2EO9A

Solution structure of the fifth ig-like domain from human roundabout homo1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
118
structure length
118
Chain Sequence
GSSGSSGPPVIRQGPVNQTVAVDGTFVLSCVATGSPVPTILWRKDGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Roundabout homolog 1
publication title Solution structure of the fifth ig-like domain from human Roundabout homo1
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 9
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2eo9A01
4OKVB 1BZ7B 2AK4A 5I1LA 2FZ3A 5DGRA 1EZVX 3TZVA 1VGEH 2R1WA 3UPAA 2PW2A 3BZEB 4MB3A 2K7QA 5E00A 2VXVL 4GKZA 3HZKA 1NANH 2A9NL 4XB7A 5FXCH 4ZFOL 1BM3L 2MSPA 1JWMA 3O6MH 3DSNA 3U0TB 2WWKO 4YO0A 2A74A 4IRSB 5IFAL 1OAYH 5F7DB 4Z76A 4JN2B 3FHAA 1JGLL 1VADA 2VLRD 3P9LB 2G60L 2R29H 4MD4A 2HMID 1XZ0A 1JZ4A 4WNQB 4KGJA 1R3LB 4DKFL 2FBOJ 1MRFL 3GMNB 5EOTA 3UZQA 4F57H 3AS3A 1IGTB 2ZJSH 3REWA 4B53A 5MEQA 4F37F 3CSYA 2CIKA 4RGNB 3HI5L 1DFBL 4XB8A 5IVNA 4HWEH 4JG1L 4FQQA 4KDWA 4YE4H 1MF2H 4Q9QL 1MIMH 4OFKA 1RV6X 2FX8H 3F7VB 4OLZH 3V5KB 2LU7A 5C7XH 4KJPC 4AIOA 1M6OA 4JPIA 4MWFA 1UCBL 4DVRL 3MZTA 3QEQE 5EBLA 5FHBH 3TYFA 4OCMC 3HUJF 3KPRB 4GQPH 4N90E 4OFDA 3L3GA 4P4RB 4NWTL 5C0BA 5EZOL 5ETUA 3GJFK 3G04B 4GAFB 1A6AA 5ESAB 3C60B 2W9DH 3W11C 1P1ZB 2GJ6D 1F6FB 3X3FL 2NY6B 1NGPL 1Q38A 4QRRD 5MENB 3TNNB 3QEHB 3SDDB 4PUBL 3B8SA 3CFBA 4UDUA 1OTSC 3MV9D 4KRLB 4QHKJ 2J8UA 4NWUL 2W60B 3N1GC 2W9EH 1ZGLP 4IRSC 4J7RA 3K2UH 1IVLA 4I0PA 5DQJB 4HIIA 1MI5E 1CD1A 1YEIL 3JUYA 3CFKA 3ZSTA 1P9MA 2PYFA 5I66B 4PJ5B 1CDHA 2L7JA 3DROB 2ADGA 3SE9H 5I19H 2BNQE 3LSOA 3QUYB 4YDIL 5HSFA 4OFVA 5IFJB 2A83A 1YPZA 5AUMA 1RZJC 1P2CA 43CAA 3L3IA 3TZVD 1RZ7L 3ULUE 2APFA 5DJ2B 1PKQE 4OD1H 4UNUA 4Z7WA 1XR8A 2OL3H 4L3EA 3LHPH 5F9OH 4EN3D 4Q2ZB 1H3UA 4L8CA 3MODL 3MUZ1 2R2CA 2HA1A 4G8IB 3GSRA 4S1DD 1BAFH 2J3SA 4XMLH 1HI6B 4GAJL 1OAUH 4YGVB 4NM8L 1WBYB 1BEYL 4I9WE 3FB6A 3TO2A 4HUXA 3OXSA 3VDAA 1WIOA 5IOPA 3DI3B 4MD5A 1IC4H 5CCKL 5HYQB 4YQXH 4JPVL 3BKJH 5ADPL 3VFMB 3MUGB 5DURD 1IGYB 2XXMB 1ZGLM 2HLAB 3OR7B 3C60C 4U1MA 2R2HB 5D2LA 2NY6C 5A3ID 5CSGA 4EUPH 1TENA 2Q6WA 4ODWA 4HIXH 3OB8A 3PF2A 3V0VA 4PJHE 4CADB 1HHJB 3C8KA 2XKNB 3RHWF 5BJTA 3NCBB 1KGCE 1HOCB 3KYNA 4KKCD 5GISL 4XNZB 1FO0L 4JGUA 3MRMA 1V7NH 1FN4B 4YPGA 1JF5A 2GK0B 4OCNC 5E9DE 1RHHA 3C9NA 5L2KB 4R26L 1HSAB 2AGJH 4L4VB 5T1DL 3HPLA 5IW1B 3T0WA 3T4YA 3QUYC 4NGHL 4ZXBA 5KVMC 2VDRL 4N8VA 2UY7A 4PTUB 2IGFH 3GSVA 3M45A 4CMMB 5JPMA 2OL3A 2HJFB 1RVFL 5L8KB 1MHCB 3GIVB 3BZFA 2HFGH 1FL3A 1T5XA 4D2NA 4D8PA 1OPGH 3QRFM 5IBUB 3QWQB 1DBBL 2Z93A 3DX6A 5D7LD 5J1AA 4Y19A 4CDHA 3C6SA 3SDXF 1A7QL 4FHBD 4I0PD 3ULVH 4KMLB 4X98B 1OF2B 3V6OA 4KXZI 2ED9A 5GRUH 4LLUB 1WZ1H 3O9WD 4PRAA 4YXLL 1I9JL 1IC7H 1NJ9A 1C5CH 3V6BR 1J0IA 2EE6A 4HFUH 3CDYA 4JPWL 1T20B 1YMME 2HTKC 1S7SB 4WWID 4Y7MA 5DVLA 3VG0L 1CLZH 3RJQB 3LQAC 1I85C 2EH7H 2XRAL 4RAUB 5CEZH 1YQVH 2C3GA 4Y5XA 1CYGA 3NIDE 4K8RC 3SGJA 4XNZC 1CG9A 3DXAA 2BY3A 3CFIC 1U0QA 1NUGA 2DWDA 5B39A 2NY5L 4QRPA 1C08A 3Q5OA 1OGAB 4QHLB 3D3VD 2VE6B 4NT6B 1S9XA 2MCPH 2FD6L 4C58B 3ARGB 1U8IA 3HNVH 1A7OL 1AC6A 2YKLL 2GSIB 4XC1H 1KJ2L 3KPQA 3O2VL 4IMKC 4NNXA 1NC2D 1DQQA 2PO6D 1FDLL 5CWSA 4WFGE 3HE7B 5TQ2L 4PGDB 4YDKL 3A67H 2R69L 1A6TB 3C5JA 2X6MA 5IR1B 3IJYA 4V2CB 1WWBX 3EO0A 1LO2L 1S7RA 4WJ5B 1G84A 4WY7H 4WI2A 1T7XA 4G6ML 3QJHB 2DKMA 4P3DA 4N9GA 1PW3A 1RZ8B 1LDPH 1UH4A 3MREA 4L4JA 1A7NH 2M26A 1QLEL 5IEKA 4PJIF 5CIPH 4O4YH 4KROD 1A2YA 1C5DA 4JKPL 1YA5A 3QPXH 5DVMA 3MA9H 1LNUA 2N7BA 4XHJC 4I4WB 3VI3E 3WIHL 4PJDA 1JRHL 5TF1H 4X7DC 5C6TL 4JQIL 1MIEH 1AJ7L 3ZSSA 5FECA 4NHCH 1T1XB 4ONGL 3O6KL 5HHNA 5FO8B 3EYOB 3GJEB 4IMLA 4R90L 1WC7B 3P4OA 3ARGC 5FYLL 2R23A 4WU7A 3FJTA 1NCTA 4HUUA 5JA8B 3SCMC 1HQRA 4UINL 1YYLH 2UZIH 3D0VB 3F7RA 1T89A 2CLZA 5I30H 1GOHA 4NUJB 3HE7C 1YZZA 1GGCL 3IDIA 2YUXA 3BZ4A 3JV6A 3Q1SH 4BELD 1NDGA 1ZT4B 4IRJB 1KB9K 5I1IL 2EYRB 3Q2CA 3STZA 2F54B 4YK4B 4K9EH 4JFHD 2WWMD 4Q0XL 4JFDD 5CIPA 5FOBA 5BV7H 1R0AH 5E8PA 5IMKB 2AV1A 2YEZB 3QIWD 4PP2A 3Q3GB 3GI9L 4G6FB 4PRPB 2VAAB 3W5MA 4HF5L 1RIUL 1VCAA 3HPJB 4LPWA 2D7TL 2XN9E 4AIZB 5I0ZA 5CEXA 3OF6A 3X17A 1R5IA 4F3FB 2M2DA 5EG6C 3UTZA 4LCYB 4GKNA 5LJYH 3QDGE 3RL2B 5D7KE 4BH7A 2BP3A 1DL7L 4JVPA 4CVWA 3D0LB 4QOKD 3QNZB 2Q87A 2O93L 4YAQB 2NZ9D 4L5FL 9CGTA 5KZCB 2J6EH 1AKJB 4PRHE 5I0DA 4L8DB 2H26A 1K4CB 4J23A 1YY9D 3VFRB 5FF6A 2ZOLB 1F90H 1RK1B 2NY1B 2IFFH 2OLDA 2YD8A 3U48A 2AQ3A 3LKNA 3SQOH 1NGYB 4PG9A 4IRJC 2X70A 5GPRA 5I1CL 3BQUA 5E0QA 5D6DA 1VFOA 4YK4C 2N56A 4Z7NF 2EDWA 4PRDB 2ZUQB 4X7CC 1NMCB 3RIFK 43C9B 3S88L 3QQ3A 3UPRA 1NLBL 5TE6L 4KWUA 1KJVA 3EOTL 2VDPL 3AGVA 1CF8L 4Z7QE 5EOQL 4DFHA 1HWGB 5DF0A 3GGWB 4I1NB 4TTDC 4M4RA 3MCKA 1L7IH 2WWKT 3MBED 3IETB 5FUCC 1MREH 1GZPB 5B8CB 1VGKB 2FLRT 4M61B 4FQJH 4P5MA 3TJEH 2VISB 4MA7H 5IWLC 4HK3N 5FA4A 4BM7A 4Q6IA 4WHDA 1PAMA 1WAAF 3QIBA 5H37G 1PG7W 1J8HB 3AFLA 4NO3B 4FMFA 4RZCA 2J6EA 4Z7VF 1ZHNA 2NPLX 3BGMA 4B0MM 3VXSA 1S7TA 2VERN 4P5KB 5CAYB 5IK3A 3FT3B 5C0GB 4PJXF 3N06B 3PWPD 1FYTA 2ATPA 3MYZA 5C1MB 4JB9H 2YPVH 1SM3L 2OYPA 4LIQL 