 2WKOA 2V7HA 1MZYA 1OTTD 5DUMH 2WOYA 3FT3B 4O51A 3V0VB 4NN6B 1VDGA 3DVGB 3FW6A 2P45B 1NDGA 1S7WB 5L4IA 4PJDE 5KJ7E 2WQSA 2ZUWA 5TJWK 2W07B 1A6VH 5ESAB 5E03A 4YXKL 5LDSA 1E65A 2EDHA 5L8KB 5F9AC 4C58B 3D3VD 3A6CH 1J1XH 1UWXK 4NQQA 3TONA 5MENE 2HPOA 3KGUA 2EDQA 1CG9B 1DFXA 3ZE2E 5INCA 4BHUA 1P6WA 2WK2A 3H54A 2IJ0C 1KG0B 2OJEB 3A21A 3DUSA 1A6AB 2B8OT 1BJ8A 4PP1C 3RWCB 3VWJB 4EN3C 4PBDA 1G1YA 1HEZB 5HJGA 2F5BH 4HAFA 3FSZA 5I1DA 3GS0A 1UZGA 4YVUA 4KZEH 1NBZB 1Q9KA 1S9YA 3HB3C 1TZAA 5DMIL 3SBQA 1F4YH 1AI1L 1GGUA 4FA7B 3BQUA 3D3VB 5I1LB 4AJYV 3VSUA 2VXUL 3SDAA 3MRMA 5CGBA 1WZLA 1JMXA 2Z91A 3Q06A 4GAAA 4LBEA 4KC3B 2H9GB 4IJTA 2XWTA 4JO2L 4QWWD 1QSEE 1S7TB 5CBEA 4WF7A 4XP9L 1L5GB 1MFEH 4XNQB 3TEYA 1YPZA 1J5IA 1RLBA 5EWIH 3N1PC 4Q9CA 1R19A 1KXQE 4W70A 4HEPA 2CXKA 1CI3M 3NZSA 1HDMB 4GKOA 2P28B 4PV8A 4QHNA 1MVFA 3VFGH 2QV4A 4DKTA 4F37F 4HUUB 2GJ6D 3NCWA 4KVCL 3RKDD 4A7SA 2DKUA 4E9VA 4M1DH 3K6SA 5IMKB 2VE6A 1IE5A 2SEBA 1SQ2N 4YHLL 3B2VL 4JK0D 4UB0H 3QIBC 2ZWKA 4UT6A 5K39B 4QCIA 4QIRA 4ZW5A 5F7EL 4UOZA 5HVFB 1BXXA 1S7RB 4FI7A 3BESR 3T3PF 4LGRB 1F00I 1G6RA 2Y7MA 1WBXA 4MWFB 1E28A 1NKGA 2M26A 5C0EA 4C57C 3V4PB 1XL6A 5JIDA 2WVVB 3FUJA 1OM3L 5D4QA 4PHXA 1EO7A 5DEFB 4MNQB 1UURA 4M6ML 3OKLA 2FECI 1Q9WA 4I8DA 1JZ6A 4Y19A 5JW5B 1YEEL 3KPSE 5JNYB 2KBGA 2HA1A 4U49A 1II4E 1P7QB 1DVFC 3V5HA 2YQ3A 1M4KA 4L3EA 5CEZE 2OULB 3L3OA 4G72B 1PNCA 5TD4A 1OF2A 3I3EA 3C5SB 3IMVA 5GGTA 3SBWC 3TBSB 1AS6A 4LCWD 4HWBH 4CN4A 5I73C 3FK3A 2ENSA 3HG0A 4FQXB 4PS7A 1EZSA 1V05A 1JFQH 3I9GH 2P4AB 3QXUA 3VQMA 3CXHK 2EEAA 2MWCA 1PTZA 3SQRA 2E4TA 3S34H 4A6YL 3UZEA 3LS5H 5IHZB 3VA6A 1VGKB 3LIZA 1ULVA 3FKUS 1BZOA 4N2MA 4EIUA 5DJZB 5MEOA 3IE9A 2LFEA 1PIFA 4N2LA 4YBLC 5JLZA 1N10A 1IKFH 4WKZA 1MWAH 4IBUA 4X9BA 5KJRH 1CFSA 1U3HC 4OCRH 1I7TB 1T03H 2Z4QA 4FFTA 5FW6A 4F57H 2IXQA 1WA0X 3Q7JA 5IQOA 1NCCL 3QQ9C 2M2DA 1YECH 1NCJA 2V9RA 4XVSH 3REVB 5I28A 1GKOA 1A02N 3NJHA 1A3RH 2CR6A 5C2UB 4OQTA 1N12A 3ZX1A 2OMBA 4PRPA 4NQDB 3T4YB 3N04A 4UDUA 1YY9C 2BNRB 1KBGL 3FO9B 3PDOB 4FKKA 3NJXA 4FA8A 2XZCH 1VRSA 4IHOA 1PEWA 2NTFB 5I26A 4HDIB 2OMTA 5IQNA 4AJWA 3V8CA 4CN1A 1EVTC 4XMTA 3S8WA 3CVHB 1DBBL 2JJTA 3S35L 1NLBL 2BERA 3CTTA 4HFUH 2B14A 1JNHB 3LDBC 1OAKH 5EUOB 2JH2A 3MGTA 4JCWA 3ZN6A 2AEPH 3HNVL 2WZ5A 2AJYL 3BP6B 1AACA 1X5ZA 5FDWB 2AQTA 4QRTA 2A4CA 3N1GC 4I3RL 2FR4A 2APBA 3BVXA 5F0JB 3SE8L 1OIOA 1T3FA 3CLEH 5AKVA 5F3HB 3KPRA 4ENZA 2EZ0D 4K9EL 2V9UA 4TMPA 4Q74A 4W1TA 3NIFB 1KGCD 2WXNA 5AVUB 1H15B 3WEXB 4FTDA 4NKMB 4TULL 2F54E 3ECBA 4TRPL 5J0BA 3P4LA 3NDZE 4JM4H 2DY2A 3CU1A 5JUEL 5EF3A 4OI7A 1KCVH 1GKEA 2AF2A 4JG1H 5I1KH 2A73A 1HH9B 3FN0L 4R7NB 1HXYB 1JPGB 4KO6A 4M4RB 5DD5L 1EH9A 5E5RB 5I82A 1EFXA 2FX8H 2RFXB 1R9FA 4XMVA 1DBKL 5D93B 2Z64C 3NIFF 4U7MA 3TBYB 2JB5L 3TJEH 3U9PH 1E9OA 4B96A 4F1ZA 3ESNA 4WJKB 4CVZB 2WLIB 2B08A 4NO5A 5E6SB 1NFDE 5E8OA 2I85A 2DQDL 3WGUB 3FH8A 4N25A 4OFIA 5DVKA 1B3JA 1MHCA 1Y18B 3UZVA 1IAIL 5T3ZH 5JQIB 3TH3T 4K3EL 2VQUA 1N5AB 3D4ZA 3Q6GH 4QRRD 4YVNA 5FO8B 2VERA 5I1AA 1R0AH 1TZHB 3INUH 2P5EE 1G7HA 1SMDA 2Y5EA 4TKWA 4A7QA 1ZA3B 4HJ1A 3L4XA 2QSCH 4JO1L 2BVTA 1RZFH 2NUTA 4RBPH 5EHFA 2IH8A 3VSTA 1OWRM 1XGTA 3CE1A 3FB5A 3E2HC 1ET8A 2KC0A 1XD1A 4BE5A 5LXGH 1UB6A 2X09A 2NNAB 5E6ZA 4DN3H 4X6CB 3FO0H 3SGDI 4I85A 2Z93A 5AW9B 1MF2H 1OGAA 1FNEB 4P06A 5D7EA 5JHAA 2VXTL 2BZCA 5D5ME 3ZZ1A 4ES8A 2V7NA 4QRRB 1WQVT 2WQVA 3ZTDC 4OZGE 3QUXC 4G42A 3K8LA 4LLMB 4YHML 2IF7A 1GSKA 1F42A 1OAZL 4N0UE 3UYRH 1F58H 3G5YA 3DMMC 4GRWF 4AMXA 3N1FC 4K94H 2APVA 5GZNA 1CQYA 3GSXB 1IGIL 4NZJA 3MCKA 4LKCB 1L9OA 4X6CF 4K73A 5GGVY 2JFCA 3DX2A 5D1QA 3P3RA 1ED3B 2VW7A 4ZT1A 3SZKC 1OANA 4GSXA 3PNWB 4J28A 2XTLA 3DHJA 2ATPB 5KBPA 1A6PA 4JREB 4XPHH 5DLML 1FFQA 3J7HA 1ZV9A 3VXTB 1Y1DA 1S5HA 4KJPC 4JZNB 4B9ZA 4EI6B 5DJDA 2X70B 2X3AA 1UXSB 4FXGA 5HGBB 2ZKHH 2I25N 3ARBD 3FQTB 1LWRA 4YNYA 4LEXH 3S88L 5AWNL 2VABA 2WNXA 