2XG4A

E. coli p pilus chaperone-subunit complex papd-paph bound to pilus biogenesis inhibitor, pilicide 2c
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
216
structure length
216
Chain Sequence
AVSLDRTRAVFDGSEKSMTLDISNDNKQLPYLAQAWIENENQEKIITGPVIATPPVQRLEPGAKSMVRLSTTPDISKLPQDRESLFYFNLREIPPRSEKANVLQIALQTKIKLFYRPAAIKTRPNEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVKSANYNTPYLSYINDYGGRPVLSFICNGSRCSVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords CHAPERONE PROTEIN PAPD
publication title Design and Synthesis of C-2 Substituted Thiazolo and Dihydrothiazolo Ring-Fused 2-Pyridones: Pilicides with Increased Antivirulence Activity.
pubmed doi rcsb
source organism Escherichia coli
total genus 43
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2010-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xg4A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xg4A01
3X3GL 4GKOA 2VDRH 3WO3B 4LRNH 3GB7B 4NO0B 3IFLH 1T21B 4NKDA 4D3CL 3LQAL 5JQ6L 2E8YA 1MFCH 2IC2A 5J6HB 2JCCB 2VDLH 3DECA 4PJEB 2EXYD 2VWEC 3B4NA 2GY7B 1I1RA 4LARH 2BVQA 1MRCH 2EZ0D 3D3VE 4UV4H 3K2UL 3KPNB 5JDSB 4AEIH 5AUMA 1G7MA 4P49A 3NTCH 2EECA 4HFUH 4HKZB 3O6MH 1UKTA 2CDEB 3D9AL 3OJDB 3QFJB 3VG9B 3VU2A 4G5ZL 4KC3B 3D18A 4LPWA 5F21B 2ZOKB 4NZRH 3VXRA 1TJGH 4XRCA 3V7AE 4YBQC 3T0VA 1LDPH 4PR5A 4XBEL 3RUGA 4O51B 1LO2L 3L3OA 1PSKL 2IADB 4K3GA 4X6CE 4K3DH 5T3XL 3SE3C 3TT1L 5J13C 1A1MB 3OHXB 3ARQA 1AXIB 3BKYH 4NQSA 3V2AR 4P57A 1OPGH 5F96L 3RZCD 2DQFB 1ZLUK 1U2CA 1I9RH 3UP1A 3C9NA 4X9HA 5I1IL 3JVGC 2AEWA 4HGWB 1PY9A 1SJVA 4KGLA 3I3DA 5JW4M 2PTUA 4K94H 4LLMB 4N8VA 3ME0A 5DYOB 2NXZC 4K71C 3K4ZA 5IB2B 1GYAA 1ETZB 3EZJB 3BGMA 1TJIH 4I77H 1TETL 2YUZA 4OJFL 4A6YL 5ANME 1NCBL 2QADB 2VABA 2EDWA 3TA3D 3RHWF 3TO4B 1CXLA 4G8GD 4Z5RA 1FFNB 1CXEA 1NJ9A 4LAQH 2HT4D 1DBJH 2P5EA 3ZDXE 5EUKB 2YXFA 4JPKH 2HMID 2R9HC 3NIFE 5IFHL 1FJ1A 4NO3B 1N26A 4OM1L 1NGXA 2VLKB 4WY7H 3V6OE 3WNKA 3I50H 5EC1A 3QXDB 2Z31B 3T65A 1CDYA 4OLVH 3QAZC 4Y4HA 1IGYA 1U8JA 5B21A 4JDZB 4TSCL 4HIEB 5JLZB 3RWEA 4FMKA 3LV3B 4LLUA 4J1UB 5KVFL 1E6OL 1NMAH 3HI5H 3MSPA 4DW2H 3ZE2F 2F19H 4ZPTA 2PCPB 4QNPF 1YEFH 3PDOA 2P49B 4JDVA 4AIXA 1U8QB 4RMRA 1NAKH 4AEHL 2X9WA 4K9EC 5CD5D 3MNVB 4FN0A 3SQOH 5E9DA 1K85A 3ARRA 3HUJF 1MUJA 4LKXB 5FYJU 4F37K 1E4WL 1G84A 4S0TD 4XAWL 1FRGL 4U1GB 1T66C 4QHKI 3QDGB 1MHHB 4MA3A 1UENA 4ZFFB 1DCLA 3U0TB 2ESVE 5CEYB 4D2NA 3L3IB 4TSAL 4Z78A 1CK0H 1CD8A 1F13A 4HUVB 5CEZD 1ZLVH 4NDMB 3BVNB 5EZOL 2VZOA 4A2LA 1LD9A 4KHXH 3IFOB 1RUQH 4MXWH 2NY3D 1G1CA 3SDXE 3WS6C 2H6PB 4JFFB 1IKFH 3TYFA 1KIPA 5KW9L 1ZSDB 1HXMA 1ZGLM 1CG9A 2K1MA 3I6GB 1KYOK 3KPRB 3O6LL 5FO7B 3OKDB 1NUNB 4N9GA 5ADPH 3DETD 4FZEL 43CAB 1FBIH 4Y5VA 3D3VD 4TVPL 4KDTC 2AJXH 4WW1A 3W5MA 3C5JA 4X4YB 5T33L 1N0XL 4GKSB 1HI6B 4PJ5A 4WO4A 1T1YA 1YEJL 3MMEB 1CD9B 1JN6A 4Z7UB 1JK8A 2R4SL 3ARFC 3L3GA 1A3QA 3C08L 3PWJA 1IBGL 3PHOB 3U7WL 4P2QA 4N8CH 2X1WL 1QG3A 5EORL 1JZ7A 5CD3A 1RHFA 5DC9B 1FPTH 4IRSA 2AJUL 1J10A 1OQOA 4P46C 1A6UH 1F3JB 2OJEA 3GI9L 3DV6A 2OL3B 1WGOA 2X1OA 2UY7A 2VDKL 4P23A 1UM5L 2HT3C 5JW4Q 2NXYD 1LWRA 3NAAH 2ADIB 2W0FB 4L29A 4MD4A 5DVOA 3BWAA 2NW2A 4JPIA 4QXTB 4URTB 1J0IA 2IWGA 3IETA 4X5WA 3BXNA 4JGMA 2HJKB 4JO4L 2HN7A 4QWWD 3CFKB 3PQYE 3FT2A 1EHLL 5KAQG 4GRLD 5F1OB 1KXVC 5BW7C 2H45A 2ZUWA 2HYMA 2G5BA 3IGAA 3MODL 2HRPH 4P2OB 5D2LB 1ZWIB 3ZDXF 2X4OA 2Q7YA 3MV7A 3AY4C 4J3SA 1XF3B 5MENB 1HWGB 3ZLQC 1YEIH 2ID5A 4X80H 3MRDA 4Y19D 5LWYH 3IJYA 3LN4B 5IVZA 3QIBB 5GZNC 2VL4A 3LPWA 3VFTB 4AT6A 5ISZB 4LSRH 3CDGA 1KTLA 1A7NL 3L95B 1PX3A 1BD2A 5DHYB 4Q2ZA 3SKJH 4NM8H 4Y8DC 1S7RB 3MFFB 5E6IB 1QQDA 1KCKA 2VN7A 5I1AA 5CBEB 2ATKA 4U0QB 4FNLH 3OG4B 4G8EB 3CFDB 2IAMC 1ZS8B 2H8PB 1LK3L 3KJ4B 4W4NA 4G80B 2ESVD 4IRZL 3MRLB 4GMSL 4LNVA 1DTUA 1UWEL 3GMNA 2Q8BH 2QSQA 1FE8H 5GS0H 5IK3B 4PGBB 1O5DT 3SGJA 1DUYB 3C6SA 2GUOA 4RAUA 5HHNB 3TBYA 1U3JA 5KSAD 5JNYA 5HPMA 2YPVH 5DHVA 2A2QT 4LNRA 5DMKA 4EI6B 4BZ2H 2EXWC 5BRZB 1TZHA 4HT1L 3QHTC 4YBQD 5TE7L 3VXPA 3FRPA 3SDXF 4I3RL 1JRHH 1J7VR 3EYSH 3O9WA 3HPLA 4UT6H 1LMKA 3SJVE 2WLZA 5IHUL 1UEYA 5AWNL 1A3LH 3QNZB 3RL1A 1S7QA 5JW5A 5F1IA 3W11C 1NFIA 4KY1H 2BVPA 2IPKB 2EO9A 1NGZA 4WUUB 1H8SA 1MNUL 1I1AA 1G6RH 1NEZG 5LBSL 3VG9C 4GXUM 4DKEL 5FK9B 1N8ZA 3KPLA 4PRHA 4PP2B 5ACZA 4LVHC 3CZFA 1CQKA 1AI1L 4ISVA 3MV8D 1G9NH 1IQDB 4YK4B 4ZOAA 5E8PA 5I18H 3LPFA 3D48R 3HC0A 1UJ3B 1MH5B 2WQ8A 1D6VH 2NXZD 3GZKA 4EUPG 1IVLA 2YZ8A 2W65B 3BDYL 1MLCB 1GZPB 2X1PA 4WTZA 5HD8D 1KEMH 2WBJD 2Y5TB 4O2CB 2HLAA 3I84A 1S7TB 3WNMA 5FUZH 2FHBA 5IW6A 4HF5H 4S2SB 4LHJB 4OV5A 3HC3H 5BJTA 4P4KB 3X3GH 3KPSD 1JPFA 1A6AA 3HAEB 3T08A 2W59A 3HR5B 1T6WA 4JFDD 2Q8AL 3LQAH 4D3CH 2V2WB 5JQ6H 1WWCA 4OT1L 2Q86A 1T7ZA 4UUJA 4F57L 2Z8VC 2A73B 3FQUB 4Z95L 1MCJA 2LFGA 3K2UH 3O45B 3KPMB 4RIRA 3IDMB 2IALB 1L6XA 5DJ8A 2GI7A 4MAYC 2QADC 1FZMB 1UXSA 3D9AH 1NFKA 1TQCB 2XT1B 4LPXA 4MXQC 4U1JB 4G5ZH 4P3WA 1FO0B 4NQUA 2V5YA 3EYQC 5J6GB 4KI1A 2AKRB 1VDGA 1UYWL 4OD1L 4C4KT 1C8PA 1F4AA 3VFVA 1I8IB 5F7HA 4XBEH 2PW1A 5BOZG 2WNGA 1AO7B 1JWUA 3DNKA 3Q6FA 1T66D 1LO2H 2ICCA 1PSKH 3FMGL 3TT1H 5T3XH 1AGEA 1UCBL 1HQ4A 