2EO9A

Solution structure of the fifth ig-like domain from human roundabout homo1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
118
structure length
118
Chain Sequence
GSSGSSGPPVIRQGPVNQTVAVDGTFVLSCVATGSPVPTILWRKDGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Roundabout homolog 1
publication title Solution structure of the fifth ig-like domain from human Roundabout homo1
rcsb
source organism Homo sapiens
total genus 9
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2eo9A01
1WF5A 3NABL 1Q1JH 3VFPA 2BZDA 4UU9A 4FA8A 1NCCH 1J10A 3SKMA 5K9KB 1ODAA 5E2TH 3OQ3B 2AK4D 5E2WH 2BMKA 5CIPB 4LCIL 5JW3H 3GJFK 4DKEL 2P48B 1I75A 4NWUL 3UTQA 2B2XL 5F1IB 5JW4Q 1YNKH 1MVFA 2WLZA 2X4UB 1OAUH 4V1DB 5F9JB 5H37G 1VFBA 1DBJH 1EO8H 2I60L 3L1OH 3LQZA 3TCLA 4JN2B 4GAYB 3DGCR 4HDIA 1AQDB 1RZKH 4PR5B 4M6OL 5HJ3A 3QUML 4DGYL 3UBXI 1JZ8A 4OLWL 3PWLA 1A02N 3CSYA 4GBXB 2W9DH 3PGFL 3S37L 1SM3H 4OD1H 1S9VA 3BI9X 5ACZA 2YUWA 1CICD 3HR5A 4Y1AB 3T3PE 3U4BH 2BRRL 3H3KA 4IS6A 3HC0A 4QRTA 1D5XA 4DGVL 5D5MB 4Q2ZB 3GMMA 5HHNA 4RGOH 5I6XB 3I75B 5DD0L 4MJIA 4AL8L 1JZ6A 5KSBB 4PP1C 5D70H 4HKZB 3UTSB 2B20A 4GRWF 1X5GA 2FH6A 1YYLH 3AB0B 1T0NB 4UIKL 1IAOA 3O0RL 3P4MA 3WHXA 1QLEL 1Q8MA 2JLLA 3DOSA 1DBBL 1U3JA 4JQIL 1A6AB 5CEXA 1AKJB 4L8DA 5DJDB 4XVJH 5F7LB 1UCTA 4A2MA 2IAMA 1Z5LB 1QOKA 3DUUA 1V3JA 3WIHL 4PRIA 1R3HA 1IGIH 4S2SB 2VH5H 4DCQB 2X5PA 5IP4A 1U8LA 1NQBA 3L6FA 3QIBB 3ARBC 5D7LD 4MLSA 3CDGB 1FL3A 4WI3A 4M5ZH 4S10A 2BOCA 5T1MA 4ZO8A 3EOBB 1CFTB 4HC1L 2AGJL 5TDNB 2DQGH 4HUXA 4F15B 5J12C 1FQ9C 4PRAA 2LV4A 4JO2H 1T1ZA 3KHOA 5ETUB 3IT8D 4ALAL 5JR1H 3E6HB 4MB4A 3RNQA 4GUPA 1JBJA 3DUHA 5EB9A 2X10A 3QO1A 1H15B 1U93A 4MXVE 4X5XB 3LEVH 4FQXA 4R4BA 1YPZE 1ZHLB 4U1KB 1H3GA 4X9FA 5C2BL 2CIKA 2IAMC 5IQ9A 4PP1D 5SWZE 4DQOL 1MRDL 3DO7A 4WRLA 3WFEH 1HXYA 5LBSH 3UXFA 4C58B 3CVIH 4QLRA 2VLME 1U3HB 5K9KA 4MQ7B 2VWEE 3H9SB 1TDQA 5CIPA 1UEYA 4DAGH 3OB0H 2BVYA 3JZ7A 5C7XH 4KHTL 4LF3B 5F1IA 2QSTA 4RIRB 3ARBD 2X4UA 5LQBH 1H9VA 4PJ9B 4V1DA 5F9JA 2OXHA 1I7ZB 4RMVA 2BVUA 4YBQC 2AJUL 4FQXC 1DE4B 4JN2A 4GAYA 1AQDA 3VFOB 4MJID 1CCZA 2WIIB 3MCLH 2OTWB 4KV5E 4MNQE 2ENSA 3S3SA 1KIRB 2NY0B 4N0FB 4Z76B 4HJGB 2DLGA 1GCFA 1BM3H 4GBXA 4QNPF 5T1LD 2CRYA 1QRNB 2LU7A 5DGRA 2VN7A 4Y1AA 4TNWF 5MP6L 1GJIA 4MZ3A 3KPOB 2P8PB 4WTXA 3LRSB 5D5MA 3UTPE 4KAQH 2IAMD 4G8GB 4Q2ZA 4PRID 3W0WE 2XZQH 2IG2H 5IQ7H 1HSAB 2EDJA 4K3DH 5B39B 1H8NA 5KSBA 2OR9L 4HKZA 3UTSA 5GRZA 3V4UH 4ZTOL 4L4TD 1FVEB 1MWAH 5SWSE 1JNLL 1NSNL 2YD6A 3MRLB 2F5BH 1VCAA 1A6AA 1D5IH 4JFFD 5E00B 2IC2A 4WGWB 8FABB 3FFCB 2ZUXA 1CGWA 1HH6B 1CD9B 5C0RL 1Z5LA 1A47A 1JHTB 2F58H 4GMTL 5E99L 2ZG3A 4S2SA 5ISZD 1N7ML 4DCQA 3TBWB 5ADPH 3QIBA 4YBQD 4LEXH 1ZMYA 4HLZH 1JPFB 4FQXD 1CQYA 4NKDB 1MUJB 3CDGA 3NFSH 3F12B 3CLEH 3OB0K 5HVGB 1MNUH 1FYTE 3ARRA 1TNMA 3EOBA 1CFTA 4YHML 5K9JH 5I6XC 2R0KL 3HZMA 5TDNA 2R29H 5F7DB 4P4RB 5CHNB 4Y4HB 5ETUA 3U48A 3I3BA 1RVFH 3BH8B 3E6HA 3AB0C 2WW8A 4XT1C 2I5YH 3SPVA 1EUUA 2K9UA 3TN0C 2ZG2A 1H15A 4Y4KB 1LQSR 3SQBA 4X5XA 1JYXA 1FVCB 2Y6SC 2D03L 1ZHLA 3EDDA 3CCHB 1WCBA 4U1KA 2ZJSH 4XAKD 4BH8B 1WVZA 1A7RH 5AAWA 3GMRB 4L4VB 4W4OA 4X7SH 1BFSA 3MV7A 3MRBB 4LQFL 5CSBA 3HC3H 5AYUL 3T2QA 3ULUL 1Q0XL 1U3HA 4AJ0A 4MQ7A 4TSCL 1OF2B 3H9SA 1D7FA 3RL2B 1IC4L 4WI8A 2ICEB 5KSUB 1UJ3B 5LAXB 4PJXE 3E8UH 1ADQL 4LF3A 4RIRA 1OPGL 5FUCE 4H25B 1NPUA 4PJ9A 4Q6YA 4PJGF 5L9DL 1G84A 2AV7B 4LDOB 2E7CA 1DQDH 2GJZB 5HI3C 2EDFA 1NCBL 3QEQE 1DE4A 3MBEB 4LHUB 3U83A 4KJPC 5EZIH 1XMWA 3VFOA 1OSPH 3REWB 1TTFA 2WIIA 3D39E 3WBDA 2OTWA 1KIRA 1XR9B 4N0FA 1KELL 4Z76A 4HJGA 1MHPL 3OTTA 4H0HB 4GXUN 4W4OC 4MLIA 4NM8H 3TN0D 2XTLA 1ZLWH 1QRNA 3OWEA 1U3HC 1QLFB 3LY6A 2Y6SD 2P8PA 2RBLA 3LRSA 2YEZB 1AKJD 2IADB 5FYJL 2G60H 1ERNA 4YHKH 2K7QA 2X9WA 5DLMH 3BZ4B 1YYMH 4PGBB 5JTWA 3EUUA 1HSAA 5C09B 2EDBA 5B39A 2COQA 2H2SC 4ODHH 4UNTA 4M1GH 1AP2B 1OP3H 3IDUA 3RWDB 5D2NE 2UZXB 1CVSC 5GGRY 1FCCA 2NYYC 3TESA 5F88B 4AEHL 2D4DA 2YXFA 1BIIA 1KC5L 1FVEA 3V5HB 1NEZB 5FGCE 4QOKE 2FLRT 3MRLA 2BOBB 4IDLA 2NY0C 5E00A 1N64H 8FABA 3FFCA 1HH6A 5SWQB 5IB3B 4NOFA 1JHTA 4P59L 2NZ9C 4KUCF 1H3XA 1Q1JL 3TBWA 3HI5L 4D0DB 1U3ZA 5F21B 4KVNH 5HI3D 4NKDA 1JPFA 3R06A 4G8IB 1MUJA 3IXTB 4KJPD 3HAEB 1SBBA 2PO6B 4GG6F 1NMBL 5F97E 3QHTC 1C7SA 4Z7WF 2O61B 3MJ6A 4HF5L 3LOWA 5F7DA 5JOFB 1YNKL 4WEMB 4P4RA 3JV5A 4FQ1H 2G5BB 3CZJA 3K74B 1OAUL 5CHNA 4Y4HA 2R2EB 3EYFA 1U3HD 3BH8A 4O51A 2JCCF 1YEFH 2B1AL 4HXBH 3FQXB 1BAFH 4Y4KA 1A1OB 2HRPH 2HN7A 4PJBB 2FRGP 1P84K 3CCHA 1ZLWK 2AEQL 5TE4L 2H2SD 5TPWH 2KPNA 2WLYA 4NZRH 3C5SB 3GMRA 5GIRB 4L4VA 2NYYD 3MRBA 4MA7H 2JJTA 4P99A 3Q6GH 2EDDA 3OBAA 2ESVB 3OAUL 4RWYH 3O4OB 4E42B 1NCDL 5DK3A 3SCMB 2NY0D 3MV8E 5JZ7C 2FX9L 1OF2A 2C3VB 5EIVA 1OP3K 4X4XB 3RL2A 3MJ8B 4KZDH 3RX5A 2ICEA 5KSUA 1UJ3A 5KS9B 2W9EH 4LLVB 5LAXA 4OFYD 1UZ8B 1INEL 2NZ9D 3BKMH 2WWKT 4X6CF 5D70L 1QRND 1QFUH 1KUMA 4H25A 1BD2B 2D7PA 2H1PH 5TDPB 1GC1C 3VI3F 4NFDA 3HNTH 2GJZA 1I7TB 4X4ME 4Y4KC 5LJYH 4G8GD 1KT2B 3GMPB 4HHAB 3SKNA 3MBEA 4LHUA 4K3JL 4HIJB 5I8EB 3MLWH 3ALPA 3CVHL 4G8FB 1JYVA 3GKWH 1XR9A 3MRNB 3DROB 