2XG4A

E. coli p pilus chaperone-subunit complex papd-paph bound to pilus biogenesis inhibitor, pilicide 2c
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
216
structure length
216
Chain Sequence
AVSLDRTRAVFDGSEKSMTLDISNDNKQLPYLAQAWIENENQEKIITGPVIATPPVQRLEPGAKSMVRLSTTPDISKLPQDRESLFYFNLREIPPRSEKANVLQIALQTKIKLFYRPAAIKTRPNEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVKSANYNTPYLSYINDYGGRPVLSFICNGSRCSVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHAPERONE PROTEIN PAPD
publication title Design and Synthesis of C-2 Substituted Thiazolo and Dihydrothiazolo Ring-Fused 2-Pyridones: Pilicides with Increased Antivirulence Activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 43
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2010-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xg4A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xg4A01
3CK0H 3LPGA 5K9KA 1FZMA 1NFDF 5F7YC 3RGVC 1RAMA 3WS6C 1D5IL 4KTDH 3ORJA 1VGKB 4RISH 3BVNB 3DUUB 4PP2A 3MXVL 1Y6KR 4PY7B 1VKXA 3HFMH 4GRWB 2P7TA 1AKJB 4GKZB 3QCTH 3RTQA 2QSCH 3CLFH 3MGTB 3TJHC 3MJGX 5D1XC 4L8SB 5K9JL 1H0DB 2Y23A 2VR4A 4NBYB 4M7LL 4N0UB 1KIUA 3TJEH 5JDJA 3L3DB 1JVKA 1KIPB 1S7WA 4ZG1A 2YMXL 4I3SL 1HHIB 2P5WB 3IKKA 1JZ2A 3G5XB 1V05A 2IH1A 1Y18B 2P5EB 2Z31A 2R1WB 3CFDA 3K7UA 4OCRH 3P4NB 3LAFA 3ZTJG 4WEBH 4EUPB 1IAOB 1NLDH 5JHLH 4FRWA 3HG1A 2W9DH 4OLUH 1GRWA 1NCNA 1I3GH 4MA7L 5T3XH 5JIKA 4HFUH 4WW1B 2K1MA 5C86A 4P46A 2O93L 3SJVA 1C5CL 4QKXB 5BO1L 3O4LD 4QNPE 1IMHC 2DJSA 3JWDH 5H94B 2I5YH 2R8SL 2BVQA 3TFKC 1MCQA 2GSGB 2HKHH 2XT1B 1U8IA 5ESQB 2ED8A 4FQIH 4WI2A 3ZDXE 4R26L 2W59A 4G8FB 5JHDB 5JDSA 4KK8C 3G6JF 3WS3B 1WTGT 4BKLA 4Z7NE 1BX2A 3HCVB 5IMOA 2VQUA 2CPCA 3ULVH 4MAUH 3CVIH 4U6HA 1UWXH 3KLHD 3SDYL 2D7NA 3WN5C 4NQDA 4FQJH 4PRBB 1HXMB 1VFBB 5FV2A 3MUHL 4OZ4A 3FO9B 5F97E 5J57B 1FZJA 1KCSL 5JW5A 1IEAA 4PLJD 3LQZB 1ZT1B 4LSDA 3P77B 5C0AA 1D9KD 1QHPA 1NFDE 4L8DB 3I85A 4LCCC 4P2OA 1MWAL 4XPGL 1HCVA 2W9EH 1OPGL 3RL2B 2PYFA 4APQA 4YPJA 1MCSA 2BSSB 5BZDB 1EJOH 2A77H 3D0VA 1TQBC 3BP7A 3QDGE 4P3DA 1PQZA 4N1HB 2AJZB 2YD4A 3MV7A 3V5HA 5C8JB 4LLVB 5L2KB 5HI5C 1N3NB 3RDTA 1NCAH 1I3VA 4PV9B 4PD4K 1NCUA 5JO5A 1ZS8A 4FFWD 1UA6H 5LGKA 5FO9A 2V5RA 2R69H 2R0ZL 4M1CC 1WGOA 4LNRA 4MXWH 1A0QL 4S1DD 4X4ZA 1K8IB 2DAVA 2Y1VA 2RR3A 4Z7WB 3VCLB 4NO2B 3MRFB 3X3FH 2HVKB 4JREB 4JY4A 3D3VA 4M6OH 2CRYA 3RUGB 1I4FB 4ODHL 1JPST 3LN9A 3ARFD 3VMNA 3D25B 2C4FT 3RVUD 4AL8H 3C87A 1XIWB 3FO0H 2DLEA 2NYYC 3X12A 1F97A 4IMKC 4JPKH 1IC7L 4L5FL 4ETQB 3D85D 3G04B 3MODH 1JHLL 2BNQB 4R7DB 2VC2L 4JG0L 3L3JB 5JW4N 4KK6C 5JIIA 4M02A 2HJKB 4P3WA 5IMMA 5KANI 3ULUE 1B0GA 4XP6L 3FQRA 4JFXB 5ESAB 5GZOC 2VLMD 5KOVC 5AG9A 4JHAL 2R0LH 5DMYA 1JN6A 4LQFL 4U0QB 1E6JH 4JFFD 3G6JE 1JPTH 3BQUA 4OM0H 5LCVH 2FLBT 3SOBH 5JW3H 2ICEB 2HFTA 5T3ZL 2CGRL 4QXTB 4Z95H 3GJFH 1P84K 1K4CA 3MMEA 1X5HA 1FZKA 4OUOA 4HS8H 4YDIL 4LFHG 2XKUA 5LGJA 3ES6B 4X8JA 3AY4A 2W60A 5J1TC 2M26A 2IPUK 3HNTL 4FQ1L 1QR1B 5GGTH 1DDHB 1QEWA 5HGDB 2K7QA 4O58L 2D7PA 1TPXB 4HUWA 1QSEB 4PRIE 3N85L 5D7LE 2FCBA 1WZ1L 4XPAL 4G42A 4RFEA 3WIFB 4NRZA 3WMSA 3G08B 1X6NA 2PETA 3QFJB 4HULB 4N9OB 3JTTA 2FSEA 5EZJA 5LGHH 4MQTB 1RV6X 2Y36H 4AENA 5DVLA 1T7XA 4G6KH 1A6PA 2OTWA 3VXOA 2EEBA 2LTQB 3WNOA 1QNZL 4OZGA 4P5TB 2DMCA 5DHVH 4YUEL 3D9AH 5BS0B 5DO2C 4ZODA 4DGVL 4F9PC 2VL5A 2X7LA 1N6QL 4KV5E 4ZS7L 3OQ3B 1T03L 3QIBB 3JVGC 3IS0X 4OLEA 2IBGA 1SBBA 2R9HC 3MUGA 1EVTC 3MV9A 2OK0L 5DK0B 2R1XA 1LDPH 3MRIB 4C83A 3TVMD 3NFSH 4C59B 4H5SB 3MV11 2E5EA 4P57A 1QO3A 1GOHA 1FLRL 4XBPA 2H2PC 4ZTOL 5GRWA 1IBGL 1KYOJ 4KRLB 5BVPH 2BNUB 5M94B 1OAXL 4KKNA 4MMXC 4U1IB 4TRPH 4BSVA 4XNZC 2E8ZA 3S4SB 1PW3A 4P48A 4P99A 4RDQF 4WWKC 2Z31D 3K8LA 4AM0A 1P5VA 4ELMB 2UWEA 2GTWB 5DRXB 3LEYH 2IFGA 2WLYA 2IPTH 3HG1D 5MERB 4F7EA 1V7NL 5I75B 5D71L 3WD5L 1Q9WB 1FJ1B 4P46D 5I0DA 1A7PH 1GYAA 1N59A 4UTAL 4K23L 1JZ6A 5CZKA 4CVXB 2VISA 2CKBA 2RIKA 1M7IA 2V2XA 4NO0B 4Y4HA 4Q2ZB 2FD6H 4HH9B 4TVPE 1JWUA 3QUMA 4G6ML 5CSZB 2D7OA 1HZHH 1RJLB 1CICB 5DQDL 4QTHB 1HCFX 3KDMB 1E4KC 1VFUA 3O3AA 1JHKH 1KJVB 3CSBA 5ANMB 1IAIM 4FP8L 4NCDA 3LZFH 5GSVA 3K4ZA 1IAIL 5FA4B 4WTZG 4OV5B 1Q72H 2XTJC 3FJTA 4QRTA 1ES0A 3QNZB 5LAXB 5AWNH 5CINH 1U6AH 5ADOH 3O6FB 4HIEB 3QNXA 4MHHI 4S11A 4K9EL 3A67L 2N4IA 5I8KL 3W2DH 1PY9A 5IW1B 3S8WA 2EYRA 2FIKB 3X11B 4HK3J 4WGVB 3BZEB 1AY1L 4GMTL 1AR1C 3D18A 1QLRA 4PYGA 4PJGF 3MRHB 1ZGLM 3GMRA 3U7WH 4P2OD 2VERN 1ZVSA 1SYVA 3MRDB 2IQ9L 3BP5A 4LP4A 4APQD 4R4BA 1OWRM 4X7TA 1GPOH 1WBXB 4TQEH 4U3XA 3K1DA 4WCYL 2OJZH 4XB8A 5DD0L 4LRNL 4Q7DA 2BMKA 3QUYC 2FECI 3O3UN 3O4OC 3MV7D 2GY5A 2D7QA 2QQNL 3RDTD 1JBJA 4ZTPH 3VFUB 3BVNA 3DUUA 3QPXL 4JM2D 2GTZB 4Y16B 3E6FA 3AUVA 3MRJB 2JKXA 1SBSH 3GJEB 4PY7A 5GJTH 5BOPA 3L3OB 5BV7H 2OXGA 3V5DB 1YJDL 3S3SA 4WNQB 4MZ3A 3GB7A 4JCLA 4KQ3L 1U3ZA 4NSKA 1ZVYA 1D5MB 4L8SA 2DOCA 4H8WC 3D2UB 1D6VL 3WCYA 2ZJSH 4L4VA 4Z7UE 3NCBB 2UUDH 4PJEA 3UPCA 3D3VD 4HJGB 3T0BA 4G7VH 3HC4L 2HYMA 5EOQH 1F45A 1G7QB 5HYSG 3HZVB 1CK0L 4I18C 3BIKB 4NGHL 1KFAL 3O6LL 3GMOA 3RVXD 6FABH 4JRYE 3WFBL 1OQXA 1KIQA 3GO1H 3W82A 2VXQL 3RZCB 3WDHA 2GCYB 