4GFTB

Malaria invasion machinery protein-nanobody complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
126
Chain Sequence
EVQLQESGGGTVQPGGSLKLSCSAAPERAFSNYAMGWFRQAPGQEREFVAGITGSGRSQYYADSVKGRFTISRDNAMNAVYLQMNSVKAEDTAVYYCAARVVPVFSDSTKGYVYWGQGTQVTVSSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin A tail domain interacting protein
publication title The structure of the D3 domain of Plasmodium falciparum myosin tail interacting protein MTIP in complex with a nanobody.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Protein binding, immune system
total genus 33
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2012-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gftB00
4LSPL 3PHOB 4LMQI 3VJ6A 1WVZA 1IFHH 2D03H 3MYZA 1G6RH 4ALAH 4Z7VA 3LQAC 1MCOL 5E08L 3KPLA 3D85B 4P5MB 3H9HA 3TLRA 4UT6L 4B7IA 4XB7A 4PRIB 1U3HC 3DMMA 4PYHA 2Q7YB 4H26A 4L4VE 1DBJH 3WFDL 5FGCE 4PREA 2FEDC 4XP6L 2YBRB 1DSFH 4XVSL 4OBRA 3DGCR 1T83A 2VISB 3ET9F 3JXAA 5DUBB 2DQFA 2AW2A 1CIDA 5GRZA 3HAEA 3DVGA 3UTOA 5ANMB 4OFYD 4OTXL 3GSNH 3PWJB 3NPSC 2ILLA 5DI8B 4ZFGL 4KTDH 3C60B 1KJMB 2I5YL 1T1YA 4K3EH 3SKNA 3TFKC 1CF8H 4KRPD 2X70B 4FTVA 3VXQA 3U36B 4RMWA 2DYPD 4YO0A 2MPAL 4F3FB 2EECA 1ZMYA 3IXTB 2Z8VC 1CDBA 3ARYA 3MRKB 3P2TA 4P46B 2IGFL 4PJFA 1AD0A 5C2BH 1FYTB 3B8SA 3BPLB 1X5GA 2P5WA 3U7YH 1C12A 1FFOB 4LU5L 4Y4FB 5MEQA 1Y0LA 5GGRA 2AP2A 1WZ1H 2HTKD 2N1KA 3EOAA 3EO0B 4L4JA 4F58H 1FG9C 1ZLUK 3VDBA 2FJFB 4H8WC 5FYKL 4E9LA 2IANA 3QWOB 1A7RL 2DQUL 2DAVA 4Y2DB 1QLEH 1EMTL 3B2VL 3K46A 5EUKB 5C0IB 2M2DA 4C83B 3KPSB 4LARL 2UWEE 4HUUB 5DJCA 1ES0B 5FB8A 4XAWH 4NT6A 3LKPA 1KBGH 3GBMH 3W82A 2RIKA 3T0AA 3TN0C 4F7MA 2XNAA 3B9DA 3WIIH 5GS2H 5C3LD 3WUZA 4I5BA 4BKLB 1P2CB 2Q86A 1GYAA 3O3BA 3M8OL 4UIKH 5CJOH 5TDNB 2DOCA 2MTPA 3R8BB 5F9WC 2OJZH 3PL6A 1X4ZA 2GSIB 2EYTB 5DFVD 5GRUL 1FE8L 3T0WA 2VDLH 4L29B 3WUWB 2VXTH 4QHKI 2BX5A 3NVQA 3VG9B 4NGHL 5C0CD 1JL8A 5ACZA 3C09B 4OF8A 4OCMC 4O2CB 1JGVL 1OGAE 1M1SA 1IM3B 1MVFA 2VDPL 3D48R 1JPST 2CKBH 3O6FD 3QIUC 4ZXBD 3GSXA 1JGDB 5FDYA 1AH1A 4QRPA 3F12A 1ERNA 5TH2A 4H0IA 2FB4L 3K1KC 1N6VA 2CIIB 2NY3D 2EE9A 3UDWA 4ZO9A 4Z7OF 1H3VA 2VOTA 2X1WL 2VDNH 3GKWH 2ORBL 5E1AA 4XNXH 1NLDL 1X5AA 2X4SA 1P4BL 4KRPB 3OMZA 2EDOA 3ELAT 1XCQA 1P6FA 2DYPB 1KOAA 1ZGLM 1HQRB 1AGBA 4HCRA 1D7FA 3FO9A 4WFEE 4OZGE 2B2XL 5K33A 3S7GA 1ETZA 4XWGH 1LK3L 5LAXA 5C0FB 3PWVB 3IGAB 1IM9A 1Z9OA 3ECBB 4CMMA 2ZJSH 2JK5B 2DM2A 3IYLW 1A9BA 1BEYL 4PGBA 5IQ9B 4HW6A 1IGYA 1N26A 5I1GH 2GIYA 2SEBA 1YQVL 3MV9A 4TVPE 4W6WB 4TSAL 3P30L 4OM1H 3OG6B 3QEUB 4JFZH 3R8QA 4N1HB 3TNNB 4BSVB 3GB7B 5GJTH 2ZOLB 4BZ2L 3TWCL 1SYVB 4K9EL 1K5NB 4YK4B 1I1RA 3WFCH 1D6EB 1G7HA 1TVBB 2HRPL 5E6IA 1TZIA 4KK9D 2A74B 1F58L 1A1MA 4WI4A 1MCNA 4YLQT 3M07A 4HWUA 3WE6B 2FHCA 4JAMA 4EDWH 2D31A 2VDMH 1KTRL 3FT3A 4YDKL 3V7AG 1J1PL 3BH8A 3S9DB 2DN7A 5TFSL 4HXBL 4OLUL 2FX8H 2FJHB 3BVNB 3FO1B 4FQXC 2F53E 4FMFA 4QT5B 2DM7A 3TBWA 3TIDA 2XY2A 1BQHG 2CK2A 2EXWC 2GT9B 1IGCL 4HAFA 1KSRA 4FHBD 4M8QA 2P8LA 1MRCH 2VXUH 5E00A 3TT1L 2X9XA 1U6AL 4AM0A 1XCTA 5D7SH 4LPWA 1OP5H 5C0CB 3LMJL 1TTUA 1NAMH 4GSDL 3QQ4B 2VZTA 1QR1B 4FNLH 1BVKB 5DVMA 3A6OA 1IRAY 1YN7B 3O6FB 1Q94B 4ZXBB 