3MRNB 4TLUA 4XMKH 5CMAA 3OR6B 4MD4A 4OVUA 1BZ9B 4UILL 1N4XH 3GMMA 3P11H 4HCRH 4UUJB 1EX0A 1Q90A 2IGTA 5LQBL 4PEEA 4QRUB 5I1CL 1PG7L 2WWMD 1FGNL 2WLJA 2AGJL 2DM4A 2R8SH 3SDCC 3PQYE 2AAAA 4P2OD 1ES0A 3ZQWA 4QJ5B 2A38A 3ARBB 3HZVB 2JI3A 4FQQA 5AOMA 3VI4A 5AUMB 1GCYA 1WD9A 1PZ2A 2E7BA 2H0PA 3BH9B 5FA3B 3ABZA 2ZD0A 2UXTA 4FQCL 1ROWA 1S3KL 1NAML 4PJAE 3ECQA 2VLJE 4PRHE 2H0FA 4JHZA 4NGHL 2BY1A 1RFDL 5CNHA 4MJ5A 2N0MA 1AQ8A 2CNZA 4JDTL 4GJTB 2AHIA 2BP0A 2CPUA 4KKZA 5FFLA 4DP9X 4LO9A 2P5WB 3KYNB 1TQBB 3QEHB 4JO3L 4G70B 1UWEL 5E7BA 4P2OB 3QS3A 2G30A 1ITBB 1XTLA 2IEPA 2WMPB 4PIBA 2NY6C 3ARGA 4DT2A 3T6QC 4I88A 1KFGA 5JHLH 2OL3L 5CBAB 3S36H 2ADJB 4UOW0 5KS9A 1T1YB 3BEVB 3BX7C 2V5RA 4NBZB 2EYTB 1U92B 4HCGA 1XEUA 4PGBA 4GAJL 4OGQC 1HSAB 1P0SE 3Q6FA 4MXQC 1I7UB 4UAOC 2NX5A 3QNZB 1W72L 5GS0C 4TNGA 2DQUH 2QQQA 4L3AA 4RA0C 4L37A 4AC2A 2X0UA 3MYJB 3PWUA 3AT0A 4N26A 2DYPD 2H8PB 3WEAA 5LCVL 4BK5A 1IBYA 1FL6A 3GJFA 1E50A 5HGDA 3SYOA 4LEBA 1ID5I 3L3JA 4BFIA 5ERWB 2CDGA 5IBTL 1Q0XL 5TH2A 1MJ8H 4IIZA 3CX5K 1TPXC 4HIIA 1EMTH 1MPAL 1QUNB 2EDOA 2HTLD 1E3ZA 2BJMH 3L7FA 2DYPB 3FCGA 2CKBA 3QA3B 4AGNA 3SKNB 1CXEA 2LLLA 3GNMH 2D03H 4HH8A 3FULA 3HR5B 3RPIA 3WJLA 5DJAA 3B9DA 3ARWA 4ODWB 1H8LA 3QXVA 4L8CB 4XGZA 4JFYB 4JDZA 3LEYL 4NO3A 4OJFH 4TSBL 3S96B 2FEDD 2R69H 3TBVB 3VGAC 5PCYA 1XF1A 2CO1A 2O4EA 4QXUH 5DUML 5AFAA 2WTOA 2AAVA 1AGEB 4OCNC 3KPOA 3Q2NA 1RPKA 1XF5B 3OB8A 3Q5OA 2GSGB 1I3RA 3FT2A 3MRIA 3RNQB 3VFNA 1YEDB 1C5BH 4JFEA 2GCYA 3FOMB 3TN0A 4N2EA 3NA4A 3WKQA 4ZFFA 4PP1D 1J9SA 4EN3D 1BXUA 3SJVA 4FHKA 3WS6C 1WBZB 2CIIA 1WP6A 1A0QL 3CBKB 2IANE 3NZUA 1HHKA 4P8QA 3AUVA 5F2FA 1FZMB 3ULVH 3AREC 5I6XC 5I6MA 3AT9A 4PJBF 3HB3D 3QQ4B 2ZXBA 1Q0EA 5FHBH 3NEEA 3LKOB 1F6FB 1HHIA 4X80L 1UGKA 4HUMB 3D50A 2OMWB 2PNDA 1A25A 3HC3H 1B2YA 4X8CA 2W59A 3LKQB 1A7OH 2R2BB 4EN3B 4TTDD 1YEIL 4PJIB 7CGTA 1FG2A 3AAZA 3QFJE 3FU7B 1JNLL 4PBVC 3QARA 5IMLB 5ITBH 5IKCB 4XNZC 3OWEA 3HB3B 5FX3A 3QQNA 32C2B 1NC4A 5DLLA 1OCCB 5B1BB 1BGXH 1OSZB 3JWNH 1SM3H 2ESVE 1W2KT 1HZKA 1NBYA 4RQQA 3J07A 3NCYS 3WJMB 2D7QA 2CZNA 5FM5M 4ZFGH 2PO6C 4HUNB 2IPTH 1HQRB 2UX7A 2BY2A 2CCWA 5FYJD 3R19A 1WIPA 3LKSB 2QGBA 4UB0L 5FCUL 4RGNC 1MNNA 2VLRA 2DWYA 3TBWA 4Z76B 3FYIB 2O5YL 2WQWA 5ICZB 5GZOC 3DGGA 5FYLH 3ZDXE 3M17A 4G6KH 2V9TA 2YPLA 2A9ML 2PP9A 5D2LF 2KHAA 3ABGA 4AYGA 3TV8A 2KI6A 1BZ8A 3OZKA 3ETBF 3LV3B 4NJAH 1F3RB 4ZX6A 1UUSA 5HGHB 1CF8L 5CU5A 4BZ2H 1P4IL 3CFIC 3PIQB 3QIBB 2JQZA 3MV7D 2WIMA 4JPIB 5E6ID 2K9UA 4F7MA 1PZBA 1AXSB 1DVFD 3IMSA 2J5LC 4G8GE 1GZQA 1YEWA 4ZFZB 3WJJC 1HKLL 4K2UL 1QFHA 2NR6C 4J2QA 4Z77A 5IREA 4Y4HC 1O9VA 2HKAA 1TCRA 3L3DA 1RUKH 4GAGH 1MY5A 3MLVH 1PY4A 1VA9A 2DAVA 3HZYB 4TYUA 4JKPH 1C5DB 4R4BB 5D7SH 3UYPA 2ZXAA 1JF1B 1CB4A 2CLVB 4NDMB 1TTUA 1WEJH 5BZWB 2VITB 1DVFB 3VQ1C 1HZHH 2XPZA 1AIFA 4H8HA 1NANH 3ETTA 1DL7L 1IKFL 4JQVC 4DO4A 4YXLH 3J8F7 4M4PA 4YPGB 5G5DA 3FS9A 4PGCA 1U3HD 4K3GA 4OCRL 3SDXF 5I73B 3I75B 4ODVL 2ARJQ 4WFFD 5B3SB 1T03L 2MOGA 3DV6A 3FO2A 4MZIA 4R7XA 3EJRA 4JY4B 4K7PX 4WHYH 3WIFB 5IHLB 2ED9A 3MNZA 4PGEB 3EO9L 3QQ9D 2IDFA 4D7PA 1U3JA 5C0CE 3I3DA 4XVSL 1EXUB 1M7UA 5KSBE 4DO5A 4JKLA 3BQVA 5ITFA 4HUWB 1S9WA 4XZUA 3PWPA 2XZCL 1COBA 1YY8B 3TP4A 3CDGA 5C0GA 1U3HB 2E47A 2YN5A 4ICXA 3L2MA 4PJHE 4UZUA 4G6AC 4XMXA 2NW2A 1XF4B 5FS5A 5DWPA 5A6LA 5E4EC 3L4WA 3RGHA 3WFCL 1UFUA 3VTTA 1ZS8B 3NSFA 4LCYA 5C0AB 4PJBA 5KG9A 3KPLA 5IJKA 4OKVB 1PLGL 2KS0A 4M7LL 4GAYA 5F8RC 1M42A 3SDAC 4E42A 1KCRH 4FI8A 5BRZA 2NW3B 3FU5A 2TSBA 3SYCA 1I8IA 2JKTM 3TNMB 1NCIA 5GGQH 1R3LA 4XNUH 3W5NA 4DPBX 2VAAB 1KCVL 4LASH 3LDBB 1EJOL 1PG7W 4IRSC 4EIGB 5B39G 2L4OA 3QJSB 2DDQL 1Z9OA 3RIAK 3S3CB 1GMEA 3DIFB 1CDBA 2FSDA 3IU4H 5DK0B 5HI5C 2K4WA 1BVLB 4BA8A 4PJEA 2DQTL 2BIOA 3KL5A 1U3ZA 4EE2A 2NCEA 4UQBA 2UWEB 1KJMB 1QFWI 5I1HH 3NIDE 4HC1H 2WINB 4NQCD 1N5YL 4AE0A 3WFHA 3VNZA 5K69A 3DX3A 5E9DE 1N0XL 1XDTT 3BWUC 3GK8L 1DR9A 