1UG9A 4BUGA 2AJYH 4OCWH 2FJHB 3F8UB 4MX7A 5IMLB 4U1JB 4K7PH 2G2RB 5T1DL 3DRTA 1CD8A 5CIPH 3VFMA 3WUWG 4Y19B 2YR3A 2E7BA 2J12B 4OD2B 3NGBC 3QEQA 3D69B 4WW2B 5FYKH 5KZCB 1CFTA 4NZRH 5I6XB 3HNSH 3BQUD 4N90D 4HGMA 3PWLA 2EDJA 4R4FH 5ESQA 2DTSA 3HUJE 3C5ZA 4X0KB 4P3CL 2AEPH 5BQ7B 1XGRB 1T6WA 1ZE3C 2YD6A 3G6DL 4R3SB 5ITBL 5E94A 3O8XB 2A73B 1KOAA 3M17B 3HE7A 1E4WL 1MQ8A 5IFHL 2ZP0T 4GT7A 2IAMA 1SVCP 3TWCH 3DV4B 2Y5EA 2P8LB 3TYFA 3DSNA 5HY9A 3P3YA 1CE1H 4JHBA 5C7XH 3WFEL 4UUJB 1MAJA 4XNXH 4RMWA 4Y8AA 1NCCH 2EIBA 1KELL 3CC5A 4U6VH 4ZPTA 2VIRA 4D9LL 3MJ7B 1J05B 2NR6D 1IILE 3BKJL 4PJGE 3LB6C 1OLLA 4OF5A 4GG6E 3GSNB 1PG7H 1GCFA 5F1NA 3D0LB 3MGOB 3EIFA 3QHFL 3ARQA 5E6IA 3C60D 2ORBH 1DBAL 2CO7B 1FORH 2I9TB 3ET9F 3KPMA 4QRSB 3C6LB 4XCFL 5JPNA 5C08B 2WIMA 1SMAA 2K3TA 2XFXB 4N68A 5D2LE 4PJ5B 3O45B 1SJEA 2JJVA 1DQJA 1FFQA 5I1LB 2Z8SA 1Y0LB 5HYQB 3MV9D 4R0LB 4HD9A 4JM4L 3TBTB 4O2FA 4DVRH 3MBXH 2ATPA 2H3NB 4LEXH 3MLXL 3ZYOA 3FRPG 4P2RE 5GS3A 5IROC 5MHSD 4F7PA 5B39G 4JLRA 3MOBL 2KKQA 2QTEA 5FYJE 3QG6A 3T0EE 1U8PA 4J6RH 4X99B 5D96C 4IIQA 2DDQH 3NACL 1R3JA 1WSST 4BZ2H 1UEYA 1W0WB 2EICA 4ZS6C 1VDGA 4RIRA 3VFVA 1A6TB 3VD9A 1BQLL 5FK9B 3HZKB 2AXFA 4QRPE 4RFOL 1W0YT 4LVOC 3B6SA 1JMZA 3RP1A 4ONFH 3UEZA 3G5VA 4ODXA 1LO2L 3ARBA 3UTPE 4OGYH 2W65B 3B8SA 4OZFB 1BWMA 4FFVD 1RURL 2IMNA 3K4DA 3C8DA 1T0NB 1ZHKB 3TF7C 2VZ3A 4GO6B 3LMJL 1MHPL 5GGRY 3RHWK 3E8UH 2A1WH 5FUZH 3FCTA 5DJXB 3H3PL 5IF0A 1TVHA 1N6UA 1D5BA 1WFTA 1I9RL 4GSDL 4GRLA 3LSOB 3QH3A 3FFCA 1I8LC 3DVNB 3U7YH 2J3SA 4L8BB 1D3CA 1JGLH 2WSKA 2ZSVB 1P7HL 4PJDB 3J7HA 5TQ2L 2VRAA 3FMGH 3DVFA 4NHCH 3U9UB 1JF1A 5FFLA 1IRAY 2VLKE 4PJ8D 5FECA 1IGCL 2AJUH 1MCWM 2PYED 4RA0C 4LLMA 2ID5A 4I4WA 1CDGA 2WINA 3CSYB 2FHFA 4DKDC 3TA3C 2VQTA 3CCHB 3T3PE 5EU7C 5DJ2B 4KRMB 5E70A 5CJ5A 2BVPA 2BVYA 5DK3A 1IC5H 1HYRC 2M1KA 2XWJA 3MRGB 1ZEAH 1VERA 1OSPL 4QHMB 2VLRB 5B8CC 4PRHB 1XMWA 4NHUA 3C6SB 4YPGA 3RWEA 3OZ9L 3AXLB 4X7DC 4MJIB 1V7MH 4HXAL 1IL1B 2FO4B 2XY1A 4N8VB 1G9NC 3L5WB 4U6YB 3W39A 3HNVL 5I73C 5C09A 3QRFM 5I9QB 4RGOH 4OLYL 4GQ9H 3AREA 3FHQA 4PJAB 1U8NB 1PYWB 5D93C 4I2XE 4RQQB 1U8HB 3SDXE 4NPYB 1SY6A 2LFGA 2AJSL 4WEUD 2LU3A 1MFCH 4F15B 2FBJH 4YJZL 1BECA 4XPHH 2JF1A 3M1BA 1AKJD 1W2KT 3ZL4H 4JFEA 4K8RC 2X4UA 4W70A 3PV6B 4ZFOB 2VDLL 3CNKA 1HKLH 3OR7A 3W11D 3MLVL 1D7FA 4P2QB 2NY1B 3BT2L 3OXRB 5C3TA 1WZMA 5I1DB 2VDKH 3LN4A 3PABB 2MCG1 3G5YB 1JYNA 1F2XK 4FQPA 1U8KB 5JZ7D 2P5ED 2VAAB 2UZIL 1A14L 1TIUA 5E8DH 1S5HB 5D72H 4G8IB 3UTTA 2Z0BA 4MA3A 4EJ1C 4FQ2L 1R0AH 3BGMB 3SKJH 4OD3H 2HVJA 3RVVC 5SWZB 1NCWL 1Q9WA 5TE7H 4LSSH 4L9LC 3H42L 3QEQD 5IG7A 3T08A 3TZVC 3GK8L 3PQYB 1MQKH 4X6CB 3MYJA 1CQYA 4ONHB 4PRAA 4NNPH 3PL6C 5GRVL 3WIIL 2VQ1A 3FQXB 4KTEL 3CFEA 3MLRH 3QI9B 1UJ3B 5BRZE 3MO1A 4QHKJ 5JHDD 3TCLB 5CIPB 3WNMA 3MLYH 1ORQB 5MEOA 2DLIA 4OT1L 4Y4KB 1DBMH 4JRXB 2QADD 4KK9D 2AABH 1NJ9B 1EXUB 3ESVF 3L6FB 5CMAB 2V2WA 5I18L 3R1GL 5F7UA 1MHHA 3DHJA 4LKXA 2FL5B 1S7XA 3UZVB 2HJFB 2XKNA 4WHYG 4BQBA 3HC3L 4XXDB 4Z76B 1AXTL 5CCKL 2IF7A 5CJXA 2R2CA 4ZOEA 2IALB 5IW1A 2EDYA 4QEGA 4KH2A 3X11A 1UEMA 5F72S 5E00B 5FM5M 2MQCA 4ZUSA 4QWWD 3CK0L 4WHTB 3JV4B 4WUUB 5DJ8B 1EJ6A 1PBYA 2DLFH 2YUZA 5F1SA 1FL5B 1LMKA 4MXQD 1M7XA 1N5AB 3E3QC 3DWTA 4JO3H 2C1OB 4KTDL 1DVFB 5I74C 2IADA 3FO2B 4RISL 1PSKH 5L2KD 1Q9LB 4O2EA 3HFML 3ARPA 4JY6A 4CAGA 5SX5K 3QCTL 2CKBH 2VZ1A 2WIIB 3L3OA 4LLYB 3CLFL 1NFKA 3QB7C 4H1LB 1JPFB 1GOFA 3QUMH 1HOCA 5KSAA 3B9DA 1QG3A 3TJEL 1G6RL 4WV1B 1OP3K 2A9MH 4YIQA 5IIEB 4UOW1 1AP2B 1IGYB 1JNLH 5I76B 5IB4B 3NA9H 2NXYB 1P9MC 3TNMB 4HJGA 1GXEA 1U3YA 3FQWB 5F9WB 4OCRL 1ZTXL 1RZ8A 4WEBL 4KUZH 1XIWD 1NLDL 5JHLL 5JPMA 1VEOA 4PV8B 3NN8B 2W9DL 4OLUL 3ARBD 5DYOA 2X4NA 5EN2B 4RMSA 2FRGP 1I3GL 1RUPH 5GHWH 5T3XL 2BNQD 1KYOK 4HFUL 1EO7A 4NN7B 4CRPA 1T1YA 1RJZA 4YHYB 3JWDL 4P4KA 2I5YL 1JPGA 1FQ9C 5B3JF 3IDNA 1C08A 5KVDH 3IXTB 4XPTH 2HKHL 2DYPB 3IRPX 1KXQE 3H9SE 4FQIL 3GSUA 3U4EB 4GRLD 5GRZA 3D39A 4O51B 4YHIB 3FFCD 3JWOC 5CS7A 1INQB 3SGJA 3SN6N 1K5NB 1QZ1A 1A1MB 4KJPD 3RZWA 3ZHDA 5KVGH 3ULVL 4YDKH 4L4TB 4ZUUB 4MAUL 3CVIL 3AFLA 2EC9U 2VAJA 3VFSB 5DFVD 3PG2A 4HUUA 4W6XB 4S2SB 4GXUN 4HPYH 1I8KB 4HUNB 5B21A 4W6WB 4FQJL 3FT3A 1WBYB 1QSED 1P2CB 4Q6IA 1CD1B 1XAUA 5JQHC 3RWFA 5IK3B 4DK6A 3HI1B 1GHFH 5GRUH 4UQ2B 1HHGA 3QFJD 4EKXA 4NKOB 2ZUQC 4NKDB 4GW1A 3D0LA 5DWUH 3QCUH 3MGOA 4D8PB 2ITCB 4YX2H 2ZCKL 4LPYA 1BD2E 4FA8A 1EJOL 3K2UH 4M7LT 4NQVA 2A77L 1A1OA 2A38A 2O61B 2BOCA 2B5IC 1AE6L 3UP1A 5DJZB 3O0RH 2BVOA 2VWEC 5JW4M 1J88A 1NCAL 5C08A 4AK1A 3DVIA 1MLCA 3L3KB 3W9EA 1J1OH 2XFXA 2XY2A 1UA6L 2AEWA 3GGWB 3BEWB 5D8JH 3QIBD 5CGYD 1KULA 2H9GA 2R69L 1CLOH 5HYQA 4R0LA 3TBYB 3EYUH 5D9SB 2H3NA 4MXWL 3NAAH 4DFIA 1DANU 3DO7B 4DW2H 5CZXC 2FX7H 4JFED 2VLJB 3X3FL 4U1HB 3OKOB 1LO5B 2PXYC 3LKQB 2LVCA 4QT5A 2X40A 4DAGH 4AL8L 3FO0L 1A6TA 4XBGB 1XGQB 3KNBB 4RSVA 4ZFFA 4KKCD 5JOEA 2CUHA 3O11A 3RWIB 2ERJC 4FHBD 3NCYP 2AAVA 3BN9D 3UTTD 1JGDB 3CUPA 1GJIA 4YDVA 5CGMA 1JV5B 1G0XA 4I3GA 4PJ9A 2R0LL 5IBUG 4DKEH 1E6JL 3BZDA 4EVNB 4LLQA 4LPTA 4OM0L 5DJXA 5E5MA 5I2IA 5LCVL 3SOBL 5JW3L 3KHOA 3KPSE 3IJSB 4HPOH 4Z95L 1KSRA 3AROA 1D5XA 1KTLA 