1KIQB 1EBAA 5H8DA 4OAWA 2EYSA 2X89D 3ZL4H 1TTUA 3UTPD 3QO0B 2NY1C 3H8NA 1LWRA 2R1YA 5E4EB 2AERT 3SGKC 4MNHB 5I8OH 2DYPB 3L6FB 4QHNA 4XP6L 1IZJA 1F8TL 1W0WB 3FAWA 1TJHH 4X0KB 5SV4A 3VWJB 2EKJA 2AQ1A 3WUWA 5KG9B 1N4XL 1NAML 2ZG2A 4PGCB 2FGWH 1UADC 2H1PH 2X44D 2ZUQC 4I3SL 5JR1L 5C0CD 1F4YH 3TBVB 3E1F1 4W4OC 1NMCC 5MI0B 4N1EA 3UZVB 4UBDC 4NO0B 2KL6A 3EGSB 5SX4H 5FV1L 3VD5A 3VXRA 1SBSH 1EAPB 1CFTB 5FGBC 3ZTNL 5I75B 4K23H 4JFFB 5TPWH 3B9KD 5D1ZD 3KGRA 4GRLB 1RZJH 3PGDA 4YHNB 2BVUA 5HPMA 5B38A 4V1DA 1B0RB 3BQUD 3U2SA 1BBJB 3K0WA 4TULL 1J0YA 1S8DB 4YHIB 4PJEF 2A73A 2VZVA 1GC1H 3FN0L 2NW2A 3EYFB 4BZYA 2E9BA 4QXWA 5KVGL 4DEPB 4N1CA 4OZHE 3FO2A 1UGNA 2BNRB 2BXZA 1V8HA 2GFBA 2QQNH 5DK3A 1ODAA 3X11B 2FWOA 4LLWA 1JTTA 4MQTB 1UA6L 3SJVA 1G9MC 1VFAA 4RGMB 4EI5A 4J3WA 2EIDA 3C5ZD 5E4EC 5IEHA 3W81A 3PGFH 1J0KA 3VI4F 3T08A 3S37H 4C56E 5D8JL 4JZJA 3MLYL 3QIBD 4XPAL 5KVEH 4EZMA 1JIBA 5JW4N 3VWJC 5T3ZD 4P2RD 4HH9A 3VE0B 5DMGD 3UROR 3VXSD 3TNMB 2VITB 4IRSA 3C5SB 3MCG1 3P40A 5F7DA 4H5SA 1TLKA 1EA9C 1U3ZA 4RCAA 4JN2A 4U1LA 2BX5A 4PJAE 4U6XB 3P9LA 5GS2H 5MI0C 4Y4FA 3AMLA 4KHXH 5GGTL 4HUVB 5D72L 4HUWA 1YEEL 4NIKB 2EXWD 5JDJA 5CLWA 4R2GD 3ZT7A 4I48B 1CE1H 5IB2B 5I75C 4R2GC 1KC5L 4NQCD 3GSNL 3RUGA 4HZLB 4GRLC 1TNNA 2N7AA 3VMNA 3O0RH 1MPAH 3LY6A 4IRZL 2J7LA 1XIWA 2QQKL 2LABA 3RWEA 3QHZL 3U82B 3D39B 5BVPL 4QTIL 3F7VA 3IXTB 1AY1H 4K94L 3V5KA 5JNYA 1CFSB 3GFUA 2DLEA 5H35B 5KVFL 4JRYD 5C2BL 1KB5H 1ZAGA 4DEPC 1AC0A 1QBBA 3G08A 1RUKH 4HXAH 5I16B 3HE6B 3KPRA 3LQMA 5GS0L 4AJ0A 1LEGA 5JW4Q 1C5BH 4CU7A 4L4TA 4Q9RL 4KDVA 3IDGB 5I1AB 2DLFH 5F8RC 3F7YB 3C60A 4PJ9B 1IM3B 4RGMC 1PLGH 3FQRB 2V2WB 4V1DD 3U9PL 3LQAH 3QEHA 2FO4A 1OT2A 2Z92A 2DBLH 1KELL 1ADQL 4UQ2B 1BQHA 3TV3L 5EUKB 2R56H 4JFEB 5H2BB 4P3WA 5DA4A 4H0GA 4K8RH 3PIQA 3RIAF 2ADFL 5DJZA 5CFHA 3EOAB 2DQEH 4RRPG 2ZPKH 2ZWLT 1A47A 2YPLB 3OKLB 1MHHA 3IFOA 4WW2F 2RCSL 5DT1L 5AWNH 4MXWL 5DFVC 3IFPB 4HMEA 1EBPA 4GBXB 4GG6E 3W11D 1NBYA 2UUDK 5L88H 3EO9H 1MNUL 3X14A 1R3IH 3UTTA 3GUTA 5JQHC 2P45B 3TVMA 3CFCL 2IH3A 3FB7A 2LTQB 3BISA 3MOBH 2W0KA 1BIHA 4J1UA 1KB5A 5E6ZA 2VDKL 1KBGH 4G8IA 4IRSD 4N0FA 1HI6A 2GITB 4E41E 4ODHH 4YGVA 5DHVB 4XNQA 4DCQA 3VD4A 3HE6C 4LKCB 4Z0XB 2NY2B 3S35H 3M8OL 1X5LA 2DTMH 1IGYA 2VDML 4UDTB 1ACYL 3MLPA 1B90A 1QSFB 4PJ9C 1I85A 4EI6B 4RGND 3IXAB 2FLBT 5ESQA 1X4YA 4OF5A 4R4FH 3DYMA 2ZCKH 1MJ7L 2Z8WC 2J12B 4K3DL 4CADA 3MRNA 2XZZA 3BRGC 2XKNA 1FFOB 1HOCA 5CUSH 1G6RB 1T80A 4YLQT 1FN4A 5IQ7L 5FKPB 3G5VB 1BREA 3C6LB 3H42H 3KPRD 5JOEA 5T5NG 4IOIA 4L1HA 4P46A 3MJ9L 3LZFH 3OJMB 2XG4A 3SKNB 3MRKB 2PN5A 3LDBC 3C60D 4GBXC 3KAAA 1EEZA 2NY6D 1WCQA 3ZTJH 5MEND 2HFEA 4JZOA 1HHKA 1OSZB 1RK0A 4NNYA 3SDDD 2LTQC 2H41A 1G7IB 4D9QD 3ECBB 4ELMA 3REVB 5DRXB 3CXHJ 4N8CH 5KTEL 3O11B 2NLJB 4YH6A 3FQWB 4M62L 4WIQA 3OHXA 4LRNL 2C4XA 4X6CE 4M03A 4PJ5D 4KV5E 1DBMH 2NY2C 3JUZA 4IOSD 3QUYD 1P4BH 2BC4B 2X5PA 5K9KB 5EUOB 4ZD3H 5L2JB 1U95B 4EVNA 1MRCL 5E08H 4PJFE 1AD9A 3VFNB 1YJDL 2A6IB 2K7PA 2HT4D 2IALB 1XF1A 4OCRH 1OP5K 2CKBB 1CGSL 3HHRB 2VYRE 2BDNH 2ICES 4M6ML 2GCYB 4ZAKB 3PV6A 4KJWC 2BFVL 2XZQL 1FHGA 1WTGT 3UYPA 3MA7A 3WNPA 2V17L 4X7SL 3C6LC 4R7NB 1GYAA 3CIQA 1LO0H 2CSPA 2VE6A 3QUML 1FV1B 5D5ME 4PJHF 2EYTB 3ARGA 3SPVB 1SEBA 1WTLA 2HTKD 5FCUL 1DCLA 1UM4H 2NR6D 1T3FA 2EDQA 2P24B 2BVYA 4JLRB 3SCMA 3T2OA 3E3QE 3MGOB 5HGGS 5SWSB 1R6VA 4IM8A 4Z6AT 1JVKA 4MJIE 5FB8A 3UBXI 4K8RD 3HE7A 5DI8A 4PGDA 1NUNB 1EMTH 3DX7A 4ERSL 4LPXA 1YN7A 2G5RA 5E94B 5L2KD 4M6OH 1O5DT 3BN3B 4IDLA 1V05A 4ETQA 4L4VD 2FL5B 4RWYH 1G1CA 5EBGA 1LD9A 2W65B 2DQFA 5C07A 3FZUC 3J8F7 3S5LG 1MCFA 1T0MB 3V7MA 5I1HH 5GGUA 1FPTH 2Z35A 2A9MH 4KAQL 3PQYE 2ENSA 5ANMB 5FCSH 1FFNB 5DD3L 1FBIL 4GG8B 2IBGA 3BH8B 2BHZA 3OAUL 1X5JA 3WIIH 3JTTA 4JHAH 4PIRF 5T1MB 2FX7L 5E95B 4K3JH 2H2SC 1BGXH 2FIKB 1T1XA 3V9FA 4H20L 4NNPL 5FO8A 2EDYA 4P57A 3EYOA 4J2XA 1NFDB 1WC7A 4IHOB 2V5YA 1KG0B 2RFXB 4OZGE 1KEMH 5IW3A 2DBJA 1HZHH 3TYGH 3GMPB 5L8JB 3UX9B 2L0DA 3G6JF 4XHJD 1DN2A 4GAYB 1QVOB 2E27L 1FGNH 2VL5A 5JHDB 3UJJH 4CNIB 1BOGB 3K80A 4JM4L 4IRJA 3MFFB 3K4ZA 4LQFH 1C7TA 1INEL 1OGAD 5I1GH 1P84K 4K55A 5D7SH 5E2UH 4HDIB 3ARGD 4MJ5B 4G9DB 3ZKQD 1A3QA 2QSTA 2DL9A 5DSCA 1F2XK 3TPKA 2C1OB 4OD2B 3TFKC 4LPTA 1TCMA 3OKYA 5IMKA 3O3AB 3BAEH 5J56B 3Q3GA 4WFHD 4PRPA 4ZTOL 3H9SB 1EO5A 1HILB 4GUPA 3WS3A 4NQTA 3CH1B 5E5RB 3HE7D 5FM8A 2DQUH 4XPGL 4FRWA 3HPJA 1HYSC 4NJ9L 3EDJA 2PR4H 5HHXL 1HKLL 4O5LH 3BD5A 1U3HB 4NP4L 2IH1B 5E6IA 5IWLA 3GRWH 3QWOA 4PY8J 4UTAH 3P0VH 4YX2L 5JMRA 4LVEA 3D0LA 1AD0B 2EE2A 3CFEA 4HQQH 3PDOA 2R39A 3QXUA 4PS4H 2O5XH 4L29A 4B41A 5I1EL 5JXAH 4L8DA 3TT1H 3H9HB 1YEDB 1H5BB 1RZFH 5EBWB 1IMHC 5C0DA 1YY8B 1K4CA 2E6PA 4UT6L 5C71A 5DC9B 3PHSA 3CUPB 3CVIL 3HR6A 3KR3L 2HFFB 3QRGL 2H32A 1FNLA 5J11B 1N6VA 1IGCH 2WUBH 2HFTA 1QYGH 2UWEB 3DURA 3L5XL 3SGKA 1LEIA 3VW3L 3RWIA 2AJ3B 2CIIB 2VLRE 5GJSL 2LAGB 2D31A 4LSVL 3H9ZA 3S97C 4X83A 3LN9A 1JPGB 4PRDA 3VXTA 1A1MA 2RHEA 1WEJL 4W4OA 1Q72L 2PNDA 1KYOJ 3ZYOA 1WQVT 4GQ9L 4PJ7B 3HAEA 4HUKB 1EFQA 3PP3H 4EDWL 1E27B 2IFGA 4OGAC 5JW5A 4HUNB 4KHTH 1MFDH 2AEQH 5FGBA 3MRPA 