5E2TL 3K81A 5DWUL 1UM4L 4UOW1 3QNYA 3JTSB 5F96H 5GGVL 5B3NA 3DVGA 2NY1C 2PYEB 3QEQB 4MDJA 4XPGL 1A1OB 2C4FT 3EOYG 3ZZ1A 3KYNB 3MREA 2BHYA 1FG2A 5FGSA 1J0ZA 4K7PX 1RZ7L 2FCBA 5I1IH 4EQ3A 4ZOEA 5I16B 3L1OL 3DV4A 4MXVE 3ZYOA 2J8OA 3QNXA 4I48B 1MOEA 2RJMA 1HXYA 2JCCE 5EBLB 2HFFA 4PJEE 1A5FL 3MCG1 5HGDA 1TETH 4OJFH 3QG7L 2FZ3A 4A6YH 1GOHA 1NCBH 4DZ8A 5DJZB 1JV5B 3G5ZB 3PGFL 1NDGB 4HWZA 3FO9A 2R0WL 1NGQL 3QFJE 5IFHH 1OGAB 1ZHKB 2JLLA 3FONB 1CTNA 4OM1H 3ARFD 4ELKA 4DGIL 5FUOL 4GKZA 2WP3T 4BKLA 1QHOA 3P9MB 4X9IA 1J88A 4U6HB 1GXEA 3TT3L 2YUXA 4TSCH 4C57C 1NGYB 3RGVA 4XBGB 3LHPL 5KVFH 1E6OH 4P46D 1ND0A 2CUHA 3V0VA 4HIIA 2I9LA 1K4DB 3U0PB 4GG6B 2RBLA 2C7UB 4KRPB 5TH2A 1A6PA 2OTWB 2QSCL 4ESKA 4AEHH 1WITA 1R5WA 5E08L 2HT3D 4XPTL 3IS0X 3FQWA 1E4WH 4XAWH 1FRGH 2X4UB 2EE2A 2W60B 3PHQA 1PKQE 1U8KA 5IMKB 4TSAH 5MERB 2VYRE 4KK9D 4OLUL 5L0QC 3U30B 5EZOH 1ZT1B 4FHBD 3V4PL 4AIZA 2R2CA 4D9RD 3TH2T 1B0WA 3GSXB 4KJYA 5KSUA 5GGTL 2VN4A 1F2QA 3QUMB 4U1LA 4X4XA 1GGBL 5DZOA 1ZLVK 1XMWA 1CLZL 43C9B 3O2VL 3IDNA 5KW9H 3Q6GL 4HUXA 4MMXC 3U9UB 3O6LH 5IT2L 3TBWB 3BD5A 3WEXB 5GZND 3DTXB 4FZEH 5K33A 1WLHA 3N1MC 3E6FB 1MCOL 4TVPH 1U3HA 4YBHA 1D7FA 3SE8L 4TUJB 3RRQA 3PABB 2AXGA 5DEGA 3SPVB 2BVOA 3DUSB 5T33H 1N0XH 4MA1C 1YEJH 5E0QA 1T04A 4MD0B 1EO8L 2R4SH 1T0NA 4WHDA 1QFHA 3C08H 1NDMA 5IV2A 5I1HL 2IH3B 1IBGH 1M7DA 3U7WH 5IIEA 5E24E 1NC4D 5IVXA 4P2OC 5JMOC 5EORH 4PB9L 4RA3A 3KPQB 1S7XB 1P6AB 2FYYB 4PJ8A 5EIQA 2AJUH 2NNAA 4Z8FL 1RHHA 1T0MB 4LLVA 4FMFA 2HVJB 2IAMD 1AGBB 4HFWA 4XC1L 1VPOL 3GI9H 3KLAB 1OP3H 1XGPA 1A6VL 2VDKH 3O4LD 4JG0L 5IEHB 1UM5H 5DVMA 4NKQB 3UTQB 4HS8L 4F33B 3LZFL 4QHNA 3L5HA 3FO1A 4K7PY 5E6IC 3NGBB 3R8QA 2EXWD 4UAOC 5DUBA 4JREB 1HZHL 3EJZC 1FFPA 3QUXC 4ZMAT 3GMLB 4MXVF 2PUQT 1J18A 1F97A 3OZ9L 4JRYB 4JO4H 2E7BA 2JCCF 4OCLC 4OFKA 4Z7OE 4PUBL 3S88L 4PJEF 2OBGA 2PO6B 1J1XL 3EYFB 3IDJA 5DK0B 1EHLH 3W11D 1AGDB 4UNTA 1CFTB 5KVDL 4XNUL 3GSVB 1INEL 2VC2L 5BS0A 4MLIA 3BEVA 3MODH 2ED9A 3N85L 5GSRB 4O4YL 3H7BB 3W9EB 2P43B 1S7WA 3M17A 2Y6SC 3O11A 3MCKB 2X1XR 1AP2B 2OSLB 2NX5D 4ZUWA 1IC5L 1A7NH 1LE9A 1MCRA 1U93B 1YDPA 1BLNA 3CFIC 5IKCB 3LKPB 2V17L 4JN1L 4JFOB 1ZHBB 4R96B 1EDQA 3RPIA 2HJFA 5SV4A 1R5IB 4WFEE 2A83A 1M71B 4WNQA 3VW3L 3BAEL 3QA3B 4QOKA 4CU7A 2NPLX 1HNGA 2R8SL 1YY8B 2KZWA 4LHUB 4PTTA 1QLRA 2P8LB 1FZJB 1CLOH 1OB1B 4Z7QE 4E0RB 1S9YA 1LK3H 1TVDA 4J8RB 4MCYA 4IRZH 5JIKA 1BJ8A 2P24A 4GMSH 5IROA 4PJIE 1UWEH 1BZ7A 2FECI 4MAYD 5GGTA 2B39A 4MXQD 3EZ8A 4NIKB 3EYQD 1S8DA 2BNQE 4HT1H 2EE9A 5TE7H 5MENE 3O8XC 1G0DA 2X4TB 4I3RH 1WBYA 3VDCA 3RVXC 1JPST 4XI5C 4HUWB 2ZCLL 3EYOA 4RGMB 4HKXA 1BQSA 5IHUH 5AWNH 3V5HA 4PGJA 5ISZE 1S7SA 2XPGA 4ZFOA 3VFOA 1LE5B 5T1LB 1CICB 1MNUH 3CXHJ 4ZAKD 2NY1D 3CFEA 3VFWA 5LBSH 1TQCC 5D7LE 1FYHB 4DKEH 4RWHA 5E00B 2OI9B 5T1KD 1C16A 4JAMB 1AI1H 1X5LA 2AV7B 3DX9B 1Z5LA 5DD6A 3RDTA 3NCMA 2X5PA 2DYPA 1D9KC 3BDYH 3QQNA 4NJAL 5EZLB 3K8KA 4UBDC 5GGUA 3QXVA 3TIEB 2Y1VA 5L2JB 1IARB 1UZ6E 1RZGA 2BVUA 1KACB 1FNEA 3RWHB 1O0VA 5EBMB 1IKNC 1DEEA 4PGCA 2Q8AH 1H5BC 5IJKA 4OT1H 1BQUA 4OGYL 2CD0A 1XGYL 4F57H 4F9PA 4HK0B 3DARA 4Z95H 3RNQB 4U1IB 1RIVL 2XXMB 1MWAB 2A9ML 4L4VE 4ETYA 1G7JA 5I17A 3VA2C 4Z7OF 3WNNA 5MEPA 4QRPD 1U8PA 3AREA 4K7FB 2BSTB 1KLUB 4H1LG 3PDDA 3HI1A 3CFJB 3DXAA 1UYWH 4OD1H 5JUEL 5SX4I 1SHMA 5FA3A 4UU9B 4S1DC 3VGFA 3FMGH 4U7KA 3TVMC 2XIDA 2EDTA 1KB5A 3WS3A 4ZFGL 1UCBH 4MSWB 5E2TH 3MX0A 5DWUH 1UM4H 2JJTC 5JTWA 4X6EB 3MQIA 1QLFA 5GGVH 4JPVL 4JQXC 3LD8B 3STLA 1B3JA 3QB7C 4XPGH 4JANA 3ZT7A 4PLNC 5K9OA 3DIFA 4WEBL 3WHE0 4IEFB 5CBAB 2KUTA 4GUPA 4P5TA 1RZ7H 4CAGA 4WFED 3KNBA 4F3FA 3L1OH 1KLFA 3DJ9A 4EVNB 2H1PL 1LEKA 2MQCA 5D1ZB 1A5FH 4XNQA 8FABA 1C5BL 3QG7H 4Z7QF 1VADB 2Y4SA 2A6JA 4ZUUA 3OJ2C 1OWRM 3ECBB 3VH8G 3PGFH 2B0SH 2P5WA 4YR6A 2QQQA 5J11B 3VJ6B 2R0WH 4PJIF 1NGQH 4JO2L 3MA7A 1W0WA 3IRPX 4Y16A 1U8LA 3D6GA 5F9JA 1J8HA 1G7HB 3E2HC 5EC2B 4DGIH 3F58L 5FUOH 4IOIB 3NCFB 4MQXC 2BNQD 5TQ0L 1AO7E 2YD2A 4L8CA 4R0LB 4XC3L 4QHUB 2R0KL 4X5XB 3TT3H 3T2OA 1YY9D 2XYCA 5IMMB 4YO0A 2LU3A 3LHPH 4M4RA 4P99A 3T0EA 2IANB 3CPLB 3W5NA 5DJ6A 1HHJB 4HV8A 1XCTA 5ADOL 2QSCH 3RL2B 1HIML 1K9TA 2CPCA 2PYEE 2CUMA 3QEQE 5E08H 4JM4L 4XPTH 5CJXC 4JFQB 3W82A 5D7LD 3Q2CA 5B4MC 5F8RC 4JQIL 2YRLA 1L9NA 4WEMB 2EDLA 4CJ0A 3EJZD 2CLRB 3QUXD 1NAMB 1KG0B 2CGRL 4OLUH 3QP3A 3IT8D 5IBLD 4FXKA 4ZFZA 5T1DL 3UDWC 3EYVB 1M6OB 4WFHE 5AD0A 5LVEA 1JPSL 3ETBF 1PY4A 1EAJA 1K5NA 3K1DA 3THML 3DSNA 3V4PH 3QXAB 2EYRB 1UADC 1FL5B 1UG9A 5F7YC 4ALAL 2X4PB 4WW2B 5D2NC 1TJHL 5GGTH 1JZ8A 1IM9A 1OGAE 1UZ6F 1OF2A 3D39D 3T4AB 3MRIA 1GGBH 1CLZH 3LRSB 3O2VH 3DPBA 3Q6GH 4ZSOB 1VFBB 3Q0HA 5I6XC 5IT2H 4JREC 3ARGB 2BNRA 5J06A 4PIRF 1N2RA 2EYTA 3MOBL 1MCOH 4LCYB 4L4VD 1CCZA 4N0UB 4XPFL 4X6FB 3SE8H 1ZT7A 4HMCA 3QCUL 4Q9RL 4GG6E 1YEHL 2X4RB 5F7NC 1FHGA 1EO8H 2I26N 5HHPB 5I1HH 3O6FD 1MI5A 4FTVA 3ZSTA 4F7CB 2UYLA 4GAFB 3LSOB 2APBA 3QFDA 4LPVA 4JFXA 4YPGA 3MRGA 4Z8FH 3S3PA 3OMZA 4XC1H 4YHZL 1GGYA 5JA9A 1VPOH 3T1FB 2O5YL 4HSQA 5IB5B 3TBSB 1DVFB 4IMLB 1JZ4A 1P2CA 1FL3A 4CGTA 5J1TC 1A6VH 4XNMA 4ZUSB 4U1MB 4JG0H 3H9SB 4I1NB 1PYWA 1K4CB 3L3HA 4HS8H 2Q3ZA 4XVJL 2RAMA 