1S7TB 3F7YB 1X5JA 3TO4C 3UBXI 3FB5A 5CJ8A 1ACYL 2DQJH 2C3VA 4HS8L 2IG2H 2NY7H 1NAKH 4YGVA 4EUPG 3O3BA 4UTBH 1CICD 5ETUB 3W0WE 4YR6A 1XR8B 3MREA 5GGTL 3CFCH 3RL1B 3QWOB 2FB4H 1QSFB 3ZDYF 3C5JA 3SY0A 5C0GA 1RZIB 3GI9H 1MCFA 4MCZA 3CH1B 1LE5B 4NN6C 3UTQB 5EBMB 1P69B 5GPRA 3MA7B 3K8KA 3O6FD 1WJ3A 5LGHL 1AO7A 3ZKNC 3BD3A 1CG9B 1KCUH 2Y36L 3ZT7A 3MXWH 3QWRD 5KOMC 2D31A 5I66B 5SWQB 4G6KL 3KXFA 3WFZA 4U1GC 4PJIF 5D1ZC 1IL1A 3C5SA 3D9AL 4MD0A 4AEHL 1M71A 4MSWA 3L5WA 4M62H 1FHGA 3RWDA 2EZ0D 2CMRH 2AQ3A 3U0PA 3LEXB 2VJXA 2ZG1A 3R4DA 3H8NA 1LDPL 1XF1A 3NFSL 2OR7A 3GSVA 1QBLH 4XH2A 1JE6A 1WZKA 3BJLA 2D2OA 3VW3H 1F90L 1MFEH 1MCRA 2NX5A 5L7XH 4IRSC 5L9DH 4O4YH 5BVPL 1ZA6B 1IC1A 1AQKH 1N64H 3PV6A 3OR6B 3RGVA 4HKBB 3WS6A 1GSMA 3D2UD 1K2DB 4TRPL 5KS9A 1YECH 1EHLH 3VG9C 1NC2A 4D9RE 4UNUA 4E41E 3LS4H 1UXWA 5EBGA 2Q8AH 1RUAH 3PE9A 5I1DA 1KXTB 1IZKA 5ERWB 4OKVB 1QVOB 3LEYL 5L6YH 1ZHLB 2NW2B 2IPTL 2XWBB 5I16A 3QQ9C 2GJ6B 5SWSA 5D1XA 2GIYA 4IDLA 1L0XA 4ZSOE 1FH5H 5IVZA 3DARA 5IEHB 5HDOA 1OW0C 1S9YA 5SWZA 1M4KA 2WM0A 2BVTA 2GITA 3BRDA 4PFEA 2RHEA 1FVCB 2FD6L 1ZHNB 5KZCD 1EFXB 4X6CA 2F19H 4H26B 1HZHL 1BQHA 1E6OH 3D39D 4JFDE 2XA3A 5E8NB 2BNRE 2AKRA 3T8XB 1YNKH 4PP1D 1UJ3A 1JHKL 3ZDYE 4L4JA 4JKLA 4PS4L 3O8XD 5CEYA 1ORQA 3BPLB 2W91A 3LZFL 2W0FB 2P1YA 1NL0H 3BWUC 3AU1A 1Q72L 5L8KB 3L6FA 1J0ZA 1SY6H 5AWNL 2KUTA 1P6FA 3QO1B 5CINL 1U6AL 3SKOB 5ADOL 4KRPB 3KLAA 3W2DL 5AZ2L 5IHUH 3DYOA 5GSRB 3FQNB 4PJIE 4MLIA 4POZC 2EIZA 3VJ6B 3EYOB 2VXVH 1FNGA 3U7WL 15C8L 8CGTA 3HRZA 4UAOC 1HYSC 3QNYB 4CU6A 4WHTA 1GPOL 4TQEL 2R23A 2OJZL 3BN3B 2DIAA 2OLDA 3WN5A 1KB9K 1R24B 1NBZB 1Z0NA 3C6LD 1FCGA 1RZKH 4I48B 5E5UB 1OARH 4WRLA 5ILTH 5C08D 4ZTPL 4D0CB 1FYHB 4JCMA 4HWNA 1EUUA 4PJHF 2HFEA 3VFGH 4ZNCD 1HXYA 1SBSL 5GJTL 4LF3A 5E8OB 2GEEA 5BV7L 3QEUB 1A6UH 1CXLA 4GAGH 4LCCA 2VSCA 4LLYA 3VMPA 4YBQC 1N2RB 1ZHBB 2V5MA 4H1LA 2YRZA 3RKDC 5FEBA 1S7UA 5JNYB 1UENA 5DRWB 3RI5F 2ZJSL 1WBZA 1NGPH 2DWDA 4G7VL 1OP5K 3WUZA 1Z6JT 1AP2A 5EOQL 5IB4A 2Z92A 2Z8WC 5HYJA 2K7PA 4LLAA 3Q3GB 2AV7B 1X5LA 3V7AE 6FABL 4WU5B 1U95A 4LDEB 3GO1L 2DJ4A 3FB8B 4ZXBB 1I3RA 4ZYKA 3PGFH 2R2HB 2AJYL 5EO0A 2BERA 1FNSH 1LO0H 4OCWL 3THMH 4A6YB 4GAFB 4K7PL 2MKLC 3D6GA 1FG2B 3RNQB 5IEKB 1X7QA 2GHWB 4ETYA 1P7KB 1HQRB 3ARXA 2J6EA 4RGND 5HI4D 3CZFB 3MRKB 4KVCH 5FYKL 1HHKB 1EUTA 4NZRL 3DV6B 3MRMA 3HNSL 5AD0A 3E2HC 3KWWA 4W68A 1FLTX 5FGBC 4R4FL 3S4SG 4Y89A 4IMKA 3M07A 1UM6H 3MV01 1CN4A 1NFDB 1SMOA 2AEPL 2B0SL 5E03A 1OTSD 5SV3A 1XFPA 4OUUA 3QDGB 1OF2A 2HT4C 3TWCL 1FFPB 1MY7A 1CE1L 5C7XL 3RNKA 4BSJA 4XNXL 4U6VL 5FUCE 1F3DJ 4QXGH 3IJYB 1KG0A 4OV6F 1F6AA 5H35B 2Z9TA 1EEQA 1JUFA 3ARRA 1CD1A 1J0YA 3V8CA 5C9JA 1PG7L 3GM0A 1R3LB 3OB0K 1JI1A 3VDCA 3HMWH 4NKOA 1DE4B 4Y5VC 2ORBL 2VLRD 1FORL 4HKJA 4P49A 4KWUA 5J13C 3KXFD 3I3DA 3LEVH 1NPUA 2EDNA 1FYTE 5IR1A 2DQGH 4X8XA 1W0VA 1FP5A 1N0LA 4X5XA 4AIXA 2FH8A 3CIQA 1ZSDA 4PLKD 4Y2OA 5EOCH 5J06A 2EXWC 3QISA 1SYSA 3MBXL 2EYTB 4LEXL 5EFIB 1RUKH 3HR5A 3RI5K 4MHHG 1L9MA 3TBYA 4OFKA 3SDAC 3CU1A 4KHXH 5F6IC 3T77A 1FC1A 4J6RL 5FOBB 2DDQL 1ZWIB 2NX5D 1OAQH 2R0WL 3DO7A 4BZ2L 3G6JB 1K85A 2ZPKH 2A6DB 1LO5A 2X4TA 3GIVA 1I8IB 5C0JB 4PRNB 3OAUH 1L0YA 2D0GA 3JVGA 4DQOH 1YEDB 1ZGLP 3P4MA 5JA9A 1NC2D 2YSSB 1ORSB 2WAHA 4ONFL 4K7PX 4OGYL 1VSCA 3OAZK 2FHCA 4MGXA 4YXKH 4JQVC 1HINH 5SWSD 4JDVB 5DVMA 3VWKC 1J86A 3G5ZA 4NQEE 4PRIB 4FFYL 3E8UL 1A7QH 1F3RB 2A1WL 3EFDH 4UDTB 5D7LB 5FUZL 4QRUB 4BJLA 5SWZD 2OSLB 2CSPA 1QFUH 4JFYA 5C0BE 3DUSB 2X9XA 4MJ6A 4NDMB 3TBSB 5IQ9B 4WWKA 3OAYK 1N5YH 3IFOB 3BSZH 2V7HB 2VXSH 3P2TA 4LLWB 1JGLL 3P4OB 1UZ8B 3IU4H 3U2SB 1M1SA 2A6KA 5I8OH 3FMGL 4XNQB 4NN5C 1BOGB 4NHCL 4X4XB 1DN0B 2CLZA 3UBXA 3TN0C 3WO3B 1AGBB 2AJUL 4XAWL 1ZANH 3T0XA 4JRXD 3T1FB 1MRFL 2C9AA 4RAVB 1PG7X 2EDDA 4F2MA 1MEXL 3N1GC 5TDPB 2E6QA 1NFIB 3MRQB 5ESVB 1O7VA 1IC5L 4ODVH 4NJAH 1NDGA 1JNJA 1FV1B 4KK8D 4QYOA 5HHOE 2F8VA 2G5RA 1E4KA 4S0TD 1PKQE 3CFJA 4CBPA 2VN7A 4LL9A 3BZ4B 3V6OC 1CFSB 2MTPA 3MZTA 1ZLVK 4OF7A 2FX8H 5BMFH 1MHCB 2OXHA 5TE6H 4RGOL 3BRFA 3SE3C 3O2WL 1NC4A 3KYNB 1NBVH 2YUWA 1DVFD 4P5MA 4DFHA 3MCG1 4GBXB 1NBYB 1NMAH 2NY6C 4GG8A 1DUZB 4CNIB 2BVUA 4G43A 4IRJB 5HHXH 2VLLB 3IDGA 3OSKA 4XPHL 4E0RB 1D5ZB 3ZL4L 1VFAA 4G5ZH 4ELKB 1J5OH 2OJEA 4XCEB 4JFPA 4YNYB 1HKLL 1T2XA 2Y72A 4FS0A 2VL4A 2BX5A 5IUSA 1ONQB 3QUYA 4HKBA 1K2DA 1TTUA 4NBZB 5HI5D 2VDKL 4JJ5A 5F1OB 5JA8B 4F8TA 4QXUH 5MENE 1DZBA 1U8QA 8FABA 4PTTB 5E8DL 5D72L 6CGTA 1F11B 1QBBA 1ZT4A 3L5XH 1R0AL 1JF6A 4MNGA 5BJTB 1WF5A 4E42A 1BGXL 3ARUA 2PW1A 4QRRA 1Z9LA 4LSSL 4IJ3C 3IGAA 2KBGA 4GKSB 2VKWA 4PB9H 4XC1L 5EU4B 5MEQB 4OLXH 1GL4B 1MQKL 4GMSH 4I18A 1FO0A 1T0PB 1X4ZA 2DYPD 2NYYD 4NT6B 5TE4L 1EFXA 1JTPA 3EHBC 4H26A 3MLRL 3U0TA 4BH7A 5DJ6A 4Z7VE 3UO1L 5DRZA 3MLYL 4OZFG 1YDPA 1F3JB 1DBML 4M00A 1NGXA 3OWEA 2XZQH 2AABL 1TZIA 4WFHD 5EZLB 1OP9A 5J6HA 5IHLB 5DJ0A 1R5IB 3D5OF 1YY8B 2YD7A 1A3RH 4I5BA 2H8PA 4K3EH 1T1WB 4XNUH 1S8DA 2DM4A 2VABB 4PGBA 2WBJB 2I9LA 5GSRA 3HAEB 4PJFE 2Y06H 5CD3B 2GFBA 1U2CA 4DEPC 5EIIB 1X44A 5DD5H 3KS0H 3H3BC 4DN4H 3CLEH 4Z7UB 2DLFL 5IKCA 4NOBA 5DEGA 1KCLA 5CEXA 2BZDA 2EH8H 4JO3L 1ZLUK 1TJIH 