2VH5L 1RUML 2Z4QB 3ALXA 1DZBA 1NGPH 1P7KB 3B83A 3O41B 3U0WL 1QSFB 4BM7A 1QLFA 5CFHA 3L3GB 1ZTXL 2M2DA 4XMPL 2YEZA 1PQZB 2IADA 3FFCD 2LFGA 2VO5A 2QBWA 1MCRA 1UJ3C 4OCWH 2EDKA 2Y5TB 4UZGA 4PGBA 4YPGB 3RZWA 5C09A 5CWSB 4Z6AT 4M8VA 1CG9B 1AP2A 2KBGA 3S6CA 3RWDA 4YHYB 2ZCHH 5JZ7D 5F88A 2UWEE 2ADIB 3V5HA 1NEZA 5ESAB 1R0AH 2DLIA 3WFCL 4XBGB 5JA9A 5SWQA 2FJGB 5IB3A 12E8H 4Y4KD 2XACC 4D0DA 4NCC1 3UZEA 3SN6N 4YBLB 4G8IA 3IXTA 4X7TB 3HAEA 2GJ6E 1SVCP 1VFMA 2K7PA 3O3DB 5KOMC 3ZYJA 2PO6A 1CLCA 2VL4A 1D3CA 3BPNC 4X9GA 4L4VD 4OUUB 5JOFA 2G5BA 5KOVC 2VLLB 2Z91B 2R2EA 3VMPA 1RZFH 3P0YL 3S35H 3WHE0 2ZUTA 1MCBA 2H32H 2IPTH 3FQXA 2DQCL 4UTBH 4YHIB 2A6JA 1A1OA 3MCLL 1E4KA 4PJBA 2L0DA 4HMEA 1BM3L 1Z0NA 3C5SA 3WXVL 2BP3A 1BGXH 1HKLH 5GIRA 5F7FA 3MLXH 3C08H 4QRRE 5L0QB 4X8XA 2ESVA 1WZ1L 4M43H 3MUGB 4E42A 1EJ6A 2PO6C 3SCMA 3OAZH 2ATPB 2C3VA 1TZGL 2D7TH 4X4XA 3MJ8A 1X5IA 2A74B 5KS9A 4OGZA 4J3TA 4M00A 1UZ8A 2MKWA 2GK0B 4F8TA 5L6YL 1F3JB 4DFHA 1BD2A 5TDPA 2FWOB 4ZUUB 3WE6B 2ID5A 1I7TA 5T3XL 1KT2A 3GMPA 4HHAA 1BWWA 4OQTH 4NJAH 1E4KC 5D7JB 1V05A 4H26B 5C09D 1E6JH 2A9MH 4QRPB 4G8FA 5F1OB 3MRNA 2AQ1A 4KHXL 3DROA 5I1HH 1CLZH 5ADPL 2LU4A 4GFTB 1U92B 1QO3B 3U9UB 1P7KA 4XAWL 4HQQH 2XV6B 5KTEL 1QSFA 3TBYB 1A64A 2XOTA 3L3GA 1I1CA 3SCMC 1FE8H 1PQZA 5ITFB 2DQJH 1Y6KR 3O8XB 3TV3H 2EIBA 1MJ7L 2Y5TA 4FG6C 4DN4H 4YPGA 4L5FL 4N8CL 4GKOA 4J3UA 4JPIB 5CWSA 3AGVA 1FZKB 1EA9C 2VDQH 3DXAB 4XP6L 4ODXB 2PO6D 1NC2B 3V4VH 4NGHL 5F6HJ 3WYRA 1CLYL 4HK3N 5GGTH 3O6LH 2ADIA 1PLGH 4Z7UF 5JOPE 3UYPA 1KEGL 5ESAA 4Q97A 3GB7B 1KCRH 1MQKL 1DEDA 4XBGA 3B43A 2A0LC 2VKWA 2YK1H 4I1NB 2W0LA 1TNNA 3O6MH 1MCDA 2FJGA 1ZWIB 3OAZK 4WY7H 1NANI 4FFVC 2NTSP 3W81A 4G6ML 3MUHL 4X7TA 1ZHNB 3EO1A 2C1PB 3O3DA 1CE6B 2VXQL 1U41A 1LE9A 4OI9A 5T3ZL 1PEWA 2A6IB 2VUOA 3QWOB 1CLOH 4DKFL 4HUNB 4OUUA 5JDJA 2VLLA 2ESVD 2Z91A 3LAFA 1DQDL 4YHYC 1GHFL 3K7UA 3SCMD 4PJDB 3TFKC 3OKMB 1YC8A 3VA6A 4YHIA 2ERJB 1BVKB 2XXCB 4FG6D 3CDFA 4OCXL 5C0EB 1VESA 1GGUA 2IF7A 5T1DL 2H6PB 1WITA 2MOVA 3X3FH 4O5LH 5DWUH 2J6EL 1P69B 4UNVA 5EORH 4GS7B 4MYWB 3MUGA 4AEFA 3STLB 3K1KC 4YHKL 5DQ9B 2A0LD 4UV4H 1PKOA 2ATPA 4K7FB 1U36A 2DM3A 1KJ3H 2A74A 1QG3A 2J88H 1MJ8L 2GK0A 4M1GL 5E8NB 4FFVD 2HTLC 1QSFD 4XNYH 1F3JA 5CKGA 4PJCE 1KENH 2FWOA 1NCUA 1R3KB 4ZUUA 3MODH 3WE6A 2DD8H 1T22B 3H42L 4OLXH 3RJDA 4YPJA 2WZPD 3HI6L 2X44D 5KVEH 4I5BB 4YQXH 5D7JA 1T7WA 4H26A 2CIIB 1N4XH 4QRPA 4NN6B 1D9KB 4LEOB 5HY9B 5EFIB 1U92A 3TFKD 3CMOL 1QO3A 3U9UA 5L0QC 1VB9A 4IJ3B 3TBYA 1LP9E 4KRNA 2D7NA 4C59B 5LWYH 3ZTNH 2J2ZA 5ITFA 4HBQA 3M8OH 2VDNL 1VSCA 2YWYA 4GKNA 3O8XA 3KLDA 4FQ1L 3QWRA 3VGGA 2YBRB 2YN5A 4JPIA 2A1WH 1LEKB 4OCRL 1FZKA 4BZYA 1Q72L 3DXAA 4HWZB 1GGBH 1NC2A 4ODXA 4HXAL 3JTSB 2LTQC 4TUJB 2D7MA 1IC5H 3EGSB 3MRQB 5D7JC 2R2CA 3D5OF 2IPUG 4UMGA 3KPLB 5TPWL 3TWCL 2HTLD 1H3TA 1KPRB 1MCNA 2P5EB 4NZRL 3PL6B 1CDJA 4AM0B 1YPZB 3VRLF 4Z77B 5MHSE 4TUKH 3DECA 2CD0A 5GJSH 1ZWIA 3Q6GL 3IFLL 1U42A 3D1MC 3LHPL 1G7HB 1ZHNA 4P3CH 1J1OL 5EPMB 2C1PA 5DYOB 1CE6A 4XPGL 4XVTH 4U33A 4N1HB 3QXAB 1MLCB 3O8XC 4ZFZB 5MI0B 3CC5B 2LVCA 5LXGL 2E6JA 1CGSH 2A6IA 3BKML 1E4WL 4CKVX 3QWOA 4YHOH 1EMTH 5D4QA 1SBSH 1J87A 5FV2A 1ZANL 4XCFL 3GMQB 3HNTL 4XMKH 4HV8B 5LCVL 5TDOB 1M7IB 4PJDA 4D9LL 3OKMA 4GRWE 5ICYB 1BVKA 2X41A 1JTOA 4NP4H 4U3HA 3HAEG 1A6UL 3CDYA 3BIKB 5C0EA 2W1NA 1PDKA 2OZ4A 2H6PA 3LEYH 4QHUB 1E4XI 1TZIB 3RPIB 3B9VA 4WFGD 1GGIH 4B5EA 1C5DB 2VKXA 1MHHB 1A7QL 5D7JD 5FGBA 2Q76B 1IBGL 5B4MC 3STLA 3WFBL 4KRPB 5DQ9A 3TYGH 3BEVB 3QQ4B 3WLBB 2B1HH 1CI5A 3MV9D 4K7FA 1G7JB 4MDJB 4P48A 3E3QC 3LD8B 3LMJL 4PJHF 4OCLC 5E8NA 2R0LH 1E4JA 2CDEB 2Q86B 1PSKH 2VOTA 3R4DA 1R3KA 1YEGL 4TUOB 2WAHA 1T22A 1UWEH 4ZD3H 4M48L 2ERJC 3NZHH 3O8XD 3U7YH 4I5BA 4Q74A 1R0AL 5T5NF 5CJQL 1RURL 4YX2H 2V2WB 1AXIB 2CIIA 3MRFB 4JJ5B 1P84J 1DUZB 1D9KA 5JXEA 3WDJA 3DXAD 2YPLE 4LEOA 5HY9A 4OIBA 1NC2D 5EFIA 2X9YA 5FYKH 2UYLB 2FJFB 4OKDA 1R3JB 2FLBT 4UUJB 2J8HA 3MROB 5MEQB 3AROA 4GS7C 5FGBC 3OZ9L 3DO3A 3L5XL 4P2RE 3A6OA 5HSFA 4Q9RH 2VIRB 25C8H 2ARWA 3ORJA 1OWRM 1FYTB 4LDEB 4WW2F 3VA2C 5LKNA 3AY4A 3CVHB 2YBRA 5F9WB 2VXTH 4M4PA 4KK8C 3S35L 3V0AC 4ZNEA 1LEKA 3KG5A 4NSKA 2IPTL 3CSPA 5B4MD 2I07B 4KJWC 2ZOLB 3JTSA 4TUJA 3ULUC 3EGSA 1YEKH 3MRQA 5EOCH 1AHWB 1ZAGA 1UKTA 3P2TA 5BZWB 4FABH 3KPLA 4NN6C 1D9KC 1KPRA 2P5EA 3MBXL 5JXEC 3PL6A 4AM0A 1KLGA 1YPZA 4KVCL 4J23A 2Q3AA 4LRNL 2OMBA 1XGUB 5SV3A 1NKRA 4YBHA 5GJTH 4IJ3C 1H3UA 4M43L 2AJ3B 2VRAA 1G7HA 2IEPA 2QR0B 5EPMA 4R96B 1IGMH 5DYOA 2D7TL 4FQIL 4H88H 4PRHE 3TJEH 2F5AH 1IT9H 3QXAA 1MLCA 5AWNH 4ZFZA 3JVGA 3CC5A 3UTTE 5J57B 1RUPH 5IM7B 5IB4B 3AY4C 4XBPA 5ANME 1RZGB 3LKPB 5F7NC 2Q7NA 2MQ3A 3WS3B 3GMQA 4UNUA 4IRZL 1KB5L 4HV8A 2O5ZH 4HS8L 5TDOA 5ALCH 2YRZA 5E1HB 2DI7A 1UFUA 1I3VA 2XT1B 1BLNB 4F9LA 3BIKA 4F57L 4KK8D 4DUWA 4CBPA 3UAJC 3PL6C 4K8RH 4OF5A 2E7HA 1AY1L 3V8CA 4QHUA 1TZIA 3RPIA 5EBMB 4HQQL 4R7DB 1AH1A 4F58H 4KJWD 3HC4L 1QBMH 4TVPH 1C5DA 2RQ8A 3ULUD 3MUJA 1MHHA 3OL2A 2IFFL 4ZSOE 4AIXA 4XNZB 1PJ9A 1I1YB 3PQYE 3WUZA 3BEVA 1D9KD 3QQ4A 5JXED 3HRZB 3JVGC 3VGHA 5MI0C 4Z95H 1G7JA 4ZS7L 3MJ9A 4MDJA 