2JSFA 5T3ZL 4ZPVA 1ZSHA 3INUL 1F6AB 3KG5A 5HGAB 2DWXA 3C5JB 2F74A 3ETBJ 1AG0A 2WBJA 3EYQD 3H8NA 4N8UA 4R3SA 4MA3A 4TVUA 3H9SA 4PRBB 1PSKL 1EGJA 1BQLL 3MBWB 4Q9RH 5K59E 3GSUA 3NDYE 1YQVH 2VXSH 4LCCA 3ULAB 2ZWYA 4BINA 2E74C 1CLYH 3K0WA 1CR9L 3AWFA 4KROC 2MQCA 5EO0A 3WDJA 5I16B 4NQCB 2D73A 2XETA 4UTBL 2AK4E 1MVUB 4Y89A 1SJVA 3QZLA 1YJDH 3GTNA 2UUDH 5ALBL 2ZCZA 3L3OC 5DJXB 5MHSE 2YIHA 1DJXA 4MXWL 1W16A 2ADGB 2J4WH 3D69B 3QUXD 3R8QA 1OP4A 3V0FA 2XG5A 2Y1AA 4FJZA 3E9TA 3DMMD 3O8XC 4M5SA 3T0XA 5DI8B 4MX7A 3U83A 3DRQB 4GSRA 5L88L 4WW2A 4BCYA 1MRFH 5HHNB 3E2HB 2P3YA 3VXOB 1LP9A 5I5JA 2EDWA 4X5PA 3SE9L 4YWGH 3U82B 1M9WA 3GRWL 4UNIA 4XPHL 1FH5H 2C9SA 3FXIC 5EBGA 3RWIA 3NN8A 2IGFL 4F7EB 1UCBH 1WS7A 4KJPD 3I84A 2ZKYA 4JHVA 4N2NA 5B1JA 3DMMB 1J5OL 2M83A 2CH8A 5AYUL 2B9AA 2V3DA 3VFTA 1DVSA 3F04A 1OZUA 2VW4A 2ZKHL 2G60H 3CZLA 4HVBA 1RZJH 4UOJA 5GS1A 1UWGH 4AENA 2FLRT 4XPTL 2HLEB 2V3EA 4FI6A 1SBSL 1RK0A 5HHVL 2HRHA 4NBYB 5AB1A 4HWZA 1FYTD 1MY7A 4JPQA 1D6VL 1N4XL 2ZNWA 4WHTB 3MNMA 3FFOA 1JHKH 1WFTA 1M2VB 1FNLA 4PGJA 5D71H 5JHMA 1I4FA 3MLZL 4HHAA 3VXNB 2GPZA 1GY2A 2OP4H 4GQ9H 5BVJB 5D8JH 3SDCD 2JJTC 4KO9A 2AABL 2FL5B 3M1BB 4YUEH 3QQ3B 1VGEH 4PTTA 4YDVA 3ROOB 1MUJA 3TO2A 3QAQA 5D4JA 5GGRA 2J55A 2OTPA 4A1RA 5KYYB 3BHBB 5EU7C 3VD2A 3Q2CA 3WTTA 1JWUB 5TF1L 3STLA 1UM4L 4HLZH 3CFJA 1ET5A 3GRGA 1FYTB 2BW5A 4ESKA 3P4MA 2FQGA 2I5YH 4LCVA 2CJTA 1E4WH 2E76C 5GJSH 2JCCE 1D5IL 4E68A 5J89A 4S1QL 4I3SL 1RZIA 1IM9A 2MPVA 4IBZA 3S3BB 3SODB 3ULVE 3SDCB 4HBCL 4YGAB 3DRTA 3QQDA 4FG6C 3RX7A 2KDGA 1CPUA 3HNTH 2QZQA 3OZ9H 4UINL 4CC0A 1G7QB 2WUCL 3T09A 1HYSC 3D9AH 1U8KB 3TBTB 3VXRE 3HLAA 4J1UB 3MGAA 4RMVA 4ERSL 2C9PA 5DHYA 4LHQB 5FFOA 2CG9X 3E8VA 3TEXA 3ME0B 2D9QB 3TH2T 2G5BB 4MXQD 5DT1H 3TYGH 5I0ZA 3MV11 1FVCB 5GS0D 4PWGA 2JNZA 5IW1B 2WZPA 3Q8AA 2V0AA 1MHHA 1LK2A 3BPCB 4RMTA 3BZFA 4PHZA 3LPPA 4I7ZC 5EEZA 1NCTA 2Y7QA 2ZXEB 3GBDA 4ZW8A 1NMCC 1QFOA 3FT4A 4PJGE 5FC9A 3OSVA 1NUGA 3ZTEA 1AKJA 3QR0A 3H7BB 4G5ZL 3WLBB 2NY6B 4Z1PA 5DYFA 5KANG 3T1FB 1NMBH 3JWNE 5BVPL 5K9KB 2QSQA 2EEDA 3O3BB 3EGDA 1T66C 2YUVA 5T1JA 1FDLL 1RUQL 2IV8A 4FNPA 4PWEA 2X4RA 2Y1YA 4G3YH 4ANUA 2RAMA 4UAOB 1KBWA 4D2NA 5HYEA 1EMTL 4FQPA 4ZZKA 4KTEL 2Q3ZA 3I2CH 2BY0A 3V5DA 4CBZA 4XCCL 2C4XA 4FG2A 4JZJA 5FYLE 4K5MA 1PZSA 5IR1B 3U2SA 2D03L 3HHSA 1MIEH 2AERT 2ZWZA 1D7FA 4E9XA 4PRNA 2OCJA 3TXAA 4IBSA 5FGBC 2BCMA 3FFCD 4X4XB 3ZE1F 2QPSA 3I6KA 4I3GA 1P5VB 3HG2A 1HFUA 3F12B 1TPXB 3MRFA 4MQXC 3SKOB 3VYPA 1FNGB 4P3CL 1URZA 3MPCA 5D1QC 5FHAH 1HINH 4Q2ZA 2E5EA 2DI8A 3DTDA 3FOLB 2OMUA 1BBJA 2X2IA 3BAWA 1SYVB 2IWGA 2YXFA 4QHLB 5FUZL 4C83A 4XPBH 5C08D 1JP5A 1MCDA 1XAUA 3OZLA 4BSWB 2W8CA 4X9IA 5B38G 1V7NH 2AXFB 2A6JA 5JXED 2WC7A 2WN3A 4N87A 3FFCB 3BXNB 1VFBB 3FTXA 3VGAB 4OLWL 1A9BB 3ARED 3W0WA 4RLDA 3ET9F 4NCC1 4DPCX 1RUAH 3IXAB 4XO3A 2WSPA 3AS2A 4OCYH 3RFZA 3QDME 5FHBL 3T8MA 1BG9A 3JVGA 3EYVB 5GGSY 2BVOA 2R1XA 3HUJF 2K6YA 3FPYA 4LLWA 1DQTA 3SGEH 3VGGA 5C08B 5JPNB 3VFVB 3PFUA 1C16A 4HJJL 3P4OB 4OAWA 4RIRA 1KJVA 2OSXA 4L18A 4ONOA 1W0WA 3QUYA 4JRYD 4ELKA 4IOFC 1BA9A 1YC7A 4W4OC 2X4OA 4JW3A 2DL9A 5F0LB 3AREB 3FQWA 5I6XB 3NG5A 1TVDA 1DN0A 4N2FA 4PBWD 5JOPD 1MIML 4MBOA 3TWCH 1I1FB 5CHNB 5ICYB 1ZGLM 1ID2A 1VZIA 2VNCA 1SM3L 5FXCH 4JY6B 5LAXA 4DKFH 3KYMA 4LSQL 1SXBA 2PO6D 3SE4A 4ZMTA 2IQ9H 1R3KA 1GS8A 3C60A 4ZUUB 2NDGA 3LZPA 6PCYA 3D39A 1MFAL 1SJHB 4NT6A 4ZQTA 1X6NA 3VDBA 3UPAA 3NSYA 4R90L 2E9WA 4JRYB 4MMYA 5B39A 4RGND 2PLTA 1IIKA 1VFAA 3VXUA 2J21A 4XAKE 4UM9D 4G8FA 4KRNA 2RJMA 4EZLA 2BSTA 1IGTA 2WZ6A 2OXGA 4G7VH 3INOA 5JQHC 3F8UB 4XNZB 1A5FL 1SFDA 4NZUH 4WHDA 2PTVA 4X50A 2DM2A 1DEEB 4XWGH 4C4BA 5J06A 4IBVA 4YFEA 4G6KL 3P40A 4MMXA 3RWEA 2AXHA 3QXAB 5E2VH 2W0FA 3BEWB 2XQYK 4WEBL 4FJYA 1F4HA 4LZKA 3L6FB 3UTPD 3QULA 1AO7A 4XXDA 1IC4H 1EANA 2J71A 4RGNB 5E1GA 4UM9B 1OD9A 1BVZA 4N3TA 4F24A 3PP4H 5MEQA 2CIKB 2D4DA 4LK4A 2NR6D 