4DVBB 1PSKL 3MRPB 3WLBB 4JRYB 4ODBD 4F7TA 4D0CA 4PJBF 5T33H 2OI9C 3I6GB 5HGHA 4M93C 1FE8H 3U30B 2CKBL 1DEEB 5E8OA 1J0HA 3K0WA 2YUVA 3K81A 5C92A 2C1PB 2NTSP 3S37H 2FWOB 3VDBA 3QUML 3LRHA 1S7RB 1ZHBA 3VFWA 1XGYH 4G3YH 5I71B 2A9ML 3H0TB 4N8VG 4QHNA 4D0DA 2OYPA 2C4FU 1JNLL 2VLJD 3BXNB 5DO2D 3NA9L 5BZWA 4LARH 3PHOB 3VXPA 5HYIA 2H2SD 3HUJB 3FRUB 2OL3B 3CXHK 4KUZL 2XRAH 2IJ0C 1MH5B 4GXUM 4WUKH 3SKUD 5FYLE 5IROA 5GHWL 5JTWA 3C8KB 1MVFA 2QSQA 2R2EA 1K3ZA 4P59H 5ICXB 2DQDH 4KU1A 2H2PD 5EWIH 1XCQA 2BSTB 1FG2A 1ZMYA 1CL7I 1NLBH 3MROA 4XP4H 4RGMC 4H20L 3RPKA 3V5KA 3QDJE 5KVDL 1GOGA 4XPTL 3EKCA 3MRKA 4PJGB 5DQ9A 4EDXB 1OWWA 4GG6B 1LEKB 4MD5A 5D1QC 3TBWB 3RX7A 5IVOA 4YHMH 2LAAA 2V7NA 1KTKE 4YDKL 5ENWB 1KNOA 5HVGB 3QDGA 2HT2C 3BO8A 3O41B 5GZNC 4DN3H 4HPYL 4OFVA 3C9NA 4PLNC 5D2LB 4R97C 1QSFD 1S9VB 2YD5A 4DZBB 1UVQB 3KLHC 4B7IA 2D4FA 1YY9D 1R3KA 3IVKA 2ZSWA 1GHFL 4NIKB 4P2RB 1I8LA 5GRUL 2D9QB 5IQ7H 1CLYH 4IM8A 5E8PB 5DWUL 3FFDB 3C08H 4PJHA 5K9OB 1Q9KA 4YX2L 3T0EB 2VITB 2N56A 3FOMA 1BVKB 3K2UL 2H32B 2JCCF 4PLJC 3VFTA 4U3CA 1D9KC 1EO5A 4QRPB 1RU9H 3PHSA 3TA3A 3UTSE 1M6OB 4X7SH 5LG1A 1J1OL 1EA9C 3OKNB 5GJSH 3K1KC 5D8JL 4EQ2A 4XI5D 2DQHH 2J6EH 3P9LB 4XPBH 3BI9X 1CLOL 2HN7B 3MYZA 3EYUL 2A6JB 3CVHB 4Z77A 2QJDA 5B8CA 5D70H 5EFIA 4IOIB 4J12A 3NAAL 3N1QC 3WL9A 5FDWB 2R2BA 3IKCB 1T0MB 2YK1H 3FT2A 4X6EB 4DW2L 2FX7L 3C09C 3MRRB 5FOBA 4X6BA 1II4E 1LD9A 4WI3A 4DAGL 4S1DC 3NZ8A 4ZNEA 3PWPE 5GS2D 2Z4QA 4ODWA 2JTDA 3PWJB 1S5IH 1N4XL 3BH8A 2VSDA 3TPUA 2VLKB 5AUMA 4H1LG 4XAKE 2GJ6D 3Q1SH 2VDPH 4I0PB 4DKEL 2MFNA 2VN4A 4CADA 1K8DA 3OJVC 5J56B 3DUSA 4I0CC 4HPOL 5FHAH 4XCNA 1I8MA 3F6IA 4WFFE 2JB5L 1TQCB 1CFNB 1KJ3H 5L2JA 2DQJL 2IG2L 2NY7L 1NAKL 1UB6A 1EFXD 5DS8B 1Z3GH 4UTBL 3QA3A 5GGRB 1MCBA 1XGTB 3VFOA 4XNQA 2JIXA 2PR4H 3MRLA 2FB4L 2CK0H 1IT9H 4LHUA 4TULH 1QTYT 2NQCA 1Y6MR 5I19L 3AB0B 3KYOB 1EEZA 4L9LA 3T1FA 4HFWB 4BFIB 3FB6B 3TZVA 1T6VN 3UPAA 4CVZB 4I2XB 1ZAGA 3SDXB 3PL6A 1KCUL 2R0KH 3RFZC 3VGFA 3DBXB 2ZOLB 3F7VB 1YA5A 4FQXC 3MXWL 4NO5B 3FB7A 1FFNA 4AMKL 1A7NH 1LP9F 2EE9A 3O9WB 4HT1H 4M62L 2MQ0A 3TIDA 2CMRL 4M1GH 3BP6A 3KYMA 3B2UD 2VO5A 4PIRF 1WWCA 3FOLA 1MCKA 3LB6D 2X4QA 5A2LH 5GGUB 1QBLL 4F7CA 2PF6A 2X4PB 4PRPE 1RHHB 1DUZA 3I6LE 4ORZC 1YUHA 2NXZB 5L7XL 3HI5L 2R56L 5L9DL 4O4YL 3WHXB 1N64L 4LDOB 2NY3B 3TVMC 2DTMH 4U1SB 1YECL 1EHLL 1ONQA 5DMKB 4OCNC 3IDJA 1AGCA 3LS4L 2Q8AL 1HI6B 1RUAL 3MACH 1XT5A 2DL2A 5A40E 1R5WA 5BRZB 1A7OH 5L6YL 4HMDA 1VESA 2WK2A 4QCIB 4ZXBD 1RK1B 2O5YH 1CTOA 4M3JA 5CEZH 4HH8A 2Y5TA 1YNTA 3N9GH 3E0GA 3L3GB 1S7QB 4IMLA 1LK2B 5FGSA 2CIIB 5HHNB 3BP4A 4NQSB 1X5AA 1G9EA 2Y6SD 3QZWA 4PTUB 3VXUA 5F3BA 1P9MA 4JDZA 2HLAA 4ZUWA 4ZUVB 3OHXB 4RRPA 2FLRT 2F19L 2VE6A 4P46C 1KB5A 1E6OL 4PJCF 3OKLB 1JRHI 3BYTA 4HLZG 1YNKL 3EYVB 4PLOB 1BFOB 4I0KA 5F7DB 2CRIA 1JYXA 2ZUSA 4LCWE 3RA7H 4JZJC 1QQDA 4IS6B 5KN5A 3PIQB 3QDGD 5TFSH 2HA1A 5HHPA 3CU7A 1DQML 1SY6L 1S3KH 5DDHA 3A6BH 3BPNB 3FO1B 2XPGB 2GSIB 1NAMB 4HDIB 1EZVX 3DX7A 3WHE1 2XWTB 4PJXE 1KLGA 2AEIT 3U0WH 5DZNA 2YEZA 5FO7B 5IHUL 1LP9E 3VXMA 4V1DE 1FSKB 1HSAB 2VXVL 2WWMC 4YHKH 1X4YA 1I1FB 1MY5A 1RIVH 4MDJB 4U1MB 5GRXG 4Z6AT 1MCDA 4JN1H 1LEIB 5KSBF 2J8UE 5I0ZA 5GS2H 1QRKA 3GSWB 3DYPA 4UU9B 5CP7A 1M7DB 2E6PA 2MPAL 1U8OA 1R5VA 3G6AB 1T2QH 1FIEA 3NFNA 1VA9A 3NIFF 1RZKL 4WWID 1EHNA 5ILTL 1OARL 4P2OC 2B4CC 2AK1H 3MRPA 3VFGL 4H8WH 3VXRE 2NPLX 4X9FA 3KPLB 1L6XA 1A6UL 3SO5A 4XZUB 5I1AB 3IDMB 1OM3H 1F02I 3WFCH 1FO0H 4X9BA 2C1PA 3ULUD 1WCBA 1J7VR 4KMTH 5E56A 1MAMH 4JM2C 1IGTB 1CIDA 3CZJA 1HKFA 3ZKMD 3H9SB 4RBPH 4YBLC 5DD1H 1UWGH 2E7LC 1HIMH 1YPZA 3KPTA 5J4MA 5E9DA 2NLJB 3SCMB 3PGFL 4OCXH 3DRQA 4WDIB 1U0QA 1LO0L 1W72B 3THML 3KYAA 3X13A 4K3HA 4LSQH 4PGJA 1D6EA 4S1QL 2APBA 3QQ3A 4K8RD 1ZV5A 1DN2A 3F62A 2IANE 3QCVL 5GRVK 2LABA 4JY5H 4LPCA 4F80A 4KVCL 2PXYA 3DXAE 4PRID 4PJCE 5D7LD 2BSRB 3B83A 3BEVB 4HJ0D 2A6IB 2Q7YA 5F71A 1UM6L 2DMKA 5DK2A 1TJGH 1JNHB 3AC0A 1XF2A 2ADJB 4OFPA 3O3EB 3ULVF 3BDYH 4R4ND 2XN9E 1VFOA 1BD2B 4NQTA 2F53A 2CLRB 2NNAB 3EDJA 4NM4H 3ZTNH 2FECL 3OG4B 1AD0B 5D7IA 3O41A 2XA8H 4LHUD 2SEBB 4QXGL 3F5WB 4JKKA 3MFGB 5D2LA 2DLGA 2NY5H 4WO4B 3BGFB 4B5EA 4U2ZA 2YA1A 3Q48A 3HPLB 4NQCA 2P8MA 3TO4A 4BFEA 5ELIA 3HMWL 4N5ED 3IDYB 1EDQA 4RZCA 4GAYB 3SGEI 2YC1B 4PJBA 2NR6C 5K9OA 2VITA 2MHAA 3NIFE 3LEVL 4PREB 1BZ9B 5GS0C 2HKFH 2DQGL 1C5DA 4XP9H 2PO6B 3C60C 3GMNB 3KLDA 5FAAA 1H5BC 5EOCL 2ESVE 3P9LA 1RUKL 4OI7A 3VXNA 4KUCD 1QFPA 2A6JA 3GUTB 2EDKA 4JQXC 4GBXD 4KHXL 5HHME 35C8H 5F7NC 1WISA 3QWQB 3P9WB 4PG9B 4UIMA 3RRQA 4ALAL 4X6DF 5D1ZA 2ZPKL 5J1AA 2F5AH 1QD0A 4C56A 3KPSB 1T22A 4P23C 3OAUL 1YN6A 1OD7A 3WIHA 5T3XE 2Y7QA 1HILB 4ORGB 5EPMB 3CFKB 5DJYA 4NRYB 4QTIH 3WO4C 5I1CH 4Y5XC 1BREA 4U1NA 3PWJA 2J5LB 3W0WB 2Q87A 1G7JB 1JWSB 4YXKL 1HINL 1AGFB 1J10A 3KPRA 5EC2B 2VLKA 3V4UH 1J1XH 1MHEB 2DIBA 2HRPH 4IRSA 4OI8A 3VGEA 4M8QB 4KJWC 3EFDL 2MMXA 2F74A 1QFUL 2HG5B 3MLTB 3WKMH 5E08H 4FFVC 4J3WA 3ULVE 3I2CH 1UWXK 1MUJA 4Z0XA 1N5YL 5K9JH 2VXSL 1CFNA 5EO9B 1A4KA 3IU4L 2IMMA 2FYYB 4PRDB 5H2BB 5I8OL 3IF1B 4OJFH 2YD3A 4LCYB 3ECBB 3JV6B 4JEGB 1MIEH 1CIUA 1ZANL 1OW0A 4XCYA 2XKSA 5HHVH 3DLQR 