3LH2L 4FZ8L 1REIA 4FP8H 1GZPA 3RP1A 1WJ3A 1U3HC 2HJLB 5EU5A 3SKOB 5ID0B 4IRJD 1NMBH 4DGYL 4D0DA 2DQTH 5EWIL 3MQIA 1CS6A 1IAIH 2F54D 1NLDH 3MNWA 5CZXC 3P9MB 2QSCH 4ZSOE 2EC9T 3OL2A 4EDXB 2MCG1 3WD5L 1BP3B 4UOW1 3QFDB 5EU7E 4QXTA 1H5BC 2EIZB 4G6FD 4PRPD 2XFXB 4OGXL 4PJBB 1NH6A 3HMWH 4TTDD 1DR9A 2CUIA 3QO0A 4H1LG 5J11C 4X99B 2IG2L 4TNVF 4MNHA 4PJGE 2DYPA 5INCA 3L6FA 4M8QA 1NCCL 3B2UC 3DV6B 3IFLL 3LKQA 4ESKA 1ED3A 4X0KA 3IKCB 2IAMA 2CO7B 3NH7H 4J4PA 4AEFA 3IGAA 4YNYB 5JDSB 4ZODA 2B4CC 4FQ2L 4PREB 3UP1A 1KNOB 5DD1L 5IQ9B 4LDLB 5KZCD 1AKJD 3TBVA 4XRCB 2AK4E 1AGEB 1T22A 4PLKD 2CLVA 4NO0A 4MA8H 4L9LB 4AT6B 4I13B 1KLGB 1EAPA 1SHMA 5J4MA 2NY1D 4JFFA 4ZOBA 4YWGL 1NMAH 1BJMA 2R1XB 5F3BA 1NCAH 3LVEA 3PABB 4XPTL 2APVA 5IB5B 5DD6A 3RDTB 3H7BA 1Q1JH 3FHQA 4WU5B 5DJXA 2NTFB 2J8HA 4YHIA 2QHRL 5DS8B 5AYUH 1LEKA 4DW2L 3EYFA 4U0RB 2BSED 2G9HA 4JO2L 1FG2A 4OLWH 4K7PL 3CLFL 1DBKH 35C8H 5M7QA 3TBTA 4UBDD 1UWXK 3L3HB 1MUJB 5BS0A 1X4XA 1E4KC 5I76B 5E56A 3ZLQC 1R24B 3X11A 2VDLL 2FDBP 4MX7B 3I2CH 5FYJH 1A3RH 2HKHL 3NTCL 4KUCD 3O2DA 3BE1L 1LK2A 3VH8G 1GVIA 1JP5A 1J8HD 5AZ2L 4MJ6A 3FOMA 4XBEL 5C0BE 3VE0A 4UIKH 1OQOA 5DWUL 5J89A 5SX5K 1Q94A 2VN7A 1D6EB 1UEYA 3KLHC 4WTZG 2AJYL 1NGQL 4HUVA 1OW0A 4XNUL 2W0LA 5DUPH 1WBZB 3RVXC 4L9LC 2DQJL 1CXKA 5L6YH 5LXGL 2J8UE 2Z4QB 1ITCA 5L9DL 2XTJB 1ZWIA 3MV7B 2DKSA 4GW4A 1INQB 5IROC 4APQB 3RDTC 5ESVA 2BJML 3IU3B 4RIRA 5CINL 3VWJD 3R1GL 3THML 1RURH 3IAGC 5EIIB 1YECL 4JDZA 1FG9C 1L7TH 1JZ8A 3ARFB 4XT1C 3RPIB 3UC0L 4J3TA 4U0RC 1CFSA 1RUQL 5LAXB 1FYHB 3FRUA 1AI1L 1YPZE 4DOHE 3O4LB 5E1HB 4FNLH 2E7BA 2VWEE 2RB8A 1JGVH 1RZIA 5FUZL 5JW4M 1MCRA 4O02H 2A6JA 1H15B 5DHVH 1MJ8L 3TIEB 4Z7WE 4F8TA 3RWJB 1QZ1A 4JY5L 4L3EE 2D7PA 4ACPA 1I1AA 4KU1A 4S0TD 3IDGA 4L8SB 5E70A 5I1AA 4JFFD 2AV7B 4GRLD 5IB3A 2F5BH 1IKNA 1KOAA 3T0XA 2V2WA 5B3JE 2Y5TB 3B9EA 3TCLA 3HKFA 1NCBH 1CQKA 3LEYH 4G43B 1EHLL 2OZ4L 3GSQB 1K9TA 3NIFE 2DJ4A 2YD1A 4F33B 1OTUC 4ZUTA 3BYTA 3S36H 1G6RH 2X4RA 2J2ZA 2DIAA 2BNRD 1D6VL 5D2LE 4PRIE 1F4AA 1G9NL 3RWGB 3KLAB 4HWZB 2YWYA 4MZ3A 1V5JA 3OKLA 3FTGB 3I02B 3KPMB 3FQTA 2CD0A 2HWZH 2Z8VC 4LGSB 3LRSA 5CP7B 3IFPA 4UB0L 3TO4A 2XTJC 2ICEA 4GBXA 4YHKL 3IAQA 4JQVA 3ZDXF 6FABL 4BFIB 4OIAA 5DJ6B 4APQC 4NKIL 3CPLA 3O45B 2AXGA 1NUDA 3NZHL 1QA9A 4HK0B 3AS1A 4X5LA 1I7UB 1JPFA 4JR9L 5E8OB 3ARFC 2AJZA 3MBXL 5F9WB 4OQTH 2GITA 1NFKA 2V7NA 2VLLB 4NZRH 3T04D 1Q9OA 4XBPB 4IDJH 3DGCR 1U42A 1H3XA 4LKCA 4Z0XA 2V2XB 3FT4B 3NZ8A 3S96B 5DFVD 3WKMH 4PRBB 4G3YL 4L8SC 4Y19E 1E4WL 4I3RL 3QYCA 3V6OE 2XA8L 1Q0YH 2FHBA 4TUJB 4EI6A 1PZ5B 5F3HA 5E2WH 3L3OB 4NM4H 5TFSL 3D39D 5IFHL 1FZMB 1MCCA 4LASL 5C0IA 2CKBH 5KW9L 1G6RA 2DRUA 1ZSDA 2AABL 4FQHB 3R0NA 1SJHB 4TYUA 3G5VA 3F5WB 3HE6D 1VPOL 1UG9A 4QRQB 4PGJA 3EYVB 4OGYH 2CXKA 3KPOA 4RMSA 1I75A 3V4PH 2HKFH 4M1GL 1D7FA 5FYJD 3IB4A 3MRKA 5A2JH 2Y06L 3DV4B 1RJLB 3DXAE 4PJ9D 1S9YB 4K7PY 5ILTH 5T3XH 1K2DA 1OSZA 2AI0H 4HULB 4EBQH 1MHEB 5KJRL 4QRPE 1XGYL 1NCDH 4J8RB 4JFED 3QDJB 4OCLC 4LU5L 4DN3L 3BIAX 4OQTA 4KI1A 4JAMA 1MLBB 2NLJA 3O11A 3Q6GH 5F9WC 4P4KB 3VRIB 4GKSB 4PV9A 1XEDA 1T03L 2IWGA 3VRLF 1NC4B 4DZ8B 1I7ZA 2YPLD 1DBBH 4MMXC 2EDRA 3VGEA 2F74B 3ULVE 3DRTA 1JWUB 4GBXD 5ERWA 5F1IA 3ZT5A 5CJQL 4KXZH 1FRGL 4GS7B 3C2AL 1YN6A 5FA3A 1I8LA 5FGCB 4J3OC 2E9IA 2IALA 3OKDA 2A9NH 4N8VG 5DZOA 5EA0H 1PDKA 2HN7A 1MFEH 2Q3AA 3D48R 2ZUWA 3K74B 2FECL 3E6HA 5IFAH 4RNRB 1AXTL 4F7MB 1JGLH 5EU6B 4Z18A 1DLFH 4I2XA 2G60H 5CEZE 3L5WA 5DTFB 4KJQC 1GRWA 1DQMH 3IS1X 1ZLWH 1VGEL 2NY2D 4JFQB 1ZHBA 2EYTA 3SPVA 3SDAA 1T83C 1IBGH 1QSFD 1UM6L 4PJDE 2CRZA 4NC1E 4D0CA 3ILQC 3IDYB 4Q9QH 1BLNB 3ISWA 4U6YB 2YD2A 5DRWB 3TGXA 5EBMB 2O5ZH 1FIEA 3CK0L 3RWDB 5HGHB 4EUPG 1N59A 4KJWD 1BF2A 3U6RA 4DVRH 1HHHB 2UVEA 3W39A 4KPHH 5HYSA 2ZJSL 4P4KC 3C6LD 1XGTB 3NABH 4LLDB 2FL5A 4NCC2 2H45A 5J6HB 1UH2A 1BMGA 1MF2L 3FB8B 3P3YA 2NW3B 5E8NB 2FX8L 4OLZL 1N8ZA 1I3RB 3GMQB 5B39G 5C7XL 5IMLA 2BVOA 1W0VB 5F7EH 1D3CA 2ESVB 5F6IB 4W4NA 1KPRB 4KI5C 1J1XH 1UJTA 5D71L 1Z9LA 5FHBL 3UJTL 4NWUH 4YR6B 4I18B 1FFNA 3O3DB 5FV2A 5IJKA 3LIZH 1BQSA 3BH8A 1KCRH 1MCOL 4R3SA 2P42B 2W9DL 4GAGH 5J1SC 2H8PB 2FIKA 4PR5B 1KIPA 1L0QA 4YDIH 3BKCH 2IADB 1X5ZA 3FZUD 2DDQH 1OSPL 4IHOA 2FEEI 2V5RA 5DJAB 3I6KA 1TDQA 4AM0B 4CU8A 5DJ8A 2R0ZL 1BIIA 3WN5A 3IDYC 3MSPA 3VXPA 3BWUC 3MODH 4OM0H 4ZAKD 2H9GB 4TUOA 3SE9L 4GAYA 5BQ7B 3WIFB 5I19L 5D5MF 4RBPK 1J10A 1TZHA 1U8LA 4AH2B 2OTUB 3KHOA 2H2SD 4WI3A 4CRPA 5CCKH 3MFFA 3UBXB 1S9KC 5GJTL 3HG1E 4OD1L 1KPVA 1S7QB 2HG5B 2OL3L 1CDGA 4HDIA 4B50A 3OPZH 2K9UA 3LHPL 5CGYC 3W9DB 1MELA 1S7VB 5F9OL 4TNWK 3RVWC 3UYOD 2X4TA 1BAFL 1NFIA 1E0OB 4M7ZB 4XMLL 2C1OA 5SWSD 5F6IC 4P2QB 1OAXL 3S35X 1F2QA 1YC8A 2X9YA 4S0SD 1BF8A 3H9SA 5F88A 1H0DB 2OJEB 2X05A 1FO0H 4QRSA 3ZE2F 3BKJL 4Z7UA 4BK4A 2RQ8A 4R26H 4ZFFA 3OJVC 1Q9LB 3UCRA 3VFTB 4Z95H 1ZT1B 2Q7YA 3DVGB 4U1NA 3VFSB 1AD0A 1U91B 4HIXL 4OJFH 1VSCA 3JWOC 5L7XH 1RVFH 1F4XH 3BEWA 5D93B 3TFKD 1V7NL 1WT5A 4EQ2A 1YEDA 3S4SA 3QDMA 5EBWA 1G7JB 3W0WB 1YY8A 3IS0X 3KXFB 3BH9B 1HYSD 1ZHLB 4OUUB 5IHBA 5IIEA 2ZOKB 4MNGB 4P23B 3VXSE 3QCTH 4NSKA 2AJ3A 1FYTE 