1LO3H 4JRLA 4K7PL 4Z3HA 4NI6A 3HAEH 3ABLB 5IIEB 4XVTH 1RUKL 3M45A 4GAGL 1RIHL 4ELDA 1IM3A 2NTSP 5TFSL 3FSAA 1TLKA 5TDPA 5KUMA 2FB4H 3SKMA 2YD2A 5DQ9B 1SJEB 3A22A 1R46A 1CZ8H 2HSIA 1VZGA 3OKNA 3F7YB 4LPCA 2J5LB 1NUNB 3K81A 2E7LC 4XE5B 4DAGL 3H1ZA 4PH8A 3OR7B 3ZHDA 1LGVA 1AQHA 3HI6H 4Y4HB 4R0LC 5EORL 4PY7B 5E5MA 5TQ0H 3O45A 1JWSA 3K4AA 3BPLC 2BIMA 2WSKA 4LLYA 1MW2A 4HXBH 5DJCB 1E27B 4N9GA 1F13A 1I1AC 1MELA 2E27H 2WBXA 1S7UB 4ZXBA 5F71A 2OX5B 1F3DH 4PTUA 3OTTA 1AHKA 4L0PB 3VG9C 2P8LA 1X9LA 1SBBA 3OLDA 4E5XG 5FOJA 3SCMA 3NJLA 4BHUI 1RURH 2KT6A 2OK0H 2BNQE 1OK0A 1JNNH 3HZKA 1AS8A 4EBQH 1I8MB 4Z3EA 4FC3E 2DIJA 3TN0C 2YOCA 2YEQA 5L7XL 3RI5F 1ZLSL 4JDEA 1NGQH 4JHAL 3GMNB 4G6AD 4GKZA 2GUYA 2V7HB 2ZOLA 3N2JA 1LEIB 5E1AA 3R1GL 3AQZA 2PCXA 3OJDB 3TCTA 3AG1B 4Q6IC 1IBDA 2X4UB 5BOJA 5DJ0A 5DHDA 3QO1B 2H2SC 4W93A 5T1KA 2WP3T 5EEXA 1IZJA 2W80C 3HUJA 3SDAD 1C8QA 3B5TA 1KPVA 2ZXDA 4KX9A 1XB8A 1KCRL 1ZDSA 4JFPA 5J1SC 3DDFA 3DKHA 3L3IA 3DUSB 1GZPB 3FPXA 4XOBA 3ZPDA 2UXGA 3QDJA 2P5PA 3FTGB 2FX9H 4Z7WF 1P69B 1X9QA 2X88A 4XNUL 1A1OB 4LHUD 2RB8A 4LASL 4G11A 4IRSD 5E4EB 3MCG1 3B9KC 3RL1B 3L4VA 1Q9KB 4QT5B 1VEPA 1S9YB 4N0YH 4APXB 5F7HA 2K6ZA 3HMXL 5EOQL 3VTAA 1UB5B 2N7SA 5HI5D 2WP3O 5HYJE 4ORZC 5F9JB 2FJUB 4ELMB 2VDRH 5FUCE 1DZ0A 2X7LA 4QOKE 5BPPA 3U4EA 3SDAB 1MCBA 5JPMC 3MRMB 3KYKL 2P1YA 2YK1H 1G43A 4X4YB 4LFHG 4XNBA 1AHWC 4LAQH 2XWTB 1M71B 2UZIL 3VFRB 3W9DA 4ADJA 4LHUB 5AL8A 4IRSB 1I8LA 3B43A 2R0LH 4K3JH 1NEZB 1HXMB 1NGYA 1YPZB 3PWLB 1ZAGA 1O5PA 2DMKA 2R0ZL 2GITA 2ZG3A 2WXFA 3N0AA 3NZHH 4JKMA 5AOIA 4AIOA 4ELMF 2Y2YA 7FABL 4P23D 1VZHA 3QO0B 4OI8A 3F7VA 3CSBA 2YPVL 3HE7A 4PV8B 5HJDA 2B39A 2F61A 1KTRL 1XMEB 3CVHH 1HCYA 1P9MA 1RCYA 1AR1C 2WUBH 4I48B 4PP2B 5D2NE 2ZNXA 2WAQA 1BIIA 5DUBA 5DMJB 4IRJD 4D9RE 2G2NA 4CADB 5C7XH 3WTYA 3DARA 1GYAA 4LSPL 3SGKA 3V52H 2X6BA 2DD8H 2FNBA 4OI9A 3BVTA 1IU1A 2Q0ZX 1G6RB 3LS4H 3OLGA 3L3GB 2VDOB 3HNSL 5HHQB 1U8PA 4H8WH 1A6TB 5IF0A 2DTMH 4W6WB 1DBML 2XKUA 5KSAA 1V7ML 1FGVL 2X2YA 5E00A 4JKKA 2XWBB 3DVIA 4ZQKA 3GSNH 5IFJB 2GIYA 1OF0A 3DA0A 3OKLB 4WK2B 1Q9WB 3O8XD 5GRUL 1D5MA 5JO5B 4Y19B 3CQPA 5HHMD 3X1FA 1MJ7H 2XVKA 3D12B 1HCVA 3E3QE 5F6HJ 4XBGB 2CHZA 4KROB 1EO5A 4FYRA 4G8IB 4E9LA 4K07A 1SEQH 2X28A 2C9XA 1CGXA 1R3JB 2GTWB 3UJIL 1OK8A 3V5HB 1KOAA 4UV4L 3FQNA 3EDFA 3RWGA 3N44B 1T0OA 5AVYB 3L3OB 4WFHE 4MLIA 5I1EL 4QLRA 3EFFA 4Q56A 4XOCA 1RZGA 1VACB 1A1MB 4FQIH 3QCTL 5KVGL 1WHOA 2BVPA 5JHDE 1DJYA 2BLFA 2ZQKA 4XOAA 2APFA 3O8XB 5HHMB 3CFKB 3JTBA 2G60L 4N24A 5LBSA 4I4WA 1KJ2B 1KYUA 3N44F 3KPMA 4HPYL 1RVFH 3H3PH 3M46A 4LRNL 3WSQL 3JBG7 2OSWA 3ZRFC 2WCGA 1MSPA 2VXQA 4OCWH 1XGRA 4PAZA 1KJ3H 5B38A 1DO6A 2EIDA 2R83A 3DX4A 5CFAA 4GRWH 3B7UX 2AC0A 2Q8BL 5F1OB 1CFSB 3KEHA 2ATKA 2HXAA 5J6SA 4GKSA 1QTSA 4NC1E 4O9HH 5JORA 3EFDL 2IXQB 5DRWA 2XV2A 4F8QA 4YUEL 1Q72H 4F33A 5KYUB 4PVLA 3UG4A 3HFFA 1VGEL 5IJKC 2A1WH 1PVHA 2VT0A 3G04B 4AYMC 1WLHA 5FECA 5JIIA 3TCXA 3S8FB 5DHMC 3CIQA 5J11C 2BSRB 2NZ1A 3ATAA 3HJEA 3TPUA 4P07A 4N3UA 3VH8G 2DQIH 3KGRA 4LVEA 4NN7C 5K93A 2K0RA 3MODL 4KKQA 1FFNA 2I5YL 3B1UA 4IHOB 2YAPA 5GJSL 4E9RA 4TSAL 4UI2A 1E9QA 4HKBA 5EN2B 1XV8A 5IHUH 3SGDH 4TQIA 3AG2B 3NA9H 1RSYA 3MGTB 4IS6A 5IMOB 3KH3A 3M1OA 3BO8B 3DX8A 2WLMA 3O9WA 4WUKH 3RIFF 4BWTA 2XC8A 1HYSD 3D9AL 3CSFA 4OFKA 3FHQA 4P3DA 4UOW1 1T3FB 1IGYB 4OM1H 2ZSVA 4PJXF 4XODA 3KW7A 3OV6A 3PGCB 2WN2A 3ZZSA 3BKYH 5CLYA 2VL5B 3OX8B 5HHPB 4P5SA 4M3KB 1FFPB 1OWWA 4NKIH 4P9ML 1G5AA 3FQ4A 2DOCA 2A73B 1NGWB 5J12C 2P7TB 2EYSA 3RY4A 1HX0A 3SD2A 2FWUA 2Z4TA 3EBHA 1NMBL 4GUOA 1EFXB 4AK1A 2VMEA 1QWHA 1T66D 1B9KA 3SY0B 7PCYA 4N68A 2H4EA 4MGXA 1P5UA 1E9OB 2X1OA 1VF5C 1BQSA 4NO5B 4OFYD 4LCCC 1J0ZA 4RVBA 5KN5B 2EDJA 1WT5A 3LH2L 3CFTA 1LDSA 2V6HA 4NRYA 5A16B 3FCSA 2FO8A 3L81A 3O6KH 3VM5A 4QXTA 4AZUA 4TQEL 2BS8A 3BLKA 3HFMH 1NMCB 5E9NA 4OJEH 2UXVA 2D2OA 4JPKH 5ABAA 1AXTH 3RX5A 3AG3B 4C56D 2RR3A 