2EYTB 3IJHB 4LBEB 4ZYKB 5EULV 2WUBH 3VXOB 4G6FB 1OD9A 4OZGF 1ZT4B 2CDEA 5FM5O 4WVRA 4J4PA 1EEUA 3QNZB 2Q86A 3V4VL 4I0KA 1NFKA 3DYMA 4JM2F 4OLYL 4TUOA 1WTGT 5GGTL 4JM4H 2CLVB 4TTGA 4ONHB 4GAFB 5EUOB 1YECH 3SQOH 2VZ1A 1QLRB 5D2NB 2DQDL 4F9LC 4P23B 2V2WA 3MRFA 1DUZA 1JRHI 1OARL 4XPTL 1P9MA 3HA0A 2WBWB 4JKKA 1JGUL 2UYLA 2YD2A 2FJFA 1R3JA 1F6AB 4UUJA 4N8PA 1IJ9A 5MEQA 3EO9H 3UPRA 4HD9A 3DSFH 3SHSA 3S4SB 1KEML 4KRPC 4GH7B 2VIRA 2P5ED 3UAJD 2BFVH 3PL6D 2DDQH 2L4OA 1PKQE 2OJZH 1FYTA 1ONQB 3LD8C 4J6RH 3CVHA 1S7VB 4F7CB 4B7LA 4P5TA 3GI9H 4J4PC 1INQB 1CIUA 2H41A 5IBTH 4BELD 4DW2H 2I07A 2VLMD 3F7VA 5E8EB 1BVZA 3A0OA 2DJUA 4JDVB 2ZOLA 4EDWH 4R8WH 1PBYA 1AHWA 2DQEH 1FLTX 3Q2CA 4FFYH 4XXDB 4IOIB 4XPHH 5C6WH 5K9QG 5GRJH 5TH2B 1P9MC 4LCYB 1TCMA 1B0WA 4TNVK 3MRDB 1XGUA 2VDKH 2MFNA 2R0WL 3MRPA 4FXLA 4GKZA 5EDXA 5T33H 3T2PA 2AJ3A 2KDGA 2XQYK 1FV1B 3C87A 4KI5C 2R15A 3T0XA 2HVJA 1KJ3L 1S3KH 4LSUL 2EC8A 2ZPKL 2A83B 4HCRA 5FV1L 5IM7A 5IB4A 1FHGA 3QJHB 1RZGA 3MYJB 3LKPA 3WS3A 4HWNA 1S8DB 5F9OL 4DN3H 1RQ5A 1AIFB 4KRPD 5A40E 2D7OA 4XNQB 5KVEL 4R3SB 4HKXB 4QHNB 5KBNC 4H20H 4YQXL 2DMKA 2KUTA 1AHWC 1SY6L 1KN4H 2JB5H 1BLNA 4O02L 3ARSA 4WUUE 1LD9B 4J4PD 7CGTA 1HQ4B 5M94B 5FYJE 5EBMA 3VXTB 4R7DA 1NUFA 3TPKA 4CUCA 5IVNA 5E0QA 1A14L 1SYSB 4GXVH 2C3HA 4CAGA 4UINH 1EEYB 3EFFB 2GFBA 3ARWA 2EYTA 3IJHA 4GG6E 3K2MC 4LBEA 2A1WL 4AG4H 4ZYKA 1I3GH 3VXOA 3X3GH 4Z7WE 1ZT4A 3IDGB 1P7QA 5CEZH 3MOAH 3QNZA 5CILL 1J1PH 5DT1H 4KI5D 2CLVA 4ONHA 5EUOA 3BPLB 4XBEL 1FYTD 4BQ6A 1QLRA 1NLDH 3CSBA 3ME0A 5D2LF 5D2NA 4URTB 5DZNA 5HYJE 5HYSG 4N68A 3QCTH 2YUZA 2FEDC 4P23A 2UWEB 4QTIL 2FR4B 1AGBB 3BPCB 5CGTA 2W0FB 4LKXB 4Z0BL 3SE9L 4L1HA 3FTGB 1G6VK 1UZ6E 2JJSA 1OLZA 1OD7A 4JRXB 1XCTA 4UI2A 4ZXBC 1FGVL 2DBJA 1F6AA 3WCYA 3BKCL 3KNBB 1PZUB 4LCWE 4XNZC 3S4SA 5K33A 2AS5M 5I1IH 2GJ6B 4WTZA 1K6QL 2WUCL 1QSVA 2VERN 1ONQA 5EO1B 4ZFOB 1S7VA 4F7CA 2HAZA 1EZVX 1INQA 3MLRL 1MRCL 4PGZA 1OY3B 2AK1H 2BXYA 4X6CE 5E8EA 5EIQA 3ZE0F 4QCIA 4JDVA 5D2NC 1U3YA 3VI3E 2MCG1 1MQ8A 3HZYB 4P23C 5IVXF 5HHPB 4K2UH 4XXDA 1MFEL 3WHE1 4IOIA 1WTLA 4G7VH 5D6CB 5TH2A 1F90L 2JJSC 1OB1B 4LCYA 2Q6WA 5KG9B 2DLFH 3MRDA 1L7IH 3JV4B 3LS5H 1A9EB 1A6VL 5FOJA 2FEDD 4IDJL 3TYGL 4QRRB 1NJ9B 1FV1A 3INUH 2IGFH 3VXUE 1KJ2L 4JDTL 3QPXL 1KXTB 5GGUB 2A83A 3T2OA 3TBTB 1H8OA 3MV8A 1KN2H 4YAQB 4ZXBD 3QJHA 5HGAB 3MYJA 1SJEA 5D7IE 1L7TL 3R1GH 3UC0H 3W2DH 2PTVA 3MMEB 1AIFA 3NZHL 1NGWB 4ZOEA 1KFAL 4PFEA 3CH8A 4XNQA 4R3SA 1B2WL 3MXVH 4QHNA 4YX2L 2CK0L 3K2UL 5HHXL 5EOQL 1A3LH 4X4MA 1R6VA 3BO8B 4LSVH 4G6FD 3MRHB 5FHBH 5FGSA 2F74B 1LD9A 1HQ4A 3DI3B 5I1CH 1H3PH 3VXTA 2DTML 3MLTA 1E0OB 2OCFD 4L9LB 3A67H 3BRDA 1CVRA 3EDJA 4JGMA 2GUOB 5I75B 4PG2A 4NBZB 4P23D 4OV6F 3FB5B 1SYSA 3S36L 3GBLA 3DHMA 2XY2A 3P11L 5GRUH 2FB4H 1EEYA 3EFFA 5H37H 2AEIT 2R39A 2D0FA 1NKOA 2R1XB 2DN7A 4KGLA 3IS0X 5KVGL 3IDGA 2F9BT 3FQNB 1CYGA 2XG5A 4F7TA 1CD0A 3SGDH 1YEKL 3KR3H 3LPGA 5C6TH 1PY4A 2AJZB 5C70A 2UWEA 5IMLB 2FR4A 1AGBA 2Z9TA 3BPCA 3ZO0A 2FD6L 2W0FA 4LKXA 4Q0XH 3FTGA 1BX2B 4LSPH 1MFAH 4JRXA 5MEPB 2JF1A 5GJTL 3QUZB 2IQ9L 2V7HB 3KNBA 3IB4A 4ONFL 4PG2C 1JNNH 1JJUA 4U6XB 2Q7YA 2VLRB 1Y0LB 4AIOA 2YSSB 2F5AL 1F3RB 2WNGA 1IT9L 1OW0A 3U4EA 4P2OB 1JGVL 4MXWL 3M1BB 3JWDH 1J0ZA 2GJ6A 4QRQB 4LPXA 4RGNB 3KJ6H 4HEME 5DJ0B 5EO1A 4HIXH 4ZFOA 4BQBA 2QLVB 1AR1C 5DHVB 2DQFB 4GLRH 3ZTJG 1VACA 1W0VB 2H26B 3BPLC 4CNIB 2ADGB 1YEHH 2D0HA 1BWMA 4FQHB 4UBDC 5I1GL 2WANA 3HZYA 3IKKA 3O81A 5HHPA 3QDMB 4U7KA 4YZFF 4CU6A 5D6CA 3ZYIA 4RFEB 4XP4H 2F54E 3SKOB 5KG9A 3WKMH 2YD5A 5BO1L 1KCSH 2DICA 4S1QL 5GS2D 1HWGB 3JV4A 4XPAH 5I30H 5IFJB 4PJ7F 3O6FB 4D9RE 2VR5A 1A9EA 4KI1A 5F1SA 1TJHL 1OW0C 4QRRA 1NJ9A 2V2TB 5FB8B 3BAEL 1XF1A 1K3ZA 5GGUA 1JL8A 1QFWH 3TBTA 4NQXB 4OSUL 3L3JB 3QDGB 4YAQA 5HGAA 5IFHH 4GQPH 1BFVL 2UUDH 2CO7B 3DV6B 3GSNH 3OPZH 3MMEA 1NGWA 4PTUB 4TNVF 1J12A 3PF2A 1G0YR 2CO6B 2VLJE 4AEEA 3BO8A 4E0RB 1DUYB 3QYCA 3MRHA 4FZ8L 2F74A 3F7YB 5JHDE 4DTGL 1AR1D 3L3OB 3T2NL 4J12A 1CTNA 4QKXB 1AO7E 4YFLI 4L9LA 5GS1B 4ISVB 3G9VA 4G9FE 1P4LB 3BKJH 4OB5L 1KB5B 2GUOA 4UBDD 4GO6B 2J1KA 4NFCA 1PFCA 2BFVL 3FB5A 1T1WB 3RUGF 1BIHA 4Y2OA 4LLDB 1XGQA 4JRXD 4HIIB 3D9AL 1UC6A 1T1YB 2CK2A 3G9AB 3OAYH 4LOUC 4JPWH 4NC1E 2R1XA 3HS0B 4YXHH 4YLQT 3BW9B 3FQNA 4FP8H 4TPRH 3W39B 4Z18A 4QGYA 4FNLH 1N5YL 2GJ6D 5DQDL 2DQEL 4L3EB 4QYOB 5BVPL 5A2FA 5I19L 1NMCB 3CIQA 4FFYL 1QRKA 2AJZA 4XPHL 1N0XH 5GRJL 2V9TA 2ZCKH 1XEDA 1XIWB 3EDKA 3SE8L 1BX2A 5MEPA 4K55A 4L9LC 4XHQA 1CFBA 1OAKL 3QUZA 4HH8A 2V7HA 2W9LA 3LZFH 4U6XA 5DD5H 4JHWL 3ULVL 1Y0LA 3BN3B 2YSSA 4RAVB 3ARVA 3F62A 4AQOA 5EZJA 4P2OA 2UUDK 3NH7H 2E7LA 2Q8BH 1FP5A 1YY9C 5CUSL 4QRQA 5DEZA 1YN7B 1RV6X 3CXHK 5DJ0A 3BSZH 1EHLL 5EOCJ 2VZTA 5DHVA 2DQFA 3N85L 3VG0H 5JHLH 4QRRD 2ORBH 5KVDH 4H20L 4RMUA 1W0VA 4Z8FH 2H26A 4CNIA 5C0DB 2ADGA 3ULVF 4FQHA 4PREB 2AABH 4YHLL 4K9EH 1RIUL 3I6LE 2EH7H 3S4SG 4LOUD 4GRWB 5ALBH 1I8LC 4NUJA 3DX6B 4G42B 3AAZA 4WTZG 4RFEA 1INDH 1BF2A 2ZUQB 2LQRA 3SKOA 4JVPA 2HJFB 1U8KB 5DTFB 2QQNH 4NHCH 4ODVH 1KLUB 1BEYH 1RIHH 5IFJA 1G0XA 2LAGB 4ZO7A 1BQUA 3O6FA 1ZGLM 2ZCLL 4NQCE 