5GS3A 4MSWB 2HH0H 4TTGA 2NW3B 1LP9E 4FFWC 1JWUB 2J6EA 4OCXL 3I6LD 2NY3B 4TUKH 2YPKA 2GJ6A 3FB7B 1Q9OB 3FTGA 1AQDB 5IK3B 5I8KH 2WBJD 4L9LC 3VXUA 3LS5H 5JR1H 3C2AL 1VGEL 1WCQA 4HAGA 5MHSE 4D94A 1HIMH 1P4IL 3EYFA 2PW2A 5EZIL 2VZOA 4KK5C 5FYLE 1OAZH 2FD6L 2P5EE 2VNCA 2XWJB 4JPWL 4O4YH 1ZA6A 1T4KB 2L0DA 4XCEA 5F3BA 3QI9C 2ATPA 1BWWA 2ED7A 3CVIH 3O3AA 4R8WL 4WFHD 3S3JA 2XI9A 4Q6YA 4HJ0D 1CN4A 4Q6IB 2A1WH 4GXUN 2HFEA 4GQ9L 4CN4A 4PIRF 1CZ8L 5FM4A 1MRFH 4LSVH 5T1MB 1MJJB 2Y5TB 3WJLA 1J8HD 1SBSH 1UEMA 4LPYA 1IBGH 2DTML 4J4PC 2AJZA 3BHBB 3SPVA 1TDQA 4UU9A 3U0WH 4K07A 1GGTA 2VIRB 3FZUD 4UB0H 4PJIE 1C08B 5GZND 1K2DB 1CDJA 5DHYA 4QRQB 1TQBB 3BRFA 4TSCH 1I8IB 2P4AB 4OI8A 1IZJA 5CJQH 5C9JA 4EN3C 3FOLA 4HUNB 1CGVA 1J87A 3PGCB 3MFFA 1TCRA 1YJDL 1FVEA 5DRXB 3M17B 5BCAA 4JRYA 3A67H 4BQBA 5IG7B 5CBEB 3OR6B 3BP4A 3CVHA 4XMKH 1FCGA 4Q9BA 4CVXA 1AGCB 3I3BA 4YQXH 5D7JA 1TVDA 2P49B 5DD1H 3D9AL 2Q8BL 5CEYA 3GMQB 4KJYA 2YPLA 1HINL 4YDLB 1OQOA 1X9QA 3SDDC 1LO2H 5ALCL 5FK9B 4OLEA 1TJHH 4C55A 4Y8DC 1CQKA 1IAIH 4HUKB 4D9LL 1MFBL 4FP8H 4L4TE 1N3NB 3VFTB 3RWCB 5KG9B 2BHUA 1ZVHA 1IVLA 1V7NL 3B6SB 2DQHL 3BT2L 5F3HB 5CEXB 2HKFH 2VXVL 3FO0H 4P5TD 3BGFC 3S35L 3UYPA 4P2RE 4HZLA 4E41E 2WBJB 2FATL 1CLYL 4HD9A 3IU4H 2OR8A 1YA5A 2X4RA 3C5JA 3EOTL 3S37H 4MB5A 1D5XB 2BSSB 4KHXH 3C5ZA 5T3ZH 1LNUA 5HGBA 5D96B 5JOEA 2ZKHL 3QXUA 1EAJA 5D7KD 2Z31D 1YEDB 1N4XL 4HCRH 5CS7A 2ID5A 4PJAE 3ZHLA 5CWSA 1I1AD 5I74B 1KPRB 1A02N 4G42A 5GRWA 4MJIE 1J8HB 4YHKL 3RVXD 2AXFA 3DUSB 3QUKA 1Q9WA 4UV4L 1CD0A 2R0LH 5CIPB 2J8UF 3SGDH 3S4SB 2UZIL 1ZHNB 1I75A 2V7HB 3NACL 3LCYA 4DQOL 3NTCL 3AMLA 1SJHA 1XF1A 1YMHB 2R4SL 1KTLA 3QPQC 1MSPA 2HJFB 4F9PC 2OJEB 1N5YL 4MX7A 5DS8B 2FWOB 3GRWH 3X13B 3OR7A 2W07A 3TZVC 4GAFB 3H9ZA 3IAPA 3T8XB 4LCWE 4Z95L 2EIDA 4MMZC 2V5YA 3VWKC 4AIZA 5CEZL 1CU4L 1IGTB 3MREB 3QEQE 3R4DA 4FXKB 5TDOB 1VFBA 3HC4H 4XCCH 1U8PB 3DRTB 3WJJC 1JHTB 1QFUH 5GQBA 1BD2E 5DDHA 1F2QA 2CRIA 4HIEA 1NFKA 5I1EL 3UC0L 4TRPL 4AQOA 5KSVB 3VMOA 5IOPB 5HGHA 1H8SA 2OSLA 3HNVH 5FA4A 4NO2B 1CL7I 1DE4B 4U31A 2AK1H 4LFHG 2YK1L 2PO6A 4O2EA 3MGAA 1QEWA 5CINL 3CDGA 1TJIH 5HHVL 1SEQL 3TNMA 1T2QH 4PJGA 2OR9H 3NIDF 1RUPL 3NMEA 4MQXC 2YKLH 1KEGL 1QQDA 1UEYA 1DL7H 5L6YL 4D0CB 2DI8A 1OSZA 2AK4A 3MNWA 1T04B 1G7MB 1MHCA 1FDLL 4PY8I 2DWEA 2DM4A 3G5ZA 3PWUB 4D3CL 4X4MA 2I25N 2DTSA 3DI3B 1ZWIB 3KYMA 2VLJE 2IPUK 4P5TB 4UDUA 1UJ3A 2F8VA 4E0RA 1WBXA 3O11B 5IBLC 4PGZA 2ERJB 4QRRD 3QWQB 4WGVB 4ONFL 2LTQB 3V6FA 2YC1B 1S7VA 4PD4J 5ID1A 3FN9A 1UH2A 4CL7A 3R06B 2D7MA 5EZLA 2YUWA 5TQ2H 1BWMA 1MCSA 2HWZH 4JVWA 4S2SA 2I07B 5I0ZA 3FHAA 4X4XA 3U6RA 4PRPD 2Z31B 2JB5H 5DC4B 1I1AB 2HT2C 2GUOA 2J3SA 4ZFOL 2VRAA 3BFOA 5KAQF 1MHHA 5BZDB 5J1AB 1G84A 5E2TH 3PDDA 4P3CL 1Y6NR 3LRGA 4YHYB 1B88A 2EDJA 1IC4L 1IEAB 1GGBL 5IIEB 4AH2A 2OXHA 3QFJA 2WWMC 2VLMD 4F2MB 4KY1H 4L8SB 2H6PA 3OBAA 2NW2B 5C07D 2YMXH 4FFVC 4U6YA 3B8YA 3ARED 3IJHA 4ONHA 5T1DL 5DRWA 1PZ5A 4JFED 5I16A 1BLNA 2E3VA 2EYSB 4BSWB 2ZG2A 4JQVA 2WIIA 3G5VA 2X4NA 5JO5B 3VW3L 1G7IA 3BMWA 1L7IH 3DROA 1VENA 4U0QB 2HMID 1U8QB 4LHJB 4PJBE 1WFUA 4CW1B 1WZKA 3C87A 1RUQL 4D8PA 3BZEB 2X9YA 5EO0A 5C0ND 5I18L 3FMGL 3WFEL 2FBJL 3MLZL 2DL9A 5CBAA 2ZP0T 1DLFL 