3LZFH 1KBGL 1FFOB 2B2XL 3TBVA 3R0MA 1UB5A 3QDJA 1P9MA 1GJIA 5SX5K 4NGHL 4YHPA 4IHOA 1OP3K 3U9PL 1HZHH 3W9DB 3V9FA 3O8XD 1IE5A 4OZIB 4FXGA 4HWUA 5MEOB 3DRTB 4XI5D 3OZ9H 3OKLA 3OJVC 2OK0L 5GRVL 3S88H 4PUBH 1J1XH 5HGGS 4QY8A 5DJ0B 4HD9A 4ZUTA 3OAUL 4HKJB 5KVDH 1EHXA 3HZKA 4GRWH 1INEH 2VC2H 4I13B 4PJHE 3Q5YA 3HI6L 4FQXB 1Q0YL 2M1KA 3AS1A 2DM4A 5CEZL 3N85H 4O4YH 1C7TA 1FQ9C 1C5CL 4RSVA 1R3HB 3QWRD 3CCHB 3L5XL 3BO8A 4OB5L 3GSNB 2J3SA 1IC5H 3IJSA 4LIQE 1T5WB 1AO7D 1D9KD 3SDDC 2V17H 4RGMC 4JN1H 4UBDD 3O3UN 1MIML 4L8SC 4DUXA 2DBJA 3QI9C 4V1DD 5D93B 4CVXA 1CICC 4I2XA 3VW3H 3BAEH 4QHLA 4LPYA 5DHXB 2R8SH 3VFGL 2OI9C 3IDIA 1U8MB 4AJ0A 4LFHD 3TFKC 3X12B 1NBZB 2Y25A 4JRYE 1VENA 3MRMA 4O58L 1FNLA 4JDTL 3U1SL 2GT9B 3CDCA 3VA6A 1MVUA 3DO3A 3FCTA 1U2HA 3RZCA 4X7TA 4OBRA 3BIKB 5A16A 3FB5A 3LKRA 3GSUA 4KQ4L 1FORL 4P5KB 4OGAC 4PJBB 1T89C 2W0KA 4UQ3B 5AAWA 2ZCLH 5IG7A 4S1DD 1WCBA 1CE6A 4I9WE 3TVMD 4HCRL 2M8XA 5LGHL 3MBXL 2V2TB 4QGYA 1NBYA 1S7UB 1ZVSA 5HI3C 3QG6B 3L7FA 1HILA 1C12A 1CXIA 1EZVX 2GJJA 4KK6D 3DYOA 2LV4A 2XZZA 4GG6F 2E7LC 1WIOA 5BZDB 3U46B 4YNYA 1BF8A 1LO3L 1WFNA 3HZVA 2C3WA 1KTDB 5DLML 2IBGA 4NJAH 2I9TA 5EO1A 2VE6A 4I5BB 4L5FL 2A74A 3WHE1 2HP4A 4IIQB 2UZYB 4RGOL 3CNKA 5FM8A 3P0YL 1WIPA 3SKMA 3WKML 1KLGA 5F93C 1JHTA 1NSNL 3GMOA 3UJTL 3FFCB 4P48A 1NEZA 5F9AC 2QSTA 4QCIA 3ZKXB 1IGJB 1VESA 4GBXA 4OGYH 5T1MA 4NUJA 2P42B 1XGYH 3HUJA 4PRBB 4MQXD 4ACPA 1RIVH 4OCRL 1A1NA 1AHWB 2A9MH 4L3EE 2GTZA 3GJFH 4PRID 5FEBA 4EUPA 1FG9C 2VDOL 3MJGX 5JORB 2DKUA 1K8DB 1YA5A 3ZHKA 1F3DJ 1MREL 1AXSB 5J11C 3O3EA 4R4BA 3B9KA 3BZFB 1PQZA 1XIWB 2OX5A 3ZKSD 4QKXB 5DQJA 5JUEH 1JGDB 4HEME 2G9HB 4W6YB 4XCFL 3FQRA 3X13B 3VXTB 1QR1A 2A1WL 4RRPA 5B4MD 1UM6L 3OGCB 4FRWA 4HHAB 3CU1A 3HNSL 1I7UA 3MO1B 1CL7I 3QR2A 4PV9B 4ZFGH 4R0LC 2BOBA 3IXTA 4U7SA 4G7VL 4P2RB 4NQEB 4P2CG 4JPVH 2JE8A 3D3VA 5GIRA 2BSRB 3MGTA 5H2BB 2AV1B 1XZ0B 4WEBH 2VKXA 4HIHA 1Z9SA 4NQVA 2CMRL 4LCUA 1G7QA 5ENWB 2H1PH 4ZXBA 3R0NA 4OIBA 3BKCL 5DMJB 1HQRB 3JV4B 1C5BH 1OP9A 1PAMA 2EE3A 4YXKL 2XZQL 3T77A 5DFVC 1M7XA 2FO1A 5HBBA 3MJ6A 4HS3B 3QHFL 4X6CA 5EIVA 4JO2H 4YX2L 1QYGL 3LKOB 1D5MA 3VRJB 4IS6B 5CEXB 1IM3A 3S35L 4CN6A 3F58H 4IRJC 2Z92A 2P44B 4PTUA 5C8JA 4O02L 4R3SB 3TF7C 3CX5K 5J9PB 5TQ0H 5DDHA 4XC3H 2R0KH 1IC4L 5JMRA 4TN9A 3SBWC 1U91B 3AROA 4WU5A 5DO2C 2R2EA 4QLRA 4I9WD 1HSBA 1LILA 4PRDA 1N59A 5ADOH 3IJHA 1RPQA 4GRLA 1HIMH 4I3SL 3U2SB 3WE6B 4EI5A 3RTQA 2EIBA 3UBXA 2KPNA 5J89A 1BZQK 2GYSA 2H26B 1AKJA 2A6KB 4JQIH 4JY6A 3MZGB 1Z9OA 3HCVA 4RISL 4ETQA 3AVEA 5IM7B 4JE4B 4LFHG 1FVDA 1ONQB 2CGRH 4K9EL 4N5UA 4Y19A 3MUGB 3QISA 5T1DH 3V6OA 2HRLA 2VLJB 4KKLC 1BFSA 1JPSH 5ESVB 3THMH 1OSPL 3OB0H 4ALAH 5D1QA 2X70B 4I0KA 4U1NA 4PGZA 4UIKL 1ZANL 2YK1L 1F6LL 3UPAA 1EH9A 5C09B 3V5DA 2R29L 4KKBC 5TQ2H 3NA9L 1AIFB 1N0LA 1MPAL 4U2ZA 2R1YA 3KPOA 3ARWA 3MOBH 3SDDD 4L3ED 3VFMA 4XPFH 4BUGA 4N0CC 1VGEL 2ESVA 3BPCB 3QCUH 4Q9RH 1YEHH 1NQBA 1JNHA 3RWGB 3QI9D 3KPTA 2I25N 1MELA 4XZUB 3MNZA 3RWDB 1S9XB 3H6JA 3SGEI 4C56B 1U3YA 2QQLL 2ITCA 3HPJB 3HLAB 3SDXA 3TFKD 2D7TL 4YHZH 1FL6A 2ICWA 1A2YB 2O5YH 1J8KA 3ES6B 3QZWB 5A40E 3QO1B 1Y18B 4JRXB 3SE3A 5BZWA 5H35B 4Q9BA 5JPMA 1MCDA 4XVJH 1KBGH 2X7LB 1IGTA 2WINA 3I02B 2B2XH 4Y4FB 1V3JA 4K3JL 4NGHH 4L1DA 1P7KA 2YWZA 1Q8MA 2F58L 4XX1G 3U9PH 2V7NB 4AM0A 4P5MA 4KUCD 4ZSOE 3WN5C 5H37G 4X83A 1EBPA 3JVGA 1X7QB 2Y23A 5BV7B 3WUZA 2E7MA 2OK0H 2CDFB 4KI5C 1Y6NR 1WZ1L 5EOCL 2CDGA 4D0DB 4J2XA 1N5AA 2GCYA 4EUPH 1ZA6B 3OAUH 4N0UE 3KYMB 2VAAA 2PR4L 3BI9X 3HI6H 4LSVL 4HLZG 1Q0YH 5HI3D 1A6TB 4QRSB 5CEZH 4CVWA 3S4SB 2ADJA 1C5CH 4F7PA 3MRQB 3L5XH 5FYJD 3OR7B 2P47B 1I7ZA 5DRNA 4OB5H 3KG5A 2ZG3A 2V2XB 1AGCB 3GGWB 3PXHA 4LQ1A 1WC7B 5EULV 2YOCA 3MLUL 1MIMH 1UB6A 1SYSB 3H9SE 5GGSY 3NH7L 2BOCB 3VGAC 1KB9J 3SKUD 3SDCD 5I0ZA 2OR9L 1UKSA 3H7LA 3SGDI 5CGTA 1U95A 3FQXB 3U79A 1I75A 1J0JA 3VFGH 2CLZA 4L8BA 3QEHA 2R15A 1DN0A 3C8DA 4RMWA 3GBNL 3QIWB 1J5OL 5DRXB 4QTHA 4QHMB 4ODXA 2XTJC 2NY2B 2AXFB 1P84J 5C0BD 2Y9RT 4O58H 2YEZB 4JDTH 3U1SH 4LPTA 5IJVA 5IHZB 3GKWL 4J7RA 2Y7QB 4IIQC 4PJAB 2MJWA 1BIIA 2JK5A 5EH1A 3G6JE 4Y5XB 1FORH 1XGQA 2F53B 1CDHA 1CBVL 2P7TA 2R69L 1F11B 3I6KB 2QR0B 3ZKXC 2QJDA 3UTSB 3NN8A 4MDIA 3WS6A 2YN3A 4M02A 2J8UB 4HCRH 3P4NB 1X5FA 3OB8A 5LGHH 3MBXH 3CC5A 4ORGA 3M1BB 1INQB 3DMMA 2Y5EA 3RJQB 5B38B 4G6ML 4JEGB 4XWOC 4ZPVB 1P7QB 1AE6L 5DA0B 1MJ8L 1Q9KB 3UTTD 1WZMA 4BH8B 5E2VL 4DZBA 3ARFA 3FOLB 3VD3A 3DRQB 2HT2C 1LO3H 4M43L 4UT7L 5DLMH 4KI5E 3LQZB 3RWFA 1XF2B 1U8OA 4LLQB 2N56A 5DURD 2FR4B 4RGOH 3HE6D 1LVEA 3SJVA 1E27A 3P0YH 4P46A 1T1XB 5HTSA 1RK1B 2Q6WA 3WKMH 1RUML 1QSFB 4Z0BL 1NSNH 4YIQA 4CNIB 1JGVL 5ITFB 3UJTH 2DQHL 5FYKE 3QJFA 2XWJB 4NNPL 3NFNB 4WW2F 4IRJD 5TDOA 6FABL 3MJ7A 2ARJA 4PJBE 2LVCA 4TUOA 3MYJA 4OCRH 3UPRA 2IH1A 1BQHB 4GRMB 2ERJB 2VDOH 4MCZA 3FQNB 1FNAA 3NPSC 1N3NB 2Z4QB 4JCLA 5JHDB 2ZSWB 2FLBT 5DO2D 1LEGB 2NYYC 3LEXB 1V05A 5FKPB 3VCLB 1MREH 3DX8A 4H0GA 4LBEA 4AENB 5FGBA 2AEQL 4GKNA 4MMZC 1FV1B 5BW7A 3GJFK 3ILQC 1VHPA 4PJ9B 4XCFH 5DI8B 2A1WH 2MSPA 1UM6H 3PWUB 3QUZC 4LP4A 3HNSH 1DQJA 4HAGA 1YEKL 5FO8B 2XTJE 4IDLA 4NO2A 5EU5A 2OTUA 3GSWB 4Q9QL 