3OAYK 4P49A 4P2OC 4UINL 2V2TA 5FB8A 1J0IA 5EO0B 1KJMB 4RGNC 5CMAA 5AZ2H 4NQXA 1MFDH 1VPOL 3BKYH 3L3JA 3QDGA 5CBEB 3MGAA 4OM0H 1A7NL 5BQ7B 5CEZL 5L8JB 4KZEL 3WIIL 3DV6A 4Q6IB 1AE6L 4XNMB 5FXCH 2YA0A 1KXVC 4F80A 4OLZH 1NLDL 2EEDA 3GO1H 4EOWL 1YY9D 4PTUA 5IW1B 3FFDB 4RMWA 3TIDB 4R97C 2EEAA 5C0IB 3FN0L 4E0RA 3EBAA 4OM1L 3RI5F 1DUYA 2LU3A 4JFZH 3F7YA 2XIDA 4OQ1A 2FECI 3L3OA 4AT6B 1F4HA 1GYAA 4YE4H 2QKIB 4G6JH 1IKFH 1E6OH 3P0VH 4ISVA 3VRLE 1P4LA 3O6FC 2FX7L 4OZHF 3CFCL 1GPOL 3UEZA 1KB5A 4X6DF 4XPFH 1T1WA 5I1IL 5DHYB 2BRQA 1TVBB 5EU6B 1WGOA 4LLDA 3CFIC 5ESQB 4JAMA 1QACA 1T1YA 1LDPH 2QADB 4YGVB 3UROR 3P3YA 4XHJC 3HS0A 3AC0A 3MLUL 2VLRD 1MCCA 4J1UB 1H0DB 3BW9A 1V7NH 4P2OD 5AD0B 3W39A 1QQDB 1EERB 3AS0A 2AEPL 4NKIL 1KCKA 1T80A 4L3EA 4QYOA 4RGND 3OX8B 3PHQB 4XPBH 4K3EH 1U8QB 2R56H 5BOPA 4QRSB 43C9A 2BNRE 5DHXB 1XIWA 2HKFH 4OAWB 1TJIL 3GBMH 5HHQB 5GS1C 3L7EB 4KK5C 3A6CH 1Z3GL 3O2WH 1JPTL 3QDMD 1TXKA 2GY7B 4RAVA 1PZ5B 2YZ1A 1CE1H 2R0ZH 1GSMA 2GIYA 5FCUH 4GAGH 1KN2L 2B0SH 5DUBB 1P1ZA 1YN7A 2BNQE 3G6JF 4GKSB 3UTTB 5TFSH 3UC0L 3NVQA 3O6FD 1A0QL 3TA3B 1BOGA 1HHJB 2J3SA 4C56E 2BVOB 3MCG1 3PWPE 2CGRL 5C0DA 1A3LL 1ND0B 4PREA 3HMXH 3QDGD 2ZKHH 4NN7B 3V4PH 2NLJB 2VLKE 3G6DH 4XHJD 4CVZB 1XF2B 3DX6A 1HYRC 3FRUB 3Q5YA 3LKOB 3WUWG 4OFKA 4ZOAA 5IWLA 5A2KH 4L29B 5L7XH 2HJFA 3R0NA 1U8KA 5DTFA 1TTUA 2CMRH 5CGYC 3MXWH 1KLUA 3L3IB 1H8SA 4LASH 1ZOXA 2I26N 4O4YH 2P44B 3QO0A 1JGLH 4V2BA 5FM8A 5GRUL 1S7XB 5EO0A 3K3QA 1KJMA 4QHMB 2VR9A 5BVJB 1DQML 4PIRF 2EECA 4HAFA 4HFUH 5CBEA 1S7TB 3QR2A 5BQ7A 4KK5D 2N56A 3T4AB 3FQRB 4Q6IA 1HOCB 4XNMA 1SMAA 4R4FH 3NA4A 3X14A 3GSWB 2MPAL 3FKUS 5GGSB 1D6VH 3AREB 1AJ7H 1MCWM 4ODTH 5IW1A 3FFDA 6FABH 3TIDA 5JA8B 5C0IA 1CL7H 5DVNA 4Q0XL 3C8HA 3QFJB 2AV1B 5DFWH 1KJ2B 1MFAL 1VGKB 2ZUQC 5DQJA 5IWLC 4XCEB 4AT6A 3ZDZF 2QKIA 4OD3H 1JNNL 5IHUL 4L3ED 1K4DB 4G3YH 1MJUL 5GSRB 3MRGB 4XVSH 1RMFH 5DMIH 5JPMB 3B6SB 4PY8I 5HGDB 1NAMB 5DHYA 1ORSB 1TVBA 3CNKA 3GK8L 5EU6A 3VI4F 1D5BB 1P6AB 5ESQA 4DZBB 1ACZA 3ZHLA 2UY6A 3L3HB 5MHSD 3BT2H 5CGYD 4U6YB 4YGVA 2XXMB 4NM4L 2ITDB 1G9EA 4K94L 4Q9QL 1B3JA 1R5WB 2NY7L 4Q6IC 4XP9L 4J1UA 1H0DA 3GSRA 1MCOH 2F8XC 4H8WL 3HNVL 5AD0A 1QQDA 4KY1L 4HWBH 1L9MA 4PG9B 2RCSL 4KTEL 3OX8A 2N1KA 3PHQA 4JFHD 3SDYH 1U8QA 3MQIA 4TVSa 2H9GB 4QRSA 5EZOH 3KHQA 4XP4L 5E5MB 3ZKXB 2W07A 3WKML 2YD1A 3KJ4B 4XPAL 5HHQA 1BHGA 5IOPB 3L7EA 4CJ1A 1G6RB 4YO0A 1PZ5A 2V17H 3KPPB 2C9AA 3V7AG 4BFGA 1FORH 4LLUB 1TPXB 3GJFB 4D9QD 3IJYB 5DUBA 4BFIB 4GKSA 3WSQH 1GGCL 3KPSE 4NPYB 3LDBB 5F9AC 2NY5L 1I85C 1U2CA 1W72H 2W92A 3QB7C 3UTTA 2VQ1B 4WV1B 1UGNA 3GSNL 4EUPB 4YDKL 3TA3A 1MAML 2R4SL 1HHJA 4M62L 3VXRE 4IMKA 4OZGE 4YC2B 1DN0B 2BVOA 3HKFA 2IANE 1ND0A 1FAKT 1T0MA 5EU4B 4YFLF 1N0LA 2YWZA 4MJ5B 3JV0A 1I4FB 2NLJA 1XF2A 2P5WE 4CVZA 3LQAH 3FRUA 3LKOA 1QPPA 1FGNL 1NUDA 5E2UH 5BS0E 4L29A 1JK8B 3FMGH 4X98B 4M7JL 2EDNA 4F8QA 1JPSL 1EGJH 3KDMB 2EDXA 4Y5XB 1BBJB 1RY7B 5ERWB 2GSGB 4ZFFB 1S7XA 5CLWA 5ID1B 4QHMA 1BZ7B 3T65B 5BVJA 5EC1B 2WIMA 5JW5B 3C6SB 3EJZC 3G5XB 1S7TA 3HFML 3UMTA 1AGFB 3T4AA 4NIKB 1KPVB 3FQRA 3TA3C 4FP8L 1HOCA 4O9HL 3N9GL 2VDOH 4IMKC 4Z7WB 3GSWA 2RR3A 1LO0H 4O2CB 5EU6D 1CBVL 1GAFL 5GGSA 3AREA 4MGXA 1A6WH 2BK8A 4WI7A 3O6KH 2AV1A 1M1SA 1QKZL 1RZIB 4U6VH 4W81A 4KQ3H 1KBGH 1VGKA 2VXVH 4LSSL 2VDML 5SV4A 4XCEA 3ZKNC 4RQQB 1IGYB 4A6YL 3CFDB 1ZVHA 1DDHB 4P4KB 4LLYA 4M8QB 1K4DA 1IZJA 2XKSA 3MACL 3CZFB 5GSRA 3MRGA 1PEZA 2FATH 4XTRC 4B0MM 3L7FA 5JPMA 2PYFB 3B6SA 1AGEB 3WKNA 5HGDA 1NAMA 4F37F 2R4RH 1ORSA 3JWOC 1D5BA 3FHQA 4DZBA 1JZ5A 1DP0A 1TETL 3GRWH 5I15H 1OWWA 5F6IB 3L3HA 3W82A 2OR8A 5DJ6B 4U6YA 2ITDA 5E5RB 2ORBL 5I9QB 5KVDL 1Q9WB 3MA9H 1UA6H 4MHHG 5BV7L 1D5ZB 4PG9A 4R90H 4AZ8A 3R8BB 2QQKL 1DLFH 1J1XH 5C0BD 4BYHA 3BP5A 1T7ZA 3QULB 1T0PB 3EJZD 2ZG1A 3IRZA 1M7XA 2H9GA 3MCKA 3KPNB 3PG2A 1WWWX 3TA3D 5DD3H 2PTUA 2D9CA 1CIDA 4KKLC 4ODVL 2DM2A 5D1ZC 4OFIA 5E95B 3U1SL 3VU2A 2P8MB 3EOTH 5IOPA 2XZCL 3O2DA 1G6RA 2FECL 3SGKC 5IUSA 4KQ4L 3S3JA 2YD3A 3KPPA 2MSPA 2CKBL 4E41B 1TVHB 1H3VA 4LLUA 4OF3A 1CFQB 3GJFA 3IJYA 1FFPB 2E27H 3ZKND 4BFIA 2OL3L 4OM0L 4FS0A 4NPYA 2J4WH 4O2FB 2CXKA 2J8OA 5DDHB 1S7UB 4WV1A 5J9PB 2VITA 3HCVB 4EUPA 4DWHA 3MFFB 5DUPH 1F97A 1FPTL 4XTRD 3BWAB 4NZUH 2KH2B 5D7IB 3VW3H 3MC0A 4FQLL 2QV2A 1DN0A 5C07B 5ICXB 5TE6L 1VFOA 2FIKB 5EU4A 4MJ5A 1I4FA 4JRYB 1NL0H 1PW3A 1URLA 4P9ML 5D2LE 3ZKXC 4MQXC 3KJ4C 1BFTA 2XA3A 4R26H 3HUJB 3BN9C 1F45A 1JK8A 1RZ8B 3LH2H 2DWEB 3BD4A 4X98A 4Z9KB 5CEYB 1FAIL 4DFIA 3BXNB 4UOJA 5F1NB 3KDMA 4X99B 4EQ2A 4Y5XA 1BBJA 5ERWA 1AXTH 2GSGA 3QFJD 1F42A 2ICWI 4ZFFA 4PJ8B 1TPXC 5IIEB 1FRGH 1D6EB 5ID1A 1I1RA 1BZ7A 4KKLD 3IFPB 4X6BB 2Z8VC 3CXHJ 5EC1A 1C12B 4I13B 5D1ZD 5JW5A 2B4CC 5KAQF 4F9PC 4WV1C 3G5XA 3TC9A 1AGFA 2CJUH 1KPVA 1TMCB 4Z78B 1M7DB 4Z7WA 1EHAA 3PDDA 5FDWB 1YMHB 4O2CA 4OLVH 5ESVB 4WWKB 2XA8H 4PYGA 4BZ1H 5HGHB 3QEGL 1RZIA 3MO1B 2PCPB 3HNSH 5HHOE 5IVXE 3VGBA 4HZAA 5EU7C 3R0MA 4KKAC 3MLVL 4RQQA 3ZT5A 4JFYB 1IGYA 1OL0A 2XZAL 3CFDA 1DDHA 1KG0B 1MFBL 4P2CG 4P4KA 4JO1H 5BXFB 4M8QA 5E6IB 3OV6A 3VXNB 3CZFA 4WFED 3GMOB 4Y5XC 5J7CC 1CE1L 