5HHPB 4Q9QH 2X4QA 1T21A 2A9ML 4N9OB 4OCWL 1A6ZB 1JZ7A 1QA9B 4FQ2L 4ZYKA 4DGYL 2A38A 1CFSB 3SDAC 4TUJB 4OLWH 3UJTL 1CVSC 3ULUL 5HHNB 2EEAA 3H7BA 2GSGA 4LVOB 4ORZC 4X4ZA 2VWEC 5JIIA 3LKRB 2WUBH 3ALWA 5AUMB 5F1OB 5L2JA 4XI5D 1VGKB 2HFFA 3AXLB 5H35A 5A1AA 4HUVA 1NMCC 4G9FA 2LU7A 1PLGL 1QBBA 1AY1L 1OTTC 3RDTD 2XPGA 3QHTC 5DTFB 5M95B 3TYGH 4QRRB 2CLRA 4KI5D 4P23C 3IB4A 5F9JB 2IH3B 2EH8L 1QG3A 2Y7QB 4XXDA 5J3HC 5K59F 4M62L 4YHOL 3VXSA 4Q9RL 1TZHB 1KF9B 2DQJH 4X5WB 1HE7A 1KJ3L 5KSUA 2F54A 4PP1D 3QJFA 3RGVD 3WNMA 3QAZB 4HS8L 4NQCE 3RWDB 2D9QB 5GJSH 2H2PD 1ZT4B 5BW7C 3HLAA 4PRPB 5BJTB 2HFGH 5IVZA 1B0GB 3U0PB 4IOIA 1RUAH 4M61B 2GAZA 1CL7L 3WHE0 1MH5B 5E2UL 4ZSOB 2AAVA 4PJEE 3MV7A 4GW1A 1UM4H 3MTRA 2BERA 3V6OA 1LO5A 4PYGA 5ADOH 5CD3A 5C07B 3RQ3A 3VDCA 3G5YA 4Z9KB 5FUCE 3B9KD 3AREB 3HI5L 3IFNL 4JFEB 1IAOA 3BN9D 4V2BA 4XVUC 1SY6A 1YC7A 4HBCL 4Y5XC 4QTIH 5F9OL 2GFBA 3VXPB 5CUSL 1G0DA 1RJYA 4R4BB 5DZNA 2VC2H 1AD9A 1A22B 1QFWH 5D5MF 2JB6B 3E2HC 1I7UB 5D5MB 3OF6D 3D1MC 4GBXD 1J0IA 3NCYP 3E6HA 4RMTA 4XXCC 1YEGH 4UNUA 5C09A 3VFWA 4U6VH 2ED8A 3RKDC 3REVB 1I8LC 4LKCB 1F45A 5B3NA 4HUXA 1ITBB 1OAKH 5DT1H 3WN5C 4U1KA 3GI9L 4F7TA 2BNRD 4U3HA 3CU7A 4TSBH 1FRGL 2W91A 1DANU 1EO8L 3S98A 4JZOA 2EKSA 5JUEL 4LSPH 1XGTB 4PRDB 4E5XA 1OTSC 1X5ZA 4X6CE 4IDJL 4OFPA 3OHXB 5D2NC 3FAXA 3QJHB 3VFNA 5DJ0B 1XR9A 1F42A 5E08H 1MCOH 1E28A 3EDKA 1CVRA 3TBTA 4N8VA 1AR1D 2JKXA 3REWA 4KI5F 4UT6H 3RDTB 4Y19A 1QRNA 1JZ4A 1IGFL 4QOKD 3T4AA 3WFDH 43CAA 2XQYG 4WW2F 4XP6H 4X7DC 4NOFA 4GUPA 1IGML 3D25A 4XVSH 3MLWL 3N1GC 3B2UD 2XFXA 5IW1B 4WW2B 3QDGA 4RZCA 5D6CB 3U2SB 3QQ9D 3RGVB 3PV6B 3Q3GA 4U1MA 3LKNB 3O4OB 1KB9J 4PGCB 4JZJB 4HJGB 4OTXH 5TDPA 1A9EB 2FIKA 3PWNB 4ZFGH 4POZD 4PRAA 1MNUL 1W8NA 2I5YH 3STBA 3I02A 4QHLA 5ESVA 3B5HA 1JN6B 4JO3L 3HRZA 5I1IL 4AL8H 2YZ8A 3SGKC 4N0FA 1OPGL 4O9HL 3QUYD 4WENB 2MPAH 3UTSA 4ODXB 1MFAL 4XCNA 3RVUC 1DQQA 3DVIA 3SY0A 43C9B 4JDVA 4JN2A 1IL1B 3B9KB 3MNVB 2UZXB 3GBLA 3MJ8B 2A6JA 2OL3B 4P2QA 1JWMA 2GJZA 3ESUF 3RWFB 5HDBE 4GAGL 1IKNA 1S7UB 1K6QL 3RTQD 3SKMA 2GTWA 4PJ7E 5F44A 1A7RH 3NCMA 1N64H 2DQUH 5F7WC 3EO1B 5C70A 3B2VH 1DEDA 4XMPL 4GBXB 1LHZA 1UVQB 3BPCB 1HCFX 4LARH 2BC4A 5E8NB 1T1ZA 3ARWA 3FJTA 1A6UH 5ICXB 3W0WE 4CN6A 1R3HA 1A4KA 4FZ8L 3VFMB 2R39A 4FXLA 4YXLL 4NN5C 4POYA 2BNRB 4NQXB 4NZDA 1P7KB 4TNVK 3OB0H 3M8OH 1JGEA 2FECI 1WCBA 3VXRE 1GVIA 2CXKA 4N1EA 1SEBA 3W9EB 1J8KA 1GZQA 4YBLC 3G6DL 4P3DB 5CD5C 5GRUH 1U3HD 2BJML 1FE8H 3ZKQD 1YEKH 4ZUVB 1WFOA 2FEDD 5F96L 2VQ1B 3WXWL 2R2HA 1RURL 3K4DA 3OAYK 4F7CA 4ZO8A 1FV1A 4QOKB 5DD6B 5CLTA 1JGVH 5J06A 5AD0B 2A77L 4JJ5B 2VDPH 5DMIL 5EC2B 5FGBA 1INQA 9CGTA 1XR8B 4AT6A 3TFKD 3KGRA 4I18A 2CDGA 4JKKA 4HK3J 4S1RL 4OCYL 4DGVL 3RI5K 2FB4H 4IIQC 5GSVB 5DJ8B 1A6TB 3D3VD 3RX7A 3EAKA 3DARA 5J7CC 3UTQA 2ORBH 1D3CA 1SYSA 1PEZA 1NLDH 1KIQA 1ZV5A 2OR7A 4I0PC 3WIFB 4CMHC 1P4BH 3V95A 2APTA 4HX1A 4FRWA 4P99A 5L2KA 1ZGLB 3QUYB 4Z5RB 2NY5H 1KLUB 5T3XL 1LK3H 3T09A 4JRWA 1AQKL 2GK2A 5DJDB 4YDVB 1R3LB 4TPRL 5CZVL 3I50L 1QP1A 3Q6GH 2ESVD 4N9GB 1DN0B 2XQBL 1MLBB 4IHOA 1WTLA 5DHVB 1X44A 4HLZG 4IBLT 3MLUL 1G1YA 3UZEA 3RTQB 1G9NL 4TYUA 1LE5A 4GG6B 1G7QA 4DKFL 4TSAH 3DRQA 3P30H 3VXMD 1RZ7L 1VFOA 4N8PA 