3VXMB 4PD4K 1VHPA 3V52L 1IM9A 2HFGL 1JPGA 4NQDB 1S9WB 1OPGL 4JY4B 1A0QL 4MVBC 2VDNH 1A7PL 2ITDA 2MQ0A 5D7IB 1P7KA 5A16A 4M7ZC 3CD4A 3A6OA 4YHZL 3D5OF 4Y16A 3BKYH 4CVZB 1BVKA 5GRUL 3X12B 4E0RA 4Q9CA 1FO0A 3BP7B 1NBZA 3OAZK 1E27A 1IC7L 1MCQA 1C5CL 3L3DA 3VFPB 4CL7A 5FDYA 3SBWC 5JHDD 1ZKAA 1F3JB 2Z31A 5ICZB 4X6DE 1T2JA 4G42B 1T21A 3RKPA 1CLZL 2MJWA 3IVKA 4HKJA 1JV5B 2EDBA 1IAOB 4PY7B 4NZUL 1IQDA 4KZDH 1W2KT 5IT2H 3VXRE 2EE9A 1KJ2H 3O2VH 5D93C 4NRYB 1MCDA 5HHOB 3EJYC 4PYGA 4V1DE 2XFXA 3H9SD 2YD5A 4H88L 1FDLH 4RQQB 3GB7B 2J1KA 2C3WA 4OGAD 5TQ2H 4YDKH 2R69H 2WINA 2B5IB 1LO5A 4AG4H 2MCPL 1RIHL 2P7TA 1XGQA 4P23C 5IHZA 1U3HD 3OKEB 4X99A 1EH9A 4ALAH 3BHBB 3ARYA 3KJ6H 4XC1L 4JDVB 1MVUB 1P6FA 1U8HA 3HS0B 1MCBA 3V6FA 3WE6A 4NO5A 4PREA 5HYJA 5FHAL 2F19L 1S3KL 3A67L 1BVLB 1ORQA 3SJVE 5IF0B 3BDXA 4WY7L 2HVKA 1N3NB 4L9LA 1CGYA 1WF5A 4XCEB 1EO7A 1JRHH 3BO8B 4R8WH 4JQIH 3PABA 1AJ7H 3B2UD 3VGDA 1A7NL 1FLTX 3QUMB 4Y1AB 1IKFL 3WFEL 1RJZA 2NTFA 5FM5M 4RAVA 1OHQA 1HIMH 3PUCA 2VXUL 1KJ2A 1HXMB 5IESH 2FH8A 2VDOH 2D7QA 5EZJB 3MA9L 4IS6A 3RUGE 3WUWG 5EO9B 5CZKA 5TF1L 3SDXB 2YMXH 4MD0B 1SBBA 1MUJA 1MIEL 1AE6H 3VXOB 5I76A 2BERA 4NHCL 1R24A 3MRFB 3NFNB 4M93B 2B5IC 4KUCF 2V7HB 4MX7A 4NJAH 5MERB 1UXSA 1YDPA 2P1YA 3MRQB 1AGBB 5I1IH 4WI4A 3KPRE 5J9PA 3QQNA 1Y6KR 2UZIL 2W38A 3N0PB 1QKZH 4L4TE 1D5XA 1HHGA 5B38G 4JJ5A 1ZGLA 5ABDE 4JZNA 1NUFA 2JK5B 1DVFA 3GI9H 4P2OA 1WCBA 5DFTA 3U36A 1J86A 1WBZA 2VQUA 2VL4A 3RY6C 1ETZA 1W72L 1P53A 4M7KH 4LK4A 4LVOB 3HZYB 3MXVL 3MV7A 2NY3B 2ADIB 1I7TB 3MLTA 4APQA 1QO3A 4NYLB 4LNRB 4TVPH 5C0EA 4WHTB 5BV7L 4DZBB 5ACMA 2Z0BA 3L7EB 5D2NB 5E99H 3DGGA 2YHGA 4FFZH 3KLHD 5IVXA 3GSOA 3UTTE 3GJFB 1VENA 4LCUA 4XX1E 2GTZB 3TIEA 3RVXD 4M93C 4JGMA 2QL1A 2YD9A 3NCMA 5KAQG 1AQDA 5DVKA 5HGAA 3QNYA 5T3ZL 2Z8SA 1CLOH 2DI7A 3RDTD 3O81A 3QNXB 2IBBA 1KPUB 2R15A 2Y5TA 2YSSB 5ID1B 1KJMA 3BN9C 3FO9B 5DJDB 5ICXB 4PJIB 4JPKL 3RFZC 1B4JH 5DJ0B 3DMMB 3S88H 1F90L 3TBYB 5TE6H 1FIGH 2IFFL 5FM5O 1FZOA 2VDPH 1CF8H 5EOQH 2IC2A 5FO7A 4EXPX 3OJDA 4KK9C 4HWZA 5CZVH 1I8MB 2ICWI 2XZCH 3FTGA 1TJIL 3I02A 3RJDA 4KVNH 4D9LL 2BCKB 4LVOC 1WZMA 2NY3C 5KS9A 1LP9B 4LBEB 2XY1A 5DJ6A 4F58L 3DSFL 1ZANH 3C09B 3O45A 3IDUA 1ZMYA 4RDQF 1HNGA 1Y0LA 4U1HB 1I7UA 2F58H 5F1NA 1QLRB 2DM2A 5D2NC 2BSRB 1OTUD 2W07A 1DUYB 32C2B 5KSVB 1L7IL 3UDWC 3IAPA 1LVEA 4JCMA 1BQHG 4G7VL 4XVJL 3HLAB 3BEVB 4FQJL 4JANA 4OF3A 2BNUA 2FR4B 7CGTA 3S96A 1VFBB 2YS4A 4ETYA 4ELME 2XTJD 4CMHB 4D3CH 1QBLL 3MV7D 1T4KB 2IQAB 1DQDL 3QB7C 4APQD 4OSUH 4TUJA 3T0EB 1OY3B 5HGBB 3HZVA 4JB9L 2YPVL 4IIQB 4MQ7B 3MC0A 4F2MB 4I3SH 3ARFD 5JOPE 2IANB 3EO1B 2OBGA 4FQHA 3O4LD 4XX1G 1SJHA 3DMMC 3ZL4L 2XPGA 1BVZA 5I1KH 3FCTB 4K3HA 4P3CH 2FO1A 3MLWH 3F5WA 4YDVA 3WHE0 1J0HA 4QRQA 4G6AC 3HNTL 1OGTA 1TJHL 3KPTA 2VDQH 1PG7X 4OF6A 5FYKH 4FXKB 2FGWL 1C12A 2FCBA 3IF1B 4X8JA 1S9YA 2VLJB 1F4YL 1AQKH 3U0PB 2BRRL 5ISZB 3C09C 1MHEA 4BH8B 3FN0H 2WUCH 2WIIA 5JORB 4YZFE 1T1ZA 1SBSL 1DBAH 5HDLA 4KRMB 1M7XA 3EW3B 4E42B 3SEPA 1AO7B 2VLKA 4P4KA 5TPWL 3JWDC 3O3UN 4WFED 2YD4A 4Y5YA 5CEYB 1T7WA 4LMQI 1RZJL 2HTLC 3T4AB 4PLNC 4WFHE 2QSQA 3CFJB 2DTSA 1CT8A 1KLFA 1Z0NA 4CMHC 1I7RB 2QR0B 2FH6A 4TVPD 3QQ4B 5D8JH 1NBQA 4ONHB 3T0EC 1ZTXH 1NAMA 4YHMH 4WO4B 3H2WA 3MJ7B 2EDOA 5DLMH 5BXFB 5SWZA 4IIQC 2BOBA 4FFWC 1DJSA 1EPFA 3QXTA 5IVZB 25C8H 5CJXA 2NY7H 1SJVA 4RNRA 5C07E 1F45A 4QY8A 5ICYA 3GMLB 4HCRL 4JO3L 4YHPA 1V3KA 5DTFA 4NQVA 2YN3A 5IBUG 3PGFL 1K8IA 2VABB 5KVEL 3AM8A 4LLMB 4RSVA 2OMBA 4XXDB 5DK0B 2P8LA 2UVFA 2DB8A 4E5XA 4ONFH 4NO2A 4IRZH 3VJ6A 3JWOH 4MNQB 1A6PA 2MWCA 2F5AL 3KWWB 5T1KA 1D5BA 4YFEA 4KK8C 3IJHA 4QTIH 4TRPL 5EBMA 5IW6B 3E0GA 3OX8A 5C2BH 4WVRA 3LEVL 2YBRB 3VRJB 5FO9A 3NCYP 1U8MA 3IDMA 1Z9SA 1DQJB 1A4JB 3HR5B 3ZT6A 4X6BB 4KJQD 1D5MB 1CGTA 1XGTA 1GCFA 1MPAL 3KG5A 4LLDA 5HDBF 5HYIA 1G7LA 5J6HA 3HTLX 3GBNH 4Q9RH 1ORSA 5CHNA 2NW3A 5K59F 4HMDA 1LHZA 1K8DA 4G8FA 2PYEB 4W6WB 1IE5A 2A38A 3FFDB 5EORH 3ILQD 4C54A 1KELH 1ADQH 1RUKL 4HXAL 3TV3H 1MHPL 4WO4C 4DK6A 2HLFC 3V0AC 1U6AH 2G75A 3QDJD 3ZTJG 2CXGA 1F02I 1XF5B 1C5BL 1QACA 2XQYG 4FFYL 3MRJB 2JCCF 2ADFH 4P4KD 2E5EA 2G2RB 5I8EB 2Y9RT 3H6JA 2IPUG 3RZWA 1PLGL 5F7FA 5E4IA 1NC4D 2H8PA 4KH2A 1UM5L 3TLRA 5EUOF 3T0VA 4PRPE 4PR5A 3DECA 5D9SA 1KXQE 2NCMA 4NBYB 2DBLL 3FO0L 4OZIE 2R56L 1XGRB 5DJAA 4PGEB 5FUCE 3T3PF 5EO1A 1YEJH 1OAKH 1A21A 2BMKA 4AYFA 1S5IH 4KI5D 4WI9A 2ARJA 1UB6B 2VXQH 4KQ3H 5HI3C 3X13B 3AAZA 2DQEL 3IDNA 2VDKH 2ZPKL 1FFPB 4BJLA 3OGCB 2VXTH 5EU6D 5AWNL 1S7UB 4AH2A 3ROLB 3EBAA 3B5HA 3NGBB 2Q7NA 3EO9L 1N5AB 1JGDA 3U9UB 5GRWA 3UBXA 3GMRA 1JZ2A 4L3CA 3T0DA 1BFOA 2A6KA 5IKCA 1S7QA 5FYKD 2OJZL 2VDMH 4MDJB 2FJFB 3OR6B 1ACYH 2VC2H 5B4MC 5DA0B 1CD9B 1KBGL 1ADQA 4ODHL 1MJ7H 3WEXB 1IILE 3ZE1F 1H0DA 1P7QB 5KANG 1FH5L 3S35L 2DTML 3SBWA 4TOYL 4L3AA 1MLCB 1C16B 2F15A 4EEEA 2GTWB 3FFCB 1K3IA 4ZPTB 4OLXH 1ZT1A 1TCRA 1XGUA 1MJUH 4PRNA 1U91A 2ZCKL 4P59L 3EIFA 5CGYD 1MH5B 4Z7OF 3BXNA 2D03H 3RVWD 5H94A 3EOBA 3I6LD 3WJJC 4U7KA 2ESVD 4MXVE 1DLHA 5IM7A 1CTOA 4PPTA 4OV6F 1GAFH 3W0WA 3H42L 1U58B 3BD4A 4AEEA 4QHUA 2AVGA 5KTEH 1A1NB 1ZHLA 