2UY6A 1DQLL 4G7VH 4V2BA 5JW4R 3L3JA 3SDAB 2DLGA 3C2AL 3SHSA 3BUYA 4LK4A 5BXFB 4BFIB 5FKAB 3KXFE 1BAFL 2X4QA 1RIHL 1MQKL 1JWMA 4RFOL 5TDPB 4BH7B 2NY7L 2CMRH 3FFCE 4OLYL 5I1LA 2XWTB 3T0WA 4DVRL 1HE7A 2BRRL 2I5YL 1NC4A 4E5XA 3BKCH 5EIIA 15C8L 4NKMA 4YXKH 2XZQH 1P5UA 4PV8B 2K9UA 3VXOA 4PJFE 4U6YA 4OZIF 3GMRA 3QHFH 2IAMA 5E4EB 2VRAA 4ODTL 3B8SA 4P0DA 2IGFL 4CN4A 1MFDL 2AJZB 2J5LC 4N0CD 2W92A 3U6RA 1CL7L 4PJCB 4YX2H 1QYGH 4Y4KA 1KPRA 4I0PD 4JJ5A 4LVEA 5ALCL 4U7MA 4Z7WB 4PGDB 5CGMA 4U31A 3S35H 1SM3L 3GMPB 5C0FA 3AM8C 3D0VA 3QQ4B 4O02H 3G6JF 3ESUF 4CMMB 2GTWB 5CINL 3DOSA 3X11B 1IC4H 1AQKL 3T0DA 3B9DA 3QPQC 3GB7A 4KRMB 1FZOB 5CLTA 1DL7L 1G7PB 2D7PA 3IAGC 2JCCA 4R4FH 2E6JA 4PJEA 1VEMA 1BVLB 3VH8A 1OAXH 3C09B 4DCQB 2R39A 3A67L 3HMWL 3VXMB 3KPNA 4I3SH 2YA2A 4QRRB 4M8VA 4M7KL 2CDEA 1SEBA 3OJDA 3QFJA 1CXHA 3U4AA 2AERT 4WO4C 4RISH 3B8YA 1KT2A 3L7EB 3NIDE 4K9EH 4OFYD 4RFNB 3B3IB 2ZOKA 1T1WA 4NM4L 4P4RB 1BIHA 4R90L 5I66A 5T3ZE 1BHGA 4KI5D 1L7TL 3EFDL 4OF5A 1MCSA 5KG9A 1OSPH 2QHLA 4IRSC 2B5IC 1WUNT 4R8WH 5ICXA 4NQXA 5EZIL 4DK3A 3OHXA 4DTGH 4UIKH 5EU3A 1ZANH 2YK1H 1B4JL 2XQYG 5EU6D 3C60C 5DSCA 2RB8A 4NRZB 2R29H 3E6HA 1PX4A 1GPOL 2DB8A 3NA9H 5EN2A 4XVTL 3ZL4L 1FSKB 1LO4L 3OB0K 2K7PA 2UVFA 1MPAH 4PJBF 3P73A 1UQSB 1LEIB 4WU7B 2CK2A 4QTIL 1T20A 5E1HB 4HGWA 4Q6IC 4WI5A 1VGEH 1L0XA 2OQJB 4LLMA 1CFBA 1PKQA 4J3WA 1JZ2A 4DN4L 5IB2A 1C08B 4MNQD 5LXGL 1KIRA 2VUYA 4MAYA 1G7IB 1JI2A 1BWMA 5A3IC 4C59B 4QF1B 2D0FA 3VI4E 1DN2A 3TCLA 1QBML 1ADQL 3ALXA 5HYJB 4MX7B 3H2WA 2QQLH 2B1AL 3WCYA 5E5MB 4NO3A 5CS7A 2D7TH 4OQTL 4L9LB 2XTJD 1GAFL 2F8VA 1L7IL 3EOBB 25C8L 2FH6A 1JYXA 4OLZL 5DEZA 5F9WB 4FQPA 4J1UA 4AG4L 3DVFA 3KXFD 4RMQA 4HJJL 3WUWB 4K3JH 3PWVA 4ODWB 2F58H 3FTGB 1U8QA 2RQ8A 4CRPA 1G7LB 3ZSSA 4XP1L 2NY4C 2CQVA 1RUAL 3MNVA 4DGVL 5I1CL 5M94B 3QIWC 4U1HB 1WZ1H 2W9DL 4LKXA 1CVRA 5EOCH 5HHOB 2NY2C 4XHJC 1MHHA 5J1AB 2VR9A 2PR4H 4PJFF 4LSVH 5CEYA 5EO9A 2O5XL 4XWOD 5DS8B 4HUVA 3CDFA 5GRVK 3G5YB 4WCYL 3SGJC 1U6AL 2DKSA 2J4WL 3F12B 1QBLL 1FCCA 3IFOA 4U4BA 4C56E 1MSPA 4OQ1A 4KKCC 5TF1L 4N8PA 4X7SL 4OF8A 5EFIB 1ZGLB 3QBTB 3MLUH 4EJ1C 3I6GA 5D7IE 3T4YB 5FO7A 3NH7H 2J1KA 4U1SA 1A8JH 43CAA 2IBBA 1YN6B 4QRQA 3ARTA 4F15C 4B7IA 1HCVA 2DOCA 4JM2C 5I73B 2OR9H 3EJJX 3GHEL 4H1LH 4LLAA 4X4YA 4S1RL 3O3DB 4XVUD 3GBNH 3KYOB 1J5OH 1MAKA 5SWSE 1I7TA 1RVFL 3PHOA 3NIDF 2GJ6E 3ULVC 3LB6C 2Z93B 3GKWH 1J11A 2NYYD 4YLQT 5F88B 4M1CC 3LS4L 1F3JA 3ULSB 3HTLX 5IF0A 3DUUA 3IYLW 5KTEL 2H2PC 1TTFA 2YPLE 2OL3A 1CBVH 1XGTB 3B6SB 2R69H 2E9JA 3STZB 1R3JA 5INDB 3ILQD 5D6DC 3WFHB 1XH3B 5FM4A 2DS4A 1FVCA 5EPMA 4GS7C 1H3GA 4JGUA 1QFWI 1XR9A 3QUZD 2HKFL 2W0FA 4WDIA 1U8NA 5HI5D 3PJSA 3MRKB 2P1YA 1NCTA 1XR8A 4G6MH 4BQ8A 5GRZA 3D2UB 3C5ZB 2HJKA 4PJIA 4X98A 5KSVB 3CFKA 5EBWA 1RZIB 1AE6H 3ARDC 3H0TB 1SMOA 3K8MA 3P9LB 1MJ8H 1ADQA 3FAWA 1PG7W 3FB6B 5DRZA 5B39G 2VISB 4OQTA 3VI4F 4UT7H 4XP5L 2R2HB 4P2OA 2BNQA 1ZWIA 1KGCE 2WWKT 2BXYA 4FQLL 1XF3A 5MENA 4NRYB 5J0BA 4LSDA 3I3EA 4KZEL 2X10A 3QIBA 1MIEL 1JF1A 5C0DA 5ISZA 1RUMH 4Z0BH 4PJAE 1JGVH 3MR9B 1JGLL 3AUVA 5DHYA 2DQHH 4XNZC 4YHIA 3QIUC 1WT5C 4NNPH 4CUCA 2EYSB 6FABH 4XWGL 1BFOA 5D7LA 5E6IA 2HTLC 2PYFA 5C0CD 3UTSE 4NN5B 1EEYB 1S7VB 3PWPE 2EE6A 3QPQD 3GMQB 3QUXA 1QSEB 3PWNB 3UJJL 4XB8A 3CFDA 2Y72A 4X7CC 1CN4A 7CGTA 3WFZA 5E4EC 3HB3C 1WWAX 5J3HC 2AEQH 2ED8A 4G80A 1JFQL 4MWFB 3MRLA 3U36B 3P4MA 1I1CA 4WI6A 4NQTA 3RWJB 1GZQA 3BE1L 4PGBA 3DGGB 4KPHL 4GW1B 1V8HA 2MFNA 1SJHA 3UTOA 2ATPA 32C2B 4OZFG 1WCQA 1YEKH 4WO4D 4O2EA 3IVKB 4Q9QH 3VXSD 1DQLH 4XCYB 3O3AB 5FA4B 3ULVE 4F58L 4P2QD 5K9JL 3C2AH 3ROOB 1X5ZA 2H3NB 3BN3B 4K55A 4L4VA 1BAFH 1TZIB 5CMAA 3HRPA 4IRSD 1RIHH 2YD4A 3C09C 1MQKH 5D7IF 1QSFE 1OT1A 4YDIL 3QNZA 5C2UB 2EKJA 1YQ2A 4YGAB 2NY7H 1Y0LA 4OLYH 2JIXB 1EXUB 4D9LL 4DVRH 3C60D 2AVGA 5F6HI 3RNKB 2BRRH 2I5YH 4P23D 3LN9A 3TBTB 3L3KB 3F7QA 15C8H 1LP9B 4BELD 4C55A 2B4CC 5FK9A 3L5WA 2GK0B 2GFBB 1A7QL 1SVZA 2IPUG 3WL9B 5I19L 5SWSD 3GO1L 3L6FB 2I07B 4ODTH 5JHDE 2IGFH 1MFDH 1CL7H 3KHQA 2GJ6D 1MH5A 3TIDB 2W65A 5ALCH 1JPGB 1SM3H 2Y5TA 3JUZA 4O2CA 2BMKB 3SKNB 3ULUD 2Z91A 3MLWL 2YPLD 4S2SA 1ROWA 4MJIB 5CINH 1AQKH 3ARBB 1FSKC 1CD0A 4L9DA 4CMHC 3HAEA 1DL7H 2VXVL 2BSSB 1YPZE 3MV7D 5DJXB 3G04B 3A67H 3HMWH 4NN7C 5A1AA 4NQCB 3IDMA 2IALA 4LLDB 1BD2D 4Y2DB 3BHBB 3P4OB 4M7KH 2UZIL 4DJMA 1FZMA 3PGCB 5E8NB 1J05B 3JV6B 1U58A 3QWRA 3V0WL 3PP3K 2YHGA 3S3JA 2AKRA 3VFNA 1UXWA 4NM4H 2NY4D 3DBXB 2JB6B 4R90H 4UDTB 3VWKB 1L7TH 3EFDH 1KGCD 1AO7A 1D9KA 1QTYT 4NC1C 1OM3L 4XHJD 5MEQB 3B5TA 3FT3A 4HIXL 2X9XA 2I27N 4N8VG 1VEOA 3B9VA 5F9WC 1B4JH 4Z7WE 4PJAF 1GPOH 4HGMA 4XVTH 5KANG 3ZL4H 3LCYA 1X5HA 2PYEA 1QSVA 3KYAA 1LO4H 1M7IB 3MV9B 1ZLSL 1IKNA 1H5BA 3AAZA 2FX7L 4RQQB 2EDBA 1VSCA 1OHQA 4UNUA 4M6OL 4KKCD 3P40A 1BGXL 2YN5A 1YC8A 2WIMA 1DEDA 3PWPD 4I48A 5JO5A 2J8UF 2I24N 4K7PL 1DQQB 3B43A 5EBLA 4DN4H 1S9KC 5D7JB 5LXGH 1BOGB 4N0FB 3VXME 3W2DL 2FJGB 4JZNB 5IEKB 5D9SB 3G5ZA 5GRWA 4JM2D 5CSBA 1NDGA 4QRRE 5I30L 4A2MA 4CVZB 2P8PA 5T5NG 1QBMH 1DQML 1ADQH 5F6IB 3MRNB 1YMHA 1OGAA 2B1AH 1ZHKA 2WLYA 4X6DB 3MXVL 3OKMA 3CXHK 4GFTB 4OQTH 3I3BA 4GAYB 4OI8A 2C26A 3LKQB 