4R0LB 3BQUA 5DQDL 4OZHF 3H9SD 4NHCL 4G7YL 4BZ2H 3TWCH 2X5PA 4OZHB 4K2UH 5FM5M 1LDSA 4UV7L 1KENL 4CRPA 3MRLA 4Z7QE 3GM0A 2HRPH 1ZVSB 1F58H 5AG9A 3HZKB 1YECL 2OQJA 2BHYA 2P8MB 1X7QB 1FZKB 4NDMA 5DZOA 4ELMA 4XBGA 1NEUA 4YDKH 4KDTC 3U46B 2G5BA 1J1PH 1H5BA 3GIVB 2WLZA 1TZGL 1U3HB 5E4EC 5TFSH 4OLUH 1WZLA 5A43C 1U36A 4LVEA 1IGCH 5IM7B 1KTDB 2XRAL 1MHEA 1MPAL 2GY7B 3V8CA 4XH2A 1U6AH 3QIUD 3QA3A 2AJYL 1I7RB 2VLKD 4POUB 5BV7B 3LMJH 1AO7E 4GSDH 4PRBA 1G0XA 3V5HA 2BVQA 3ZE2F 1H15B 4YHLH 3BH9A 3QPXL 4LCIL 4KV5E 1P7HL 5C92A 1Q72L 1VB9A 2OMNA 5C71A 4XTRC 1E27A 4OCXH 3DGGA 2NY0C 3D3VB 5EA0L 2C7UB 4MA7L 3C2AH 1VGEH 4LBEB 2DIJA 2EDFA 4LRIA 3ULVE 1P4IH 3N1QC 2FD6H 5B38B 4RGOL 2FRGP 3VXUE 2B5IC 4NYLB 2FECL 2P43B 5JOFB 4ODVL 3SDXA 4OBSA 1NCAL 4UI2A 4EI5A 4R8WH 5DQJB 3WDJA 3OSKA 3MRJA 3QDJA 4JPKL 3HUJE 4MA3A 4EI6A 4ZFOA 1FQ9C 3FQUB 1JNHA 2RFXA 5HGAA 2ESVB 5SWQA 3RPKA 1CR9L 4LLWA 4ZFZB 1YNLL 2DTMH 3G6AB 3FT2B 3MV8E 1TQCC 3VXMB 3DX9A 2HYMA 1DQLH 3H9SB 2VZ3A 4K7PY 4JANB 4RFEB 1R5IB 3AFLA 1A3RH 4R7DB 5JMOC 2V5RA 1Y6MR 2YD8A 4Y89A 5F9WB 2F15A 3RL2B 2B7DT 3WEXB 1X3DA 1FL3B 3DO3A 3KPQB 4KKAC 5EFIA 4FQXD 5DMKB 3MROA 3SDYL 2EXWD 2YD3A 3OG4B 4L3ED 4NHUA 1R24A 4JE4B 4LCUB 5I75C 4CDGC 3BZFB 4GMTL 3MRIB 3BE1H 5E8PA 2OZ4L 5SWZE 3X11A 4G3YL 3F7VB 1U0QA 2PTTA 2Q8BH 2APFA 1ZS8A 4IS6B 3TBSB 1J12A 4NUGL 5JMRA 3QIUB 4M3KB 1ZT7A 2VLKB 5ALCH 4FFWD 5EU3B 2BNQD 3MBEC 1I7TA 1CT8B 2BVOB 3OJVC 4HUWA 4QRTA 4OFKA 4D9LH 4KRMB 3O2WL 4KKLC 4U4BA 1MCIA 2NY5C 4Y8AA 1V7NH 2IPTL 3BT2H 3WKNA 4KK5D 4BFIB 1JBJA 2ICEB 3IRPX 4NO5B 4ZFFA 2VXVH 3IU3B 3S35H 3P4LA 2EDLA 1LK2A 3JSSA 4WTWA 3VRLF 3QI9D 2FATH 5HI5C 1GPOL 1CLYH 2YPVL 4PJ9D 3RI5F 3VFPB 4ONOA 4I3SL 5TE6L 4DJMA 5KS9E 3GSRA 1VADB 1ORQA 4PJHF 4LKXB 5D9SB 3ZO0A 3P11L 3VGDA 5FECA 4OGYH 1JZ5A 2BCKB 5F89A 1T7XA 4N0UA 4PJ5A 4RGNE 2AEWA 5C0BA 1MJUL 2PKDA 2ZKHH 1RFDL 4FQJL 4KU1A 4OZIB 2VQTA 2E9JA 5HPOA 3ZE0F 4QCIA 1G6RB 1GXEA 4YHKH 1KGCE 1OP5K 1KB5B 3MLTB 4UV4H 3O4LD 1SJEA 5FOBB 3ZYOA 4EN3D 4KVCL 3FQWA 2UZIH 4DQOH 4EDXB 5MEOB 3NTCH 5M94B 1ZLSL 4DVBB 2QQNH 5ID0B 1N5YH 1NCNA 4NN7C 3ARXA 4R6UA 3UBXG 2O93L 3N1MC 1EEZB 3AU1B 4LPCA 5CHNA 2XZQH 3HN3A 2XN9A 3MUJA 4Z95H 2VABB 4PJCA 3RY5A 4KQ4H 1ZHKA 5GRVK 4FQXB 4QYOB 3G04B 1YPZA 4LDLB 5F6HJ 5LGKA 3G9AB 4L3EB 5I1JL 1FZMA 3L9RA 2FGZA 2ADIA 2EDWA 1T5WA 5FA3B 1DDHB 3SDDD 5DJZA 1P5UA 3WL9B 4JO1L 2YRPA 5I1EH 3ZE1F 3O8XC 4TRPH 3FKUS 1UB6A 2CH8A 5D4QA 5GIRA 1HSAB 4YZFE 2XZAH 3X3FH 4XHJC 2YK1H 5CINH 5DK3A 1SEQH 2OP4L 3ZKNC 2HVKA 3MUGB 1OCWL 1RUPH 2BNQB 4MJ4A 4YHIA 1KEGH 5ITFA 4KJQC 5L6YH 3QEHB 4L9LB 3CK0H 5IV2B 2AQ3A 1CFTB 3WD5L 4RQQA 3TCLA 1MJ7L 4OM0L 1BF8A 4MGXA 1FDLH 2EO1A 3MRQA 3VE0B 1I8KB 3T0EA 4D3CH 1L6XA 1R3JA 1LWRA 3JV6A 2AK4E 1QSFD 4OV6F 5SWSD 5D72L 5DJYB 2VE6B 5EBLA 1NEZA 3QI9B 1ZK9A 4JFOA 4PJ9B 2KKQA 1HHGB 4JQXC 4ONFH 4U1HA 1HYSC 1BQSA 2R0KL 3RUGE 1T0MA 1RK1B 2IAMA 1IMHC 2H3NB 3MRCA 3QNXA 2RJMA 5E8DL 1OVZA 1F5WA 3SDCA 2OCFD 4K7PX 3JWOH 5LWYL 5MEPB 2X7LB 4FN0A 4XVTH 5EU5A 4WTZA 2YA0A 3N06B 1CXHA 2B20A 3FRPA 3PQYE 2W0FA 4JDZA 3QPQD 3NGBC 1OW0C 3N9GL 1IC4H 1M71B 1GGBH 3O4LB 1AJ7L 2QADC 4RIRA 4WNQB 4EN3B 1XGRB 4KAQL 4UUJA 3TZVD 3HMWL 1F6AB 5F88A 3W2DH 4JCMA 