4GW4A 4DP8X 2XKSA 4L9DA 5F93C 1ZOXA 4G59C 4UIMA 4GSUA 4F20A 3FQUA 2ENJA 1TSRA 5FO7B 3E6HB 1ZHKA 2NUTB 1TYEB 1XO8A 1FCGA 2J88H 3LQZA 2OXHA 1IO4C 3LPFA 3VFWB 3FUIA 1SXSA 3RB5A 3D0LA 1FHNA 4LIQH 1MRDH 6FABL 2ZJSL 3D3VE 3WNIA 1I7ZA 2UXFA 2F1BA 4JE0A 4J4PA 4X7FC 2YRPA 4PRID 3NSJA 5E4OA 5CINL 1OGAB 3Q44A 4RWHA 4RMBA 1OAQL 1U8NB 3RWFA 1M6OA 4C56B 1SXNA 1DQMH 1T04A 4XCFH 2VLLB 4M8QA 1MCKA 3MTXA 3MCKB 5I1JH 3T3PE 2DM3A 5BUAA 2CJUL 1LO0L 1Z9SB 4H13C 4HPOH 5D1QB 4E5XA 1Z3GL 2EABA 4JM0A 2A9CA 2DKSA 3WXWL 3WS3A 4PRIB 3QT2A 4TSCH 5CILH 4ZG1A 2WOBA 3K2UL 4QNPF 2CUIA 1N7ML 3W39A 3CUPA 5TE6L 4FQ2H 2Z7UA 3QE5A 3ECUA 3LCYA 4Z7UA 3SDYH 3R0NA 2P9RA 3O2DA 3UIZA 3VGEA 4IOFD 1TQVA 2DMCA 3MREA 3QORA 3V6ZA 3T2NL 1A2YB 3KR3L 1MCWM 4YNYB 1EAPA 2JK5B 1TG8A 1CGWA 3VFUB 2GJ6E 1GOFA 3JWDL 1JWMA 4B7LA 5CMAB 3RU8H 3QNXA 3LZNA 4ODBD 2ENPA 3DHPA 1Y6NR 5E94B 3WFBL 1GC1C 2O1AA 4Y1SA 5IB4B 1ACCA 4FFYA 2Z31C 2K45A 2V2XB 1EPFA 1HHGA 2VKXA 1JBJA 1M7DA 3GGWA 3GLDA 3VI4B 2Y6TE 3AUWB 1RU9H 4NZUL 4XWGL 5DHEA 1FZOA 1ML0A 3KBPA 4QRPA 5LN4A 1ITCA 3EJYC 2YUWA 3O0RH 4P46A 4KTDL 2R0KL 3SN6N 4PGDB 2HX8A 4OM0H 1XGQA 1B4LA 4NENA 2E9GA 2VDLB 4IMKA 1UHVA 1MCWW 4MJ5B 2WQRA 1KLFA 3T0EA 1DSYA 1GPOH 3CX5J 2D8KA 2NXZC 1G6VK 1GL4B 4L4VA 3V4VL 3HCVB 2ZP8A 3CSYA 1ZLDA 4DEPC 2ICEA 3OB0H 4R4FL 3MRCB 3VQLA 3PP4L 1S7VB 4LCWE 1KYAA 4MQTB 1Q1PA 5IQMA 2WB1A 1LO3L 3IS1X 1FLRH 3KXFD 4DQAA 1EFQA 2G2PA 3SQBB 1G94A 3QWOA 3REWA 4B9FA 2ZUSA 3V0GA 4DGWC 1ZT4A 1ND0A 2AQ2A 4JY5H 2EO9A 2DZEA 4HKJA 3Q6FB 1QI5A 2EKSA 1TJGH 3H4FA 3WY4A 4OLZH 4XB3A 5TGBA 5FWQA 3A67H 4X6DA 2QJDA 4ZOEA 1F56A 1PD6A 3N6YA 4OSUH 4P4RB 5LGHH 1NH6A 1X9RA 3TEWA 5BW7C 5DJ2A 3W9EA 1AC0A 4D8PA 4E9WA 2FEEI 1FL6B 5DVNA 3NMEA 5DEJA 4AQ8C 4IU2A 4JANA 1E67A 3CJJA 5TH2B 4OV5A 3DO7B 1OP5H 1OQXA 4HXBL 1L9PA 4W9IC 5IG7A 1JGLL 1I1AD 4HIIB 1UA6L 4EOWH 4PI0A 1U2CA 4I0PA 4ORGA 2ICCA 3GMPA 3V4PL 4I9XA 5C0BD 1M05A 1XH3B 3X12A 3L7EA 3BKML 5KVEH 2R15A 3NIFE 5EU4B 3RY6A 1RURL 2AQRA 3NRPA 1JNNL 1J10A 2LVCA 3RPKA 5FYJH 2FEJA 3GHEL 4F5CE 4R0LB 4C59B 1CYWA 4NUJA 1T22A 3BPLB 2RH0A 3QP3A 5CKAA 4P4KC 1T0MA 3HG1A 3H3BC 1I1AB 2CRIA 1KB3A 4O00A 4XHQA 2YSSA 4XO9A 3V10A 3VG9B 5C0BB 1MOEA 3MBXH 2FBJH 1NA8A 2CK0H 3JV4A 4XCEB 1KEGL 3KPOB 2H2SD 4QGYA 3VWKA 2HRGA 4UZSA 1KGCE 4F3FA 1I3RB 4RDQG 5ACMA 1WZMA 3RGVD 2FECL 1PD1A 1MLCA 4IOIA 4U1MB 4UBDC 5ANME 4JFEB 3TEUA 3VB8A 4F2MB 3BUQA 3TN0B 3L9YA 4N4YB 3NCEB 2J6WA 1HI6A 1MREH 4ZFFB 4N2DA 4KQ4H 1ZXKA 3UC0H 5I1GL 5DFTA 4FHJA 1HHKB 2EDTA 2BMKB 3B9KD 2QGEA 3MR9B 2WWKT 4AM0A 3ZYJA 4YLQT 1ZHLB 3VH8A 4Q6IB 1BLNA 1C08B 4O5LL 2XWDA 1YAIA 2B2XH 1BJMA 1PAMA 1HHIB 1E7UA 2X1XR 4NNPH 2OCCB 5I18H 4GRWE 2NYZA 3O3UN 4PJ9A 4Z7VF 4MXVF 2PUQT 2YK1L 5DMGC 4JZOA 5AW6B 3LRSB 4Y5YC 1E6OH 4X6CE 1EDQA 4FFVD 3X3GL 4BRJA 3C2AL 3W38A 2LABA 5FUOH 3LAFA 1FG2B 1RHHA 2DL2A 2VDQH 4QRRE 3V5KB 4WVRA 4ZSOA 1JXJA 3TFKC 2YEZB 4K3JL 3B9KB 2MCMA 2WWKO 1JK9B 3MFFB 1EEUA 4H5SA 1NCGA 3CFQA 4UTAH 2ORBL 1FVEA 1NC4B 4HJUA 2WLLA 1K5NA 3CVHL 3KWXA 4RQQB 1AR1D 3EDJA 3ZU8A 5BO1L 5JPMB 4XPFL 1EEQA 4HUVA 1UFGA 4S2SB 3DUUA 1U58B 5A2KH 3VX1A 2MOVA 2ZX5A 3D0VA 4R7DA 1UZ8B 3QI9A 1AHWB 1DLFL 2BK8A 4GBXA 5J3HC 4HOZA 2V33A 3I6SA 4PLKC 4N0CC 1OE2A 2OTUA 2VLRB 1NWOA 5CKGA 2FBRA 4Z3GA 1ZEAH 1IRAY 3CSPA 3LS4L 3KLSA 4J8RB 1B0GA 4XAWH 3KL3A 3O3AB 3ES6B 4W9JC 5EO9B 3B56A 4X98A 3M17B 1NAKH 1ZK5A 1TR7A 4ALAL 1AR1B 4FQHA 4XHJC 4EDXA 3C8HA 4PVBA 2ARWA 1GZHC 1SHWA 1UKTA 4TNFA 2L7UA 4RX4A 3BFQG 3NZ8A 1RXLA 1SEQL 3M7FB 1YEJL 1OVZA 4F7MB 2PTTB 3BP7B 3ZSSA 4HS3A 1RH8A 4RBPK 4D8OA 1GZQB 1EEZA 2VUYA 2YMOA 5A2JH 4OIAA 1MFDL 2VQTA 1PKQA 4OD2B 5KVFH 4YHNA 1INDL 2PKDA 4ZOAA 3L3DB 1TCRB 5C9JA 4QJ4B 3QC5X 1F41A 4UNTA 1AG6A 3K74B 4E41D 2HLAB 3FU0A 4GOSA 4R26H 3PWVA 3UYPB 3APDA 1KYOK 5HPOA 3IMBA 1DUZB 1NGZA 2YOAA 3DJRA 5D4HA 1CGSH 3MJ9L 3QXTA 5HPMA 4ZK8A 3SCMC 1NLDH 4CVXA 1SLVA 1QFUH 1KTLA 1KJ3L 4BKSC 1INEL 