3QUYB 4PRHD 5FHAL 1GAFH 2Q76B 3Q1SL 1L7IH 3TVMA 3C8KB 4WJ5A 3P9MA 3ULVF 4U6HA 25C8H 3LB6D 4Q7DA 4OLZH 3K80A 1NGYA 2JJTA 1AQDA 3RVVC 4XBGA 3EIFA 5E8OA 4AG4H 1QSZA 4M1CD 4HJJH 1X4YA 2PTTB 4JQXA 5GZOC 4NQDB 2H2PD 2BCKA 4FFYL 1K4DA 3U0PA 4GG6A 3ZDZF 2C7UA 2OTWA 3V52L 2FWOB 4HMDA 4XP1H 2BNUA 1RUAH 4DGVH 5I1CH 2FNBA 2ICES 3MBEB 5FCUL 2W9DH 2X4UA 1KXQE 5D72L 2W60A 3HN3A 2YBRB 4PY8I 3SGEH 3HE7B 2AK1L 3N1GC 1U42A 3OX8B 4NRXA 5IMKA 4QXGL 1UT9A 5MERA 4OCWL 2ZNWA 4N68A 2O5XH 4ONOA 3OKEB 3EJYC 1E28B 4O9HL 1BJMA 3O3BA 5BVJB 3VRIA 1DLFL 1IAMA 5GHWL 4WCYH 3ARDD 3OXRB 3SE4C 4PJXB 1U6AH 2J4WH 1QBLH 3QDHA 3GSXA 2DJUA 2DM2A 4LVOC 3FRUB 1YMMB 4YHML 5TF1H 2OXGA 5JQHC 43C9A 4X7SH 4NC1E 1RK0A 3U9UA 2Y07L 3LS5L 3TBWA 2DWDB 1S5HA 4V2CB 3S8WA 3BQUC 4OD2B 3C5ZC 3GHEH 1W8NA 5DQ9A 5I8EB 4YFEA 4PJHA 3QIUD 4TUJA 5C07E 3QJHA 4GW5A 1GGTA 2A6IB 5HYSG 4LLYB 5FB8B 1OW0C 4CADB 5CJXA 3KVQA 1EPFA 2HTLD 1RVFH 2ZCHL 1NKRA 1NUDA 3RDTC 2FYYA 1DR9A 4MJ5B 4M1GL 1FN4B 4RWYL 2ZUXA 3OAYK 3LS4H 4WV1C 3HB3D 1AGBA 3RY6A 2EO1A 4OCYL 5J3HD 5KTEH 4Z77A 2EKSA 3I75B 3BKJL 4PJCF 4MQ7B 4GW4A 5D2NA 3WIFB 5DA4A 1Z9MA 5IEHA 4Z7WF 4LPUA 4F33A 4E41B 5KZCB 1BOYA 1E4XL 2XG5A 2HKFH 3SGDH 1B0GB 3H3PL 5IJKC 1BBJA 3NZ8B 5HGAB 4YH6A 3GM0A 2YC1B 2VQ1B 4F9PC 3DROB 3FOMA 2AK4E 3G08B 3S98A 4J3OC 3JUYA 2ORBL 4JRYA 5D7SL 4FABL 4NKDB 3HKFA 2Q3AA 3RGVD 2JJVA 2CKBL 2NY6C 3QXUA 1TQBB 2IQAA 3EYFA 5DK0A 1AGDA 1CGYA 1CFTA 1MCBA 2PXYC 3GSVA 3B2VL 1Z2KA 4XP5H 5AUMB 5GSRA 3W9EA 1TTUA 1JHLL 5SV3A 4FQLH 5FYJL 1I9IL 4UIMA 3BP4B 3MCKA 4NKOA 4KZEH 1G6VK 1MIEH 1QFWL 1QNZL 1T7XA 3U4EB 3VXRB 5JW4N 1U93A 4XRCB 5IKCA 3H42L 3LKPA 1JGLH 4PR5B 3RUGB 2WIIB 2PETA 5CSGA 4JFOA 2FJHA 1ZHBA 5KANI 4R96A 4M62L 5F3HB 4XWGH 1RV6X 3V8OA 2CK0L 4XXDA 3QH3B 5FECB 2Y06L 1M71A 4NQSB 4P57B 3MRPA 3PIQA 4P5TC 3QA3A 4CKVX 1YY8A 3SO3B 4R97B 3UJJH 5EWIL 2P8LA 3U7AA 1FZJA 1OB1A 4U6XB 4E0RA 3HZYB 1CWVA 4XMPL 3HG1E 1JFQH 4P9HC 1F2XK 2FRGP 4PYHA 3BE1H 4N1CA 5KN5A 1U3HD 3FO2A 4KPHH 4PPTA 1FNGB 3RI5F 4U2YA 2VABB 2MWCA 2X09A 2KKQA 3WKNA 4Z5RB 1NJ9B 1QKZL 5SWQA 4F58H 2P5EB 5K9JH 1OWWA 1CFQB 1TLKA 2APTA 3VFPA 4L3EA 5B3JE 1J9CT 3WLBB 4PJ8D 1Q9LB 1T6VN 4YDIH 3JTTA 2ITDA 2NZIA 5EC1B 1HEZA 1GC1C 4L8SA 2YKLL 4Y4HB 1LE5A 4D9LH 2BZDA 1OTUC 4H8WC 1IGYB 1CICA 1XGRB 5C07D 4LLUB 1VGKA 3BGFC 5L2KB 5E00A 1N7ML 5ESQA 5EOTA 3LEVL 1A7QH 4L4TB 4F37F 2BY0A 1G6RB 2XXCB 5I19H 2AV7A 3DX9A 3GO1H 1NFDB 4JDVB 3D85D 3QDME 4ZD3L 1QSEE 4JHAL 3SE9L 3P30L 3GMMA 5E9DB 5HJ3B 1MUJB 5C92A 5F7DA 5EZLA 1BF2A 4B50A 3UYPA 2NLJA 4R26L 3S35X 3CLEL 3TIEA 4YZFE 4MA3B 3MLWH 5L2JA 3EO1B 1H3VA 1U36A 1WJ3A 3PL6B 2DF3A 5BS0D 3BPOC 4HBCL 4K8RC 5EBMA 2VH5L 2J12B 5IVNA 2VXVH 3ALWA 1EX0A 5H37H 1LD9B 4U3HA 2LTQB 3IKKA 3RNQA 4U1IA 2NW3B 4XCEA 2JJSC 1UJTA 2W9EL 4OBSA 5D7JC 1YZZA 2AK4D 5GGRB 3RVVD 3TYFB 1N64L 4K94C 4HLZH 1HXMB 2DQTL 2UZIH 1F8TL 1CQYA 1P4LB 3GSOB 4N9GB 4LMQE 2E3VA 3H3KA 4Q97A 3DUHA 4K7FA 2BSTA 2E7LA 3V0WH 1L4IA 1T7WA 2RGSA 3CXDL 1LP9E 3HS0B 4WW1B 3C5JB 4LU5L 4HXAL 3JV0A 4NP4L 2AXJA 4UU9A 1OM3H 4PJ5B 1JN6B 3V6ZB 1JK8B 3L3GB 4HIXH 2GITA 3P0VL 2MOVA 1MJUL 2VZTA 1MLBB 2EDHA 4CL7A 4MSWA 1QO3B 1IZKA 4YQXL 1ES0A 2DLEA 1I3RA 3EJYD 1Q9WB 1ZAGA 5ESAA 1F90L 1T2QH 1ZLSH 4M8QB 2OS7A 3JZ7A 4MJIE 2FX7H 5CBAA 1P9MC 3O4OC 4M6OH 1BGXH 4WFFE 3MBEC 4IOFD 3RGHA 3MLTB 4K7PH 4RGNC 5IBUG 4WI8A 3HE7C 4MD4B 5IQ7L 3T0BA 4PJDE 3W2DH 1EJOH 4NQCE 1NLDL 4YHYB 2BC4A 4Q6YA 3HG1D 1HH6B 3BQUD 4JPIB 5I30H 4A6YB 3VJ6A 3IETB 4EQ2A 1KXTB 1DQMH 2Z8RA 4KK5C 1JBJA 2HN7B 4YDLB 3AC0A 5E94B 3MXVH 1G7HA 1C5DA 3KHOA 1S3KL 5FHAH 3Q1SH 2D7QA 3LOWA 3LDBC 1OOAA 2VR5A 4R0LA 3SCMC 4QHUA 3IGAB 3RDTD 4WWKC 4X5XA 4LSQL 2X4OB 4Y2OA 4BFBD 3SO5A 1KIUA 1MRDL 5B3JF 4PJGE 5IVZB 1X5XA 4FFYH 4DAGL 3D0LB 4LPCA 3CDGB 4L3CA 3V52H 3RL2A 3VWJB 2WM0A 4U0RB 3MV9E 3D69B 1T0PB 1MCFA 1CDGA 5FCUH 1KUMA 5DJDA 4M93C 5D72H 3CVIL 4LDLB 1TZGL 1NC2D 2AK1H 5D1XC 4QXGH 1J86A 1TXKA 2CLRA 3MJ8B 3QDMD 1NAMA 2D7MA 4OCWH 4JKLA 2ATKB 4O9HH 1DLFH 5GHWH 1EHNA 1R5VB 2NY6D 2UUDH 2BVTA 3QXAA 1XF4A 4XPHL 1RFDL 5GRXG 2GK2A 2X4PA 2PXYD 4TYUA 3ARED 1KJ2L 4IRJA 2FD6L 4O2FA 4X99A 4YHMH 4JFZL 4BYHA 1MCPL 4X6DE 5CJ5A 3MNWB 4KHXL 2E9BA 5ICYB 4G43B 4YFLI 4ZSOA 4RAUB 3TN0C 3ABZA 1VFBA 3SBWA 3CMGA 3TBYB 3CFCL 5JNYB 2Y07H 3LS5H 4OCMC 5HPMB 5DMKB 4IJ3C 4PRNB 3U83A 3ZE1E 4B41A 4X6FA 2CRYA 1A9BA 3O9WB 4W81A 5C0IA 5C0JB 4PRPB 4NCC1 5TE6L 1B88A 2D03L 3RL1B 2Z8SA 5HHPA 5F1IB 1QZ1A 1NFIB 2ZCHH 4DKAA 4HUKB 5LCVL 3TYGL 3U4BL 4P5TD 3GBLA 1I1AB 1LP9F 2BFVL 2DQUL 1FNFA 3LSOA 3K2MC 4M1GH 4RGNE 5M95B 4RWYH 3OL2A 1RURL 3KPLB 5CZVL 2AI0L 2E9WA 4OCYH 5A2LH 3CZFB 3NCYS 2O61B 3TBSA 5IB5A 3BKJH 5E8PB 3AS0A 4IMLA 5I2IB 3X14A 3MRHB 4ZUSA 4U1MA 5BMFL 2AJSL 3H9SA 2P5WD 2DQGL 2J6EA 1E4XH 1RSFA 4MQSB 2HLAB 1NLBL 4WRLA 3H3PH 2NZ9C 3MPCA 4GBXC 5IVOA 4OV5B 2W07A 2FEDC 5BJTB 3BISA 2R2BB 4WFFD 4YAQB 5MEOA 2ORBH 2YRPA 5D7SH 4FABH 2XI9A 4UTBL 2CKBH 2VQTA 4WI7A 4DUWA 5CZXC 2Q86B 4UUJB 3T0ED 3BRFA 5DJ0A 5EO0A 4PJDF 5J4MA 1K2DB 4HKJA 1PG7L 4I4WB 3B2VH 1OTUD 4DUVA 3M45A 1AR1C 3B9KC 2E27L 1P4BL 3G6JA 5LKNA 1JHLH 4ZS7L 5FYJH 1I9IH 3NFPB 3BMVA 5C7XL 4FA8A 4Z76B 1QFWH 1QNZH 