4TULL 3RGVB 1IARB 1OQOA 4ZTPL 2PYFA 1EVUA 4OGYH 4L8SC 3MOBL 4HBCL 1YJDL 4P3WA 4MQXD 1ITCA 3RX7A 2YKLH 3BN9D 3VMOA 2X4SB 1L9NA 1JYWA 4WHYH 5DJ6A 4Q9BA 2E7MA 5I8KL 1Q9WA 2NX5E 3GBNL 4ZODA 1S5IL 4YHNB 2VXSL 1IILE 5EBWB 1RJCA 3VD9A 2WMPA 1A6ZB 2DQIL 3LKNB 2J8UB 5TQ2L 2O5XL 5B38B 3QULA 2F19L 2CLRB 3NFPB 1VEPA 5HHME 1CZ8H 5E24E 5CD5C 3C2AH 5FO7B 1QPXA 3KPNA 1RIVH 2P8MA 4P4KC 1UM5H 2EIEA 4GMSH 1I9RL 4TSBL 3RAJH 1N8ZB 3OJVC 3QQNA 4QXTB 1REIA 3MLYH 1K4CB 1NGXB 4E41A 1TVHA 1CFQA 4NJ9H 1FFPA 4KKAD 5F6IC 2EDTA 1F4XH 2YA1A 4O2FA 5DDHA 1S7UA 4LU5H 2Q8AH 5I9QC 1MWAB 1RZKC 3HCVA 4KWUA 4GT7A 3ZE1E 3R8QA 3MFFA 3BWAA 5FHAL 3A6BH 5D7IA 1WIUA 3BIBX 4NT6B 3C5ZC 2RFXA 5L8LB 5ICXA 4JKPL 2FIKA 2OS7A 3ARGB 1WFNA 3WNMA 4QHKI 1RFDH 1B0RB 2IJ0C 4KTDL 4XX1E 1IAII 4JRYA 5JLZA 2VLJB 1SEBB 4O58L 4OD3L 3HUJA 4FQPA 2ADFH 4S1SH 2CR6A 1YNLL 2PUQT 1RZ8A 2DWEA 5B22A 1RMFL 5DMIL 3PP4L 4ZUWB 5CEYA 2Y07H 1AO7B 3BXNA 4IBLT 5F1NA 4X99A 4OFPA 4YNYB 1MHCB 1HNFA 3VRIB 5CD5D 5IIEA 1D6EA 3SKUD 2MQCA 5LGHL 1I1FB 2FL5B 2C7UB 3IFPA 4OUOA 4X6BA 1FZOB 3T04D 1C12A 1CDHA 4P4KD 4NZTH 4Z7VE 5E9DB 2ARJQ 3TJHC 1OCWL 4Z78A 1M7DA 3S7GA 1MI5B 3ROOB 5FDWA 1YMHA 1C1EH 3H2WA 4HT1L 4KTYA 3RY5A 3SDYL 5ESVA 3VFGL 4WWKA 1OAQH 3MNVB 1PVHA 5HVHB 3GSXB 5HI4C 4JFDE 5HGHA 2DQTH 3MO1A 4IOSD 2PCPA 3VH8B 2DQHH 1BP3B 1DVFB 4GQ9H 4ONGH 1RD6A 4JFYA 3C5ZD 3RWFB 5HVWA 1KG0A 1U6AH 2NY1B 5BXFA 3VXNA 3GMOA 5DD1H 5AZEH 3RGVA 4LIQL 1FORL 4APQB 4PJ7E 4PJ8C 5FUOL 1FBIL 4D8PB 1P4IH 5GRYA 4KMTL 2NXZB 3DX9B 3WSQL 2X4SA 4M9OA 3UX9B 5M95B 2AJVL 4QY8B 3H3BC 3TM6A 1IGTB 5C0CB 5EO9B 4YHNA 5EBWA 3QEHB 4E41D 3BZDA 3KYAA 3IU4L 1WAAF 5F96H 4MJ2A 1A6ZA 3LKNA 2J8UA 4WWKC 4JEGB 1PGRB 4UDTB 5B38A 1P2CB 4G43B 2CLRA 3NFPA 1T6WA 1MEXL 5FO7A 3TJHD 4OCSH 5HDQH 5C07D 3NABH 4U0RB 5MENE 5E6IC 1QA9B 5D5MF 7FABL 1FFNB 3RGVC 1N8ZA 4JFXB 4JRYD 2EXYC 1X5YA 5HI4D 4QXTA 4LCIH 1M6OB 4X6FB 4N90E 4F2MB 1K4CA 1NGXA 5CCKL 4NQCB 3TT1H 4UT7H 4JKLA 3ULSA 5KSBF 3RUGE 1A7PL 4M4RA 4DVBB 1B4RA 3QXTA 5C0AE 2B2XH 4QHLB 3SY0A 4QWWC 1MWAA 4ENEC 2VUYA 2I60H 5B3JF 4NT6A 3L5JA 4PJ8D 3OGOE 1JVKA 5E8OB 1T3FB 3RIFK 1A6WL 3ARGA 3O6KL 4M6OH 4NQDB 1NGYB 3QUMH 4DGYH 5ADOL 3VWKB 4OLWH 3SEPA 4KQ3L 2VLJA 1SEBA 1FZJB 4LARL 1XF3B 3PGFH 3TO2B 3GZKA 3ARXA 2FATL 4NQSB 2YUXA 4ZUWA 2BRRH 4WWKD 4EUPG 1AO7A 1WWAX 4PD4K 5I0DA 4YNYA 1MHCA 4KXZI 4DGVH 3VRIA 2RAMA 3TGXA 3RBGA 2GT9B 5DVLA 5I15L 1I1FA 1YMME 1CU4H 4HGWB 1NBYB 2FL5A 5DD0H 2C7UA 3T0EE 1FZOA 4U6TA 4AL8H 4KKNA 5E6ID 5C9KA 4KFZC 5E9DA 1TQBB 3RGVD 1EEZB 5DC0A 1MI5A 3ROOA 5I74B 2EXYD 4UIKH 1MREL 2D7QA 2BHYA 2IH3B 1J1XL 2WWMC 4I4WB 3ARGC 1QLEH 5FF6B 1OAXH 2XRAL 1DBBH 3MNVA 2X1XR 4PB9L 4JQIH 3NIGF 3GSXA 4QWWD 5DD3L 2GYSA 4ENED 1TFHA 4TOYL 1YEIL 3VH8A 3WIHH 5EA0H 4RFOL 1JYNA 2XYCA 3RWFA 1LO2L 2FHBA 3HG1B 2D0GA 2WBJB 5J1AB 1PG7X 1I3RA 2N4IA 4Z7OF 5FK9B 4APQA 1U91B 1Q0YL 4D8PA 3MR9B 3DX9A 2AGJH 4CW1B 3GHEH 4Y89A 5I2IA 5DSCB 2V7NA 1CR9L 2HH0L 3G5ZB 5L2KB 4QY8A 1EVTC 2BNQB 4ALAH 4NRZB 1IGTA 4N0CC 4NC1C 4GRMB 1J0YA 5C0CA 5EO9A 3QEHA 4PGCB 1VFUA 3RTQB 3W9DB 4UDTA 5IT2H 1FH5H 4M7LL 1BFOB 1P2CA 4HULB 5C2BH 1QYGH 3P4OB 4PJFB 4DQOH 1HEZB 1VGEH 3S98A 1CD1B 4LCUB 1DVFC 1MRDH 4LL9A 5DS8B 1OAYH 2VLKB 3RBSA 5E2VL 3RU8L 2JB6B 2NY1C 5IKCB 1QA9A 2WWMD 3ARGD 3DURA 4JZJB 1FFNA 4MDIB 2OI9B 4JFXA 5CEZE 4NO3B 4APQC 4WWID 4RISL 1M6OA 2NXZC 4OZHE 4UQ3B 4X6FA 5AAMA 1C5BL 1Y6MR 4F2MA 4X6DE 4NQCA 2ENYA 4DVBA 3MGTB 4KHTH 4OFVA 4QHLA 3UYOD 2HG5B 2WWKO 3I9GL 1AO7D 2FCBA 5HGBA 3WNKA 2NPLX 2HFFB 3SJVE 4U1LB 1IAIM 2AJUH 5E8OA 1T3FA 4P2QB 4NQDA 4U1SB 1NGYA 3VWKA 2C4FU 2H8PB 3QUXB 4LMQE 4WUKL 5E9DD 4DZ8B 3IDXH 1FZJA 1GC1L 1XF3A 4N0CD 3OJDB 1MI5D 2X4OB 4LSRL 4U0RC 3TO2A 2OK0L 1UQSB 1XGTB 4NQSA 3Q0HA 4CN1A 5MP6H 3SGEH 3OXRB 4WCYL 4H8WC 4Z7NF 2P42B 4U05A 3FOLA 3NACL 3KWWA 2EYRB 2GT9A 4MD4B 3RL1B 1DQLL 1DVFD 2H32B 4JKMA 4HGWA 4PBVC 4HK0B 1T7VA 4ORGB 2VZ3A 2NY1D 4N0YL 2OR9H 4U1NB 1J8HB 1EEZA 2XQBL 2ATKB 4APQD 1BOYA 4ZTOH 4M5YL 2IH3A 2NXZD 4XCNB 3SBWA 1EBPA 4N0UB 1UB6A 2BY0A 4I4WA 1JNLH 3V6BR 1NSNH 3VWKC 4Q9CA 1EO7A 4ZUTB 4G6KL 3EZ8A 5C0RH 1P53A 4LGSB 3I3EA 2F53B 4W70A 4GW1B 4GMTH 5E99H 1RIVL 5C0CD 1N7MH 2NY5C 5J1TC 3I02B 3N0PB 3HG1A 1P7HL 4JPKL 5KVFL 2WBJA 4ZAKB 1LWRA 1SEQL 5J1AA 1DL7L 2A9NL 5IVZB 5FK9A 3NPZB 1U91A 1CF8L 3I6LD 3MR9A 1F4XL 3EYUL 4TNWK 4CW1A 2R0KH 4P3DA 2QEJA 2C3WA 1V3LA 5HDLA 1IEHA 3G5ZA 5L2KA 1T20B 2BNQA 1TQBC 1S9YB 4NRZA 1IC7L 2YR3A 1UVQB 5ITBL 3KGRA 4GRMA 3S9DB 4MA3B 3SBWC 5F72S 5TF1L 4PGCA 3SGJA 5HHVH 3BGFB 3FT4B 3KXFB 1HZHL 1RFDL 3S34L 3D2UB 4K23L 3RTQA 3W9DA 2V5YA 3PWLB 3WL9B 5FKPB 4AENB 1BFOA 2D03H 3B8YA 3QG6B 1EJOH 3P4OA 4JM2B 4PJFA 3L5WB 1HEZA 1C5CL 1CD1A 4WFHD 4LCUA 3OB8A 4KRLB 3T09A 2VLKA 4FTVE 2JB6A 5IKCA 2Y07L 3HC0B 4OD2B 5AYUH 1B90A 2CPCA 2WBJC 3ULUH 4JZJA 4NQDD 4MDIA 3PP3H 4Y4FB 3MRCB 3VWKD 4NO3A 4HMCA 5T5FH 4LVOC 4UQ3A 5E8DH 1IC4H 4Y5YB 4LAQH 4S0SD 4P5KB 5LVEA 4NZTL 3VI4E 1ADQH 3B9DA 1JHKL 1OPGH 1EV2E 3KYNB 5DUMH 1YEDB 3OR6B 5L9DH 2XWBB 3P4NB 1FO0B 3WIFB 5A16A 4HFWA 2HFFA 3SGJC 4FQCL 4U1LA 2QQQA 1NCBH 3RTQC 4P2QA 1ZLSL 4U1SA 5KSAB 2CRZA 