2OP4H 3HUJA 3RWFB 2LU4A 4OUUA 3DJ9A 3LZFL 2ZOKA 4NQEA 3D2UB 4P23A 3T2PA 3DX8B 3NGBC 3OKKB 5F7HA 3W9EB 5JXEC 3PP4H 5KSBF 3WDIA 2DI9A 3VXMA 1NFDF 2CGRH 1TQCB 1YMHA 2R2BA 2IJ0C 2X9WA 4AEIH 1G7HB 4R4NC 5BMFH 2X9XA 2AK1H 3EFFB 1MRCH 4F7TA 4GMTH 1OB1B 2YUVA 1U8PB 4YXKL 1HINL 1E4JA 1PGRB 5JPNA 2WLYA 4YIQB 3RWCB 2IPTL 4HJGA 1DBML 2BFVH 4O51B 1XCQB 4JFZL 4F9LC 4QTHA 4HLZH 3ME0A 5GSRB 1G9NC 4N0UA 1A14L 3I9GL 4WW2B 3DVIA 3QFJA 4RFOH 5ICZA 4G42A 5BO1L 1KTLB 1JV5A 3D25A 3QUMH 3U4AA 3ARBA 4QKXB 4PY7A 5FCUH 3PGCB 4OCRL 3LEXA 4MVBD 1KFAH 2BDNL 1LILA 4U1SB 1DEEB 4JFFE 2IBZY 3ZZ1A 4B7LA 4CKVX 4P2QD 1V3MA 3P73B 3M1BB 4RQQA 3QSKB 1CLCA 1RSFA 3QG6B 1YUHB 1LO0L 1JUFA 4D94A 3MNVB 4ERSH 3HAEG 4C55A 3HNSH 3VG9B 5CD3B 1SYSB 3AXLA 3OKEA 1Y6NR 3BHBA 4P99A 5JIIA 5BS0E 4HC1L 1IEAB 2X4SA 2D0HA 3QEQB 4NN5B 3QWRA 5EU3B 4LPCA 1UC6A 1BVLA 3M17A 3QEUB 1EMTL 1HKFA 4WUUD 3EJYD 1JZ3A 1QQDB 3MRGB 3W0WD 1GJIA 3KXFD 2KDGA 4PJCF 1N3NA 4QGTA 5GRVL 2UWEF 4XCEA 3RA7H 3CC5B 1OM3H 4DGVL 1B9ZA 1WFTA 1HSBB 4P23D 1ONQB 3RU8L 4HV8B 2FX7H 2JKXA 4WW2C 4X6EB 4OZ4A 2DM7A 3QUMA 4LCWA 3VXMD 3WS6C 4HBCH 4XPBH 5I1HL 3JV0A 4LKXB 5IMMB 5TDPB 4NQDD 1FPTL 2WBJA 1N5YH 2A9ML 4JKWA 1YNKL 3IDJA 3S3PA 1MI5B 1JZ5A 3O3BB 1T1YB 4S1DC 5EZJA 1BFTA 2P5EB 3RVVC 1IAIM 1JJUA 4X5WA 4JHAL 3SDXA 3ALPA 4MD0A 4X6DF 4K3JL 1CD8A 3VXOA 1NEUA 5J13B 3MRFA 5I2IA 4ZUVB 1PKQB 5IMOB 3VG9C 2VUYA 3I75B 3D85A 5MERA 4W68A 5DFWH 3L9RB 1INEH 1EO8H 4HHAB 1RUPL 2GUOB 3SDCB 1ULVA 2P8PB 5HHPA 1HZHL 2OS7A 3TYGL 5F6HJ 4NN5C 3VXUA 4FFVC 2P8MB 1Q9KA 1UEMA 2PW1B 3EDFA 1FGNL 3N50A 2JK5A 2LQRA 4PJBF 5HHOD 4PJ8A 2C1PB 4DUXA 1EVUA 1GGUA 4XPGH 3ARXA 3TBWB 4NP4H 3ROOB 3HZYA 4UV4L 4G9FA 4UV7L 4PJHB 3U0WH 5IG7A 4PV8B 4JM2F 3PWJA 2HVJB 5MHSD 3BAEL 3HCVA 1ZS8B 5D2NA 2EKSB 3H3BC 3QWRD 2BOCA 3ZKNC 5I1EH 2DQUL 4S1RH 1SJEB 3JV4A 5DD5H 2PR4L 2MPAL 4MCZB 3S3JA 3KDMA 4QCIB 3O9WC 4J3VA 3GRWL 3JWDH 3I3DA 4UTAL 1A6ZA 5J13C 1T5WA 1MRDL 2QKIB 3ULUC 4BQBA 1MCIA 3L5XH 4HQQL 1CR9H 1I3GL 3FAXA 4ORGA 4Y1AD 4OCXH 3T8XA 5GJSH 4FXGB 3RUGF 4LSVH 5JXAL 3TT1L 4O2CB 4F7EB 5ID1A 1B0GA 3SDCC 2V5MA 1G0XA 2IQ9H 2BVPB 2HH0H 1CXHA 1Q72H 5DJ0A 4GQ9H 1ZLSH 4MDIB 1TETL 1IGCL 1UJ3B 4P9HL 2WUBL 5DYOB 1QYGL 2OXHA 5E5MB 2XQYK 4G80A 3CMGA 5A2LH 3BPCB 1G9ML 1DUZA 1CICB 1YMMB 3HZMB 5J57B 2C26A 1I8MA 5DUBA 4FZ8H 3DUSA 2IPUK 1C7SA 4MHHG 5T1LA 3VFVB 3W2DH 2BY0A 3LV3B 3HN3A 1FQ9C 4GH7B 5CKAA 2DN7A 3BN9D 4U1HA 2OQJB 1DUYA 32C2A 3WD5H 2AEQL 1TVHB 3NVQA 4FP8L 3G5ZA 4QNPE 3G6JB 1UWGH 4OGXH 3HLAA 3BEVA 4KK9D 2FR4A 1NMBL 2DS4A 2G5BA 2DQTL 1CK0L 2GAZB 1IAIL 1VFBA 3HI6H 1CFBA 4HKZA 2IG2H 1T4KA 2NY3D 2BXYA 4WI7A 4PBVC 4XAWH 1XFPA 3IFLH 4K7FB 3ARWA 3T0EA 3PHOB 5HGBA 2CMRL 1FVEA 2B1HH 4XCFH 3WKNA 2A6DB 4JFOB 1NCWH 5DMIL 2FBJH 3PXHA 3AREB 4QRUA 1U8NA 2P5WA 4TSCH 3FO1B 4NRXB 1I1YB 4RFEB 4X4ZA 1UJ3C 3NCJL 1R3HB 1FZKB 4MSWB 4FXLA 3WJLA 4XCNB 4YWGH 1DE4A 5GGVH 3BMVA 4FXKA 4XPTH 1FZJB 4RFNB 2XWJA 5BOZG 2VLJA 3DRQB 1A02N 4I2XE 3U0PA 2ICWB 3AU1A 1F97A 4BH8A 4J3SA 4YBQC 4JO2H 1Z5LA 4MA8L 5DJYB 3CLFH 3DMMD 5KN5B 3ORJA 3TT3H 2ITCA 3QI9A 5T3XE 1N6UA 3RVTC 3DUUB 4NPYB 2XIDA 5CEYA 4G6AD 4CUCA 5EH1A 3CFJA 3CVHL 2PTTB 5C08A 3PWNB 2DQDH 5HDQL 3NTCH 3ZHLA 2QR0A 4CW1A 4JRXA 3QQ4A 4HIEB 4RAHA 2DQIL 4OLWL 1M05A 4KK5C 1DBKL 1MCWM 4HK3J 4UIMB 3QIWC 3MJ7A 3MLXH 3MTRA 2DKUA 1T04A 4GLRH 2X1WL 5IVZA 2X42A 5HVHB 4X7TB 3HB3C 3AREC 3BVNB 4ELMF 3DVNB 1NGQH 5FYJL 1A3RL 5DQ9B 1JTPA 4K07A 2HTLD 3E8UH 3NAAL 2VABA 5L9DH 1HE7A 3O8XB 1DN0B 2DQHH 1WAAA 3BP6B 2NZ9C 4U1GB 4UIKL 4RFNC 2XWBA 2XTLA 3T0ED 3ARSA 4KTDH 4Z7VA 4CN6A 2MQ3A 2VQ1B 3PWPB 5I8CB 2CH8A 4FFWD 2X4UA 4PJXA 4Q97A 2IAND 1IEBB 1PZUB 2R2EA 1AI1H 3VD9A 1I8KA 3OGOE 5L6YL 2PCPB 4XVUC 5FDWB 4LDEB 1X5XA 3MRIA 2FYYA 3O41A 1DQJA 4NC2B 5I73B 3ARUA 1A4KA 1D5MA 2HAZA 3HRZA 3RTQB 3CGTA 1T6VN 2WMPA 4XPFH 4ZMAT 5ENWA 3H9YA 3TN0B 1EFXB 4PRHB 1WUNT 3MZGB 3KPLB 3BIKA 5FEBA 1L7TL 4ZTPH 2ZG3A 3FFDA 2VLJD 1QHPA 5FK9B 3KYOB 5GGSB 1AGCA 5ISZD 1ZLVK 4FNLL 2I07B 5K33A 1EHLH 2OZ4H 4KK8D 3NIGE 4WDIA 4PFEA 1JGVL 2J5LB 4NOFA 1VACB 4YXHH 4O02L 3AS2A 4HKXA 3BW9B 3ZKMC 2Z9TA 1B88A 2YA1A 5HVHC 2EO1A 2OR7A 3FRPA 1AO7D 3BGFB 4U2YA 3DO7B 2G2RA 5I8EA 1KENL 1FL6B 2Z91B 1G9NH 4FQLH 2F5BL 1W72B 4HFWA 1X6NA 3H9SE 1IAKA 2CQVA 2WP3O 3O8XC 4LSQL 3T0AA 5HYSG 3FQXB 3I84A 4YHKH 5DEFB 4KI5F 4Z7UE 4XP4H 4U1GC 6FABH 3WJJA 4PJEA 2OR9H 5HBBA 4NKIH 2GIYA 4HAGA 5GGRA 3V79C 3S36L 4KQ4H 3NZHH 4WO4D 1A1OB 1QRNA 5MEOA 3X13A 1SYVB 3TJHC 4XNXH 1N6QL 5EZLB 5EO0A 2CRMA 4ODVL 3K1DA 4OLUH 2HWZL 4IOFC 1II4E 1S7UA 3VFOA 4MJ2A 5EOCL 4AIXA 5I73C 4HWBH 4UUJA 3G6DH 3PP3K 3RTQC 1S5HB 3NN8B 3QDME 2AJSH 4F7PB 1H3PH 3VXQA 4R7DA 1MWAB 4G3YH 3TN0C 2FJFA 3OR6A 2CRYA 3GSXB 5DRNB 2XA8H 5KSAB 5CS7A 3UO1L 1VEMA 4MNQD 2OZ4A 5JOFB 4OQTL 4NZRL 4S1QH 5I6XB 5IFHH 3QULA 3K1KC 2J5LC 4I0CC 3MR9B 1P7QA 1JNHA 1HH6A 2CUHA 1FFRA 2CDEB 1QR1A 4F9LA 4H8WC 4KUZH 2CRIA 2N4IA 3MV8B 2GJJA 4HXBH 3BGFC 5TDNA 1VPOH 3OKOB 1C16A 1MJJB 1OLLA 2ORBH 4WEUD 5CP3A 2GTWA 2Q86A 4OFYD 2OX5A 3MRBB 4M1GH 3BPLC 4A2LA 1I8IB 3V5HB 4MA3B 4NM4L 3WO4B 2D4DA 2ID5A 5ITBH 2Y06H 2KKQA 4NKDB 