3IDUA 1OGAE 4NNXB 4NZTH 2JCCA 1NDMA 7CGTA 3UJIH 4ODVL 4OD1H 1IAKB 4NJAL 1G9NH 4PJ8C 2OTPA 3KPNA 4BK4A 4PY8J 2E9BA 1ROWA 2E7HA 3F7VA 2WBJD 5EC1A 4NO5A 4NM8H 3SKMB 3DROA 4X9HA 2FX8L 5D7JB 4HS3A 4PGDB 2OMNA 1ADQA 4R96A 5BMFL 5EU5B 5TE6L 2IPKA 3IDIB 4J3SA 1KUMA 3GRWA 3NPSB 4E41B 5JIPA 4W81A 1RHFA 1NBVL 4K8RH 2UYLB 3TO2B 4OLZH 4KHTH 4OZIA 3H7BB 4UIKH 4R9HA 1KPRB 2AXHA 1NMAL 4XX1E 3OAYH 1FVDA 3O2DA 5GRJH 5KJRH 5F7WC 5HHXL 4ZSOB 1INDL 4FTVE 4G5ZL 1J5OL 2I24N 3V6ZB 2GK0A 3GM8A 3ULSA 2QLVB 5FM8A 5I8CA 4UDUA 3BUYB 5D5MF 1I3UA 2A83B 5EDXA 4WJ5B 4QXUL 4G8EB 4JFDB 1WZLA 2BNRB 3ILPA 4L8SC 1J1PH 2I60H 3W11C 5E9DD 4E5XA 3S34H 1X6LA 3L5XL 3UX9B 3QIWB 4Y7MA 1V5JA 4J3VA 3L3GA 5JZ7C 4XP1H 1IM9A 1L7TH 2A0LC 1ZLVH 5JLZB 2FNBA 4PB9L 1A2YB 3QUXB 4OLXL 4NFBA 4GMSL 3MCKA 1X9QA 4PJIB 1QRNA 1CGVA 1A0QH 1RMFL 1PX4A 5B3NA 1T3FB 1AQDA 2DD8H 5A16A 5BVJA 2ADIA 4JN2A 2AJ3A 5DJCA 3OKLA 5KW9H 1N8ZB 1OOAA 5TGBA 2XZQL 3RAJH 1G7PB 1FN4A 2PW2A 4IS6A 4MQXD 5GQBA 3PIQA 1A3RL 4KJYB 2CRMA 4K3EL 4E42B 4UMGA 5EBWB 4X4ME 4XNUL 4LVNB 4Z0BH 4G9DA 1HDMA 5CBEB 4HDIA 5FGBA 2Y07H 2PN5A 3DOSA 3U46B 5JR1H 4KK9C 4N9GA 1A02N 3LKPB 3VFNA 3TO4D 2Y06L 5C0CA 1HSAA 4TUOB 5MEPA 5I1IH 3VXSA 4DN4L 3STZB 1HHJA 3BHBB 5FYJD 3GSWA 3T0ED 4LHUG 5T3ZH 5JUEH 3GSOA 1GC1C 5TDOA 2FZ3B 3MRBB 5IB3A 1CBVH 1KLFA 3PJSA 4QWWC 5DRNA 2G75A 5C0FA 5T33L 5GIRA 3TIEB 4OQTA 4X5LA 4MXQC 1FE8L 4FQ1H 4OLWH 4HK0A 3UTPD 2EC9T 4B41A 4Y5VA 5I1AA 3MLSH 3S37L 3IDMA 1MFBH 2PKDA 1AXSB 1XGYL 4G3YL 1KB5H 3OGOE 3F12B 2YZ1A 4XB7A 5KVFH 4LARL 1OAKH 2GT9B 4C56D 1YEFH 2I25N 1QLFB 5FA3B 4AIOA 1YMMA 4DUVA 1A3QA 3FQUB 2NLJA 4WUKL 4F33A 1QNZH 1A1NB 4JREC 5FB8B 3SDAA 1N6QH 4P59L 2DQDL 4BA8A 5IVXA 3KPRD 2DWEB 1T03H 2VLKD 1MCIA 1NLBL 3PNWB 4HKZB 4XP4L 1BZ7B 1XIWC 2G5BA 3JWOH 3RWGB 2OK0H 3KR3H 3LKSB 3ISWA 1VENA 1U8JB 2YA2A 4I0PD 3DGGA 2ICCA 5DXWA 1MCEA 1ZLUH 43CAB 1XF4A 4YO0B 3NPZB 5L0QB 3MJ9A 2EDHA 3I02B 1NCTA 3VD5A 4YHML 2EYSA 2PTUA 4CN6A 2Q8BH 1DLHB 1GAFH 4JQVA 5GGQH 3QJFA 3QQ9D 4FN0A 1FYTB 3VWKA 3OGCA 3OXSB 4DN3L 4ZD3H 2ICWJ 1CWVA 1UKQA 5KSBA 1IJ9A 5K9QI 3G9AB 1P7QB 4KJPC 3GMLA 2F8XC 4OFDA 3DMMB 1V7NH 3ALXA 1RZJC 5DFVC 2VYRE 3PWVA 4LBEA 3EDFA 3B3IB 1CLYL 1G7MB 2EIEA 1T04A 5IJVA 3C08L 3LD8B 5GGSY 1TPXC 4LSTH 4F37F 5EZOH 4M43H 4RNRB 3TN0A 3HC0A 4Q9RL 1KPUB 1Q9OB 3JTSB 3DO3A 1BZ9A 4G6MH 4OZHF 3DX9A 5DJDA 3HR6A 3O9WD 2YPLA 5J11B 1VFMA 1MI5A 3LN5A 4X7SL 3ZT6A 1BVLA 5ACZB 2DQHL 2J6EL 3NOIA 4WI8A 4XPBL 3S37X 2YXMA 2X70B 2UUDK 5D70L 2LTQC 4P5TC 5T1LB 3SDDB 4G9FA 4NO3B 3VD7A 1CL7H 4NQEB 4G8GE 2YK1L 1T89C 3GSXA 2DQEH 4WVRA 3SE4C 5A43C 5D2NE 5E95B 1A3LH 3V6OA 3QIBC 4HGWA 4WFEE 5CGYC 2NXZD 1JHTB 5I17B 5SV4A 3TPKA 5BXFB 4AIZA 5C0BB 1A7RH 1U93A 1J0JA 4N0YH 2NY3D 3SE3A 4QHLA 5DD3H 2ITDA 4LGPB 1K4DB 4EIZC 4HC1A 5JOPE 2J8HA 3CFKA 2E27H 4UQ3B 4NRYA 2I27N 2Q20A 4FMKA 4DK3A 1P6AB 5BRZD 4LCUA 5FYKE 3VE0A 4JKPH 1FBIH 2VXTH 4HAFA 1NCBH 4NRXB 5DUBB 2D7TH 3VH8B 3Q1SL 4UV4L 4EI5B 3DTXA 4U7MA 2VDPL 4M8QA 5EBLA 1IEBA 1R3HA 4HMCA 4UILH 4GXVH 1K6QH 4K3DL 3QPXH 1MWAB 3DGCR 1XCTA 1NGQH 4RCAA 4TUKH 5FHAL 4MAYB 4F3FA 2B39A 3MBEB 4KQ3H 5I75C 1MJ8H 3DUHA 4CL7A 5HHOB 2WWKT 3WFHA 1D6VH 1PKQB 1TMCB 3EFFA 4JM2F 4XGZB 3TC9A 3V6FB 4ZAKB 4FNLH 1A9EB 4HZLB 2PR4L 3EZ8A 2XV6B 3H9ZA 3HC4H 1ZLSH 5EOTA 5BW7C 3JV6A 3WJLC 2CK0L 1IT9L 4TULL 5F7KC 4QF1B 5E5RB 3TNNB 5FO8B 4MXVE 5T1KB 3SBWC 1CICC 1FAIL 2CXGA 2XNAB 4HUXA 5EU3B 4F37K 4KY1L 3MNWB 3HPJA 4CU7A 2Z91B 1IM3B 2JK5A 2APFA 1S9XB 4JAMB 3WIHH 3PGDB 1AH1A 1Q38A 3QEHB 1W8OA 3P0GB 4A2LA 5CBAA 4OIBA 3DI2B 3E6HB 3SJVE 5DLMH 3O6FC 3MOQA 4PR5A 1NEZB 1HWGB 2HT4D 3QQ4B 1LO3L 4HT1L 5CJXC 2NTFA 4LKCB 2APXA 5IB1B 1SM3H 4X6DA 3O2VL 4M1GL 5KG9A 2BRQA 2VZUA 5ITBH 4E41A 1Z5LB 3FT4A 5MENB 1KTDB 1NUDA 3GNMH 3UPRB 3VFRB 3TGXA 3T1WA 1F42A 5F3HB 3NFPB 1G7HB 3L7EA 3WFEH 12E8H 2EZ0C 2F54A 1CQKA 1KELH 2AJXH 1EVUA 1XR9B 3RWCB 2X41A 1F4HA 2XG4A 5HHQA 4JO2H 1DUYA 1QSVA 2EDXA 1OVZA 3VD3A 2DTML 4NQDE 32C2B 5TDNB 4OAWA 4Y16C 1MOEA 3HN3A 2VDNH 4KXZH 4ZUTA 2MQ3A 3KPQB 3H9SD 3MACL 4PJ7A 1H3TA 2G9HB 2VZVA 1A7OL 4Z7VB 5C0AE 5ID1A 4JGMA 3RWHB 5J9PB 4YC2B 2YS4A 3AVEA 1REIA 2O5YL 2EO1A 2X4OB 5CEZL 1KC5H 3MRCA 4JANB 1LO4H 1ZVHA 3N9GL 1EO8H 2P47B 5HDBE 5F88A 3QIWA 2X4RB 3VWJB 5F89A 2V9RA 5E1AA 3MV7E 1I7ZA 4GKOA 1OGTA 2HFFB 3U4AA 1ED3A 3LKOA 5CWSA 1WUNT 1T66C 3RZCC 4OZGF 1A6AB 3F65A 1KJMB 3MOBH 1ADQH 5DURB 4PJFB 1ERNA 5AZEH 1T3FA 5FKAA 2VNCA 3GRWH 4XNMB 4M5YH 4TOYH 3RA7L 1TCRB 4CKVX 4RX4D 4WW2C 1BD2D 3EOTH 3S36L 1BQLH 5I6XC 3D3VE 1H8NA 1WV7T 3O2DH 1KCRH 4RMQA 1BJ8A 2NW3B 2V2TA 1XH3A 4QOKA 4H25B 3O8XC 3L5HA 4LIQH 3U0WL 1RURH 2XQBH 5CBEA 4QGYA 4H88H 3LRSA 5F8RC 3ZSTA 3O4LA 4WO4D 2BC4B 3H6JA 1QA9A 1NSNH 4LAQL 5D1QA 2YD2A 3LMJH 5EUOF 1LE9A 2EXYD 3IAQA 3L7FB 3LKPA 3HZMB 1RIVL 2AI0H 1CF8H 2COQA 4JN1L 2CLVB 4JO1H 4JG1H 1T4KA 4NQXA 1G6VK 5I1GL 1CLZH 5F7EH 2UWEF 5T1MB 3STZA 3QAZB 4GSDH 5E2UH 5HDLA 1U8MA 3TN0D 2P46B 3LPFA 1T2QL 4FQQB 3QFDB 3MRBA 4N90E 4D9QD 3BWAB 5F1KC 4H8WL 2PO6D 4GW5B 4YHPB 2CQVA 4L3CB 1FL6A 3IXAA 1Q0YL 1IGCH 3KLSA 3REVB 3INUH 4KJQD 1OM3L 3WFCL 4DGIL 3C6LC 3LKNA 1PZ5A 1FO0L 2HLFD 5DI8B 3MNVB 3MRNB 