5D8JH 2H8PA 3QUXA 1EX0A 2DQTL 3G5YA 3MLZL 5GPRA 1KELH 4DZ8A 4FOMA 1MHPH 4PJAB 1JWMB 3OJDA 2X4OA 1J0KA 1UQSA 2R69L 3D0VB 4JZJC 2OI9C 3D3VE 3H3PL 3OXRA 1P4IL 4PLKC 5IK3B 5FYJH 4CU8A 2EYRA 3QIUB 4LSDA 1OGAE 2H3NB 5FYLL 4MD4A 3RL1A 2HWZL 2H32A 5BRZE 4DK6A 4MVBC 1CXLA 4HK0A 3HG1D 3WLWC 3QCVL 3UP1A 2WBJD 4U1NA 1KYOK 5IMMB 2IBGA 1OTUC 1J8HA 4RMRA 3AM8C 3TZVB 4HS6B 2ATKA 1D5MB 4DK3A 5F96L 1EAPB 3CFJA 1NDGA 4PJBF 2FO4B 2XNAB 3V0WL 1KC5H 4N0UA 2EDHA 1VA9A 1BQHG 4ZUTA 3QUXC 5L2KD 3D85B 1U8NB 4OCSL 5KANI 2F53A 3PP3K 4GW1A 3LIZL 3V5KB 4P59H 3I02A 2EXWC 1IEAB 3HI5H 4U2ZA 1IMHC 2FYYB 2EDYA 3RTQD 1BBDH 4ZAKA 5IVZA 1NMBH 3TT1L 4UT7L 3ESUF 4HF5H 4BUGA 1VEOA 3PIQB 1LEGB 4OQTA 1T20A 2HTKC 1S9YA 4LPVA 2EC9U 3MGOB 1UVQA 3VH8G 4ZDHA 5DFVC 4AIZB 4PLKD 1WFTA 3G04B 2B1AH 4MA3A 3D0LB 4FMKA 3FT4A 3KXFA 4CMHB 3D2UA 1JHLL 2X05A 4MVBD 3WL9A 5FKPA 4AENA 3QG6A 5E2JA 3VWJB 3WLWD 5J56B 2AEQH 4OKVB 5TE4H 4EBQL 1JPGB 4JM2A 2VXUL 3L5WA 5TQ0L 1OTUD 5E08L 4M3KB 3SDXB 2D3VA 2X7LB 3QDJE 5I76B 3BQUB 3DJ9A 4OD2A 4P2QD 3RZCB 3OAUH 2JK5B 4ZAKC 3U0TB 4Y4FA 3MRCA 3IF1B 1NCDH 3QUXD 3DRQB 5IESL 2FX9H 4OZFH 1CU4L 1HH9B 3L3KB 3M17B 4Y5YA 4P5KA 5TE7L 4DVRL 1INEH 2EXWD 1FVDA 3KYNA 1UWGL 3MV11 1I9IL 1YEDA 3OR6A 2VB5A 2XWBA 1OTTC 1FO0A 3P4NA 3WIFA 1ZEAL 3KPTA 4LNRB 3TH4T 2DM7A 1CFVL 35C8L 1OAXL 3FT3B 4K3JH 5DC4B 3CVHH 5KSAA 3V79C 2DKSA 5CINL 3QPQC 2AK4E 5LGJB 1YJDC 2H45A 2HTKD 5EA0L 1J8HD 1OSZB 1RUMH 4PJAA 1JWMA 3B9KB 5DFVD 1DTUA 4YEFA 4X7FC 4PJEF 4ONOA 3U0WH 1CK0L 5HHOB 3WFZA 3D0VA 3WNOA 2PTTB 1XH3A 1ZTXH 3H8NA 4EI5B 4XMPH 5IK3A 3GHEL 3HZMB 3QIUA 2F53D 3FHAA 5IJKA 2CUIA 2H3NA 4Y5YC 1FL6A 5INDB 1C16B 4PBWD 1F6FB 2H2PC 3JUYA 1FNLA 4Y5VB 1G9NL 2HFGL 2IWGA 4ZAKD 5IMMA 1UYWL 3SPVB 3QISA 3TZVA 4HS6A 1D5MA 2Z8SA 2AERT 1EAPA 4P9HC 4EN3B 2FO4A 1YA5A 2XNAA 5IT2L 1KIUA 4YWGL 3SDCB 3QRGL 1FH5L 4HKBB 1WCBB 3MRIB 1QYGL 3WFCH 2KQMA 3D85A 1VGEL 4QTHB 4AEIL 2PYEB 1U8NA 1OAYL 1OLLA 1WWCA 3MV7B 1OTTD 3V5KA 2M8XA 5I8OL 5HHMB 3E1F1 1IEAA 1FZMB 2FYYA 3KXFD 4KROC 3D2UD 1ZA3B 3WEXB 2DMCA 4PD4J 3QIUC 3QPQD 5IJKC 5DRNB 1YDPB 3VFUB 4NCC2 3ZHDA 4U6HB 3PIQA 1LEGA 1MAJA 3P0YH 4GRLB 3FAWA 1MCEA 4KK6C 3TZVC 3MGOA 1Q94B 4AIZA 4ZOCA 3G04A 3T1FB 3D0LA 2DQCH 1EFXB 4CN4A 4Y16A 4PUBL 5B3NA 1NCNA 5D7LE 4FQ2H 1VENA 3IDXL 3V6FB 4U49A 3VWJA 4OKVA 2FGZA 2H2PD 1JPGA 1W0WB 1J7VR 1FLRL 4R0LB 3WXVH 4MAUL 3WJLA 1ITBB 3SDXA 1A6PA 5I76A 2X7LA 3O45B 2ICWB 4WI5A 3BQUA 3QHZL 1UWXH 1Z6JT 3Q1SL 2JK5A 1WZ1H 5D72L 5C9JA 3RZCA 1RU9L 3U0TA 4ZFGL 4KKCC 4LRIA 2BJML 3IF1A 3DRQA 1OQXA 1JPST 3QI9B 3MJGX 1TZGH 3FONB 1YEEL 1HH9A 3L3KA 3M17A 3T8XB 5JMOC 1T03L 5L6YH 4I8DA 3UCRA 3FQWB 4KROD 4R7NB 3EZJB 4KJYB 4CDGC 1QVOB 5D9SB 1F2QA 3FN9A 1BIIB 4Z7VB 4LNRA 1X4YA 3BPOB 3QIUD 4JREB 1NLBL 1IL1B 5T3XH 5EU5A 4CMHC 1UJTA 3OR7B 3FT3A 3O2VL 2D9QB 3VWJC 1SJHB 2HFTA 5LGJA 4GBXC 3PABB 4OIIL 4KHXH 2J12B 5E03A 4KK6D 1OSZA 3TZVD 3WJLC 3B9KA 4JFDB 4YDLB 5I1EH 3R06B 3BQUC 4XAWH 3EW3B 5AG9A 5HHOA 3RZCC 5KTEH 3VJ6B 1UADC 2PTTA 1ULVA 4LRIC 4HS3B 3WD5L 1F11B 1CXFA 4EI5A 4ESKA 2OZ4L 3D85D 4N1EA 3UJIL 4PRPB 2ZUYA 4MD5B 5INDA 1MJ7H 2MTPA 1C16A 3NIDF 3EYFB 4L5FH 4MJIE 4N8CH 2EDRA 4PJDF 4O51B 4Y5VA 3IKCA 4PTTB 2XN9B 4KKCD 4XP6H 4QO1A 2P1YA 5HHVL 4NGHH 2HA1A 5DJ2B 1CLYH 4EN3A 3SDCA 2HN7B 1DCLA 2Z8WC 5KJRL 2IBZX 3QEUB 4XC1L 1LVEA 4HKBA 1KEGH 1EJOL 3MRIA 4KUZL 3RDTB 1MQKH 4V1DD 5CS7A 2LVEA 3VD5A 4JFEE 4QTHA 1UWXK 2PYEA 5E4EB 3CUPB 1T7XA 3QIBC 4PJIB 5GGQL 4PRIE 3ZDXF 4NQTA 1FZMA 3WNLA 1UCBL 5GS2H 5KAQG 4G6MH 1ZA3A 3U9PL 5T5FL 5C0JB 4EI5C 1RUAL 3IRPX 3WEXA 3VWJD 5E8DL 2VXQH 4FXKB 4N9OB 5T3ZH 2B39A 3HRPA 4GBXD 4M6NL 5DRNA 1RHFA 4LAQL 1T4KB 1YDPA 2FBJL 1OAZL 4F15C 3VFUA 3UTZB 1MCWW 2FJHB 4OIAA 4L4TE 4DKFH 4Y1AD 1A3RH 2YD4A 4O2EB 4U6HA 3BQUD 5DUML 3TH2T 4Y5VC 3RZCD 4OZIE 3RUGB 2JJVA 2A77L 4GRLA 4JFFE 1GHFH 3ARDB 1Q94A 1V7ML 4JE4B 3ULUF 1S9KC 3N1PC 3T1FA 4EN3C 3SKNB 1A1NA 3P77B 5ISZE 3SDCC 1EFXA 5C3LD 5D8JL 3H6JA 4OCXH 3FN3A 3UPAA 3UTSD 5CP7B 4ZMAT 3V6FA 4OTXL 5T1DH 5HPMB 1W0WA 4NZJA 3JXAA 1ES0B 3OJ2C 4R0LA 4IRJB 2J6EH 3O45A 2ICWA 3C5JB 1QBLL 4MA8L 2Y06L 1YUHB 2DLEA 3QI9A 4RX4A 1AI1L 3BGMB 3FONA 2YD8A 5F71A 3QIBD 3T8XA 4WHDA 4PJ9C 4KDTA 1MJ8H 5HHOD 3NCEB 4F3FB 3FQWA 4GRLC 1QHOA 4XAKE 4R7NA 4KJYA 3T0EB 4ELMB 5JIKA 4EI5D 1NCTA 1F8TL 1QVOA 3CU1A 5D9SA 3WFDL 1IGCL 4Z7VA 4C83A 3H42H 1JMXA 1IL1A 2P45B 3HI6H 3OR7A 3TBVA 1S7RB 1T89A 1SJHA 1WAAE 3PABA 2PXYB 4X4YB 4LIQE 2DF3A 4R0LC 1FFRA 3FO1B 3V52H 3DRTB 2X1PA 3CMOH 4JFDA 3QIWB 4H1LH 4EN3D 3SDCD 1BBDL 3OKLB 3ILQC 3VJ6A 1X6LA 4HS3A 3WN5A 3TF7C 1F11A 5I18H 3IDJA 1DJSA 2NY6B 3QI9C 3ET9F 2PYED 4OJFL 1FNHA 5D5ME 1TITA 1RJZB 2VDNH 4PRPA 3MV7D 1J86A 1TQCB 4MD5A 4TRPL 5HHMD 5DJXB 5ENWB 4JG0L 2E9IA 3H7BB 4OCRH 1N59A 5KSBE 1RAMA 1DQQA 1Q72H 2XN9A 3H9SD 1PX3A 2YC1A 3GIZH 4JVUA 4M6ML 4PTTA 4X9BA 5CD3B 4HXAH 3BPOC 2A6JB 4JREC 4GAJL 4V2CB 2W91A 5DJ2A 3MJ9L 2BY1A 1T89C 3QEUA 4LCCB 2R9HC 5IGXL 2QSCL 3GDBA 5CJOH 5B3JE 5AUMB 3RDTA 4PJ9D 3U7WH 4KV5F 3TWCH 2XTJB 2XWJB 2ZNXA 1CFNB 1MCLA 3CXDL 4GRLD 2BXZA 3P4LA 5D1QB 5JIPA 2EH8L 1FG2A 3CUPA 4PJIA 4YDLC 1YC7A 