5B4MD 5DRZA 2PYED 4M7JL 4FQIH 4WI6A 2ATKB 2CKBL 5IUSA 4BKLA 4NBZB 1QEWB 4Z77B 4UMGA 1WBXB 1XGYH 1M7DA 3QUZB 4OGYL 4DN3H 5ALBL 3WHXA 3V4PL 3ZYIA 2HKFL 3RWFA 1GIGH 4XCCL 2JJSA 3D2UA 3JV5A 4OZIF 2GJ6A 3OKKA 4S2SA 4LEOA 4QRRA 2A0LC 3CU7A 4QYOA 4WTZA 1J5OH 1U8JA 1F58L 4EBQL 1NEZB 1TITA 2ED7A 4CN1A 1NCDL 5DMKA 5CJQH 1HQ4A 2GSGA 5KSAC 3C2AH 1KYOK 1T66C 4LOUC 3ET9F 5I6XC 1P5VA 1KJ3H 5JW3H 4YIQA 3RWCA 1O7SA 2E9WA 1MCKA 3S4SG 5HYJE 4C56B 3RGVB 5IHUH 3BWAB 4WW2A 1IGIL 5JXED 5JA9A 1IQWH 4GW1A 4TPRH 1KTLA 3WS6A 4OV5A 3B9VA 1GGYA 3SGEI 4LLYB 3KYMB 4R4ND 1ZV5A 3WO4C 1EEUA 3GSWB 1AP2A 5D4QA 2XZAL 4EN3A 5EA0L 1CXIA 4PJAB 1MFEL 1UM6H 3K81A 1RMFH 4U1SA 1DEEA 12E8L 1BZ9A 3U46B 5DEGA 2YC1A 4HIJB 1DLFL 5LBSH 3CK0H 3P73A 1E4XI 3MUY1 3QUZC 1DQML 1P7QD 2VLMD 2AKRB 3P77A 4WV1B 2DWEB 2PXYB 1IBGL 5KVDH 2D7OA 1R3KB 3FFCD 3DTXB 1EAJA 1HHIA 4ZQKA 4ISVB 3VXNB 4PG2C 2MHAA 1SVCP 1IEAA 2O5ZL 4KKBC 5EU3A 1L6XA 3GSUB 3M07A 4X80L 1O7VA 2PTVA 1BD2D 2QQLH 3P4MA 3TPUA 5D71H 1JFQH 3QZWB 4KPHL 2CDGB 2DQGH 3UJTH 1D5ZB 3FONB 2JJUA 1KULA 4FQCL 3NABL 2H2PC 3RWHB 1MCPH 2I9TB 1HSBA 3D2UD 1MCOH 1ONQA 3DUHA 2B0SL 4DVBA 4DKEH 4HV8A 3RGVC 1TJGL 5TH2A 4RMRA 1U8OA 5F7EL 1IGJB 4JHWH 1J1XL 2J4WL 1JCKA 4M6NH 3MROA 5D7IF 1OSPH 1TVDA 2BSTB 1JTOA 1IC1A 5D7LA 1T1YA 3WFBL 3LIZL 1AFVL 2F8XC 2OK0L 2P5EA 3MV7E 2R0ZH 2YWZA 1KCRL 1WITA 4PGZA 4AMKH 3O9WA 4HPYH 4QHKI 4UQ3B 3ALWA 5FYLE 4GAGL 1Y18A 1IGFH 3ES6A 4HKBB 3WSQH 4Z9KB 4QF1B 3BKCL 4TVSa 1F3DJ 2DDQL 3PJSA 2ZZUT 4WV1C 3I75A 5I8KL 1CN4A 3D9AL 2PXYC 2WBKA 3GM8A 5F93C 4BSWB 5E8EA 3RKDC 1GL4B 5IVXE 4RGNC 3MGTB 5GJTH 5F7UA 2Q8AL 4Y4KB 5F7KC 4X7FC 8FABB 4N0CD 3L7FB 3WNLA 5J6GA 3ARVA 3HC0B 3BD3A 4OM0L 5L0QB 5BZDA 3RVVD 1OAXH 1PSKL 3JTSB 5I17A 5CSZB 4ZUWB 2ZNWA 3D3VA 1FP5A 3NA4A 4JG0H 4XGZA 2UUDH 3G5XA 4LCCB 4U1KA 1WIPA 3OPZL 1FORH 3V8CA 2QSVA 2B4CL 3LPWA 4XP1H 1QFWI 3T1WA 2Q76B 2Y36L 4PGBB 4I5BB 4PV8A 3BJLA 3IJSB 2HVJA 4FS0A 3SDDC 1NC2A 4LSPH 3QEQD 1IGMH 2EKSA 2PO6A 5HI5C 4Q74A 4FFVD 3B3IB 4N90D 4X9GA 2EEBA 2Y7QB 5KS9E 4LGRB 1B0WA 2X4NB 4Y4HB 1GOGA 2B20A 2BK8A 4HUMB 2C4FT 2UZXB 3OKMB 3FB5B 3VGHA 4Z95L 4D0BA 4OGZA 4OJFL 1LK3L 3Q5YA 3S5LB 2ED8A 2P44B 4NDMB 2ZKHL 4KTEH 5L7XL 4FXGA 1F4XL 3V52H 4OF0A 4O2CA 3B43A 1XGPB 1IT9L 2YPKA 4WW1B 4TSBH 4Y4KC 2HT4C 3L95A 2EH8H 1A0QH 3ZKND 5HHME 1UH3A 1A7PH 1MI5D 1VFUA 1HDMB 3LKSA 4X6CB 4KGLA 4R0LB 5F9DC 2P5ED 2DIBA 1F3DH 3H0TA 4YHZH 4MDIA 1UJ3A 5DYOA 3QCTL 2BNQD 4OF8A 5IBLC 4ENEC 3BPCA 3CDGB 3N9GL 3K4AA 5GS3A 3ULUD 1L0XA 3H3KA 4LCCC 1EHAA 3KPPB 5BZWB 2CDFB 3LKOB 4ODUB 3LV3A 3Q6FA 4EUPA 2NR6C 5JLZB 2VDNL 1PYWB 4M3KB 1PVHA 3MRRA 3BP5B 3SDCD 1VERA 4NZUH 3T1FB 1CGUA 3BKYL 3WLBA 2IMMA 5JO5A 4FQXB 3LRGA 1PEWA 3RNKB 2OQJA 2QLVB 4ZNCD 3KNBB 4WRLA 2ZCLL 3G6JA 1GOFA 4HMCA 2R8SH 4H88H 5D5MB 4O2FB 4Y4HC 4H25B 1MCEA 3O3EB 2GAZA 3L1OL 1RIHH 5E8DL 4J3XA 2EDDA 4KZDL 5IT2L 3DX9B 1TVBB 1F42A 4LGPB 4C57C 1FNEA 4JFDA 4NQSB 4HSQA 4FTVE 4LP5A 4MJIB 1QFUL 2VLKE 1CGXA 4LIQE 5EC2B 1TZIA 1KGCD 3WLWC 3S9DB 3QIWA 4BYHA 3ESUF 3TA3B 1JHLL 3L3KB 4F9PC 5FHAH 2F19H 1S3KH 2Y25A 1ZA6B 5FKAA 4R0LC 4AG4L 3KPNB 2P4AB 2X4OB 1UZ8B 4O9HL 3SQBA 2FSEA 2Q1EA 4OTXH 4ALAL 2H6PA 3QA3A 4MSWA 3KJ6L 1XAUA 4QOKA 5SWZE 4XCNA 2DMBA 2VR4A 5LKNA 3V5DB 4LRIA 2XG5A 1FL5B 5JIPA 2D0FA 1FZJA 3RI5K 1IKFH 1OQXA 3WFEH 3PQYB 3ULSA 1QOKA 4LVHB 5IVOA 2D7NA 2VXUH 2WP3T 4N1HB 5F97E 4FQXC 4GXVL 4X4MA 5F9JA 1JF1A 2LVEA 1QD0A 4ODSH 3DUUA 4R8WL 1ZE3C 4X6FA 3S8WA 1CICD 1YMMD 1CE6B 3EJJX 1UZ6E 2DD8H 2PTUA 3GK8L 1LP9F 3QHFH 1KSRA 2XWTB 1HIML 5I1DA 5IESL 5F89B 5INDB 1JGEB 4K2UH 2W0PA 2VDOL 4X7EC 3FT2B 4A6YB 3VFWA 4LARH 3UAJC 3EYUL 4UIMA 2F8VA 2YMXL 4YBQD 3TA3C 3NFPA 1KXTB 2NQCA 3WMSA 1AE6L 1FNGA 1XH3B 4HJJH 4NQXA 5JUEH 4LCIH 5E2TH 4X7TA 2J88L 3MBEA 3P0GB 3RVTD 3ABZA 2MMXA 4H8WH 1JYVA 2A1WL 4NJAL 5D6CB 4MMZC 2AJUH 3MV01 1ZXQA 1W72H 2JJTC 2W9LA 1A9BB 4HGWB 3O8XA 3B2VL 1DN0A 2JB6A 4U6HA 4POZC 1GH7A 2MKLC 3MXVH 3BP6A 1XR9B 2E7HA 3MMEA 1QKZL 1NDMB 4HG4K 1P6AB 1QPXA 1CFNB 4UU9B 4KK5D 4WFGD 3PWPA 1X5HA 2I9LB 4OI9A 1WIUA 4LVHC 3NMEA 1H3VA 5DZNA 3UTSB 1RUML 5IV2B 4XCYA 3HB3D 2X89A 1JPST 1TFHA 3ARED 4Y5VB 4M7KL 4HW6A 4XP9H 3O6LH 3RTQA 3TBSA 3MRHB 3MRCB 4MB5A 4TVPL 1KF9B 4B5EA 1UACH 3TN0A 1EFXA 4OD3H 3F6LA 1QRKA 2FJHB 3KPLA 5T3ZH 4S11A 5E99L 2HRPL 5C0CA 1MFBH 1KACB 2XNAB 4FFZL 2EZ0C 5GGSA 1S7XB 2OTPA 5EZIL 3MLRH 4PYHA 3OXRB 1Q9WB 4XH2B 4LVNB 4JPKH 4BFEA 3BW9A 1K5NB 1WZLA 5HHQA 4XVUD 3L3JB 3OKNA 4QRTA 3DO7A 3B9KA 5D1ZA 3GHEH 1D9KB 1I1FB 1FL6A 1AGDA 1W72A 1CLOL 4KFZC 1JYXA 4HEME 1TJIH 3QPQC 4D9LH 4OKDA 1ZA3B 3PWLA 4HS6A 5DEFA 1YNTB 2W92A 1OL0A 1B4JL 1J0JA 4F58H 3DSFH 4AQOA 2VB5A 5F8QC 2XXCB 4KC3B 5SX4I 4OM1H 1FIGL 5MP6H 4ZUSB 3FOLA 1UVQB 3QH3B 4Y0GA 3ZKMD 5CZVL 1RULH 2XZCL 1WGOA 4KVNL 4Y5VC 2DAVA 1DSFH 2VNCA 4G7VH 4XVJH 1CTNA 3PNWB 2X1PA 3C5ZA 3MLSL 2LAAA 3VH8B 2FIRT 3NN8A 3BIBX 2EECA 1ZANL 3I3BA 3W0WE 4XPHL 1FE8H 3O8XD 4ZSOB 4P2RA 3CCHB 1QBLH 3HUJE 2F58L 3JXAA 1DQDH 4NQEE 2APTA 3V6ZB 3QXDB 4DJMA 4YFLF 3MO1B 4PLKC 5C0JA 3JVGA 5K9QI 3VXME 3TJHD 1PX4A 1OAQH 1GSMA 4LVNC 1WWWX 1X7QB 1V3JA 2FEDC 4JRWA 