3DVNA 3VFRA 4XPGL 3ARQA 2PYED 4OCRL 1DANT 4NCC1 4NBXB 4YE4L 5T1DH 3GMOA 4GAJL 5L88L 3G5XA 1U8MA 1VEOA 1G7PB 1I1FB 3HZYA 3VW3H 2BOBA 3VA2C 3CFKA 2XTJE 4XT1C 2BSED 1YN6B 2QSVA 3MGTB 4JO4L 1GC1L 5FYKE 2J2ZA 4OV5B 3PHOA 5JHLL 3GBNH 2MFNA 1RUQH 1BX2B 2EKJA 1N2RB 1K9TA 3LH2L 3W11D 3QUXC 3SDDB 1T7YA 5I18H 5JORB 5JW4M 2XV6B 3D85A 4P5MA 2FBJH 3MLZH 4MQXD 3CXHK 3KLAB 2A9MH 4OCWH 2NX5D 4PRIA 4FQ2H 4Z76B 1KYOK 3RJDA 4DGYH 4WHCA 5DZLA 2WUCL 2R8SL 2D4FA 2YBRA 3UJTH 1G7LB 3BGFB 3H7LA 3ULUH 5FO8B 2VISA 3T3PF 4M7ZC 5DUBA 5IBLD 3QDME 1NBYA 3BYTA 1B0RB 1J0HA 1MFEL 5ANMA 3ARGC 1WV7T 2XG4A 5HYSG 5IJKA 5DI8A 3C60A 1QSFB 1KJMA 2GYSA 2BSRB 3OKEB 5SWSB 4M6NL 1AY1H 2MOVA 1JF6A 4WI8A 1MCKA 2EDNA 3QNYB 2X70A 1HCVA 2CLVA 5E0QA 2EH8H 3U36A 4J3VA 4ZPVB 4M62H 4OQ1A 4YXHH 2HT2D 4F3FA 3KVQA 4Q9RH 3IXTA 4QXTB 3SO3C 4P46A 1KJ3H 5IW6B 1FYTA 1OM3L 3FN0L 4HS8H 3WFHA 4EUPG 1FFOA 1FFQA 4Y4FA 3NFPB 4RX4D 3DV4B 4Y1AE 1X5XA 2WWMD 2F54E 2CDFB 1A4JB 3U30B 1NSNL 2QBWA 3GSVB 4FFVD 1CL7H 1I4FB 1U8LB 3GNML 2FJFA 4GKSB 1UACL 4ZOCA 5E2UH 5C6PB 5JTWA 2J12B 4QLRA 2DQEL 1JPSL 1NANI 4MHHG 3MA7B 4Y2DA 1XF2B 3TZVB 5EUKA 5C0IA 1V3LA 4C83A 3KPSA 1JYXA 4HUUA 3KPNB 1I3RB 2Z8WC 2GITB 4QTHA 2PYEB 3HI5H 3V6OE 2KQMA 3IFNH 4PJDF 2Y5EA 2YXMA 5A2JH 4PJDB 4OIAA 3VWJC 2VJXA 4GG8B 3VI4E 4HBCH 4XRCB 3WO4C 5D6DA 4BKLA 1P2CA 5F9OH 5I73C 3VA6A 4U1IA 1WF5A 5AAWA 1EO5A 5CUSH 3P77B 4ENEC 2VDRL 2R15A 5F7EL 1OWRM 2EYTA 5IBTL 4Q0XL 3SDAD 2CR3A 3ARBC 3SGEI 1TTFA 4L29A 3WUWA 3CD4A 4QRUB 1PFCA 1NCBL 5DRNB 2AS5M 5DEZA 1FPTL 2E5EA 1UXSB 3Q5OA 1S9XB 1A6WL 5DGQA 2ITDB 3OPZL 2NX5B 3GI9H 3GSWB 5FUCC 2P44B 5EO1A 4O2CA 2DIBA 1FRGH 3G08B 1HXMB 1IM3A 3O6KL 1JFQL 3DYOA 1EO8H 5F7MC 5JUEH 5D1QD 3PDOB 5J13C 3TT3L 1OTTD 3L95B 3FONB 4P4RB 5JDSB 3QCVL 1JGDA 4IDJH 1JHLH 1DBML 4OFYA 4X6DF 2CIIA 3JWOC 4IRZH 5J3HD 1UH3A 5AWNH 5IGXL 4M1GL 1NGWB 1PQZB 3WNPA 1I85C 2AXGB 2F5AL 2DYPA 1HQRA 4NP4L 5DXWA 3MLWH 5AYUL 5IP4A 4I4WB 3LN4B 4ODBD 4NWUH 3MQIA 5C0FA 3PWVA 3CFCL 2FGWH 3ECBA 4RMUA 4L8CB 2GJJA 4YC2C 2JK5A 1JZ3A 1MNUH 5IQ9A 3L7EB 2F19L 2AJXL 5I1IH 2XWBB 5EOTB 1OPGH 1UADC 4O9HH 4PTTB 4XVUD 3QEUA 5C6TL 3TNNA 4BSVA 3GB7A 5FXCH 1FIGH 4CADB 2ZOLA 1SYVA 3C5SA 1A1NB 1K5NA 5HHOE 2YSSB 3BKJL 1D6EA 1TVBA 4PR5B 1NMAH 2A74A 3QXWA 4OGXL 3CX2A 1ZTXH 1ZA3B 2WM0A 1EHLL 1JGLL 1I1YA 4X98B 4GAGH 1EHAA 1K6QH 1FLRL 3RKDD 3QYCA 5EU7E 1KIUA 4XP9L 1BQHB 1NBVL 1S8DB 4MDIB 1ZEAL 3RHWF 4XMPH 3CNKA 1NFDE 3ZTJH 1TETL 3BVNA 2FJHA 1J88A 3FO1A 3SDAB 4QT5A 2GT9A 4O58L 3ZKMD 1OARL 4P9HC 3TVMA 2DI9A 4OFIA 1OTSD 1UH4A 4FZ8H 4MB3A 5C0CA 1I1CA 4BUHA 4YXLH 2AEQL 2JJUA 3QQ4A 1QBML 1QR1A 1JI1A 4OLYL 4WGWB 2KPNA 1NMCB 2OZ4A 5D1QB 2VTFA 1YN7A 1WBYA 1FVDB 1Q94A 3S97C 5EUOE 5JIHA 1J0ZA 3UROR 3AB0B 2BJMH 3D2UA 2NW3A 1JWUA 3HZMA 3ZHKA 4OLZL 3FB7A 1AQDA 3WXWH 3DX7B 1BP3B 1RURH 1PD6A 1U3ZA 3S34L 3CH8A 3F8UB 4D9QD 5TF0A 1GOHA 4HKZB 3OKLB 2ZUUA 2XWJA 5E95B 1FHGA 1T4KA 4M4RA 1LD9B 1RZJL 1ULVA 2BRRH 5T5FL 2A77H 5DMIH 5GGSY 3QDAA 1B6DA 4HWBL 3WIHL 3L3IB 4LIQE 4YGVB 4LGPB 4L8DB 4S1RH 3WMSA 1XF4B 4IRSC 4OCYH 5J4MA 2CUHA 4DW2H 5KW9H 3ZYJA 5IWLA 3RY6C 4WUKL 5T1MA 1MJJA 2Y5TA 1S7RA 2OL3L 3BJLA 4M03A 4K55A 4L4VD 3RVUD 1KIRB 4H20L 4YH6A 4O00A 3BHBA 3H2WA 