5GQBA 3FB6B 3IFLH 1EFXD 1RK0A 5BOZG 3LHPH 1O5DT 4J7RA 4QF1B 5FYKD 5KW9L 5C0JA 3RGHA 3F8UB 1J1OH 3UTOA 3V7MA 5MENA 3ZSSA 4XPGH 2A2QT 3AMLA 4FXKA 1NFDB 3DIFA 1J0HA 1HHHB 5EN2B 1T4KA 4HPYL 2X4NB 5LXGH 3UTZA 2FJHA 4WU5B 1E4WH 4Y4HC 1H5BB 4O2EA 5D96B 1ZANH 5J4MA 4XCFH 5IB1B 2KQNA 3RUGA 3ILQD 2X89A 5C0AA 1KYOJ 5LCVH 3ARDA 2X40A 5DVMA 1T2QH 4D9LH 3QI9D 4JY4B 4RX4D 3P77A 2IMNA 1N3NB 3RDTC 1XGPB 1A6UH 1KNOB 3IDMB 5CP7A 5HPMA 5E4EC 4XNXH 2JJTC 1S7QB 1ES0A 3NIGE 4IRJA 4RNRB 5GRVL 2YA2A 5I17B 5A2IH 1A7QH 4KI5F 1NEUA 2R9HD 3C5JA 1IBGH 3WFBH 3C8DA 5JPNA 3DNKA 1YUHA 3MRRB 5D6DA 3BGMA 3FO0L 4Z7OE 3W11C 4BQ8A 4JFDD 3DX7B 3UJJL 4EI6B 4I77L 3LMJH 5E7FA 4F3FA 3LPFA 3T0EA 4ELMA 3ARDC 1IAKB 3K4ZA 1XR8B 1YEGH 4RRPA 3ZSTA 3DI2B 3MBEC 5ID0A 1IM9B 1X4ZA 4HCRL 4M48H 4PRPD 4PS4L 1GRWA 3TEUA 1FDLL 1ACYH 5CJQH 5CZXC 1S7RA 4N1CA 4Y4HD 1RURH 3EYSH 3SE3A 3IDYB 1RZ7L 2PXYA 4PGEB 5FKAA 2XN9D 4X4YA 4M3JA 4IRJC 3FO1A 3DRTA 1KCUL 3QIWA 1MCIA 1FC2D 3EO1B 3OKLA 1QRNE 2JJWA 3OZ9H 3L5XH 3RDTD 4LPTA 1LE9B 4XH2B 4TVPD 2DIBA 5D6DC 1G9ML 3MRKB 2FDBP 1RJZA 4P2YA 4G8GE 3FCTB 2DLHA 4PP2B 5EWIL 2DS4A 5DJXA 5ENWA 4X6EA 1RJLB 3H7BA 2FIRT 3T0EC 5SX4I 4TSAL 5CD3A 4WNQB 2HLFC 5JDSB 3F58L 3ILPB 5D71L 2BSTB 1CXHA 4FQ2L 2R1WB 3QG7L 3W11D 4I9WD 2BNUB 4LCCA 4N90D 3SE3C 3B2UC 3UO1L 3VMNA 2YD7A 5AUMA 2VTFA 4UV7L 2XWJA 1CFNA 2PXYC 2X89D 3MBXH 5DURB 3WNPA 5D1QA 4KVCH 3ARDD 5INCB 3BE1L 2V5TA 1BJMA 3NCCB 4H0GA 4LRNH 5DVKA 3QIWC 1B0GB 3MBED 3FB6A 4LHUD 2R1YB 1VERA 5IBUB 3HZVB 1LHZA 4QF1A 5CZXD 4FTVB 2FSEA 1S7SB 3PGDA 4ETQB 2NY6C 4FQIH 1NFDA 1RULH 2BHUA 1HHHA 2CQVA 5EN2A 1WLHA 2X4NA 4Z7NE 4IRJD 4WU5A 1AR2A 1H5BA 1AFVH 1HQRB 1K3IA 3DHJA 5IB1A 2NMSA 4IRZH 1KB5H 5EUOF 3RVVC 4HS8H 3RVTC 4JY4A 3GHBH 4G6AC 4LCCC 1XZ0B 1N3NA 1P4BL 3NPSB 1XGPA 4F57H 2XTJC 1KNOA 3IDMA 5D1QC 3T0ED 1AY1H 3VGEA 3WDIA 1CDBA 5FUZL 5I1EL 2VZUA 1S7QA 4RA0C 2DQUL 4RNRA 4L4VE 3HC4H 2HLFD 3O4OC 5I17A 3BISA 1HILB 1RZJC 2WP3O 2IFFH 2F15A 5IFAL 3B2UD 5I1JL 4MHHI 3QHFL 4GKNB 1NANH 2PXYD 1CXIA 3D3VB 3MRRA 3WS6A 2QSVA 3VXPB 4NQEB 1ZHKB 4ZS7H 3HR6A 3TT3H 3DX7A 3QIWD 1H5BC 2EE6A 4EI6A 5D96C 3P9MB 1KB9K 1IAKA 5GS0L 1XR8A 4OLYH 3MLPA 1NFIB 1MPAL 4HEPG 2NY6D 4KU1A 4TQEL 4F7PB 1IM9A 4JLRB 5JOEA 1JNJA 2D4FA 2DQDH 3ZZ1A 1MCPL 5EU3A 3RNKB 1CQKA 1FYHB 1OARH 4XPTH 1BJ1H 4S1DC 4PGEA 5FO8B 3PDOB 2VSDA 3RVVD 5B39G 1JGUH 3RVTD 1MLBB 1ZVSB 1XCQB 5ILTL 3P40A 4G6AD 4MNGE 1T1XB 4OF8A 1HCFX 1IEBB 3O3EB 1KEMH 2HVKB 4L3AA 4XH2A 4BH7B 2XTJD 3MRKA 5D1QD 5FYLD 2KL6A 2C3GA 1A3RL 3FCTA 4PP2A 5D7SL 1RJLA 2A6KB 5C09E 4XCCL 1L0QA 5GGSY 4WNQA 3U7AA 5JDSA 3ILPA 2EIZB 2BSTA 1N6QL 2R1WA 4OBRA 2BNUA 1BD2D 1SHMA 2UZIL 3HE7B 1FNSL 2FZ3B 5GISH 4M7LT 5INCA 2W65B 1B0GA 4YBLC 2R1YA 2R0WH 3O11B 43CAB 3HZVA 4JGUA 2PR4L 1R5VB 3V6OA 3S88L 4YXKL 4FTVA 1SYVB 5I1LB 2XKUA 1S7SA 4ETQA 3ISWA 1FNEB 1VFAA 3ELAT 1MIEL 4LSUH 2ZPKH 4S1DD 2Z31B 1LGVA 5FO9B 1V3MA 5A43C 3VD4A 5DRWA 1FIGL 1HQRA 1EO5A 4HPOL 5F3HA 2VZSA 5F9OH 5L8KB 4Y19E 4X7EC 4NZDA 1OVZA 1JTPA 1RJYB 1F58L 4X5WB 1TCRA 5DC9B 1SY6H 1XZ0A 4LVEA 4ZFOL 1ZXQA 1GH7A 4O02H 4PJBE 2I24N 2AJSL 3V52L 3G08A 3DBXB 1IM9D 4AYFA 2I9TB 1G9NC 5DRXB 3V6OC 3QDAA 4D94A 1HILA 5C71A 3QNXB 4HIHB 5I18L 1QSEE 3BH9B 1A14H 5HDOA 3SDAB 4NWTH 3MSPA 4LHUG 3D3VA 3JUZA 3STBA 3DPBA 3VXPA 4NQEA 1ZHKA 2I27N 4I0CC 4LP5A 2OSLA 2MCPL 4NSKB 3QNYA 3DVGB 1NCWL 1QZ1A 2DL9A 3GIZL 3EKCA 3EYQC 3P9MA 5IVOA 4XP5L 5GGVL 5CILH 2AI0L 1NFIA 1YNTB 3I85A 2O5YL 4IM8A 2HKHL 4F7PA 4JLRA 5FCSH 1R3IL 4TTDC 1NCAL 4XBEH 5CJOL 3TVMB 3NPSC 3U7WL 3VXQB 1LK3L 4JQVA 2UV3A 4QTIH 4JANB 1KLGB 1KJVB 3RNKA 1B6UA 4Z0BH 3SE9H 1EHXA 5J13B 1TENA 2Z8RA 5FO8A 4XNUH 3PDOA 5SWZB 2FBOJ 3GI8L 4U31A 1MLBA 1ZVSA 1XCQA 1FGVH 4HJJL 1T1XA 3BKCH 5DR5H 1E4XH 5C92A 1IEBA 1QP1A 1QSFE 2APVA 3O3EA 1L6XA 2HVKA 1P6FA 1TIUA 4RRPG 4BH7A 4HG4K 3LPWA 5DURD 1GIGL 2NY3B 1NEZG 1K6QH 2WUCH 4S1RL 4XBPB 4I3SH 4EJ1C 4UILH 2A6KA 1CTOA 4MMXC 3MLRH 1T2QL 2BSRB 3B5TA 1ROWA 1MRCH 4ACPA 4M1DL 2EIZA 4X5LA 4M03A 3T08A 4JQVC 2SEBB 5JXAH 2BY2A 3HE7A 1MFEH 4JG1L 4OF0A 4MNQB 4XNXL 5DMGC 2FZ3A 1F90H 3EYQD 2NW2B 2W65A 3AMKA 1U58A 3KPQB 1F3DH 2PW2B 3O11A 4TTDD 3TLRA 43CAA 4LNVA 3GMNB 1R5VA 4QRPD 3NA9L 3FAXA 1A6VH 1SYVA 5I1LA 4IDJH 1JIBA 2FX8L 4G7YL 4PJEE 1RI8A 5C1MB 1AD0A 1FNEA 4NUGL 3JWNC 1KJ2H 5IBLC 4JDTH 3QPXH 4OF7A 1HE7A 2Z31A 4MD0A 4X4ZA 3ARZA 5FO9A 3W0WB 2YPKB 2ILLA 1DQTA 1L7TH 2VDLL 4O00A 1CN4A 1KFAH 3D3VD 4K7PX 3QWRD 1B2WH 1ACYL 1RJYA 4NQED 4HUUB 4X5WA 2CK0H 2VAJA 3EYSL 3K2UH 5HHXH 2VYRE 5EOQH 1HHIB 1X5XA 3NBNA 5SWSB 1R3LB 4IMLB 4FXGB 3DBXA 2DTMH 2Z92B 4L8BB 3UPRB 4WHCA 2I9TA 1QBAA 4U3XA 5DRXA 2EKSB 3VFWB 3QNXA 3QCUL 4HIHA 3BH9A 5H94B 3BZEB 2X1WL 3CFEB 3S36H 3SDAA 4ODBD 4YDJB 1L6ZA 3ARBB 5DMGD 4F7MB 3P11H 4NO2B 4P5TB 4JHAL 1G7IB 1Q9LB 3DVGA 5I1KH 5KVGH 3CH1B 3QBTB 3F7VB 1ZV5A 4ODSL 3TH3T 3GUTB 4MNHA 1LK2B 1YNTA 2CKNA 3BDXA 2AXHA 3IFOB 4WFGE 5IBLD 4UTAL 1CDCA 3TVMA 4CVXB 3VXQA 4OCYL 4PLNC 1Z9MA 4BFBD 5BJTB 4JANA 5T1LB 2B4CH 3D25B 1BVLB 1KJVA 2FD6H 4J3WA 4H5SB 4EUPH 2GHWB 5SWZA 3MV9E 4JFEB 2Q3ZA 3MRPB 4GKZB 1ZT7B 3FQTA 4WHTB 2IQ9H 