3HMXL 3RVUC 3F7PC 3AXLB 2PKDA 1ZLWH 3H42H 1KJ3L 1X5GA 2VDQL 4R4NC 4ZYKA 3ET9F 1DLHB 3PGDB 4M62H 3CSYA 3JWOL 1AGEB 2NY5C 3KWWB 3BDXA 2CK0H 3R1GL 2Y06H 5SWZB 3B2UC 4XMKL 3QNYB 4TQEL 4K8RD 1R3IL 4Y1AD 5DGRA 3MV9D 2J8HA 1HYRC 4OFYA 3VXNA 3WN5A 5EWIH 4MDJB 1N6VA 4G42A 3X12A 5C6TL 4XMPH 1K3IA 2CJUL 3DV4B 4YBLB 3QNXB 1IMHC 1HXYB 3ZYZA 2HFFB 3NIGE 5KSBB 5HGDB 3BGAA 2R0LL 2FZ3B 5ICZA 3PL6C 2DN7A 4HWZB 1QKZH 1WBZB 4OF0A 4PJBA 4UQ3A 1EEZA 1ZGLP 4FTVD 4X6DF 1ZK9A 4MB4A 3VMOA 5ELIA 3TJEL 4ELKB 3VXRE 1MY5A 3ZT5A 2SEBB 1MCLA 1DZBA 2YKLH 4BKLB 4MNQA 3BPLC 1IGFL 1S7UA 4GMTL 3RWCA 3CGTA 5JXEC 3ZE1F 3GFUA 1URLA 4JVPA 1OAZL 5IQ9A 3L5IA 4EI5C 1F4XL 1ND0B 4XGZA 4HWNA 1N7MH 4K3HA 4HIIB 4OZFA 3LEVH 2ZPKL 5TH2B 3U46A 4FQ1L 4ZD3H 4JHAH 1R5WB 2EIZA 4B53A 1FYTD 6CGTA 3SE9H 3P30H 4PS4L 4O5LL 1KTDA 4RGND 1OGTA 4I5BA 2EC9U 4R26H 3CLEH 2YD6A 4M7ZB 5CP7B 3PHQB 4PLJC 5DK2A 2ZZUT 4IIQA 4POZD 3KXFA 2DI8A 5D1QC 4LCWB 3A6OA 4JKPL 4RZCA 4HBCH 3MUZ1 4YDVA 4KK5D 5HHMB 3FFCA 3QHZL 2VH5H 2NTFB 1QRNB 5B8CB 3TCXA 2EH7L 5KSUB 4PRBA 2XTLA 5CHNA 3SCMD 3INUL 5JHLL 3GJEB 1ITBB 2W9EH 3KAAA 4LQFL 4WWKD 4X4XB 3RWIA 1J1PL 4PJFA 3RU8L 4N90E 4OCSL 2GSIB 4LEOB 3IDNB 1N64H 3NMEA 3GUTA 4HUXB 2DQTH 5I8CA 1F8TH 2CIKB 4YHYC 1K8DA 5JORA 4AZ8A 5IMLA 4ZO7A 5I1EH 1KIQA 1AXSA 3MRFA 2MTPA 1CFVL 4APQC 2JJWA 1WZKA 3CXDH 3Q5OA 4YDLC 5L2KE 4LU5H 4BM7A 2AXGB 2R23A 2BVOB 3HMXA 4L4TE 4JFEB 4HXAH 4M5YL 4AMKL 4NP4H 4J4PC 1NFDE 1KB9K 3KDMA 4HJ0C 2KZ1B 1T0NB 3OGCA 4ZUVB 3P0VH 4IDJL 3MJ9L 3VGHA 1NDMB 5C08D 5IV2B 1MJUH 5D1XD 5IVXB 4YQXH 1ERNA 5E9DE 5TFSH 4CDHA 4WEUD 1KTKE 1X4XA 2IMMA 2IEPA 3KGRA 1P84K 1RHHB 3PXJA 1F90H 2ADFL 2BSRA 1E0OB 5H2BA 2A38A 3NCYP 3V5KB 3VWJC 4XP6L 4KJQD 1XGPB 4U0RC 5DK3A 3VFRB 5ENWA 1KCVL 4JZJB 3TN0D 4QHNB 1HQRA 1YNKL 4BFEA 1D5BA 5IQ7H 3TZVC 5D96C 1NLDH 4HS3A 1NMCB 5DUBB 2CR6A 4E42B 1HYSC 1FFPB 5E95B 3LKOA 2EDKA 4KROB 3VRJA 3WBDA 3NIGF 3ULUL 4P3DA 1S3KH 1QP1A 3AS3A 5HHXL 3QUZA 3RI5K 1NKOA 4X9FA 4WHYG 3UAJD 3EDJA 4LSQH 3VI3E 3M17B 3O11B 2UVEA 1P1ZB 1MRDH 1LO0H 1OAYL 4DAGH 4ZUWB 5J56B 4ODBD 1LE9B 3RUGF 1YDPB 2P8MB 3WE6A 3C6LC 1AR2A 4CN1A 1ZEAL 1YJDC 1HH9A 3CVIH 1YUHB 2A6KA 2NZ9D 1TZGH 4K2UL 3OAZH 4GBXD 1S5IH 3TP4A 3OXSB 5C71A 4WNQB 1DSFL 5IM7A 2FEDD 1ONQA 4QOKB 4PREB 1IQWL 3F5WA 3WXVL 1BPVA 2V5SA 4K3EL 1QLRB 4LVNC 1UC6A 5CZXD 1S9YB 4XPHH 1RFDH 3VG0L 4MCYB 2YD5A 3I9GL 1A3RL 3BPNB 1KJ2H 2FD6H 2HFGL 3AM8A 3B9KD 4JFZH 4JN2A 5DJAB 1MCPH 4RFEA 3LAFA 4WFGE 5C0CA 2R1WA 3FQTB 2UUDK 5ECJE 4G6AD 3GK8L 3CFCH 5F1KC 4R2GC 3QUKA 1SEQL 1S8DB 3RVUD 1G9MC 5C0GA 1IEAA 3HRZB 2YD1A 5EDXA 4KGJA 3QQ3A 5TGBA 3S3SA 1YNTA 4R4ND 1I9EA 1WBYB 4XCNA 3DMMC 3EYOB 5TE6H 1F5WA 2D03H 3RWGA 3VXUB 1JZ5A 1KSRA 4FQQB 3K74B 1ITCA 3S7GA 5LCVH 3TYGH 3U4BH 3A6CL 4OZFH 3MJ9A 2BFVH 3VFWB 2DQUH 3X17A 3RWDA 3VXSA 2V9QA 4C56A 1HWHB 1RURH 4ZXBD 4R7DA 5CZVH 1NFDF 3P77A 2AI0H 1YEDA 1GHFL 3SDYL 4M03A 3RY4A 1IAOB 5DD6B 1EFXB 1QEWB 5D7IA 5BMFH 2AJSH 2DYPB 2DQGH 3U48A 1CDIA 1OAKL 2QQKL 2X4NA 5HYSA 2XKNA 3C60A 3I02A 4ODHL 4EN3B 1NLBH 4F8TA 2X44D 3RP1A 3MRCA 1WISA 3QQ9C 3QCVL 1YN7B 4Y89A 4DKFL 5SWSA 1TCMA 1X7QA 5C1MB 3TGXA 4Q6IA 1DEEB 4PGCB 3MA9L 2CDFA 4UTBH 3ARYA 2GJ6A 5ILTL 2CUIA 1T5XA 4D0DA 4F8QA 4JFHE 1MF2L 1PG7H 2P45B 5A2KH 5JXED 4PRPE 1A6TA 4QRSA 1H15B 1P4BH 2E27H 4TVPE 1T7YA 5FGBC 2YPLA 4GRWB 4H26B 4ZS7H 5J1SC 4EI5D 3RTQD 2C1OA 3MRQA 5MEPB 2NY0D 2XKUA 1U8PB 5C7XH 4BSVA 1HOCA 4Y5YC 1MEXL 1AKJD 3HMXH 1SYVA 5EU4A 3HI1B 2V2XA 2HLFC 3K3QA 1S78C 3REWB 1HHHB 1HDMA 1KJ3H 2VDQH 2GSGA 3UTZA 2XN9B 3VI3F 3OR6B 1QFWM 5FA3B 3W0WE 4PLJD 5I8KL 1PLGH 4WI2A 1KPVA 1SYSA 3JWOH 3WS3B 1UVQB 3R1GH 5D1QD 5GGSA 3VMPA 4XMKH 3TPUB 5C9KA 1QLFB 5I71B 4TQEH 1R3IH 1CT8B 3FQXA 2YD7A 3STLB 1VA9A 5E8DL 5K9OB 1KELL 3DIFB 3QIWA 4GUPB 5C6TH 5DRXA 3S9DB 2MKWA 2CJUH 4UILL 3BJLA 4F3FB 1CLOL 5GISL 1RQ5A 2YEZA 2MQ3A 1X6LA 5I74B 3LIZL 2X89A 4XT1C 3AU1A 4M7ZC 5IHZA 2Y7QA 4Y4KC 5CJ8A 5I9QC 2R0LH 4PJAA 2ICEA 2A6JB 5F7UA 1WEJL 3JBG7 4APQD 1RZFL 3E8UL 2FL5A 2D0HA 3R06B 4TPRL 3BRDA 1KCSL 1NCNA 4NC2B 2GJZB 3MA7B 4YC2C 4WFGD 3I6KA 1F11A 2QR0A 5B8CC 3UTSA 3UZVB 4J4PD 1J8HB 2WUBL 5LAXB 3TJEH 4HJ0D 4XP9L 2VSCA 4EXKA 1CDCA 3VMNA 3PWPA 2VLRE 3P4NA 3U82B 2Z35B 1INQA 1IGFH 4GMTH 4M9OA 3VE0A 4ZQKB 4OUOA 1OAZH 2VZVA 4JM2A 3WFCL 1F4XH 1I1YB 4ZPVA 1JGEB 5SWZE 2VLLA 3NCBB 5ID0A 2ZPKH 5DVKA 4HV8B 4XP4L 1Q9KA 3LKNA 5IR1A 4FQ1H 4BH8A 3DVNA 1D5ZB 4NT6B 2F74B 4UQ2B 5F9OL 4HZLB 4PS4H 5D71L 4O5LH 1Z6JT 1YEEL 4FOMA 1B6DA 2HVKB 1GGUA 3TZVD 1AD0A 5DZNA 4LLQA 4KUZL 1IL1A 2AXHA 1HYSD 4XBPB 1T1XA 3JWNC 1QSFA 4JKPH 4ZFZB 5KSBE 4M7LL 4LOUC 5AD0B 3K7UA 3QHZH 4G6FD 5D6DA 1K5NB 4RDQF 1OAQL 2F54B 4Q58C 2CRIA 4KAQL 3GBML 2EH7H 1EA9C 2M26A 1DQDL 2R9HD 1YQVL 1IM9B 4ELME 3INUH 4JZJC 5JHLH 4LQFH 4RRPG 1J1PH 3MRIB 3RU8H 3WDJA 1Z3GL 5INCA 4OCSH 5JHDA 2ZUSA 3F6IA 2ZSWA 3GJFB 1LEGA 3LEXA 1KCUL 5FKPA 3VCLA 5DJYB 4C4KO 4G9DB 4JFHD 1CFVH 2BNRB 2DWEA 3MRJA 1N2RB 2IG2L 3ARDA 4AENA 2EYTB 2ZUQB 5IGXL 1A4JA 3T0AA 5FCSH 5HDLA 5IB4A 4KROC 3TO4C 1T2XA 2DLTA 1ZT7B 3C6LD 3PQYD 3WV0A 2FIKB 4M5YH 4AMKH 1TNMA 5JPNA 3S5LG 3MLZL 4LSTL 5F1NA 4IDJH 4R9HA 3MJ9H 4XXCC 4X0KA 3O0RL 