1WK0A 3D5OF 1N6UA 1QBLL 4XWOC 4M6OL 2VIRA 4Z7WF 1C08A 1K2DA 3OKKB 1C7SA 1YEFL 3OAZH 4QRQA 1I8IA 1CXKA 4Y5XB 4MCYB 4Z7WB 2HJKB 4PB0H 2JJSC 5TJWK 1U95B 4AEIL 5T3XH 1OF2B 4NZJA 5C0RL 1AQKH 4TPRH 5CZVH 3I50H 1I9IL 1C5BL 3PGCA 4ZNEA 4HGKC 1DCLA 1F11A 2XQBH 5MP6H 5DRXA 3M17A 3SKJL 5JIKA 1W2KT 5D2LA 4XNYL 3MLUH 5IG7A 1AXSB 3ARDC 1TVHB 1G9NH 3OR6A 4DKFH 2X4UB 1T6VN 4EXKA 2IQAB 1KUMA 2YRZA 4GQPH 5CILL 1RZ7H 3WN5B 2QHRL 5DQDH 4LFHD 1RULH 2B1HL 2Q8AH 5GISL 3BPOC 5KJRL 4NHCH 4G7YH 3GMQA 4LLVB 4UV7H 1KENH 3VXOB 1IE5A 5K9QI 3AC0A 3NCYS 4XHQA 5CD5D 5ECJE 4ZS7L 2V2XB 1J1OL 3CFIC 3RU8L 1YECH 5FK9A 3JTSB 4H88L 1MCLA 1YDPB 5DMGC 3MYJB 3VFTA 3GI8H 3RWCA 3EFFB 3X12B 5KG9A 2YXFA 3B6SA 1TZGH 3LRHA 4GRLC 5F3HA 4ELME 1SMAA 3RWGB 2OXGA 1TIUA 4U49A 4Z7NE 2XRAH 2EDEA 3ZDZF 4ZS6D 2WBJA 3MNZB 2HLFC 3O41B 3QIWC 3KR3L 5JW5B 1MPAH 1YNKL 3VXNB 2AJYH 1S9WB 1U9KA 1ZXQA 4L5FL 4NPYA 1RZFL 1D5XA 2BSSA 3IS1X 3WHXB 2D0FA 3O3UN 2VDKH 5KOVC 4LCIH 2VZVA 3MJGX 1KXQE 1Q72H 4I0PD 4NQDE 5IB4B 1BPVA 3HR5B 1YEDA 5FUZL 3NABL 1KPRA 3MRNA 4PRHE 5EA0H 1U8KB 1J8HA 3Q1SL 2E27L 4L4VB 5H37G 1UKTA 1EFXD 1HNFA 5MERA 1OGAD 3OQ3B 4U1SB 5CIPA 3OB0K 2B1AL 1YEJH 4H1LG 1ZHNA 2V7HA 3EOYG 4RGOH 2QSQA 3SKOB 1MOEA 1PYWB 4C4KT 4NJAL 2V7NB 4ODVH 1YMHA 1ZE3C 5I71C 1NCAH 4YPGB 3DYMA 2HJFA 5I17B 3RWIB 1I8MB 5DS8A 4JPKH 3V52L 2FWOA 1WAAF 4ZUUB 3X13A 4BFGA 4FZEL 3T8XA 4K23L 1S3KH 2FSEB 4QGTA 1CR9H 4MVBC 3QDJE 1OP3H 3MREA 1YNLH 1JNNL 4FXKA 2IADB 5TDOA 3KS0J 4F9LC 1U8PA 3DRTA 1JHTA 3LQAL 3CGTA 4WFED 5DQ9B 2K3TA 1CXEA 1JHKL 4OZ4B 3UCRA 1SHMA 2HFTA 4NN5B 1NCCL 4PGEB 4OGZA 5JW3L 4Z78B 5KSVA 2JJTC 5FKPA 1I9RL 1EHXA 1YY8B 1E6JL 5DR5L 1EPFA 1DE4A 2EDYA 5KVGL 2ZCHL 3DWTA 4YBLB 4QHUB 2KZWA 1ORSB 4FQ1H 5BS0E 4YEFA 4RWYL 4I0KA 4K3DL 4TVPD 3SDYH 3WLWC 1W0VB 4D0CA 2UWEF 3SCMC 5BV7L 1LEIB 3TM6A 1PW3A 4JGUA 1MCBA 2XQYK 1T04A 1RZKH 4GMTH 2UWEB 5DLML 1G7MA 3BN3B 2OZ4H 3PWUA 3VMPA 1ZWIA 1BREA 4P5TA 4AY0A 5IKCB 1I9EA 2WV3A 3O11A 3MRFB 3CFJB 1A7OL 5D1XD 2YC1A 4MLSA 1BF2A 2PTVA 3QG6B 1RU9L 4RISL 4XTRD 4IIQB 1CFNB 1UB5B 3DXAE 3R06A 4G6KH 4HK0B 2NY0D 5IROC 4NSKB 5EPMB 1KG0B 2A6DA 3O2WH 3UMTA 2QQKL 4JHZA 5DSCB 2F53D 2I07A 1MQKL 4YHPB 3TBVB 4LDOB 5DJ2B 1CXIA 2DB8A 2IPTH 4I0PB 4UOW1 4CMHB 5MENE 2Z31A 2OMBA 2UVEA 1PSKL 2QL1A 4H8WL 1I1AA 2H45A 1GH7A 1AE6L 4TULL 3ARPA 5BZDA 5J1AA 5J56B 1GPOH 4M7JL 4UQ2B 1EFXB 3TA3C 5TE6H 1IEAA 5BQ7B 1OGAB 4OQTL 5IIEA 5TQ0H 4NJ9L 4BQ9A 4F2MA 5K9JL 5I1LB 3P11H 4MAUL 4L8SA 4HG4K 4LVNC 1IAIM 1VHPA 4UTAL 3ALXA 3AROA 3C6LC 4ELKB 5B21A 5CP3A 2HKHL 5C0JB 1RFDH 4FQJH 2EYSA 3LDBB 4ZUWB 4BSWA 4WV1B 4KVNH 5MHSD 2B4CH 2CK0L 4X9GA 1PJ9A 1KXTB 3SEPA 1OB1B 4NNYB 5BZWB 5FYLD 1BJ1H 1U8QA 2P5ED 4NKMB 5H37H 4CW1A 1SVCP 4JQIL 4OZGF 4KVCH 3P4OB 3BZEA 2DRUA 4N8VG 2FEEI 2HT4D 4OZGB 4M4PA 3UX9B 2N7BA 4KKAD 1ZLSH 3SE8L 5K93A 3BEVB 1CS6A 5EH1A 4WHTB 3GUTB 2LQRA 3BP7B 2ENYA 5HHPA 4YBQD 2A73B 3H0TA 3WKMH 3BIBX 1HWHB 2YR3A 4MA8L 1QA9A 3LVEA 5TGBB 4RGNC 4TUJA 5E4EB 3PHQB 5SX5H 5HHNA 1KCKA 4NRZB 4PJCE 1CK0L 2AI0L 3QR2A 4PB9L 4AIXA 1MFCL 3LKRA 1OAQL 5AUMA 4G8EB 2FO4B 4RGMC 1E4KC 4PLJC 1KC5L 4JO1H 1VGKA 2VZSA 2BOCB 3MBED 4LSSH 3AXLA 2CGRL 4KI1A 5CMAA 1NCWL 4HHAB 4HC1L 4KKLD 5DTFA 1NCUA 