2UY6B 1CK0H 5C0IA 1DLHB 4WKXA 1ZANH 1CXKA 3VCLB 2C26A 5CAYB 1WUNT 2R7EB 5DRXA 4KH2A 1C9SA 2VMCA 4LMQE 3DV6B 3FO2B 1QNZH 1CXIA 3S36X 1ASOA 3NCBB 3MNZB 4BWUA 1JZ3A 4FQ1L 2Z92B 4DGIL 4YSQA 1JE6A 4HGWA 5IFAL 3GIVA 3PJSA 4FLQA 4KQ0A 1NCAH 2XN9D 2R9HC 2XBTA 4HH9B 4NWTH 5ITFB 1L9NA 3A4AA 5FKAB 3T0AA 2DQIL 3IFLL 1MCEA 2E7MA 1G87A 4OLYH 4OZHA 3PWPB 3OKMA 2EECA 3CDGB 3MRKB 1BZ7A 4UT9H 5C0GB 2DEYX 5T5FH 5JR1H 2XX0A 3CDZA 3UERA 4ODUB 1WF5A 5L4JA 1S7QA 1E40A 1FORL 1RP8A 1TNMA 3AXHA 4XVUC 2Q86B 1OL0A 4AVIA 2VZSA 5MP6L 4EUPG 4NN5C 4PRAA 2XQYG 1TVHB 1U8IA 5J11B 2Z6FA 4XR8C 3K2MC 4PV1C 1JV2B 2P48B 4NN7B 1OTSC 4ZJ9A 3B7TA 5LGJA 3QEUB 4GQZA 5ESQA 4Z7QB 4H7VA 4KMTL 4A67A 2BC4A 3P0VL 3CVBA 3L13A 4NUPA 4TM9A 4EZMA 1R3LB 1JGDA 1KPRB 4H8UA 4HJ0C 4WV1C 1QBLL 2QVTA 3VMOA 2VR3A 1YHPA 2JB6A 2ZXCA 3MV8D 3CZEA 1IC7L 4S1RH 3BSGA 4UT7H 1IMHC 3MI6A 2R29H 4Y8AA 2GI0A 5GSRB 1DVZA 4WZ9A 3VXQB 1QHQA 2BDNL 3NT0A 5T3XE 4Z7QF 3D33A 3IDNA 4AKPA 2E46A 1G4RA 5DQJB 2ZUTA 2E0PA 4G8AC 2EXTA 3NAAH 2WWNA 2PYED 4FF9A 4PRDA 1J9TA 4PJBE 2PPFA 4DGVL 4F58L 2W94A 3SGKC 4U33A 4RAHA 2BCKA 3C87A 1U91B 5K9OB 4IMLA 3LRHA 2QKIC 1NDMA 1PYWB 2BSSB 1WA2X 4G5AA 5J12B 4M3JA 2ZE0A 3L1OL 3VI3A 5DMKA 2A7BA 4WJ5B 4PS4H 4UV7H 2VL4A 4B9PA 4MA3B 4KDVA 3H9SB 1DVTA 2YFNA 1N3NA 1ETZA 5EZOL 1IBBA 3ARDC 1KF9B 1OLLA 3GMRB 4M8VA 5JW4Q 3AJ7A 4LCCB 1WISA 3MLPA 2IMNA 5IMMB 3CZUB 2PYEB 2BIPA 5CLXA 3QFDB 4D0DA 2P49B 1VLXA 4D0CB 4CGTA 1TLMA 1Y0LA 2YGQA 4IKKA 1H5BA 1UGNA 3CZFB 3FSWA 2FUQA 4MJID 3C6SA 1U42A 4MJ6A 1HHHB 5L9DL 4JDVA 2OJZH 2WY3B 3MRDA 4Z0BL 5HP5A 3PGDB 1ZT1A 4NERA 4W9EC 2B0SH 4UQ3A 1MFMA 1DQML 1BOYA 1FV1A 3GSVA 4U0QB 4XCFL 3MJWA 2QPFA 2YR3A 5I1JL 3QCUL 5FIEA 3ARSA 3MV01 4UQEA 4HPOL 4BQ9A 2J56A 3C8KA 4XNAA 4L1DA 3QH3A 5D2LE 3MNVA 5E70A 4MJIB 4JRXA 1R33A 1O7SA 1XGYL 3P30H 3RWIB 1LD9A 3NN8B 4BUQA 5GS0H 2EIKB 3GMQA 3IDXH 3BSZH 3E6FA 2IIJA 3JWOC 1IT9L 2DS4A 2BOCA 4RGMC 4UDTB 1FNSH 4F7PB 4HHGA 2F7IA 3KJ6L 3IETA 2DJMA 2VAJA 3HHMA 3BP5A 1H8NA 4NZTL 3CHXA 1QSFA 3KLKA 4N6QA 5KVEE 2CDFA 4I1PA 1K6QH 3CZGA 5E08H 3LEVH 4PMFA 5K9QG 1EK3A 1F3JB 4L8DA 5DUJA 2QR0B 3VFPA 5FKPA 1Q4NX 2FWOB 2RGSA 4HWZB 5FYJE 4Q8BA 4F15C 5JDSB 3BZDA 3ZO9A 2O6EA 1BVKA 2Y07H 3O4LA 5DWUH 5AD0A 3FQYA 3TH4T 3VD7A 1I4FB 2ZUXA 3NCJH 4XMLH 2HKFH 1U8QA 5EV7A 1ZPUA 3SDDC 4K7FA 4FTVD 4IRZL 1JZHA 5IVXA 4TLSA 2Z31D 3WFZA 3GM0A 4R83A 3NSDA 5KTEH 2ZWSA 4EI5A 3QEGL 3EHBC 3O9WC 3WCYA 4YDVB 1UEMA 1WPCA 3TO2B 5IJVA 3MOAL 2FD6L 1RU9L 3NRQA 1F1DA 1I9IL 1MQ8A 3IVKA 4O2CB 4TNWF 5I66B 1MI5A 3STLB 4JG9A 3SDXE 5I23A 3EJYD 5FGCE 1H3GA 3MV9D 4R5TA 1ROCA 2X4SA 4F2EA 3MV7E 1AD9B 4KK9D 1QWNA 2FATH 3IDJA 4UQCA 2AK1H 1RZIB 2K7PA 4PGZA 3W11C 4FTVB 5E4AA 4KKLC 2NXZD 2Z31B 2A0LC 1KV7A 1TU2A 1QBMH 3DRTB 3GSWB 1BFOA 2D3NA 4DOHE 4HIJB 2NY2B 4XBMA 3NIGF 3ALXA 2IAMA 3FTVA 1QQDB 4NB7A 3KLAA 4BFEA 1SGKA 3MV9B 4KK6C 3UPRA 2HJFA 1DQLH 2FWSA 1I9JH 5EF2A 4P9HC 2AKRA 4G1MA 3VYOA 2IAAC 4NFDA 5DD3H 4W9FC 1UD8A 5FO2A 1WT5C 1JTPA 1MHHB 1LK2B 5J8OA 1KULA 2NXZB 3GXNA 3OLEA 4GIAA 5E51A 4R2GC 5SWZA 4DEPB 3MJ7B 3KVDD 4WFFE 7TAAA 3HRPA 1FO0B 4HJIA 1MRCH 3SIKA 3EXJA 3P9MA 1GAFL 3CC5B 1R24B 3BN3B 4BZ1H 1TO5A 5ESVB 1A6WH 5TQ2L 4EOWL 5DEZA 3V5DB 1W8EA 5EEWA 1L7IL 3F64A 4XRCA 1W0VB 4XWOC 4AKOA 3QBTB 4JFFD 2ZIDA 3W82A 4W9LC 3VGBA 1F11A 3T0WA 3MNWA 3CFDA 4AXWB 4F8OA 4D9LL 4YDJA 1XGPA 2RACA 4XE0A 2PWFA 1A7PH 3HHSB 2CU9A 1RP9A 4FLSA 1T6VN 4A2GA 4FL4C 2OMXB 2AJVH 3SE3C 3LQMA 1D9KA 4P4KD 4YDMA 4ZAKC 2NZIA 4U1IA 1XGUA 3HBPA 5EOCL 4Z7NF 3RL2A 1Z9PA 1XB3A 2MCPH 3IT8D 4GG6A 3GI9H 2CBOA 3MBXL 1R34A 2H32B 4JFFB 4Y5VC 4QF1A 1M3JA 1JGUH 5KVFE 2CA4A 2DQMA 1BBJB 3GYRA 4P2YA 3IAGC 4HV8A 1JGVL 2NY7L 2KMWA 4UBDD 5F7KC 2VR7A 4H88L 3I50H 3G6JA 2J5WA 2X5PA 4HSQA 1U8MB 4GW5A 4S1DC 3ROLA 4GMTH 4DZ8A 4WRLA 3T1WA 4P4KB 3D18A 5JIKA 1ZWIB 3Q8EA 4UWQB 1IAII 4XBEH 4K3HA 5IB3B 1CXLA 1J05A 5D72L 3MBEA 4J6RH 1UOWA 2G0LA 