1I1YA 1AC0A 2A2QT 4KMTL 1MAML 3QDJB 4NYLA 1AGEB 4EXKA 4M61B 2QKIB 4CMMB 1D9KA 4R0LC 5D6CB 3FZUD 1UWGL 5DD1L 2QHRH 1HIML 1KJ2A 1JRHH 3KPSD 1BIHA 4IOFC 1PX3A 3NCFB 2UVFA 4OCXL 4M9PA 3FQUA 2EC8A 2NY6D 1BIIA 5HXMA 1SJHB 2HMIC 3L5IA 3RVWD 4OZGE 3HS0B 4YFDB 1N0XH 4HKZA 3QULB 5CLTA 5INCA 4P5KB 5EU6A 3DJ9A 4KPHH 4PG2C 5GRYA 3CDGB 2YPKB 1ZGLB 2PCPA 4AYFA 3MV9E 5E2WH 4CMHB 4YO0A 1TJGL 4KFZC 4KTYA 4EEEA 1FGNL 4YHNB 3T3MF 3BDYL 1EHAA 3MLVH 4OCSH 1CZ8L 4P4RA 1YC7A 2B20A 4AT6B 4NM4L 3ZTNL 5INDB 2KDGA 4OQTH 5DGRA 4HQQH 4GRWF 2FR4A 3DX8B 2AW2A 2XA8L 3L9RB 1HEZA 1JCKA 3OJ2C 3D85A 5EOCJ 3EOBA 3UTSB 5IOPB 4MS8D 3IRZA 1A9BB 3NABH 4PJEF 1KLUA 1RK0B 3MLUH 3VU2A 4XCCH 1GH7A 2UWEE 1ODAA 3R8BB 3RWJB 1IGFL 4Y2DB 3DI3B 1VACA 3HI6L 4HW6A 5CGTA 4JFFA 2ATKA 1KT2A 1S78C 5DC0A 2FH6A 4JZOA 4ZDHA 4HS6A 2HKFL 3OKEB 1C16A 1BZQK 4XP9L 5D7JD 1NGYB 3ZDZE 4EI6A 1XGUA 3PWPB 4KI5C 1MVUB 4E41D 3VFPB 1FZOB 1S7SB 1HH9A 4DKFH 2X70A 5FUOH 1CXEA 1TVBA 4FQXA 2XXMB 1J12A 35C8L 3V8OA 1B2WH 4ZOAA 5I9QC 3MJ9H 3S96A 2LQRA 1T83C 3VXQB 5KVEH 1UB5A 4FMFA 3ZKSD 1ZA3A 5F7LB 2F5AL 1DP0A 5B4MD 3Q5TA 3MJ8B 4XVSH 4C4KT 1TFHA 3FRPA 5GGSA 3UC0L 4U2YA 2D0FA 4F15C 5A2FA 3QXAB 5K93A 4QTIL 5I1CL 3OKDB 4JFQA 1XF3A 1G7LB 4JFDD 4PPTA 3U6RB 4LOUD 3D87B 2BNRD 5DEZA 3WLWD 4NNYA 1CXFA 3V4UL 1J1XL 2HRPL 3T4AB 4A2MA 3O3DB 2NY1C 1BAFH 3EYFB 3CPLB 3QIWD 4MNHB 3TVMA 4U1KB 1YEHH 3B9AA 4HKXA 5E08L 3WKML 1I9EA 3T3ME 3BH9A 3I2CL 4XNYH 4D2NA 2AK4A 1C5BL 1U8LB 3SGEH 3CXDH 2UZYB 5FV1L 1G6RH 4GKNB 3QXTA 1PKQA 3QDMA 4OJFL 3Q0HA 3BIAX 1MIEL 2BY0A 3STLA 1GGIH 2AXGB 2ENSA 3B5HA 5DFWH 4L4VE 5HHVL 1ZTXH 3L3HB 4PJEE 4HK3N 4Z78B 1A4JA 4NZTL 3ULUL 1F58H 1BBJB 2GUOB 3I84A 2F5BH 3QI9C 3UJIL 4FXGA 1UJ3C 4QOKD 4OD1L 5IB2B 4H0GA 4O2CB 4OZHA 1G9NL 5EU3A 1JFQH 4Y4KC 4PRPB 5TPWH 3EO1B 3ARWA 5TF0A 5DHYB 3PHQB 5D1QD 3AM8C 1N26A 1A7BA 2DQIH 1T20A 4NM8L 3PGDA 1AGDB 4HC1H 3AMKA 4NKMB 4JZJA 1LK3H 1FL3B 2HT2D 2RFXA 3I75A 3QEQE 5GZND 4HWBA 1BF2A 5CUSH 4G80A 2R4RH 3ZO0A 2W0LA 4K8RL 4OLZL 1RZFH 4KHTL 1KTDA 3I9GH 5K59E 3GMPB 1YQVH 4UIKL 3SDCB 3VFRA 1S7VB 5GRJL 5KJRL 4K7FA 4HGKC 4HF5L 1TCMA 1WFUA 4XHQA 2V5SA 3MR9A 1SEBB 2AQ2A 4C54A 1DVFC 3TBVB 1E28B 5ALCH 5ICZB 4HBQA 4WFGE 4UT9H 1BJ1H 1Z9MA 1EZVY 4K94C 5C0EB 3V0VB 3SPVB 2ZCKH 3B43A 3L95A 3Q6FA 1CE6B 3X14A 1J1PL 2IGFH 2I60L 5LJYH 3QIUB 4BM7A 2XXCB 3LQMA 2IH3B 2C3GA 5J1SC 1HSBA 4LCWB 4WV1C 3S34L 5DEFA 1AE6H 4OCLC 5HVFB 4MJ2A 2NY2B 1Q8MA 4L3EA 2NXYC 1RSFA 5CJOH 2JE8A 3KJ6L 4YFLI 4JM2A 5F9WC 4XP1L 3VWJA 3EJZC 1L7TL 5GGVY 1T7YA 4PJXB 3V9FA 5EU6D 5J12B 2E7LA 1ND0B 2P42B 1LP9B 4YH6A 1YYMH 4V1DB 1A6AA 1EBPA 4NN7C 3KS0J 2DD8L 3KPPB 4FZEH 1G7IB 3ELAT 1QFOA 4WENB 1F4WL 5KW9L 4E9LA 4HV8A 4L1HA 2J8UB 4MA8H 3RJQB 4YHYC 1OQOA 4FQHA 4XNMA 4MD4A 4ODUB 1MFNA 3RAJL 4JFZH 1BMGA 4N0RA 1LEGB 2B8OT 1FYTD 4L29A 1RZGA 2AS5M 3DX6B 4KQ4H 4Z0BL 1OY3B 4XP5H 3S5LB 1B0WA 3VXRB 2Y07L 5JR1L 1IGJA 3GSRB 3DMMD 1FNFA 5FCUL 3RY6C 1A8JH 4KDWA 5CSBA 4JZNB 2FHBA 5I1IL 2DRUA 2GYSA 1YN7B 3DECA 3LHPH 5JUEL 1H9VA 5T1MA 1EAPA 2RGSA 5E8EB 3NIDF 1NMCB 2Z93A 1CBVL 1ACYH 3BW9A 4FQQA 1QBMH 3BWAA 3FFCE 1G0YR 4WHCA 1ETZB 3QYCA 4XMKH 4AQOA 4OLWL 1AIFA 2P48B 4ZFZA 3MLSL 4FQXD 1U3HB 1MFBL 3MNZB 3T04D 5IW3A 1KB5L 2CIKB 4GUPB 2IANB 3CSGA 1LNUA 1I7TA 3DXAB 5DSCB 1GVIA 2CDGA 1UQSB 4KK5D 2ZUXA 4PJCB 3ZE2F 2OQJB 2VDQL 5KVFL 4HIJA 1R6VA 3WEXB 1OAKL 4R7NB 3R06A 3P30H 4GRMA 3C60A 4BH8B 1YEFL 1C12A 5J0BA 2R1YA 1FGVH 1H5BA 3W9DA 2EDFA 2OZ4A 3T0WA 4UT7L 1B0RA 1ITBB 1MCCA 2JJWA 2XN9B 3EZJB 3Q2CA 3BJ91 1I1AB 4YHOH 3ROOA 4AEHH 2ADGB 5HPMA 3OKMA 4DCQB 4JQXA 2DKMA 2ZOKB 5DT1H 2H2SC 3KYKH 3HE6B 2JB6A 1I7UB 3JWOL 3AMLA 3KR3L 2FJGB 5DQJB 3HTLX 2NZ9D 3QUKB 5C09E 4HIHB 4P23A 4UB0H 4PGCB 4XT1C 1F90H 1P4LB 4OM1H 2AK4D 3VGHA 5DFTA 4Y5XA 2EE2A 2EKJA 1OAYH 1VEMA 2Q8BL 5FDYA 1GAFL 4X4YA 1XZ0A 3BKCL 5GGQL 1GGBH 3QDMD 4JFEE 4LSRH 2PNDA 3LKRB 4RAUB 5EUOA 4M7ZB 4ZAKD 3GMMA 4ZD3L 1MJJB 5INDA 43C9B 4GW4A 2WQ8A 2FEDC 3LV3B 3QXVA 1NBQA 1NGWB 2VMFA 4I8DA 4TN9A 1FNEA 2CDEA 3IFPB 1WC7B 3HZYA 3CDCA 2ESVB 1G6RB 4JPIB 1RK0A 3VXTA 5HHMB 1WIUA 3UTTE 3EAKA 4YDJB 1OSZB 1KJ2H 3NIDE 4LSTL 4JPWH 3BZFB 5EZOL 3KPOB 4M43L 1KIRB 3B9KB 1YY9C 4L8CB 5ID0A 4J8RB 1BQSA 2IC2A 4YAQA 3U36B 5C2BH 2AV1A 4LEOB 5F9JB 4K3JL 3GMQB 4KKLC 2ZUWA 1RJYA 4PS4H 4LVHB 4RA3A 4PJ8A 5MEND 1E27A 2PYEA 1QUNA 4Q74A 3OJMB 2UV3A 1HE7A 4CW1A 1CL7L 2WWMD 2P24B 3VRIA 1FVEB 1V3JA 2DQEL 3EOAA 1A3LL 4XTRC 2BP3A 4XI5C 5TH2B 3EO0B 4OIIH 4YK4B 5AZ2H 1A7RL 1MFAH 4PBVC 1FFOB 4N0YL 3ARDB 4J1UA 1P1ZA 2NY0B 5I1KH 5DD3L 4Y5YB 2VUYA 15C8H 4F7MA 3QXAA 1T1XB 3AAZA 2E27L 1BEYH 3BPCB 4JKPL 1FBIL 2VXTL 1NCBL 1UM4H 2D7TL 2CUIA 5MP6H 1TENA 1H3GA 1BLNB 3DVGB 4L3ED 1VGKA 4UILL 4GXVL 4ZPVB 1K6QL 2C4XA 3VWJD 1NGQL 2E7CA 4TUKL 5FYJL 4U1LB 3QG7H 4RWHA 1AKJA 1SHMA 4GKZA 3WSQH 2V17H 1MJ8L 3MGTA 4XPFH 5IW6B 3BKYH 1H0DA 4N0UA 5DURD 3L3DA 4FNLL 1KIPA 2IQAB 1HHIA 2P5WA 1XGPB 1ZLSL 4WU7B 3G5XA 1X4XA 3IETB 3STBA 1Y6NR 3V6BR 1RY7B 1Y18A 2P5EA 2R1WA 3L3HA 3P4NA 1ZT7B 5GS1B 3WNPA 4MZ2A 4EUPA 1IAOA 4NUJB 1JGUH 2GUOA 4PBWD 2OTUB 1OHQA 1YZZA 4MCYB 3V2AR 1VPOH 3B2VH 4WW1A 5F21B 3BPLC 4MA1B 4QRQB 1T21B 4MWFB 