5C0AE 5FYKU 4PYGA 2AQ1A 1MI5B 1YPZA 4HGKC 3V7AG 2Z31C 3NPZB 1NGWB 3T0XA 4YPGB 1YYLL 3MRGB 2L4OA 3W0WD 1AD9A 5E8EB 2ADFH 5HYEA 4BQCA 3QIUA 4LCWE 4ODUB 1WT5A 3AMLA 1E4KC 3L3DB 4PRAB 4XP6H 3AFLA 4S10A 4XB7A 1FL3B 4BH7A 3VFUA 5HHME 2CXKA 1QRNE 2XWTA 1PYWB 1WAAA 2B20A 1KCVH 3L3HB 5BCAA 4X6BB 1YNKH 1N6QL 3TBVB 4G9FB 1UB5B 3QDJB 4R2GD 1WWWX 5DF0A 4YHPB 3EDEA 4U1GC 5E99L 2ZUUA 2AJZA 4M4PA 3DMMD 3OKLB 5HVFB 2WP3O 4Z7WA 2B0SL 3ULUH 3BPNC 4R7NA 5HHXH 3TESA 3HZKB 3UBXG 4F7EA 1SJEA 4JFEE 5HVWA 1W0YT 1K6QL 2XRAL 2VDNL 1FZOA 4LSPL 2FEEL 1UWXH 3BO8B 5J57B 1OAYH 2VLRD 3IJSB 1BVLA 1MFAL 1BMGA 3CMOL 3DYPA 4XTRC 2BJMH 3SJVD 5FAAA 1ZEAH 4QRRA 4DWHA 5E1AB 2FX9L 4FXLA 3TLRA 3QSKB 4K2UH 4CVXB 4MZ2A 5HY9B 3QQ9D 4YEFA 1DSFH 4I2XB 3L7EA 1IQWH 3WXVH 1TENA 2QLVB 2L7JA 4K3EH 3IDIB 4OZ4B 4PJ7B 4WI9A 3VG0H 3OAZK 3AB0B 5GJSL 3I9GH 2WK2A 1A3RH 1OT2A 3V79C 2HFGH 3MRMB 2WWMC 4G6KH 2AP2A 5CUSL 5KSBF 2EDJA 1MVUB 2X6MA 3B83A 3VD5A 3GK8H 3RZCB 3T8XA 3FB5B 3LKRB 3MOQA 1SEQH 5DHVH 1D5XB 1UQSA 2HLFD 2VLKE 2HKHL 3CUPB 1LEIA 1TCRA 3WHXB 2PTVA 4OF7A 4ELMF 3FO0L 2OQJA 2Z0BA 3GDBA 1VERA 4G8FA 1UKQA 1NL0L 1WCBB 5K9KB 4EBQL 1FZKB 1RMFL 4OCNC 4ZFOL 3A6CH 4QF1A 4HKBA 1ZVSB 3TA3B 1HILB 1C12B 2XA8L 4G8GB 3RVWC 4MX7A 2X4SB 2HWZL 3F62A 4LLWB 1GHFH 1CR9L 1OSZB 4QOKE 3SDYH 2YA0A 4L9LA 5C0AD 3QDGE 2D9CA 4GXVL 4YNYB 3TWCL 3NCJL 1FIEA 3QIBC 1X6NA 3HZVB 2DIJA 4U3XA 2I9TB 2ICWJ 1OAKH 2QQKH 5EO1B 2VE6B 4Y4KD 5ERWB 3DWTA 4ODHH 1FC2D 5DT1L 5C07A 2DJ4A 4RDQG 4XPBL 3JWDC 4ODWA 4TVSa 3QCVH 1P6FA 4I0CC 1KNOB 4DKFH 4U6VL 3D85A 5D6CB 3MA9H 4FG6C 4JFFE 4QCIB 5ILTH 4NUJB 4NO0D 1ORSB 5I1KL 5J1AA 3KPRE 1A1NB 1MF2H 1I4FB 3KJ4C 4U6TA 1W2KT 3VRLF 3VXUE 1NUFA 1PKOA 3G5YA 4LSUL 3O3EB 3F12A 1FVEB 1MEXH 3CLFL 4Z7UE 4E9LA 3QFJD 2D31B 3H3BC 5DQJB 5IFAL 2UZXB 2NY3B 1D6EB 1WIUA 3QRFM 1QR1B 5EFIA 1ZGLA 5I8KH 2AK4A 5IVXF 5CKGA 1I7UB 3T4YA 2CLVB 4JRWA 2BOBB 1KB5L 1BJ1H 3IXTB 1YN6A 4LOUD 1LNUB 4U33A 3D3VB 3MGTB 5E8DH 5T5FL 3CU7A 1KELH 3KYOA 1LK2A 4NQVB 4JVWA 5IFJA 4UILH 4LASL 5GISH 4OZGB 4YK4C 4LL9A 5F7KC 3LIZH 4NZDA 1KJVB 2Z93A 2B1HL 1TIUA 2FBOJ 1UJ3C 4F7MB 3BX7C 4RNRB 5F88A 3T77B 3VFSA 3NACL 3QDAA 4YHOL 1WEJH 3J8F7 1RZFH 4P9HL 3SE4A 1FDLL 3E8UH 4GRWE 4TPRH 1XGTA 2QADD 3UBXI 4G7YL 4OIAA 4X6CB 4BK5A 3TO4D 3STZA 1KCSH 1XH3A 4J6RL 1EIBA 3BUTA 5AEAA 3CSPA 2WUBH 5F7FA 5D2LE 4XP9H 4P4KC 1IM3B 5K9QG 3ZDYE 5C8JB 2NXYB 4DEPB 3WO4B 2VLKD 3BP6A 3PDGA 2XN9E 4AL8L 4UV7L 1IAII 1KN4L 2Z31D 3GNML 3HG1A 3WJJC 3BQUA 3D2UA 4WU5B 3WFCH 1B4RA 2LU4A 3C5ZA 3T2QA 3RA7L 5KSVA 1UH2A 3EYUL 1RZIA 4D8PB 3H0TA 1HHIA 4XP4H 1GC1L 4PRDB 1N59B 5MHSE 1OW0A 5C9JB 4H8WL 5E6ZA 4GRLB 2VISA 1RZKC 5F9OH 4PD4J 5D71H 3EBAA 1PZUB 2R2HA 1YEEH 4LHQB 1NPUA 2A0LC 4ODVL 1KPUA 4HXBL 1W72L 4JY6B 4KUZH 2QBWA 4YGVB 3HCVB 3QDGD 4ETQB 4WV1A 1ORQB 4Y19B 1AGFA 3SY0B 4M7LH 3MACL 3WIHL 1O7VA 1ZLUH 1OAQH 5AYQA 4KAQH 3GBMH 4LKCB 3RIFK 2H9GA 1DQDH 4XVSL 4X7FC 1SQ2N 1YQVH 4U1NB 5KOVC 4JY4A 4M61A 4RMTA 5BRZE 4K8RL 1NC2A 1B2WL 4I18B 1EEYA 1Z3GH 1S7VA 3VD9A 3GMQA 3QDMA 2ICWI 2OYPA 4JFFD 3PWNA 1RULL 1BWWA 1KCUH 1C7SA 3EGSA 5EOCJ 5F89A 3S96A 2R1YB 3KPOB 2X41A 3UZQA 2IG2H 3KPRD 5IGXH 3U36A 1M4KA 4XTRD 1A7OL 2V5RA 5F7LB 1QLEL 2PXYA 2ESVB 3RWJA 3V4VL 1A7PL 4WUUE 3VXUD 3DGGA 3WJLC 3MLZH 4GW1A 4LSTH 1S9WB 3LN5A 4LDEB 32C2A 1RZJC 4ONHA 3O0RH 1DANU 1FAIL 4OZHA 2WW8A 3IVKA 4Z7UF 5KSAB 5HI4C 3O3AA 2BSED 3MNZB 1RJLA 4M7JL 5K59E 3KYKH 4JLRA 3ROOA 1YYLH 5F3BA 2ITCB 3SDXB 1I3GL 1FL6B 2ICWB 5IUSA 5CLWA 1I8KA 1I7RA 4EKXA 2EXYC 4PLKC 2ZOLB 4MJ6B 5BZWB 5J13B 2PW2A 1EXUA 2F54E 4KRPC 3RNKA 3TBTA 5DTFB 3WNLA 2X40A 1U8HA 4D94A 5HDQL 1OY3B 1X5YA 1N6QH 2DDQL 1LP9A 3F7VA 3MRRA 3GI8L 2GFBA 3WL9A 1V7ML 1T22B 1P7KB 4BSWB 3G6AB 4H25B 5E99H 4AM0B 2W0PA 4P5MB 3OKNA 2ENSA 3MV8B 4S1QL 3TIDA 2R1XB 2MHAB 3U30C 2NXZB 4K71B 2CDGB 2BMKA 3SKNA 2VAAB 2YWYA 2WBJB 3EDFA 2RFXA 3ARPA 4GRWF 4ENEC 4MJIA 1K6QH 2XRAH 2VDNH 1I8MA 3ARBA 1ZHNA 4P2OD 3W39B 4LSPH 5D2LF 5ABDE 2BSSA 3KPSB 4ZNEE 5MEND 3ZDYF 4JFDB 1MFAH 3FT4A 5F71A 5IW1B 1JPTL 3G04A 5FOBB 3CMOH 3MLPA 5ITBL 3QIBD 4KFZC 4PJDA 5ISZD 1TMCB 4MS8C 3BZ4B 4Y2DA 3BHBA 2BHZA 2FX9H 5A2JH 3CVHL 1MFBL 4D0CB 1UB6B 5DJCA 5E8NA 3TNMB 5DEFA 1J05A 4I3GA 3JV6A 3TA3C 4HQQL 5E6ID 1W72A 3HNVL 2IFFL 4G9FE 1CF8L 3DBXA 4JHZA 4FG6D 4XPAL 3VWKA 1OCWL 2CLZB 2HMIC 3QEHB 1DN0B 2OJZL 3WIHA 4U05A 5GJSH 2DJSA 5E7FA 4MD5B 1QRKA 4PJGA 3RY6C 1KEGL 1XEDA 5CUSH 2G60L 2DTSA 5IJVB 2EEDA 1KF9B 1NBQA 2DIAA 4TOYL 3OKYA 4BQ9A 1BIIB 4Y1AA 1M7IA 5K9QI 3MV9A 1OD9A 2Z8WC 1T4KA 1TNNA 3MLRL 4RQQA 2Y6SD 2HKHH 1JF6A 3NGBC 5TQ2L 4XH2B 3FO0H 5E6YA 5BRZD 4RAVB 2IMNA 5CD5C 2HG5B 3B5GA 2JJSA 5HHQA 3NN8B 4OF3A 1NL0H 5D7JA 4EBQH 5FGCB 4FFZL 4FS0A 1RMFH 4RMUA 5L8JB 2FJGA 4JZNA 5ID1B 2PO6C 4ORGB 5D9SA 5D5MB 2VITA 4BZ1L 3DURB 2GW5A 3G6DH 4PY7A 2XA8H 2O26U 4WUUD 3VXQB 2FIRT 3MRNA 5GQBA 3QWOA 2HWZH 4UINL 2EC8A 1CR9H 2N7AA 3M07A 4GAYA 4CVUA 4GXVH 1EFQA 3ARFB 3PNWB 3TWCH 5E4IA 3NCJH 1QFUL 3C8KA 2NY3C 5K59F 2FGZA 4PJ7E 4BA8A 1L0QA 3MLSL 2PTTA 4HIJA 2V5TA 4M6AA 5DT1H 4XPBH 3DLQR 3FFDA 2LABA 1E27B 4P46B 5E03A 3IFPA 2H41A 4U6VH 4U1KA 4YIQB 5LG1A 1FFRA 2YSSA 5L6YL 2AJ3A 2HA1A 