3MROA 2I24N 4N1CA 4TNVF 1OP3H 4X99A 2FE0A 4MTMA 1BYNA 4LLWB 3VRJA 1FJ1A 1XR9B 2B1HH 4NQCE 3PY9A 2H6PA 4OAWB 2V2TA 1OSPH 1YEFH 1KJVB 1AZZC 4GLRI 4X0KB 3WIHH 4JQIL 4WO4C 4ELKB 2F8XC 5FUOL 1OB0A 2QQLH 4L4TD 5AB0A 2X4OB 3BH8A 4EUPA 1XWVA 2OFQA 3TFKD 2FRGP 2XQYA 3FQWB 2OAAA 3UTZB 3SYAA 3U0PA 5FA4A 3TVMA 4ABUA 4WENB 2YC1B 1CD8A 1KCWA 1L7TH 4DP6X 1CFBA 3BISA 3BKJH 2XN2A 1H8SA 3MZGB 1PQZA 3MLTA 1GTNA 4IDJH 2BSEA 3U46B 4DNLA 5IQ9A 5J1TC 3UTSA 5A40E 4Y5YB 5DFVC 4JCLA 1UM5H 1T21A 2AXJA 1RIVH 2A6IA 2E86A 1AY1L 5J3HD 1INQB 4MMYB 4PLKD 4AYSA 2QZ5A 4N0CD 4L4TB 3VXUB 4X4ZA 2NLJB 3DLQR 2BSTB 1EHKB 1N59A 1AFVH 2ICEC 3S5ZA 2FQEA 2R0WL 3TIEB 5KAQG 4Q58C 3CHQA 2YD7A 2J1YA 4FQLH 1ADQL 5DZLA 2NRDA 1KDIA 3WE6B 3NEXA 1K8DB 3LNHA 1EA9C 4XHJD 3U7YH 2PXYD 2OV0A 4D3CL 4QR7A 2QVKA 2OZ4L 1I9RL 15C8L 1A4BA 2PWHA 2X1WL 1ZV5A 1JHTB 4PJDA 5JOFA 2GUOA 3IFOA 1U8JB 2H3NB 5C1MB 4KITB 3LH9A 2XKNB 2VSCA 2OR9L 3OC5A 5MENA 1N9PA 3QUMH 1Q0YL 2PTUA 5IOKA 1PEZA 1ILUA 3F01A 5IB5A 5D1XC 4M9OA 4Z3JA 2GIXA 2UUDK 3DPBA 3I02A 3TA3C 2BVYA 1OSYA 3SKMB 3NQIA 2WVUA 1UOKA 4LSRL 1PFCA 1H6EA 1RUML 1SVCP 1CGSL 3IGAA 3JQOB 4HA1A 1HYRC 5HTSA 3FB8A 3LN4A 2J8HA 3RY6C 5IHHA 4N86A 5EIIG 4G6ML 4AUUA 3NGBC 4DKDC 4YEEA 1TF4A 4FKHA 4RFOH 2AEIT 1QFWL 5BOZG 4N2GA 4P5RA 2CGZA 1QSEA 3H53A 4MD5A 4MJHA 3DTXA 3VVVA 1TMQA 1TZIB 5G4MA 5DVOA 5LVEA 1KXQA 4M8UA 4N9OB 2R9HD 1T5XA 3VWKC 4HX1A 3SCMB 4HUKB 2DJ4A 2D0HA 1NAMB 4AW7A 3NJMA 4HCFA 1X5IA 4LVOC 4P2QD 2WXIA 4JLRB 2VDML 3T2QA 1AMYA 4JDEB 5JR1L 1AVAA 2I07B 3WDIA 2ZOLB 4LSVH 4BFOA 3IRZA 3C75A 5E1AB 3G5ZB 1QLRA 1I31A 1MJUL 4XVUD 3RX9A 1JOIA 3NSCA 3HRZA 4GUQA 4DUVA 4ZPTB 1FFRA 1MLBA 1NTDA 2OR7A 5DJ0B 4GEIA 4J3VA 2AITA 1D5ZA 1KXVC 2OL3B 1UENA 1A9EA 1OTSD 2A4EA 4HIEB 4K9JA 2MQGA 1IAKA 3ZE1E 4JM2D 5JIQA 5DD6B 4LSSL 4P5KB 4N8VB 4BGLA 2QHRH 3OKEB 4P2QB 1KJ2H 2XTJD 1A14L 3TL5A 3KPSA 3QDJB 3HC4H 4FULA 3WEMA 4U6TA 4PJ7F 5D7JD 4M1GH 5EZLB 3H9ZA 1C12B 5EC2A 5F97E 5C0DA 4MA8H 4HJ0D 3CH1A 2HVJA 2FO4A 5CLWA 3GTVA 4DFIA 1MAMH 2A83A 4AK2A 4NN5B 1WZKA 4J39A 4YO0B 1Q94B 3MCLL 4BFNA 5JQ6L 3NACL 3DYMA 4Q0XL 4YDIH 1NBVL 1NOAA 3FSVA 4G8EB 3RTLA 5FDYA 4G80B 3G5VA 4L1SA 2FIKA 1B90A 1DBJH 4GBXC 2CWRA 3MRJB 4QAMB 3W9DB 4KDTA 4ZUTA 4QAWA 5I8KL 3FHEA 5EDSA 4WV1B 1J9RA 3GEFA 3HUJE 4GXUM 1QR1B 2GITB 3OGCB 1JGEA 4NAMA 2EIEA 3EFOB 3MVSA 3F7VB 4JM2F 4PS4L 1P7KA 5DRNA 2KERA 3KL0A 1E5BA 3PAYA 3QG6A 5HHOD 3TX4A 4KBPA 2QPEB 2JV6A 3ARDD 1U2YA 4FERA 1D6EA 4YX2H 4U3SA 5DUBB 1VENA 3ARQA 3P3TA 1ASPA 2AJZA 1CLOL 2PYFB 4WWKA 2C9AA 2CLZA 3DNKA 2WQAA 4CILA 4I77L 4JB9L 5DYOA 2GK2A 1RUPH 3B4NA 4PUBH 4FYSA 2XY1A 3MAWA 5C08E 3PL6A 4JO4H 2QKIB 3HLKA 1XCTB 2HH0L 2YD1A 1U8PB 5IF0B 1A65A 4M00A 4BH7B 2K9FB 3ARFC 1OQOA 1TENA 1YAZA 4DQOH 2VR8A 4LE8A 5L2JA 5HHOB 3GSRB 1J1PH 4K5PA 3TIDB 2R56H 1D5MB 3ARDB 1EERB 2YSTA 5KVMC 1JI1A 3OC8A 5H2BA 3MLUL 2VQ4A 4O2FB 4FDWA 1GSMA 2JTDA 3UG3A 1GOHA 4JPVL 4ZTPH 3GIZH 1ZKAA 2NQCA 2A99A 2WBKA 4QHUB 1RZKL 5JMOC 4M62L 4JRYE 4NAJA 3IEAA 2M1KA 4LLQB 4XXCA 4TNEA 2OMYA 3F83A 3UZQA 2EYRA 2CO6A 2F54A 1IAMA 5ENWA 1FNSL 5JOPE 1SPDA 2XHNA 4OZ4A 4X6FA 4X7TA 2MPAL 4UQ2A 3VXMA 3KBHE 4AKQA 1KY6A 4G9DA 4YE4H 3WKNA 2X4TA 1L6XA 1ACYH 4KUZL 1K6QL 1SMOA 3QAZC 1SOSA 5C8JA 5DC9B 1OAUL 1J1OL 2IBZX 4B3EA 1DYZA 3O6MH 5KWYC 1XGRB 5BQDA 2H41A 3UX9B 1HJCA 1NFIA 4RGNE 1I8AA 2GVYA 3IJSB 4TPRH 1L0PA 1PNDA 1QHPA 1UXLA 2ATKB 1C5CL 3HBQA 2ADFL 5JXAL 3NCJL 4GKSB 4HFWB 2HKFL 4OGXL 3DX7A 1JZIA 3V0WH 4WI3A 3SDDD 1BEYL 3D2UA 4RGMB 4OJCA 1YC8A 4NQVB 2J6EH 1NCDH 5HGGS 3W2DL 3EHBD 4Q6YA 3N0PB 4OLEA 3B3BA 4XO4A 2P5EA 1TJIL 2GJRA 4PJ8A 1AZNA 5AKSA 2C5DC 5TDNB 3TPUB 2AEWA 3MLRL 4YL9A 3UTPE 1D7CA 3G6DL 4F15B 4YLBA 2O30A 2JKWA 5DK2A 1NL0L 1WAAF 4QPEA 4GH7B 5EA0L 3W11D 4GI6A 3SDDB 4PJ7A 4KKLD 3MRRA 1SUHA 1FNFA 2EE9A 4R5VA 2X9XA 1QBML 4ZYKA 1QEWA 4JNXA 1QO3A 3EHBB 4TUKH 3O9WB 3AXLB 5D5MA 4CMMA 5KZCB 5F7AA 4YBHA 5CCJA 1QKZH 