5C0FB 2CKNA 5E6YA 4IOFD 3CH8A 3MV8A 3OKOA 3RL1B 4NQCA 4D3CL 1MJJA 1D9KC 3EDDA 3RTQD 1VKXB 4U1JB 4OSUL 3HNTH 4R96A 4RA0C 4MA3A 4TTGA 4X9IA 5ECJE 3STLA 3TN0D 2AK4B 1EFXD 4PRHD 5GHWH 1BX2A 4U6TA 4YBHA 2P48B 2R1WB 4JRYA 1MEXL 3UBXG 4N0UE 2BRRH 5E00B 3MXWH 5T33H 4GKZB 3HZKB 3QFJE 5I1KL 4P3CL 3MLWL 4W81A 1NL0H 3SE8L 3BKMH 1ZLUH 4Z76B 1FNFA 2VDQL 4HIHB 5B8CC 4MD4B 5FYKL 1XZ0B 4RX4D 3ZDYF 1AQKL 3MCLL 4PG2A 1NEZA 3REWB 5MEQB 3CSYB 4MQXC 5D96B 2CIKB 2WUCL 2E8YA 3QDAA 3QEGL 1F6AA 4JN1H 1DBAL 1WFOA 2YRZA 3H7LA 3P4NA 1CDYA 4OLYL 3DIFA 3T2NH 4JPIB 4MWFB 2X10A 5MHSE 3DARA 4P9HC 1TZGH 3L5HA 5EBLB 4HCRH 4OKVA 1A7BA 4JO3H 3TYFB 1BZ7A 3RGVA 3BESR 1K3ZA 3L3GB 3MRLB 4NUGH 3T3MF 5AYQA 2A0LD 4WGWB 5C0BB 3BZEA 2X09A 1ZTXL 4YHML 4LLYA 2ICCA 4ZS6C 4FABH 3GSWA 4ZO6A 5DLML 3U0TA 5KSAD 4WCYH 25C8L 4DQOH 2NY7L 1UWXH 3PDGA 3WFCH 1T66D 2F5AH 4LOUD 4EXKA 3CFBB 4HIJA 4TRPH 4UDUB 4LCWE 2WNGA 3SKJH 4WNQA 1R3LA 5GSVB 3EDKA 3LEVH 2D0GA 4BSVB 2HYMA 3GMNA 4HIIB 1IGTA 4JO1L 3MV8D 4WV1A 4KRNA 4N0RA 3CFKB 2PYFB 3CVHB 4ONFL 1R3KA 3JWOL 4UTBH 2ADGB 2OI9B 3SDXE 4XAKD 3DTXA 4ISVA 2A83B 1YPZB 1WZKA 4DOHB 5AUMB 5SX5H 1EK3A 1P2CB 15C8H 4DTGH 5J0BA 5D96C 5E5UB 43CAB 3L3IB 4RA3A 4P9ML 2EDLA 2DOCA 4Z7WB 5DUML 4L3EB 1U41A 1MHPH 3LCYA 3QZWA 3OTTA 1AR1C 4Y8AA 3FONA 3QUZD 4L8CB 4P4RA 3GSRB 4FFYH 4HCRA 3GBNL 2Y4SA 5D70H 3ZO0A 1IFHH 3G04A 3FB6B 3OB0H 3TO2B 5ESAA 3VXUE 3OXSB 3NPZB 1P1ZA 3HC3H 4MD5B 1SY6H 3C8HA 4HT1H 1UM5H 1NAKL 3RIFF 5MENA 1IGJA 3TNNA 5EORL 3SDDA 3FO0H 4KKBD 2W60A 1U6AL 4U1MB 4M1CC 1DBJL 4M5YL 4U49A 5D2LB 4PRIB 3N85H 1FAKT 2Q6WB 1Z3GL 5DQJA 4G9FE 3V0VB 3MLZH 3AROA 4OI7A 5BJTB 4UNTA 1QFPA 3KYNB 5I66A 2H2PD 4LHJB 4PJ5A 3DROA 4ZDHB 4KY1H 3MRMB 1TQBB 3QUYA 4YPGB 4C56D 3RGVD 5IFJA 3C9NB 1RFDL 1FGVH 3ETBF 1P9MC 1P4LB 1YEJL 1OAKL 3MGTA 5DJ2A 3HPLB 4JO4L 1S5IL 3T4YB 2OI9C 2OJZH 4ZXBB 8FABA 2LVCA 3OSKA 4N8VB 3L7FA 3OG4B 2VXQL 3HC0A 1ROWA 4KQ3L 4D9RE 4Q2ZA 1VFMA 3GSVB 5JPMB 4NZDA 3BSZL 3BZFB 1FL3B 1WBYA 1QHOA 1T5XB 2VXTL 3BFOA 4D8PB 1MOEA 2Z93B 3DX6B 5J1AB 1FLRH 4Y19B 2EDTA 5HYQA 4ZUWA 1FH5H 1CLYH 3VFMA 3MUGA 4TOYH 1U2CA 4NKOB 3R4DA 2HLAA 3OR7A 2VC2L 4PRAB 2PXYD 5A40E 3RKDD 1NJ9B 2R2HA 3MGAA 1UT9A 3IJSA 1FCGA 4P59H 1HHJA 2UYLB 3WUZA 2GK0A 4Y5XB 4RGOH 2X4NA 1BBDH 1UYWH 5L2KA 3MPCA 1RUAH 5HGDB 2WK2A 1E6JL 1HSAA 4L4VA 2ZUUA 3OKMA 4NN6B 1K6QH 3U4BL 4OLXL 1TQBC 5IW1A 1MJUL 5B39B 4OCYL 4AL8H 1YC7A 1CDCA 2D03L 4YHOH 4PTUA 4QRPB 5I71B 3LAFA 4NDMA 4CMMA 1SJXA 3D87B 5TE4H 2HJFA 1S9XB 1MHCA 3GIVA 1XGPA 4IMKA 1U8IB 4F9PA 1GAFL 3IYLW 2VKXA 5HI5D 1EHXA 4ZO8A 1KN4H 3KPQB 2OP4L 4R0LA 4X98A 1OF2A 1S78C 4M00A 4YXKH 1HINH 4LLUA 2O61B 3T0EE 5IP4A 2JCCB 3ULUF 3PP4L 2IPTH 3WFDL 3C5JB 6CGTA 2X1OA 2CGRL 2F9BT 4JFZH 4AEIL 1AR2A 3EO0B 1CZ8H 1EZVY 1A14H 3I9GH 5BMFL 5E2VH 1T20A 3KPPA 5EPMB 1S7SA 2CDFA 2AK1L 5BO1H 2P5WE 1Q0XH 4GMTL 5DD0H 4P3DB 4RAUA 4N9GB 1J05B 1X5KA 4Y4KD 3T1FA 2B39A 4Y8DC 4XZUB 1JHTB 4OLVL 4YBLB 4DKAA 2Q8BH 3UJIH 2VLJE 4Y5XC 4ENED 5C0RL 5IBLD 1A2YB 5CSBA 4RFOL 1C5DB 4LSTL 1OGAA 4WI8A 4H25A 1LNUB 4QHLA 3O3EA 4NT6A 1QSEB 3W5NA 4PJDB 2C7UB 2WQ8A 3B8YA 3DX9A 1TVBA 1KFAL 2HT3C 2GSIA 5I71C 4Z0BL 3BT2L 5EC2A 5HHNB 1RI8A 4HC1H 5CMAB 4IMLB 3LRHA 4GRWE 3P4OB 4A6YH 2O26U 2R23B 4WU7B 5C08E 4U7MA 1NGWB 1F3RB 5IR1A 1A6TA 1G0DA 3T09A 1PFCA 1HQRB 3KPNA 2JIXB 4JRXE 2X4OA 4WJ5A 3HNSL 1R3JB 4Z7NE 4Y4HD 2CLZB 3D69B 1OARL 3ULVC 3QJHA 3VMOA 2JJTA 2D3VA 2GEEA 1VB9A 4DGVH 1RZ8A 3IDIB 3RU8H 3OAYK 3V5DA 4LPYA 2R0LH 1NDGB 1A3LH 4XWGL 3STZB 1KT2B 3WLWD 1KV3A 5FM4A 1D5IH 4ZOCA 4J3UA 4M43H 1YNKH 4U2ZA 2Y5EA 5CIPB 5JIKA 1BZQK 3GI8L 1WAAE 4JDTH 4ZAKC 3RA7L 5FOBB 5LWYL 4I4WA 4YBLC 5E8PB 1OM3L 1RHFA 1AGFB 2CR3A 1KEGL 5GIRB 1F5WA 3BMWA 4M7LH 4X4XB 4Z7VE 1B6UA 1NSNL 4YPJA 4AQ1B 1ZVHA 1CE6A 4HBCL 4XPBL 1UCTA 5KSBB 3F62A 1R5IB 3GJEA 1OAZH 4HS3B 4PJXE 4N8PA 3BPNB 3NIDF 1H3WM 3UTZB 1N5YL 4BH7B 1RUPH 4HC1A 2E3VA 2EDXA 2VXSH 4A6YA 1JZ6A 3D0VA 4R97B 1CGVA 5F7MC 4GXUM 1ACZA 4FQXD 4LP4A 4F37K 1CIUA 4NUJA 3F12B 1XH3A 2JLLA 2GYSA 3QP3A 2H26B 3ILPB 3HG1B 2ZG1A 1T89C 1ZT4A 1EX0A 1OVZA 2MKWA 1EO8L 2EYRA 5FF6B 3QT2A 1A9BA 2F54A 2MNUA 3LKNB 4UV4H 1XR9A 3N1MC 4PG9B 4UV7H 3DO3A 4MJID 1FAIH 3U83A 3BUTA 3UAJD 2YEZA 3QCUH 2R0WH 3TA3D 4XVSH 2VAAA 1NGXB 3LS4L 1H3TA 1BQUA 3UTSA 1WLHA 1X5GA 4Y5VA 5TDOB 3C08H 3UPRB 4AIZA 2MPAH 4F3FA 1E6OH 1OWWA 1KJVB 3P0YH 4PJEE 3TC9A 5KOMC 2EE3A 4LCYA 1EJOL 3MRHA 3RL2A 3U0WL 3MCKB 1QRNE 3MRCA 1YEKL 2V5SA 1I9IL 5HHVH 1MRDH 3QNZA 4POZD 4YAQA 5FFLA 3BPNC 4P5MB 5GXBB 1I3GH 2YZ8A 1AKJA 2YD7A 4Q6IB 4PY8I 2WIMA 4S1RL 3PQYD 3VI3F 5DD5L 1MCSA 4RZCB 4R97C 3JWDL 3QR2A 4XH2A 2AEPL 1S7TB 4HWNA 3VI4E 3VFRA 1NBVL 1IZKA 5IK3B 2ZOLA 1TETH 1RK1A 4PJCB 1FYTB 4P9HH 3L3JA 3SKUD 2YUWA 4N5UA 1FNAA 4AEHH 3G9AB 1G9MH 1NGYA 1CR9L 4OAWB 4OCXL 3NACL 4Y2DB 4AENB 1JNLH 1OP3H 1MY5A 3KYKH 4OCWH 2IQ9L 2JE8A 2HH0L 2EZ0D 2HJKB 43C9A 3WUWB 1ZLSL 3V4VH 1LGVA 4WEMB 5D6DC 2WZPD 1AIFB 4UOJA 5C09B 1UVQA 3QH3A 2E9JA 3GGWA 3UEZA 1R5WB 1DTUA 4X6DB 4G8GB 4ODTL 3IETA 3BX7C 3GRWA 5B8CA 1VGKA 1TPXB 3W2DL 4M61A 2VISA 3RHWK 1C1EL 1J9CT 1TNMA 3QPQD 4G6KH 3VXRB 