4QNPE 3QUKB 4ONFH 2HVJB 3SDAC 1RULL 3DYOA 1JGVH 3GM8A 4MXWH 2XKNA 3DETC 1DEEB 4OF6A 3U36B 1AFVL 1CGVA 4I48B 4LPUA 4PJXB 3C6LB 4LSQL 4L4TB 3SKJH 4HWEL 2CXGA 2BSRA 2VZOA 3B5HA 3GHBL 4OZIB 4JFFB 1ZA6B 3TVMC 1QUNA 5I1GH 2GW5A 2NZIA 2M1KA 1FFQA 2SEBA 3QEQB 4PRBA 3CX5K 4UDUB 3D39B 5J13C 4MNQA 2NW2A 2AQ2A 4JFPB 5BO1H 1N6UA 4NN5B 4S1QH 2AXGB 3KPQA 2PW2A 1JRHH 3EO0B 3GMNA 3SO5A 1TJHH 3I3DA 3UYRL 3BAEH 2VWEC 2XFXB 2NY3C 4YIQB 4D3CL 2GFBB 5JORB 3TT3L 1HXMB 3W5MA 4OSUH 3W0WA 4X0KA 1O7SA 1P7QB 3E3QE 2YPKA 3K81A 1KV3A 1BFVH 4UT6L 2BVQB 3NIDE 4NO0B 3SDAD 4YUEL 4PJDE 4R6UA 5IBUG 3DETD 3CFBB 1DBML 4HUUA 3P30H 1HHIA 5SWSA 1OT2A 5FGCB 2ZSWA 4QOKB 1R3LA 4IMLA 4FZ8H 4GSDL 4DTGH 1XCTB 4FXGA 2E7BA 3TPUB 4JZOB 3T2NH 2AQ3A 1L4IA 2Z92A 4L8BA 1A5FL 3TYFB 1BQLL 2VJXA 1NUGA 4N9GB 1DSFL 4OB5H 3TVMD 3V95A 1MCSA 1PY9A 2EKSA 3H9ZA 3VFWA 3BZEA 5H94A 3EAKA 1IQDB 3ZDXE 1W72B 1FL5B 3CFEA 4BK4A 1A1MB 4YDJA 1U95B 2VC2H 3ARBA 4PB0L 4F7MA 3MPCA 5HYIA 5SWZD 1WQVT 4NO2A 3D9AH 3P9LA 5HI5C 1G7IA 5FECB 1Q9LA 1GOGA 4HGMA 3CH1A 2EDLA 3HMXA 1FNFA 1Z2KA 3CLFL 4PJ5E 3GUTA 2DRUA 4QCIB 4YFEA 4PJGE 1LK2A 5IEKB 3IFOA 2NY3D 1N5YH 5DQDH 5BVPH 1NMAL 5I19H 4CVXA 3ULUE 2BVPB 3OKKB 5BJTA 3RFZC 3JV6B 5T1LA 5GISL 3TN0B 3D25A 1BVLA 4JO3H 3SE8H 4H5SA 2Q6WB 5J11B 3V2AR 1KIQB 3VFTB 4JFEA 3DMMB 1OAKH 1ZT7A 4WHTA 4C4KO 4LQ1A 3QUKA 4JHWH 3ULVH 2PW1B 5DVOA 3PWVB 1QNZH 2AW2A 4MNQD 4JHZA 3MV8B 5CUSH 1DEEA 5F9WC 2A6DB 4P5TC 2VSCA 3U36A 2AAVA 2BC4B 1SJEB 4NKQB 4I48A 1IFHH 4PJXA 5EC2A 3C6LA 5JIHA 1EHLH 4L4TA 4ZNEE 1KPUB 1LEIB 3KYKL 3N85H 1KB9J 4R9HA 3Q5TA 4OZIA 4PLJC 4JFFA 1ZA6A 3UTPD 3IU3B 4XB8A 4NO5B 2CH8A 4ERSL 4YHLH 4HUKB 4X9HA 3W0WD 3QEQA 1RIUH 3KS0H 5F6HI 5ISZA 2YPVL 2C4XA 5HI5D 1YN6B 4JB9L 4UDUA 5KZCB 3D39A 1VKXB 2BVEA 1ZHBB 2P5EE 3MLTB 3OSKA 4JFPA 3TP4A 2XPGA 5F7YC 2UVEA 2AJXL 2AXGA 3WO4B 4FN0A 4DOHE 1IGFL 4OLUL 1NBVL 3EO0A 1AXSB 2E9JA 4NWTL 1BPVA 2ZCLH 5SWSD 2N7BA 5LGKA 4I3RL 2XFXA 4YIQA 3UJTL 3RY4A 5JORA 4EZMA 1HXMA 1VPOH 4J2XA 3C6LC 4HWBA 5F7HA 1XT5A 1A7NH 2X9XA 5HYQB 4KZEH 1XGRB 3WIIH 5FUCC 5E94B 2BVQA 1AE6H 4HKJB 4F7TB 4NO0A 5CP3H 2E6QA 2L7UA 5FOBB 4JO4L 1MRFL 4EOWH 2JCCE 3CFBA 4HLJA 3ZL4L 4P5TD 4ETYA 3FN0H 4OM1H 1G9MC 3I50L 5B8CB 4QOKA 4XNUL 3ARFB 4PR5A 4XMLL 1ZLUH 4JZOA 3TPUA 1WAAA 4NN5C 5DR5L 3U2SB 4PLJD 3TYFA 1E4XL 1G7QB 2Q7YB 3RJQB 4N9GA 3FT2B 15C8L 2FX7H 3CFCH 1GPOH 3CD4A 3QAZB 4EDXB 3U4EB 3UZQA 1IQDA 4XC3L 1W72A 1FL5A 3O3AB 1A1MA 1U95A 2KKQA 3HLAB 3M45A 1WFOA 4I3SL 4JFED 4UILL 2AKRB 1LO4L 1U8PB 3SOBL 5HDBF 4RCAA 3IAPA 5FECA 4WEBL 3RWCB 1VACB 3MLUH 1F00I 3CK0L 3I75A 4LP4A 4XI5C 3TO4B 4DGIL 4DKDC 1Q9KB 3RVXC 1BF8A 2AEPH 3JWOL 4NKIH 5IEKA 3KLHC 2NY2B 1BJ1J 5JXAL 2EE2A 3GEWB 1TJGL 2BVPA 1KTDB 5HGGS 1T0NA 3OKKA 4M7KL 3C6LD 3JV6A 3TN0A 1JFQL 1GXEA 3PNWB 1EGJA 3U30B 1TJIH 3MNWB 1KIQA 3VFTA 3RI5K 1AKJA 5DJDA 3DMMA 4UB0L 3VDCA 2JE8A 3X11B 3GKZA 2APXA 1IAMA 3QEQD 1Z3GH 5C86A 3H9HB 3QH3B 2PW1A 2X42A 1JPTH 5JO5B 3CSGA 3PWVA 4ZG1A 2YOCA 3D39D 2Y23A 4KI5E 1KGCE 3NCBB 2AEWA 5KANG 2NXYB 4YHZL 2A6DA 2BC4A 4I2XE 3BP4B 5I16B 1I8MB 3RA7L 1KPUA 1LEIA 1A0QH 2NQCA 1NAML 1WEJL 5K93A 3LQAC 4YK4B 2DKMA 2CGRH 3IU3A 1PG7L 4NO5A 1ZLUK 4D2NA 2IBZY 1J5OL 5A2LH 4J3VA 4BFEA 4OI8A 1P7QD 5JQ6L 3BIAX 1YN6A 4AK1A 1VKXA 5J11C 3NCMA 1ZHBA 2Z0BA 1NGQL 4NO0D 1DFBL 4OGXH 1L0XA 1F4YH 2WP3T 3DGGB 4ZPVB 4XI5D 3DMMC 4QXUL 3RVXD 4MSWB 5DMYA 3KLHD 4RA3A 5B21A 3S5LB 5GS0C 1AXSA 3GRWA 3EFDL 2V9RA 4XP1L 4QOKD 4JR9L 2YMXL 1XGQB 2OR7A 1B9ZA 5IROA 4HG4J 3MTRA 1II4E 2GTZB 1K9TA 1M4KA 1DQMH 5I1KL 1ZS8B 4Y0GA 3O2DL 2AJYL 1G6RL 3UPCA 1HHKB 1SQ2N 1I9EA 5HYQA 1XGRA 1CS6A 4HJ0C 4HKJA 4KH2A 5E94A 5EUKB 3ZDYF 2MPAH 4M93B 5FOBA 1UH4A 2IFGA 1C08B 4JY5L 1A7OL 1T7YA 1I7ZA 2B4CL 5B8CA 1EFQA 1U9KA 2PF6A 3LS4H 3WXWH 1UACL 2OP4H 3B2VL 2GITB 3ARFA 2OXGA 3VXSE 3NCJL 3U2SA 3WO4C 1G7QA 5IHUH 1MFNA 3FT2A 4JGJA 1MJUH 4QGTA 5FA4B 4EDXA 1UENA 5EZJB 3QRFM 1QTYT 4MNGB 4OFYA 2QHRL 4BK5A 5IROC 1ZGLP 2WM0A 3O3AA 5IW3A 3GK8H 1K8IB 5JUEL 1YQVL 3AS3A 3HLAA 3MRJB 3KPOA 3LB6C 1X5ZA 4YJZL 2AKRA 3DMMD 1QHPA 1LO3L 1U8PA 4QXGL 3BRFA 2GCYB 4ODWB 3SKJL 4NM4H 4G8GA 4K94H 4Q9QH 3GSUB 3RWCA 2NY7H 1MIML 5GS0D 3BPNB 4XP9H 4UIMB 4JJHA 4H8WH 3B4NA 3HNVH 3TO4A 5F8QC 1Q9KA 4KY1H 4U1JB 1RUKH 3MV8D 5EUOE 2RCSH 5EG6C 4KTEH 3HMWL 1Q9OB 4NUJB 3ZHKA 5B8CC 4U7SA 1KTDA 1A22B 2WSKA 3AAZB 4MQSB 3ARTA 3ARFC 3PNWA 4XXCA 4HJ0D 4GOSA 3O3BB 3PV7A 3MNWA 1JRHL 1K5NB 2DB8A 4UOW0 3OMZA 5CZVL 3QAZC 1F4WL 3X11A 3QZWB 2V5SA 3H9HA 3HB3C 3QH3A 5JO5A 3AS2A 5KZCD 1NCCL 1JP5A 1ZSDB 2D2OA 5E2TL 5CMAB 5JMRA 2P43B 3RWGB 5T3XE 3F12A 5E2WL 1GGCH 1WK0A 5JW3L 2NY5H 2QTEA 2AXFB 3BP4A 5I16A 3VRJB 4CDHA 4AY0A 4YDKH 8CGTA 1MAMH 2R4SH 4M62H 3TO4C 4PJCB 2P49B 3K8LA 2NY2C 3P30L 1IQWH 1DBJL 4X80H 1EO8L 3L1OL 3QXUA 4Y19B 3LB6D 5FA3B 4Z7UE 5EBGA 4XWOC 1RZKL 1F3DJ 4XXCC 3H0TB 3U30C 1FVCA 5FYKU 1UZ6F 1FGNH 1G7MB 3DGGA 4ZPVA 4NKOB 4BH8A 1I8KB 4MSWA 1OP5H 2CRIA 2W9DL 4M7JH 4N5EC 1BECA 1SM3L 4OD1L 5KSVB 3BHBB 1JPSH 3S5LA 4YR6B 3C8KB 1LP9B 2VC2L 5K9OB 3U4BL 4W6WB 4JAMB 3ARFD 2W0PA 1QSEB 4S11A 2GTZA 2NXYC 4JN1H 1HCVA 2DL2A 1X9QA </