3FTWA 1NC2A 1LO5B 3DROA 4QHMA 4ADGA 5AVZB 1K2DA 3IFNH 3FO1A 4EF3A 1YYLL 1T4WA 4KK6D 4N0UA 5C6TH 1UQSA 1DQLL 3ASOB 3EYOB 4DVRH 2K3TA 3BGFC 12E8H 1S8DA 4LQFH 4J3OC 1VPOL 4JQXC 5EUKA 3KCPA 4U1NA 4MRBA 4RSYA 4YHYC 4OIIL 2QVFB 3QHFH 4R2GD 4UM8A 1T7XA 2HYMA 2D7MA 3IDMA 3P0YL 1VADA 4WEMB 3QDGD 2HWZL 1NGXA 1RK1B 4Z7WE 5I8EA 5D70L 4GB9A 4R84A 4TUOA 3D85A 5I17B 3IDYC 4KXCA 4WY7L 5DZJA 1V3JA 4F37K 4PJFF 5IB1A 35C8H 1E4HA 3OL2A 4AG4H 4OJAA 5D7IF 4IIQA 4KPHH 4KDWA 4XWOD 3KM2A 3MXVL 3WL9A 4R2GB 1ETA1 2IADB 1QFWM 3BCDA 3QDAA 3ZBMA 4G9FA 3DXAD 2VDLH 5LB1A 3KLHC 1A7PL 2WIIA 5KBLA 3WI9A 3ARTA 3FTZA 3FU6A 3PGFH 1U8CA 5DJ8B 1JPSH 3ML9A 3LNGA 1BX2A 2AJVL 2JWYA 5T8IA 2JJSA 2ROXA 3PQYA 3I6LD 1FRGL 3C9NA 3CZNA 4GUPA 4ZAKD 1B4RA 2JIXA 2R59A 3GLEA 3D0LB 1AP2A 1IC5L 1TZGH 4BUGA 4ELME 3RLSA 5EIIA 3FUKA 3QZMA 3IJEA 3CMOL 1R5IA 3GS7A 4QY8B 3SO3C 2JLPA 1IGML 1AGFB 3ZKQD 1YNTA 5J4MA 1NFAA 4PJAA 4TVPL 3M7OA 3RWFB 2VLJA 3DXAB 4PRHA 3Q1SH 2CR3A 3BAEL 1PMYA 2AW2A 1PLCA 1SY6L 4GQRA 4X6EB 1CFQA 4MDJB 1U8LB 2YXVA 2CO3A 4FL4B 1T04B 4XCYA 3L4YA 4X7SH 3LRLA 2CQVA 2ARJB 2FX7H 4S1DD 3SKJH 3K46A 4ZMZA 1WFOA 4ZAKB 1E6JL 3L16A 4XBEL 4FJ6A 2FK9A 2NYKA 3BIBX 3MMEA 4FA6A 4ATWA 2CLRB 1HL9A 1P2CB 2I7OA 1PZ5A 4Y5VB 2DQHH 4LXFA 3OJMB 4JJHA 4RNRA 5LN8A 4A2EA 3SEPA 2BOBB 4AEHL 4RH4A 1JXDA 3S5LB 2Y7OA 4B9YA 1FSKC 3AS0A 3F3HA 5CEXA 4HG4J 1E2VA 3ZIMA 4WO4D 4DJMA 1RERA 5CN1A 2QQLL 2JXMA 4HJGA 3ALPA 3PAZA 3VUAA 3V6ZB 3F6LA 1CDYA 4EI5C 3FRUA 4B50A 2VRQA 2O93L 2IOIA 2AQ3A 4WSJA 3U36B 1ECZA 4XX5A 2QV2A 2VZ3A 4ETQA 1K8IB 4DP0X 1LDPH 3FB6A 3K6NA 5L2KD 4LFHD 3QNXB 4ZFOA 1IVLA 1HAWA 3MJ8A 3EYSH 3MRPA 1IAOA 2Z7ZA 2Q2EB 3N43B 5DFVD 1I1YB 4BH8A 4XPAH 4OY9A 4WO4B 4XMPH 3QXDA 4KI5C 1QTPA 4ICWA 2W60A 4RAUA 3V6BR 4MMZA 4EVNB 1HHGB 1J8HD 3GGWB 3L5XH 4BFGA 2HFGL 4MAYA 4XNYH 4ZS6C 2JKIS 2BHUA 4BUHA 2IAMC 3K80A 5IM7B 5L2KB 2XPGA 3N43F 1L0XA 2BY3A 3ZZQA 4JEGB 1XGQB 3UGUA 1QR4A 5C3TA 3X11B 3IWVA 1XIWA 2V5TA 4JFDD 5JW3H 1KLFB 5FWRA 1T1XB 5LGKA 2ZPKL 3MU3A 2AV1B 2SODB 4BKLB 4XC3L 1J8HB 3SBRA 5EBMA 2ICEB 1IQWL 4DP5X 3QUKB 4G43A 4D9QD 2OJ1A 1YCSA 4WW1B 1FVDA 4HWBA 2YGVA 3KM1A 3BSHA 3REWB 5D1XD 1ZXQA 1O75A 1ZT4B 1SOKA 3D7PA 3LKRB 2ZKWA 1CFNB 1IFGA 2YUZA 3ILQC 5B1CA 3TA3D 4AGPA 2BVQA 2YGPA 1MJJB 3PYCA 4JFOA 4ZDHB 3HG4A 4KI1A 3AG4B 3BP4A 4JFDB 2RMNA 3H55A 1XF2A 4XVJL 2K3HA 5D7IA 4X6DB 2EVGA 1L3WA 3G9AB 4OGAC 3QVAA 4QXVA 1T5WB 1MFBL 4PJXE 4S10A 3U7WH 5LLIC 4J3UA 3QZPA 1AH1A 1MWAA 1YNKH 2C3HA 2X9YA 4KVNL 5DZPA 3VD3A 4JFHE 4HK3N 3MOBH 5D1XB 4BSVA 4UT6L 3BDYH 2AVFA 5D1ZA 1TJHH 1WWWX 4JANB 4QRSA 3TT1L 4OV5B 1YMHA 4ZUSA 4L4VE 3TA3B 2QSTA 3RURA 1E90A 1D9KC 1EDHA 3OLIA 3R4RA 4MCZA 3GSOA 1G6RL 5J9PB 1RD6A 2VDOL 3DC0A 1ZV2A 1L9RA 3BWZA 4ORGB 3GMPB 3D4YA 2CBMA 5DVPA 3VXSD 4AV4A 5I19L 4HIXH 2VUKA 4NZDA 1M05B 1KENL 5FYJU 3X12B 1E43A 5C97A 1QAWA 4K8RL 5HYSB 3VM7A 2WVTA 2HFEB 2ESVA 4ONFL 4IBWA 5G55A 2GJJA 3VA2C 3NH7H 1SF5A 1AR2A 3OKDB 5E8PB 2C3XA 4TF4A 3RVTC 3MO1A 4N2KA 3H85A 4CJ1A 1J8KA 4WUUD 2R4SL 2C1PB 1DE4A 4LSVL 3LEXA 1T4KA 1T0MB 4Z95H 5B7FA 3RA7H 3G5WA 1EEYB 2OPCA 4EXKA 4LKXA 2F18A 5E1QA 3GZQA 3MBEC 4MDIA 3FU3A 3AABA 3RHWK 3VXSB 3OKOA 4JJ5A 1FFOB 3BCFA 3BOVA 5FV2A 2ZP0T 3VWKB 4GRMA 4NOFA 2R1YA 3JWNG 4IOIB 1MLCB 4W68A 2Y06L 4P48A 4APQD 4LVOB 3ZKMC 1ORQB 3HC4L 4WUUB 2XFXA 3HS9A 4IU3A 3LIZL 3WO4C 3LNFA 2GAZB 2EEFA 3LSOB 4G8GA 5ID1B 2FLMA 1ETB1 4E9TA 4ANKA 2EUWA 2X44D 5D6DA 3FQXA 1MFCL 3QJTB 1DQDL 3SYPA 4AMWA 3A23A 2DMHA 2HVKA 4YAQA 1J18A 2W65A 4OFQA 2PMZA 4GRLC 3PS6A 4JZOB 2WTPA 5CZRA 3WMSA 2N7BA 2Y5TA 5EC1A 1QWUA 3OAUL 3LZQA 4XBPB 4N0FB 1RHHB 4OQTL 5DSCA 2IOMA 1G9ML 2QTEA 4OD1H 9CGTA 1L6ZA 4KJYA 4ZSOB 1E4XI 4C56E 4QNPE 2B3RA 4H5SB 4P3WA 3OG6B 4K3DH 5EO1B 5IHBA 1BG1A 1DQJA 2GFBB 3GHBL 4FZ8H 5F96L 5A3IC 2WLLB 1K5NB 3VJ6A 1JTTA 2CE6A 2NXYD 3UBHA 1H6TA 1XB6A 4HUVB 4IKIA 1LVEA 1NCOA 4ZMYA 1BREA 5ECGA 4QXWA 4Z23A 4LCUB <