3WIHL 3HLAB 4FTVB 3DURB 5H94A 1UFUA 3QP3A 4Q9QH 3U79A 2GJZB 4X5WB 5DLML 1PD6A 2GSGA 2WMPA 4KRPC 4TUJB 5FF6B 1U91B 3ARGB 1SM3L 2B0SH 3LY6A 3HRPA 4X80H 4G8FA 5JHDA 3WS3A 4EN3B 4EXPX 3GNML 3HCVA 2EEAA 1NGZB 3D39E 1Q94B 5IHBA 1RQ5A 4C55A 3G9VA 5K9QG 3SDCA 5LQBH 2P8PB 5E0QA 12E8L 4U3HA 5FYLD 2Q76B 2AJXL 3IAPA 4DGYL 3B2UC 4CJ1A 3GJFB 4Z5RB 4MMZC 4PRBA 3OKKB 4JO2L 1FCCA 1HXMA 1VFBA 3FTGB 3FO9A 3I3EA 1TVDA 1UGNA 5GS0D 4JJHA 1RUMH 2HTLC 3QDJD 4PJDF 2VDNL 3LQZA 1ZT1A 3P77A 4HLJA 4HWZB 4L8DA 3V0VA 1I85C 4NC1E 3RL2A 1P4BL 2BSSA 5BZDA 1NANI 1LHZA 1KC5L 2AJZA 5IMKB 1XF5B 1J0IA 1LO4L 1EO8L 3P0YH 5C8JA 4LLVA 5L2KA 1EMTL 1N3NA 2FEEI 1WITA 3DIFB 4JPVH 4PV9A 2JJTC 2KH2B 3SKNB 4ZXBC 4PJXA 3WFDH 4P23D 2J4WH 1VCAA 1DL7L 5DHVB 1ADQL 2H26B 5DZOA 4V1DA 5AZEL 2ZUYA 5T5NF 4HWBH 1K8IA 4YDLB 3GRWL 5EO1B 2R0WH 4Z7WA 3VCLA 4M5YL 4TOYL 2Y6SC 4NO2A 3MRFA 2HVKA 5KSVB 3N50A 4PJAF 3RUGA 1I4FA 1QHOA 1IQDB 3C2AL 5HYFA 3EOTL 3GSQB 3D25A 3VH8G 2X10A 1XIWA 3O2DL 4KJWD 1CFQB 1KCRL 3PWUB 1OAZH 4ETQA 3LOWA 3MPCA 3G04A 4LIQL 2BNQA 4R7DA 3L3JA 1CDCA 3ABZA 2XQBL 1OLZA 4TYUA 1CT8B 2HJKA 4H88L 4MJ5B 2N1KA 4I9WE 1NSNL 3T65B 5KS9F 4FFYH 5CHNB 4JFXA 2AI0L 1CF8L 5ESAA 4JO1L 3NCJH 1U42A 4JG1L 4Y2DD 2B4CH 3ZLQC 1CLZL 3NCCB 4U7SA 5F7EL 4RGNE 5E2UL 3T4YB 2ICEA 2YKLH 4QXTA 3PDOB 1X5XA 1H3WM 1HQ4B 3IDXH 2UY6A 5I1EH 1U9KA 2H6PB 3PWPD 3ES6A 4K71B 5IB5B 1CDBA 5JORB 1QR1A 5A1AA 3INUL 3CDYA 4XAWH 5DHXB 1DDHA 5HGDA 5FM4A 1HHHB 1MRFH 4X6CF 4XRCB 5DTFB 1QSEA 1KB9J 1MEXH 1A5FL 5FYKU 4BQ6A 3I6KB 3WIFA 3PF2A 3RGHA 3ZE0F 3G08A 4EIGB 3DXAA 3QFJA 5HYSB 3WE6B 2FX9H 2QHRL 1JRHL 1DBKH 3BKMH 5ABDE 3ULUC 1BBDL 4WFFD 3IB4A 4DZ8B 2ZKHH 1AO7E 4D0BB 3ZKMC 4P5TA 5BS0A 4ISVB 3KXFE 5TF1H 3WUWB 1RD6A 3NIGF 3O2WH 4YXHH 1T89A 3SE4A 3ARFB 3QIBA 3EYQD 1N0XL 1H3VA 4R90H 4JVUA 5IT2H 3KJ4B 1TJHH 5DK0A 1M05B 4KPHL 5DQJA 5C71A 2P4AB 1GZPB 3MRIA 4MQ7B 1JK8B 5I15H 4H5SA 5E2WL 2EDRA 4WHYH 5EUKB 1JTTA 3MA9H 1GGUA 2BNUA 1A6ZB 2GAZB 4OCSL 5A2JH 2NX5E 4HJ0C 4U1IA 4OQTL 2CKNA 4HQQL 1KPVB 2P5WD 4HBCH 5B22A 3LKRA 3S4SA 3EW3B 5BV7B 1V3MA 4YGAB 5KS9E 1MREH 2A0LD 3LV3A 4R4NC 4ELMA 1U36A 2GTWA 5IV2B 4YHZH 3O6KL 5DRXA 1BF8A 5MERA 3DNKA 3NABL 5ADPH 1UXSB 2WNGA 1MCLA 3MLUL 5GS0H 2DQTH 3FHAA 4XCCL 2RJMA 1MLBB 1BGXH 3S7GA 1EIBA 1FJ1A 1CVRA 4G8GB 4PRPD 5SWSE 3I6LD 5D2NB 4CVXA 3QUZB 4IHOB 4XC1H 2ZZUT 2OZ4H 5J6GB 1OB1B 5K33A 5BW7A 4HHAB 4NO0A 3WJLA 3S9DB 1S9WB 4Q2ZA 4HH9A 1QFWI 3QXWA 3B4NA 4N5EC 5TE4H 5CSZA 3VRJB 1PLGH 3U36A 2C7UB 1RJLA 3SBWA 1CICA 3ZSSA 4QTHA 3UO1H 3ROLB 3GMQA 3KDMA 2P43B 1KJVA 1WFNA 4DKFL 5ANMA 5IBTL 5FUOL 1VADB 3SDCD 4Q9BA 1I9IH 5FA4A 4OV5A 1BWWA 1PVHA 1B2WL 5LAXA 5K9KB 1FZMB 3QNZA 3MJ9L 3O6FA 4HIEA 5KVEL 3TH2T 4P9HC 4XVSL 2FIKA 2WLZA 3QWRA 3BZEA 4GBXC 4UINH 1VKXB 2ZUTA 1E4JA 5JXED 4IRJC 3MRHA 1EH9A 2P7TB 4NP4H 3RTQB 4FQLH 3IAGC 1T1XA 3MRDA 4LK4A 4U0RB 3BAEL 3BPCA 1WBXA 1R3IL 3QIUD 3SE8H 5IWLA 4QHUB 1S7WB 1BAFL 1YEHL 3VFUA 3P9MB 2IH1B 4Y16A 2GTZA 2Z31B 3CFDB 3MRJA 3GJEA 4XNYL 5ISZE 3EBAA 3V5DA 2M2DA 4U1LA 4WNQA 1GGCH 3CXDL 4V1DD 1D5MA 1P4IH 4WY7H 3D2UA 4CGTA 3ZYIA 3SJVB 1CGSL 1NUNB 3ZKXB 1GGIL 1G7QA 2B1AH 3FN0L 2NY4B 3HZVA 3K74B 3BIKA 1U8IB 4KDVA 5AYUH 1F58L 2BCKB 2W07A 3ZKQD 2JJSC 2F5BL 4Z7OF 4GH7B 2L7JA 3RZCA 5HYJE 2GCYA 5JDSB 1MCPH 5F6HI 1JFQL 4BKLB 1MJ7H 2OTUA 1BX2B 2FGZA 2FJHA 5TPWL 3VXRD 1WIOA 5IMOB 5IMLA 4U1JA 2G2RA 2X9WA 5D7SH 4HJJH 1DQDH 1T21A 2DQIL 4GS7B 4H20H 4U6HB 4Y19A 4OD2A 4F57H 2ZWLT 4HC1L 4C4KO 4O9HH 3D69A 1LK3L 1FIGH 4WW2A 2GJZA 4NQDB 3A6OA 1X5KA 2QEJA 5A2IH 4OZ4B 1EBAA 5CUSL 1FZJB 2R4RL 5E6ZA 4X0KA 2WBJC 5BQ7A 1XGRA 4NBXB 4R3SA 1KTRL 5JW5B 3O8XA 1RZFL 1IEAB 2A73A 3I9GL 5C0AB 1YQVL 3M17A 4LRIC 2OM5A 3DV4A 2P8LA 4APQB 2PYFB 4GRWH 2YN3A 3RQ3A 1SEQH 4UUJA 1IGIL 1MJUH 3D0VB 3BP7B 5MI0B 4P3DB 3F58L 1PQZB 3MJ7A 1BFTA 1J05A 2D7MA 3MV7B 3V5HB 1U3HD 3RIFF 4EBQH 2YOCA 5ALCL 4C57C 4UT9L 4LMQE 2IAND 3RDTB 3DXAD 1CI5A 3GSNA 1TTGA 1ZS8B 3U30C 5FO9B 3ME0A 1JYVA 1OTTD 2IGFL 5EZIH 5DUMH 2I9TA 2WANA 2YBRB 5I71C 4QRSA 4EUPH 3C6LA 1KENH 4P5TD 5BS0D 2CUMA 4JY4B 2AEQH 5CJOL 4NKIH 3SO3B 1IEHA 2XZCH 3HE6D 4PJ5A 3O45A 4M7JH 5I1LA 4JHWL 1Y0LA 3X12B 3TBTA 4RAHA 4P9MH 3GKWH 1YYML 2N7AA 3VD4A 4P2YA 4FZEL 2ED9A 4X99A 5IMMB 4MA8L 5EO1A 1DCLA 3FQRB 4RMTA 3O81A 1W0WA 4N1CA 4JFZL 4Z7OE 5DVKA 2KQMA 1JN6B 4B7LA 5FK9A 3HZKA 3BQUB 3FN9A 4PY8I 4R8WH 4KQ4L 1CDUA 4PG2A 4XP5L 3HKFA 4XXCC 1N4XH 1K4CB 3MMEB 2W65A 1FZKB 4OZFA 5B3JE 4KAQH 1YEEH 4MJ5A 4MQXC 1GC1H 2J1KA 5LGJB 1T0NA 3NZHH 1ZHKA 2W60B 2YD8A 5HHMD 1QEWB 4FZ8L 3ALPA 4HUWB 1DTUA 1F2QA 3LHPL 1N6VA 5HPOA 3LSOA 4NO0D 4RFEB 2JB5H 3B9KD 4LLUB 4XMLH 4NRZB 3RKPA 3DVNA 3IS1X 1HQ4A 3S35H 3JTTB 1QBML 3JSSA 2FSEB 4L8BA 5EZJB 5T3XD 2ZSVA 4PJDA 3T0EC 4AENB 4XMKL 4YZFF 3RIFK 3U9UA 2APTA 2WZPD 2OTWB 5I19H 3VXOB 4AEEA 4KKAC 4M4RA 1TXKA 4OZGB 4ZOCA 5C0ND 3CSYA 2VL5B 2X7LB 3CCHA 5DJ2A 3MRGA 5EB9A 3P30L 3MV9B 3MUGB 3QXDB 4QHMA 2VLRA 2R1XB 4PRHA 3ARDD 5CEZE 1FGVL 4C83B 3C6SA 3GIZH 5H37H 4KDTC 2NY0D 4NFCA 3AXLA 4AMKH 3K2MC 1QO3B 4MJIA 4XBPB 2VDOH 4YHOL 2FO4A 5HJ3B 5TQ0H 4N8VA 5DT1L 4U6YA 3KYKL 4ISVA 4M3KB 4WHDA 4L3AA 1SQ2N 1T83A 5GGVH 1U2HA 