1RIUL 3QJFB 4P4KD 3MBEA 1FYTA 4G8IA 4OF6A 2ARJB 5I1KH 4ZODA 3RVXD 1DDHB 2DL9A 3MYJB 3HE7A 3H9HB 3OBAA 1PG7X 4R6UA 3UPRB 3GEWB 1DBKL 4WTWA 1D3CA 3G5VA 4HBQA 1I85C 1ZA3B 3DX7B 2CO7B 2F8XC 3BZDA 4LSUH 3DX8B 3CLFH 1ODAA 4G8GE 4GKNB 4LGPB 1QFOA 2VDPL 5IFAH 3FRUA 3C5SB 3TEUA 2VMFA 3SCMA 2A0LD 4WWKA 2H32B 4NNXA 2WQRA 5EU5B 2DWDA 4FZ8L 2M2DA 1KB5H 4NSKB 1GGIL 1DQTA 3TV3L 4AEFA 3CVHA 3NABL 3L3JB 2F5BL 4AIOA 4OD2A 5JA8B 2CO6B 5I8EA 4FQHA 4FP8L 5T5FH 2X4QB 4QWWC 2NY5L 5D8JL 5FB8A 4CADA 4D0BB 1NMBL 5HYQB 2PYED 2JJUA 3QEQD 4H1LB 2QKIA 3QCTH 1T1ZB 4LASH 4Z7VB 5I1LB 1XF5A 2W91A 3MRBB 1EGJL 5C08A 5D1XA 1ZVHA 1NC4B 4E5XB 4MJ5A 2B1HH 4Y7MA 5EIIB 5IOPB 1QPXA 2LAAA 3BH9B 3DGCR 5DVLA 3NACH 4Y0GA 5H94A 1U92A 4YHOH 3VXOB 1XAUA 1JVKA 2XFXA 4P9HH 4U6YB 4WFHD 1FDLH 2IAMB 2C4XA 2DD8L 4G7YH 3UYOD 4MQ7A 4QRTB 4GJTB 3IXAA 3WIFA 4J6RH 5AG9A 1EUTA 4JJ5B 3O4LB 3L9RA 4NCC2 3GIZL 1N5YL 1OGAD 5C0FB 3KPPA 3BW9A 3MGOA 3D0VB 4YFDB 3TN0A 1JUFB 3S6CA 4KQ3L 2XZCL 4I18C 5HGAA 5CIPA 4AL8H 4UV7H 5K93A 1KN4H 2DQDL 3DROA 3GNMH 3G08A 5DD3L 3RA7H 4MA8L 3EYUH 1MCNA 1GC1H 2QHRL 3VH8B 5HPOA 4PLKD 4JKWA 3ZTJG 4H8WH 4X7DC 4KRPD 2W1NA 4YXLL 5KAQF 4X8JA 1B9ZA 4ODVH 3UZEA 5BQ7A 1H3PL 4HXBH 1W72H 2GAZB 1MJJA 1T3FA 1SEBB 2EDYA 3BP4A 4WHYH 2K7QA 3LVEA 1EEQA 2F15A 5KSAC 5HVHB 4OZGE 4AH2B 1IAKB 4NZJA 1KT2B 4C83B 4LVHB 3U4EA 2NX5B 1NCWL 1T1WB 3MACH 3WIHH 5I66B 1IRAY 2WIIA 2VZSA 3BMWA 4PJ7F 5KG9B 1IAIL 5F3HA 2DKMA 2XACC 3O41B 3LD8C 4XVSH 5ICXB 1JTTA 4NQXB 5GS3A 1ZT4B 4GO6B 1K8IB 3QH3A 4ENED 5FECA 5EU3B 4K8RH 1B2WH 1I1FA 5DSCB 1PZ5B 3E6HB 5EN2B 2EDNA 1TVBA 5JXAL 1RULH 2YA1A 4WHTA 4U6XA 5D1ZC 3HZYA 1JHKL 3P73B 2FO4B 1IZJA 1HHGB 1T20B 4OI7A 1A7OH 5EBGA 2X05A 1QLEH 4MS8D 1A4KB 3V4VH 1A7PH 1PKQB 4F80A 1GL4B 1FNGA 5HD8C 1KIRB 4MAYB 3IKCB 4NYLA 2WBJC 2ZCKL 1P53A 1FAIH 2E9IA 1DE4A 5CWSB 1IEBB 2C3GA 3TCLB 2DTML 4M7JH 2AJYL 4PBXA 3BD3A 1CFQA 4C58B 3IDGA 3WXWL 3CSGA 1EVUA 3WLBA 1Q9LA 5D70L 2YRZA 4Y19E 1I3GH 5GSVA 2F8OA 2O5ZL 2XV6B 3LMJL 4G3YL 1T7VA 4NOFA 3NVQA 5IHLB 4RAHA 4L8DA 4MZ3A 3RZWA 1XGRA 5DJ2A 5HDQH 5F7WC 3S5LA 2DDQH 1QBBA 1XGUA 2NY1B 2UV3A 4NUGL 3IF1B 1TVHB 1EGJA 1L9MA 4ZAKB 5L2KA 3FN0L 4OLXL 3T1WA 3GI8H 4WI3A 3PWVB 1V7MH 4L4TA 1G6RA 4HDIA 1NFDA 3EOTL 2PF6A 1VACA 3HAEG 4YUEL 5T1KB 3EO0A 4UOW0 5HSFA 4S1QH 4QRUB 3EFFB 5JOFB 5HJ3A 4MB3A 4H5SA 4LSSL 3BZEB 4JRYD 3ROLA 5FO9B 2VWEE 2WSKA 1CFSA 2PO6D 4GOSA 5IB3A 3EO1A 4JGJA 1VCAA 4GAJL 5EO9B 4WW2C 2DI7A 3PL6A 4GG8B 4DVBA 1V5JA 3A0OA 5FV1L 1F6FB 1HKLL 1V3MA 4Z0XB 1JPTH 2NW3A 3HA0A 5CILL 5ITBH 4HMEA 2COQA 3ARGC 1JWSB 2C3VB 5GGRA 1RJCA 3I6LE 4R4FL 2P48B 5EOQL 5JXEA 1OAXL 4Z7NE 1CDBA 3CVHH 1MFBH 1P4LA 3GSOA 4HPYL 5ANMA 3PHSA 1BM3L 1Q9OB 1JJUA 2G2RB 4U1SB 2PNDA 4QRQB 1R3LB 4HQQH 4QRPB 5KOMC 3HNVH 2IFFH 3HS0A 1CF8H 1KFAL 3TO2B 1YJDL 1HINL 4XPAH 1OCWH 5E7BA 4JQVC 4LHUD 2OJZH 1J0YA 3V6ZA 2DMBA 2G75B 1OL0A 1R24B 1F00I 3ESVF 3MV8E 1CIDA 1MLBA 4OZGF 1I7TB 3GKZA 1QO3A 1UZ8A 1KEGH 2FHCA 2G60H 4HULB 1DVFC 3V6FB 5CFHA 1Q9WA 2D7OA 4R8WL 4TOYH 3EHBC 3TH4T 5L0QB 4DTGL 5IF0B 4M8QA 1LQSR 3DUUB 4X6CF 3MLRH 1UCTA 3FJTA 1R3JB 3P3YA 1BX2B 2DLIA 1U8IA 1FVCB 5EPMB 3KPSE 2FX8L 3MLTA 1XR9B 1QPPA 1LDSA 1KENL 4JFDE 5CIPH 4L3AA 3KS0H 4HS6B 4FFZH 3EOAA 4WDIB 5FYLE 1KV3A 1U8NB 1G9ML 2IANE 3PJSB 2XNAA 3DSFL 1Y6MR 4BZ1H 1BREA 4OUUA 3CH1A 2VDML 1XR8B 1HH6A 3DX6B 4KK9C 4A6YA 4APQA 4FQXC 2VO5A 5T1LD 1OVZA 1CTOA 1CICD 4PJIB 4X98B 4HLJA 5EBWB 4UINH 5E94A 5CJBA 1BECA 4MA1B 4J4PA 5DRZB 5KVGL 1EV2E 1JYVA 1QFUH 2BNQB 4DFHA 3QULA 3NIFF 3MLSH 1X4ZA 2VL5A 1SBBA 3U7YL 1KCLA 1JF1B 5C0DB 2VIRB 3D0LA 2ZJSL 3WIIL 5D93C 3VWJA 5L6YH 3D69A 1RIUH 4YHIB 2HFTA 4OGAD 2GHWB 3QRGL 1BFOB 4JB9L 3WSQL 5D7LB 2PYFB 3TZVA 3FB7A 1DBKH 5FF6B 4TULL 3MJ8A 5DMGC 1VFMA 4UAOB 3GSRB 5HGBB 5FGCE 3QUXB 1Q94B 1R5VA 5KVEL 4M9PA 3I85A 1M1SA 2A9NH 3MLVH 4MGXA 5D5ME 3UROR 4HJGB 2VXSL 3CH8A 2MCG1 3WFBL 1ED3A 3P4MB 4KRLB 2VDPH 3PP4L 4CW1B 1GZQB 3MNWA 4J23A 1MHEB 5ICYA 1P5VA 4G43A 3D39B 3PWLA 3UJIL 1SJHB 2ATPB 3W81A 4O2EB 1KJMA 4FZ8H 2HH0L 3QEUB 4BFGA 2ILLA 1GGIH 1BZ9B 3TV3H 3NABH 1NUGA 4PRNA 2F5BH 2FSEB 1EEUA 2WANA 5CJQL 4OFPA 2VB5A 2HAZA 3OGOE 3I6LD 2XQBL 5C0JA 4FP8H 4L4VB 5CMAB 4PRPA 4HG4J 2NY5H 2FJFA 3C6LA 3PQYA 5D8JH 5EU7C 4Z7NF 1NMBH 4W68A 5D4QA 5CAYB 1Y0LB 3T3ME 1EGJH 3O6FB 5TPWL 4MLSA 4OZIE 1YNLL 5HVHC 1PVHA 3L5WB 5D1ZD 2EDDA 1CFNB 1RJZA 5F97E 4NBXB 3W0WA 2YMXL 4MNGB 2O61A 2DD8H 5LGJA 5I2IA 1IEHA 3WFEL 2C9AA 3MRHA 1NCCL 4QGTA 4EIZC 1J0KA 4NHUB 1QVOA 2A6DB 4NNYB 3GIZH 4I8DA 5DD0L 1N5YH 4D9RE 4JZOA 1JTPA 2Z91B 4KQ3H 2XZCH 5I1DB 4NPYA 5C86A 4KVCL 2DQDH 4IM8A 2R2BA 1AHWC 3F8UB 4YAQA 3F7YA 4HX1A 3O8XB 5DD3H 3V0AC 4MA8H 5FYLD 3N1PC 2QHRH 1X5JA 2IAND 1HHKA 1K2DA 3TPKA 4I4WA 4LCCB 3RIAK 4GLRI 4PG2C 4YXLH 1XIWC 1F45A 3GSQB 1H3PH 3BYYA 5M7QA 4Z7VE 3NFPA 2GY5A 1A9EA 4YHNB 1U58B 4Z76A 4LHUG 5FM5M 4YDJB 3VFNB 1NCWH 1AFVL 2VLRA 1UXWB 1VFAA 1M05B 3AXLA 5DFVD 5ALBL 5IWLA 3B9AA 3ZYJA 1DLHA 1D9KB 1IAIH 1H3TA 3PGDA 3FT3B 3SGKC 1RAMA 3KWWA 1ZHLB 4MNHA 5SWZA 1A6ZA 3O4LE 4V1DB 4F7TA 4OAWB 4ZAKC 5JXAH 3OKOB 4LF3B 3RX8A 1BVKB 1JHKH 1H5BB 3AAZB 1WFUA 3NCCB 3ARGD 1I8LC 5BVPL 5JO5B 3QO0B