4QRRA 5D1XB 3MLYL 2HTKC 2OP4H 5F9JA 2IH3A 3IDNB 3C08L 1OAXL 2VH5L 2Y7QA 1RIVL 1GOFA 1OCWH 4I48A 5FUOL 1F90L 2RCSL 1OQXA 2NY0B 5I2IB 2AJVH 1B9ZA 1TZHA 5HI5D 4X5WA 2VR5A 4HKJB 5GRJH 3WD5H 2F53B 1MJ7H 4OM0H 3RWDA 3TV3L 3S6CA 1ZT4A 4PRPA 3I85A 5BJTA 2B5IB 1LVEA 4M5YL 1B0GA 3RBSA 3U0PA 5D72H 4HMEA 3LSOA 4X7CC 4M61A 4P4KC 4ZSOA 4PS4L 1ZHBB 1K4DB 3F5WB 5HYQB 2R0KH 3UJIL 3WS6A 4ZD3L 1G6RL 4L4TD 4W4OC 1P9MC 1KB5L 4FABL 3D69B 3NA9L 3KG5A 4JEGB 1LP9F 5CIPH 1TFHA 2X4OB 5C07A 1RK0B 1N59B 4LDEB 1LP9B 1NBZB 1D5BB 5E8DH 3AREA 1X6LA 2EE2A 3OWEA 4JFEA 2APBA 4P2RD 5LWYH 4E41D 5DJAB 3QSKB 4EVNB 1CDGA 3DBXB 1DSFL 3EKCA 3FOMA 4I8DA 3VXPA 4R4BA 5JW4R 5E8OA 2P5EB 5A2LH 3N9GH 5HDQH 5JXEC 2JB6A 1F2XK 5EBWB 1F6LL 4G5ZH 3P9LB 4KAQH 2BVYA 5D5MA 2FR4B 3HMWH 4LQ1A 1RZKC 5SV3A 4XPGH 3O6FC 2YN5A 4OCRH 3REVA 4ZXBC 4LKCA 4LCCC 1CF8L 4YE4H 4LLDB 2BY0A 1M6OB 4MJID 5L88H 5I75B 4ODHH 2WBKA 2H2SC 3BP5A 2R0ZL 4HQQL 3HI6H 3STLB 2X9WA 4PJIF 3UTPE 3O8XD 5C2BL 1GC1H 4PJIB 1XGTA 4PRDA 4XHJD 3OHXA 1WZ1L 3EYSH 3QJHA 3RZCC 5EZOH 1AI1L 4RSVA 3ZKND 5DJ0A 4H0HB 3MBEB 2V2WB 2YA2A 4KJQD 1BBJB 1BVZA 4LCWD 3IFPA 4G6AC 1BIIB 4Q6IC 3RDTA 4XP5L 2PCPB 3MLVL 3QEQD 4NO3A 3D18B 1CD1B 1EBPA 1PY4A 2Z35B 2ENSA 1JMXA 4WHDA 2WUCH 3WCYA 2R8SH 2NY2C 3FB5B 5EZJB 5IW1A 3IXAB 4WW2A 1BD2D 5D6CA 3BIKA 3FB8B 4N0CC 3U2SA 3TO4C 1N0XL 3RGVA 4HIXL 3PV6A 2VN4A 2FEEL 3LKNA 1HYSD 4GXVL 1J0YA 1MFEH 4PGCA 4JZJA 4HJGA 1TQBC 1A9EA 4DK6A 3PWNA 2B4CC 1YEIH 4M6NH 3KXFE 1R5WB 4KQ3H 3E6FB 3O2VL 2I9LB 5D7LE 5C0DB 2ADFL 3ARTA 4KK9C 1S7WB 1UT9A 4KXZH 4L4TB 2ATKA 4HWBA 3WIHA 2EE3A 1PKQB 4AEFA 2FZ3B 2BY1A 4ODXA 43C9A 5C0EB 1OM3H 1FGNL 1IL1A 3B9KA 3MNVA 3MJ8A 2VLJD 2JE8A 2OL3A 2QADD 4P2RB 4E41B 2UVFA 2HAZA 4NFCA 5CP3H 5LCVL 3RWFA 1NSNH 3GNMH 1UACH 2BFVL 4NN7B 4PGDB 2DQEH 1JPSH 4Y16C 3EO1A 3AS0A 3OF6A 4GBXA 1UVQA 4DK3A 2CQVA 3BPCA 4XNMB 1OSPH 1RZGB 4PJAF 4XNQB 5E8NA 3IDGB 4KKNA 3K81A 4JFQB 5IFAL 5ICXA 4MQ7A 4MJIB 3VFMA 5F71A 3QUXD 2BNRA 4NQXA 1A2YB 1HKFA 3BXNB 1B3JA 1P7KA 5C0AE 4U1LB 2WK2A 4KDVA 1CFBA 3O8XB 1F3DH 1MCRA 2VDRH 3HI1B 1CGSL 4XWGL 5F7EH 3ETBF 4LVHC 5FYJE 1P53A 1LQSR 3ZL4L 4P3DA 5ERWB 3OKMB 4XP1L 3T0BA 1LO3L 5IBTH 4Q0XH 1M05B 2ZJSL 2D3VA 4ZUVA 3T0DA 3LKSB 2VXQL 5L0QB 1NCBH 2VQ1A 3KPMB 3RBGA 3ARZA 1FPTH 1SQ2N 3CXDH 4K7FB 5GS1C 4LCWB 1J0JA 2MKWA 1A6WH 1FZOB 3QEQB 1QTYT 1Q0YL 3OPZH 4LIQH 3BKYL 4Z8FL 4QOKA 4EBQL 3ARGD 4JFZL 5DD6A 2EIBA 3KPOB 1YEEH 3O6KH 1JFQH 1QACA 3S36X 3D39E 1C1EH 1M4KA 5AD0A 1HH9B 1VFAB 4JJ5A 5EC2A 5ADPL 1BD2B 3TT3H 1KXVC 4WI6A 3CSPA 1PZUB 5SX4I 3HG1E 4YX2L 3QCVH 1V3MA 5EBMB 2CUMA 3NN8B 3S88H 3BKCL 4ZOEA 2ZOKB 5GSVA 5DJ8A 1A6TA 3SE4A 5IGXH 3EYVB 1MREL 4M00A 3PXHA 2CIKB 2W0PA 4M1GH 4B5EA 3ZYZA 3WIFA 3HPLB 2F5AH 2C1OB 1U92B 1ZGLA 3NIFE 5F6IC 2OTUB 4QNPE 3QUYA 4Z5RA 3VFVB 4OCLC 4NP4H 3IJSB 4JFPB 4DAGL 5AYUH 2VXUL 4HWNA 1KLUA 4W6XB 3NGBB 4OD3L 4LRNH 2VLJB 3BD4A 2QADB 4YDVA 1R3LA 3QXDA 1NGXB 1EDQA 4N9GA 4WUUE 5JHDA 1P84J 1MLBA 4Z0BL 5DHVA 1EX0A 2F19H 2AJXH 4YPJA 3U7AA 5GGUB 3NCCB 2MSPA 2EDRA 3RTQA 4GG6A 1S78C 2HH0L 1RJLA 1WBZB 2L4OA 4UOJA 4U1JB 4KPHH 5C6TH 4R0LA 3VWJD 5EOCJ 4NQCD 5I8KL 1DEEB 1L7TH 4OZHA 4LNRA 4S0TD 4ENED 1BVLB 3BKJH 5DGRA 1OAZL 1MWAB 1ZVSA 4OGXH 