4BSVB 4PJAA 2XTJE 1U8NA 4J4PD 3CXHJ 1PYWA 4KGJA 4UB0L 4UOJA 4Y16D 4RQQA 1U8HA 4AM0B 4NPYA 2UWEB 5I8EB 4OM1L 3HI5H 2R56H 5E1HB 1KV3A 4F7EB 4Z9KB 1OAYL 1INEH 4ZFOA 4I0PC 1GGBL 1WQVT 4LSRL 1N59B 1RZJH 4P2QA 1ZLWK 3OXRA 2VISB 2CKBB 4HEPG 3PABA 3G5YA 2DN7A 2V2XB 3JV5A 4Y4HB 1TQCC 3CMGA 1U8KA 1JWUB 2VAAA 4QNPF 3QUMB 4UBDC 2VH5H 5IESH 1CGWA 1T66D 1S5HA 5IV2A 3P11H 4G8IA 3RZCD 4ENED 5CJBA 3LQAC 3BGMA 3O3AB 1RIUH 3U9PH 4OGAC 4MNQB 1KJ2L 2GKIA 5GSVB 3VMOA 4JPWL 3R8QA 3AB0C 4MNGE 4Y19D 4FTVD 3GHBH 5H37G 4QRTB 1ES0B 1IC4H 2DBJA 4QRRE 1JF5A 3PQYA 4HHAA 3QNXB 4X7FC 5C2BL 4ONHA 1H3XA 5F7FA 3FQXA 2EYRB 3QI9A 2C7UA 4Y1AE 3TCLA 5CIPA 3T2PA 4EN3D 3D18B 1QLRB 4Y4KA 1RI8A 3GMRB 4JRXA 1ZVSB 2F15A 1SYVB 3O9WC 1NJ9A 1EXUA 1DQMH 3AM8A 4RBPK 5CMAA 1VADA 3BP5B 5D7KE 3RVTD 2VB5A 4R4BB 3UJTH 4X7TB 3QHZH 4OI9A 1IAMA 4OIIL 2BMKB 4U33A 2FL5A 1MFAL 2HJFA 5LVEA 4XXDA 4NKQB 4Z76A 2B1HL 2IALA 3PXHA 2ENYA 5I1KL 1YNLH 3V4PH 4H0IA 2R15A 3E6FB 4POUB 4JDTH 5E00A 1WAAA 2NXZC 2GJJA 1BEYL 3JV4A 2EIDA 3GB7B 4WUUA 5DJ8A 2MPAH 4NSKB 2NY3C 1FL5A 5KAQG 1UM4L 1N5AA 4JKWA 5MP6L 2DKSA 3UYPA 2C1OA 2LU7A 3LPWA 4L4VB 1DVFA 4QHUA 5IBUB 4PJEB 1A6VH 3FO2A 1EEYB 4PJ5D 3MQIA 4LASL 1Q9LA 3OKYA 2ARWA 5F9OH 3SGKC 3P9MA 3GMOB 2BHYA 2Q6WB 3QG7L 4TSCH 1KIQB 2V17L 2WIIA 3WSQL 3U48A 4XPFL 5M95B 2ICWI 4IOFD 3BKYL 1JPFA 1J11A 4N1EA 1MSPA 2J8OA 4MX7B 1LGVA 4WV1A 2ICWB 3DRTB 3RY5A 5IIEA 3VFMB 2BJMH 4NJ9H 1IGYA 5I76A 5F7HA 3QEQB 3TNMA 2HMID 3FQWA 1CFTB 3ULUF 5IFAH 3PWLB 1AFVH 2JELH 1JGUL 2E3VA 2BCKA 4PV8A 2LE9A 3C5ZB 3NN8A 5EN2A 3MV8E 5E94B 1JNNL 1VPOL 3B2VL 3VGAB 1E0OB 3HE7B 4O5LH 4S1QH 2YD9A 4BYHA 2L4OA 2QADB 2IAMB 3QCVH 2QSVA 4Q9QL 3NTCH 3TYFB 5HY9B 1JP5A 3BPNC 3IXTA 1A6WL 3CC5B 2DYPA 4ZPTB 3MLWH 2VIRB 4NWTH 2VDMH 3U4EA 4O51A 5H8DA 4X80L 1JZ3A 3OJDB 1C1EH 4YHIA 3VGDA 1FSKC 4NOFA 2RAMA 2V6HA 2X1WL 1INQA 1K5NA 5F1NB 1HN1A 4OKDA 1RZ7H 1A1MA 4RFNB 2NZIA 4L4TA 4ZUUA 3RY6A 5E6IB 5LQBL 2GK2A 3VFSA 2X1QA 1J8KA 4S2SA 1I8KA 3KPMB 4MDIB 3LDBB 1JGEB 1Z2KA 1S78D 1WBYA 4CJ0A 1P2CA 5JPNB 4JVPA 5IK3A 1RUML 2CR6A 3HI1A 1SJEB 1DQJB 1BFVH 3BIBX 4UQ2A 5DMGD 4BFBD 4NKDA 1KEGH 4O2FB 4PRHD 4KI5D 2ATPB 3VA2C 4KV5F 3W5NA 4D8PA 2ITCA 4Y0GA 4F7PB 4JLRB 4MJID 4PJHE 2YBRA 3T2NH 2QQKH 2O61A 3QG6B 1U8PB 4IIQB 3P0YL 5DJZA 2IFFH 3ZMRA 1R3JB 3HHRB 4JPVL 4OFYA 3L3KA 4RIRB 1RFDH 3VFVB 3QRGH 3GGWA 2VZTA 3BEWA 4LSVH 2AXFB 2EECA 25C8H 2IBBA 3SCMC 3B6SB 5EU7E 3WFDL 2J4WL 5D9SA 3G5VB 1NUGA 4ODXB 1MCJA 3ARBB 1C7SA 2YUXA 3R0MA 4OB5H 4HWBL 4ALAH 2ED7A 3KHQA 1IKNC 1UCTA 4AG4L 3GBML 2VLJA 5I30H 4U1HA 3OKOA 1GIGL 3LKQA 4XVJH 4KUCF 1T7ZA 3GDBA 3FCTB 4P2QD 5IF0B 2NY1D 2HTKD 4XBGA 5DJAB 1TVHB 1XGQA 1D5BB 3KNBA 4JR9H 2LU4A 4GRLB 1OAZL 3QH3B 3RWIA 1F8TH 3FFCB 1NMBH 4ZNEE 1T2JA 1WTLA 1G0DA 1JGDA 1EGJA 3V4VH 2YHGA 3GSNH 2RCSL 1JF1B 4B50A 1JV5A 3NCJL 1HH6B 2B4CL 4YE4H 5FECB 2B7DT 4G8GD 4EVNA 1JTOA 4LLMB 1G84A 4I4WB 1QPPA 2WINB 2K9UA 4WFED 3BGFC 3QUZD 4WO4C 5EIVA 3IJSA 2X09A 2YKLL 3BISA 2OBGA 2MOVA 3PQYD 1S7TA 1UKTA 2EXYC 2BVPB 3F7YA 4LLUA 3IDXL 2XWJB 2BXZA 3IDYC 2H1PH 5I1EL 3QI9D 3P0VH 1NANH 4NHUB 4KMLB 5ETUA 5JOPD 4XX1G 4YPGB 1IFHH 3RWEB 4JE4B 1XR8A 4Y4KD 3VG0H 3RL1A 4DJMA 3QWOA 3UYRH 2HWZL 5FYKD 4KVNH 1QSFA 1MCNA 3SHSA 2PO6C 3W39B 2O5XH 1RZIA 1LE5A 3CH1A 4K2UH 5C09B 3BMVA 3UTQA 5EBMA 3MA7A 1DR9A 2FX9L 3AREB 4KJQC 3HB3C 2BSED 1CG9A 3QXDA 3WJJC 1DBKL 2HLFC 3BKML 4Y8DC 4ZO7A 5I66A 2ZKHL 4W6YB 5SWQA 1DBJL 3M1BB 3RTQD 7FABH 2R29H 3FZUC 4JFEB 4WUUD 2X4UB 5HJ3A 1DQTA 4OZFH 5TF1L 2AJVH 5E2TH 4YXHL 3OR7B 1WIPA 2KZWA 4R90L 4IOSD 3LEXA 5IT2L 1TJHL 5C07E 1BHGA 3ZE1F 3LN4B 2EDOA 5I15L 2BHZA 3F7QA 2J5LC 2J7LA 4Z7UF 1WT5C 5HVHB 1INDH 4IRZH 4J3TA 3RVWC 4ONGL 4QXWA 3UDWC 4F9LC 5I8EA 1L7IH 1WCQA 3UTTB 2WUCL 4MA3B 3MA9L 1ZA6A 4KZEH 3OR6A 1Q0XL 2HVJB 1KBGL 2VOTA 4Z18A 4HBCL 4HIIB 3SJVD 1X5FA 4NZUL 4I77H 1KEMH 2NXYD 5FYLL 5IG7B 3P73B 1K9TA 3E3QE 1MREL 1EHXA 3WXVH 5ERWA 3EJZD 2NY4D 4OKVA 3MYJB 2G60H 4YHZL 1QVOA 4PRAB 1ZHLA 2NW2A 2X9YA 5CP3A 2XWBA 2VQ1B 5ADPL 5GS0L 3CFEB 2DQTL 2GJ6A 2UY7A 3MO1B 5T3ZE 4YEEA 5B38B 5MEOB 5IEHA 1YPZF 4MS8C 3N0PB 1KACB 3HUJF 4MNQA 4LLDB 2OZ4L 2XYCA 4KC3B 3PV7A 3T09A 4Q58C 1MIMH 2V2WB 1FVCA 4O02H 3BOVA 1ZHNA 4R2GB 5E4IA 5C6WH 1RMFH 1MHHB 4LKXB 3K80A 4NQDD 1S7XB 5ITFB 4OTXL 1PLGL 3VXUE 2XKNB 5E8NA 3T8XA 4G6AD 4YWGH 4GLRI 2WBWB 5C0AD 4L4TD 2W0FA 4ZUSB 5D7JC 1I9IL 3VI3F 4GG6F 4XVUC 4ACPA 1ZOXA 3QO1A 3SKOA 3NPSC 3CJJA 5GISL 2DQUH 2IADB 1J87A 2OP4H 3FQNA 2ADFL 3N1FC 3PP4H 4UINL 4O2EB 3VJ6A 2OCFD 5D7IF 2XI9A 3EYOA 4JY6B 4NP4L 4FQLL 3VXME 4CUCA 3QNYA 5D2LF 4OQ1A 2W92A 5B4MC 1HOCB 3SE8L 5KSAB 3D1MC 3K4AA 3ZE1E 1IARB 1R24A 1NBZA 4X9GA 2D03H 4YIQB 3GKZA 3CD4A 3H2WA 4I48A 4WGWB 4LSUH 4OFYD 1EEYA 4N8PA 4LOUC 3WLWC 4KKBD 1YMHB 3BPOB 3MJ6A 4ZMAT 1RZ8B 2B2XL 3QEUA 2Q6WA 5JPMB 1L6ZA 1GGCL 5L88L 5DYOB 1N2RA 2X4NB 3QIWC 1I85A 1P4IL 3DPBA 1U41A 5JNYA 4WY7L 5DRWA 2FO1A 2OR9H 2XZAH 1T1YB 1RJZB 2ICWA 4P4KB 2L0DA 1QFWH 1YC8A 3IFLL 1JPGB 3QUXC 3IDNB 2B1AL 1C08B 4QLRA 1U58B 3UCRA 2JJTA 3Q3GA 2AV7A 3AS1A 4L1DA 5AYUL 2VWEE 4WU5A 3GSUB 3FB8A 2FIRT 4ZXBA 3D39B 1YPZE 5J7CC 2R2HA 3RHWF 5FGRA 1MCPL 5E99L 1MJ7L