1CK0H 4QO1A 1J8HA 3FRPG 4NO3A 3KLDA 5ELIA 3ARDB 1W8OA 3PGDB 5HPMB 5B38B 3CXDL 3U7YH 4Q6IC 5CJ5A 4P5KA 3QXDA 4MHHI 3FT3A 2CMRH 5C0GA 4M48H 2GJ6E 3OAZH 2NW2B 4QRRE 1UWGL 1C8PA 3UTSD 1KIQA 5DMIH 3UPCA 5EDXA 3MACL 3MV9E 5C0FA 3FO2B 3U1SL 1UQSB 1X5IA 3HI6L 2GFBB 1ES0B 2V5TA 3NCJH 4KKAC 4XAWL 1CWVA 1JNNH 1W0WA 4U1JA 2FWOB 3VWJA 3E6FB 4Y2DC 4LLWB 5KG9A 4OI8A 1JWSB 2B1HL 4XCFL 2VZ1A 3SJVB 2DQCH 1VFAB 4EI5B 1EEQA 4PGCA 1NCWL 4JM2B 5GQBA 5IEHB 3B83A 2DJSA 2FBJL 2XI9A 4JZJB 1PG7H 4MAYB 4TSCL 4HH9B 3CX5K 3DLQR 5TGBB 2EXYC 3EGSA 2FB4H 2FEDD 2DM4A 2EDFA 1CFTA 4H5SB 4U1LB 3K3QA 3N1QC 5I15H 4HIHA 4Y4FB 5GGVL 1J88A 1D9KD 4GRLA 1TPXC 1TMCB 4HUWB 4HGKC 1NCUA 4YHNA 3UTOA 1J7VR 1B0RA 3PHQB 3CVHH 5IBTH 1BBJA 1S8DA 5HDQH 1EJ6A 2J8OA 4Z7QF 3RUGB 5BOPA 3ARDC 3VA2C 1U3JA 2DQIH 4IEFB 1XIWB 3RWEB 3TT3L 2BNRA 3RZCB 2VSDA 5JNYB 4L9DA 4OFIA 4GW5B 2PF6A 1IAMA 5F96L 3G08B 4LAQL 2DQDL 3DI2B 1WWAX 3OV6A 4EOWH 2NX5B 3WXVH 1RPQA 1LEGB 1H8OA 3MRLA 3NAAH 1WISA 4L4TB 3SHSA 2D7MA 4MQXD 3S3SA 3MLXL 4HH8A 4EI5C 1U93B 4JM2C 5EOCJ 3TNMA 2VITA 3C5SA 1AHWB 4JZJC 3UYRH 1M71B 2FO4B 4MAYC 2Z92B 1BQHB 4U6XA 3S6CA 3SGEH 1Q8MA 1SVZA 1UWEH 5GSVA 3E8UL 2VQTA 4TN9A 4OB5H 3PIQB 3FKUS 4BSVA 3IDXH 3CX2A 1KCVL 1EGJL 4I48A 2JJWA 5IB2A 5D7LE 5FUOH 2ZSWB 2DQHL 5DJZB 4Y4FC 1NPUA 1LO3H 3GNMH 4HZLA 2P5EE 3CVHA 4MYWB 1MHHB 3IFOB 2B2XH 4KTDL 2FX9H 1YNLH 1E4XH 1CL7I 4ZS6D 3HMXL 2AK4D 3WV0A 3D39A 1NBYB 1ZT7B 3IXTA 2EDKA 4O58H 3X14B 3UTTB 3I6GB 3GUTB 2Y6SC 5H35A 4PLJC 3TVMB 2IH3B 1XIWC 3FB7B 1GC1C 4YDJB 1PY9A 4HPOH 3HE6A 1NKOA 4XNMB 3RZCC 5I16A 4J1UB 1KB5B 4N0FB 4HZAA 1G7MB 2GKIA 1CXLA 4XPFL 3U30B 3F7YA 4XNQB 4DCQB 3RNQB 1KENH 4AZ8A 3TH3T 4PJ9A 1IM3A 4ZTPL 1MSPA 3FQRA 4G5ZL 1KTKE 4LSUH 4OZHF 2E6QA 4LSQH 4UQ2A 5HVGB 1KUMA 5EUKA 1OWRM 4JFEA 5T5FH 3D3VE 5H2BA 4YXHL 2VH5L 4M5ZH 4R9HA 4PRIA 5ESQB 1AHWC 5DQDH 1AR1D 3MRNB 3EOAA 4FQLL 3B9DA 3GBMH 3VCLB 1N6QH 4HGMA 4U33A 1CVSC 1UKTA 2YPLA 1KTRL 4ODVH 4JCLA 4ZDHA 5HDOA 1JHKL 4UT9L 2KUTA 4JKKA 3RGHA 5EOCH 3Q48A 3MLUH 4IOIB 4XP4L 1P4LA 4P46B 1MCNA 2OR9L 1V3LA 4M3JA 5C0BD 1KTDB 5HTSA 4PJAF 4KQ4L 4LPVA 4UNVA 1CGWA 1RIVL 3IU4H 2BHYA 3DWTA 1N0XH 4LHUB 1EEZB 2VZSA 4M1CD 4ZPVB 4XNXL 3UO1H 2HFEB 4JZOB 1HHKB 5BRZB 4OLUL 3TVMC 1RK0B 4NNYB 2FEEL 3F6IA 3CMOH 3MOQA 2WLZA 5DHVA 2MTPA 4HWBL 1EHNA 3G6DL 4ELMB 2AJSL 1H3PL 3R06B 3U30C 1JK8B 2OTWB 1KXVC 4NKOA 2X41A 4UDTA 3OHXB 3PL6B 2EDJA 3SE3C 1QSFA 1U2HA 2C4FU 4RMVA 3MUHL 3IXAA 1I9EA 4NFCA 3WNMA 4S1QL 2UYLA 4EVNB 2Y23A 1FFOA 4M7JH 5A2KH 3SGDI 1AD9B 4JFYB 5FYJU 4U1IB 5LGHH 5T5NF 1IARB 4KUZL 1QFWH 4L3ED 5FKPA 1SMAA 4HXBL 5GGVY 5DXWA 1KCUL 3C6LA 2ORBL 2CUMA 1A7RL 5ALBH 5HGDA 5F72S 1MFAH 3PV6B 4S1SH 3P9WB 4XCCH 2I5YH 5F44A 3SKNA 1A6VL 3MA7B 5ITBL 4YFLI 4WEBH 5D1XB 2ERJB 5HVFB 5E24E 4FQIL 4P46C 2YOCA 3G6JE 2AXFB 1F58H 1FVDB 4XP5L 1SEBB 1JPSH 1G7IA 3EYSH 4J6RH 3BGAA 3ECBA 1T3FB 3REVA 5DRXA 4JFHE 1KIRB 2YR3A 3PG2A 4PRID 3SCMB 3Q0HA 1GIGL 4JFDE 3FQWA 4JQXC 5DMYA 4GG6F 2O61A 2IMNA 5FB8B 4M1DL 1LO4H 4MB4A 2JCCA 1INDH 5DI8B 1J1PH 5CKGA 1CBVH 3DX7B 3F7QA 1J5OL 2BC4A 1YN7B 5K9KA 5EUOA 5L2JA 1U95A 4XWOC 2XACC 3PL6C 1IGIH 5EPMA 4DUWA 4F15B 4ETQB 3VFNA 4ZG1A 2A6IA 1J05A 1LD9B 2NZIA 4ZXBD 2C3VB 2DQFB 5C07B 2XZAH 2CKBA 4PB9L 1X5FA 3RAJL 1KJ3L 2VO5A 5JW3L 4XZUA 4QOKE 2GCYA 5A2FA 4ZAKA 12E8H 3VDCA 1JHTA 1S78D 5GGUB 3O2WL 5IHUL 2Z35B 4XNYH 4R7NA 1IQWL 1BPVA 2JJVA 4Y19D 4TPRL 1P7HL 1QSEA 3JTTB 1FV1A 1BQLL 2R4SL 2C7UA 4X4ME 5GGRY 4XC3H 5D1XC 1WV7T 2ERJC 4HG4J 1RMFL 2P24A 4JLRA 3MGOA 3EDEA 5SWSA 4P57B 5CMAA 4MQSB 3E2HB 5FOJA 5LBSL 4OCSH 4X80H 3S7GA 3PDDA 1NGWA 1KN2H 2JIXA 3B6SB 4ZS7H 1R3JA 3ULUL 5E94A 1GHFH 3D69A 3JSSA 4FQCH 5KVDL 4BA8A 1K85A 4YHYB 3DXAD 4NOBA 3DVFA 2VL5B 2B0SH 2W65A 5AZEH 3INUH 1TJGH 2HT3D 4OT1L 4QRPD 1UB5B 4F15C 4GS7C 1T0MA 2QQLL 5C6PB 1KT2A 1QG3A 2J4WH 3QG7L 2VMFA 3QUKB 1JFQL 3ELAT 2DQGL 4X6CF 4E9LA 5ANMA 4KV5F 3WFBH 5DSCB 1AFVH 4GG8A 2OK0H 3K4DA 4UAOB 1MCPL 5IB4B 1AGFA 5T1MA 4DKEL 5GIRA 4GUPB 3WS3B 4X4XA 4PJFF 3ULVD 3PWPE 4OZIB 1MAJA 4FQ1H 2AJXH 3A6CH 3C8DA 1SEQL 4RISH 5KSBA 4KJYB 4HS3A 1ZHKB 4JHWL 1NFDA 4M6NL 5E6IB 3WYRA 5I8KH 3D9AH 3AY4C 3GKWL 1KG0A 3QWOB 3UTPE 2RFXA 2MOVA 1ITBB 2VR5A 3VGAB 2F53B 1NGZB 2Q8AH 4ZFGH 3CFEB 4F8QA 4O00A 4AMKL 3E2HC 3PDOB 2VZOA 3LPFA 3GMPA 4HPYL 4XMPH 4Z8FH 1G1YA 4L29B 5CEZD 3F12A 1IGFL 5KSUB 1QVOA 3ILPA 4KVCL 3WSQL 5JHDA 1PSKH 5C0CE 1F4WH 4CNIA 3HG1A 5C0DB 4LMQE 1BOGA 2DJUA 4TUKH 3CZFB 4GSDL 4N9OB 4YUEH 4K71B 4YHYC 2H32B 2A77H 1QSED 4GRWF 3DURB 3GO1L 4MJ5A 1LEIB 4X9FA 4G9DA 3BOVA 1WWCA 2B4CH 3RWIB 2Y36H 2D31B 4OD2A 3SN6N 3O3AA 4C4KO 4HX1B 3VXTB 1NGXA 1A1MB 1HILA 3FQNB 1FNHA 2E7LC 3CH1A 2AS5M 4I18C 5TDOA 2AAVA 3HAEB 4UAOC 4JG0L 5I1JH 2JIXD 4RMQA 1U3HA 4FQPA 1URLA 2IH1A 2BSSB 2BY2A 1FORL 3BZDA 3AC0A 4XP1L 3O6FB 2C3XA 4BZ1H 5JW5B 3GKZA 3MRPB 3C2SA 3QCVL 1JPTH 3RIAK 5B21A 5I9QB 1LK3H 5EU5B 4LSPL 5E6IC 1IGML 2ZKHH 4D0DB 1QBML 4XHQA 1Z9OA 3VDBA 3VGAC 2I27N 1IT9H 3H9HA 4LEXH 4WUUB 1H5BA 4KRPB 3MNWB 3EFDH 3D6GA 4POYA 3LOWA 4PP1C 1UENA 3CUPA 5T3ZE 4P2RE 2HFFA 4U3HA 2E7MA 4PJCA 4QXTB 2UWEA 2VUOA 5JW4R