3V7MA 1MCEA 3HZKA 3QUXB 1JGLH 1EHLH 2P8MA 1X7QA 1FZKA 2GEEA 2FX9L 1D5IH 1FLRH 4W68A 4XP9H 3EZ8A 2NZIA 4U7MA 5J6HB 4V1DE 1NBVH 1MY7A 3CX5K 1ZEAH 3GIVA 3AS3A 3CAFA 5AAMA 1TETH 1U3HA 4K8RC 4M3JA 3BGMB 5ICZA 5IM7A 2W9LA 3ABZA 1KTDA 1SJXA 5FM5O 4O58H 3VGAC 1OARH 1FL5B 3BYYA 2A6IB 4M7ZB 4CUCA 2A9NL 1EK3A 4PJBF 1I7RA 1BGXL 3IJYB 1DZBA 4UB0L 2AEQH 3EYUL 3ARGB 3EYQD 2DI7A 4PJBB 3OTTA 5DFTA 4OLYH 1KNOB 1H15A 2BSTB 5E56A 1NANH 1F02I 2MQ3A 1SM3H 3F7YB 3RGHA 5HGDB 4OLZH 1PDKA 3D3VA 3A67L 2C7UA 2AVGA 4CU7A 4OD2B 1DTUA 5DK2B 4E42B 1NDGB 4LBEA 5EG6C 1BFOB 3S34H 4TNWF 5I1KH 3GJEB 3P4NB 5B38A 3U0TB 1S7XB 4NYLA 1XMWA 4CNIB 3LKOB 3MJ6A 1OY3B 4YQXL 5JOFA 5T5FH 4QXUL 5DQJA 4HWBH 3WIHH 1HQ4B 3LHPL 1QLRB 3FQUA 1W0YT 2ESVA 4WUKH 4XCFL 3L3JB 4OQTA 4ZFZA 1HHIA 4KKCD 1EGJL 5EO9B 3G6AA 3FT2A 5JPMB 5ENWB 1WWWX 5KOMC 3BESR 5JNYA 4W70A 3ES6B 2YRLA 1QBLH 5DEFB 4M6OH 3TN0A 3G9VA 5DVOA 3FO0L 3VWJB 1YEFH 3DUUB 5KSBB 4NQCB 3WO4B 5I73B 3H9SA 1DJSA 1LE9B 3T2QA 4AEIH 3CC5B 4JANA 4RFEA 1R5IA 4R7DA 4XPBL 1UGNA 1DBBL 3RL2A 4PJEF 3WEXA 3GHEL 2R23A 1I9IH 5JQHC 1FL3A 3KPQA 4PJEB 3RVTC 5DMKA 1HKLL 3SKJH 4XX1E 1HN1A 2Z0BA 4XNYH 3VFOB 5IB5A 2M1KA 4LCUA 1FG2B 3ZT7A 3BZFA 3MRIA 3UP1A 5E4IA 5D2LE 2QHRH 3RFZC 3ARUA 2GHWB 4MD5B 3IAQA 5KJRH 3BWAB 3F7VA 3RIFK 2BVPB 1JMZA 4IS6A 2ZSVB 3TBSA 4LLYB 3QIUA 2JCCE 5TE7L 4ZS7H 1XIWC 2VLKA 4JR9L 3RU8H 3CZFB 4H88H 2VKXA 2BVOA 1AR2A 5EIVA 5A3IC 5JA9A 3W9DB 3MRRB 3GRWL 2Y6SC 2ICEA 4NO5A 1JNLL 3JVGC 1DP0A 4HC1A 3U83A 1RJZB 3IU3A 3W0WD 3IDMA 2X40A 1FZJB 2X09A 3MJ7B 3KR3H 4XCCL 4MCZB 1B4RA 4RMSA 3VFPA 4PJXE 4WI5A 1NL0L 2UYLB 4BUGA 1QFUL 1VADA 3VXRD 4IRSD 4L5FH 4LKXA 1RZFH 3L5JA 1RZ8B 4X6CF 5DWUL 1B2WL 1HXYB 3GMPB 4JVUA 4X5LA 3FB6B 2NNAB 2BCKA 4X6CB 4YC2B 3WXVL 4LLAA 1IAKB 4MB4A 4OUOA 2J88L 5FUZH 1T2QL 4OZIA 1SMOA 2FX7L 1MIEL 4XWOD 5E70A 3NABH 4JM2C 3QWRD 2DQTL 1G6RA 3QULB 3Q1SH 3GM8A 1KB5A 4MYWB 2GQHA 3MLTA 5F72S 5FOBA 5T1KD 2B1AH 4ODUB 5DHVH 3LRSB 3QQNA 2QV2A 4KRLB 3UBXB 4EDXA 2J5LC 2HT3C 5MEOA 4OCNC 4WO4C 1C5DB 4MXWL 4DVBA 2YD1A 2C26A 2XKNB 3KYOB 5ID0A 3LZFL 3NCJL 4XNUL 3LKQA 3BAEH 3V52H 4OLXH 1NLBL 3NIGE 1EEZA 3AU1A 5FHAH 5JOPE 4M5ZL 4FZEH 4HWZB 4YDJB 2VABA 4QGYA 1CLOL 4R26L 4ERSL 4FQQB 4FQXA 4QYOA 3G04A 5TQ2L 4HPOL 2DJUA 3EJYC 1MHPL 3UTZB 5JIPA 4LSTL 1MF2L 2AKRB 1MCDA 1DLHB 1J9CT 4JFFE 3LQAH 4JCLA 3MCKB 5FA3A 3RL1B 1JHKH 3H3PH 3OZ9L 5LGHL 2R56L 4YNYB 5FO9B 4MZ3A 5JW3H 4PP1C 1I9RH 5DMGD 1E6JH 1HSAA 5DR5H 3IKKA 5HDBF 5KVGH 2X1QA 2ZCHH 1IM9D 3N85H 4PJ7F 4GRLD 3HZVB 5JZ7C 5GGSB 1WLHA 3O3DB 2C3VB 4ZO7A 3MUGA 4PJ7B 4RBPH 2BNQA 4RWYH 2YMXL 4X7FC 1KPVB 4K3DH 4XPTL 2NCMA 3UTTE 2RR3A 1U3YA 3QEHA 4L9LA 5BV7H 2HLFD 5IV2A 3QIWD 2F5BH 2DKUA 3OAZK 4WU7A 1CFTA 5EIQA 3UAJD 5DLMH 3Q5TA 2RGSA 4U33A 3VE0A 1I8KA 4OB5H 2D2OA 4HH9B 3W0WB 4F15C 4W4NA 5DJCB 5DJYA 2VE6A 3QI9A 3K80A 1A7OH 3IRZA 4PJ9A 1HHGA 2PW1B 4UINH 1CFQB 3RVVC 3ILPB 5IR1B 1RU9H 2QJDA 5E6ID 4GRWF 3VXRB 1H3PL 4IRSB 1RK1A 4F57H 4I5BB 4X6EA 4JHAL 1RQ5A 2H3NA 3JWDC 1YC8A 4OLVL 4B50A 3L3OB 1D5ZB 1CTOA 2QQKH 4JFXB 1MQKH 2Y72A 4J4PA 1KIPB 2R1XA 4PTUB 1AGDB 5MEPA 1F13A 1T2JA 2X7LA 4YHML 3DO7B 1U58B 1AE6H 4TULH 1ZLVH 4M7JH 5K9OB 1AO7D 1M71A 3B43A 1U8IB 3O4LA 4OQTH 1N7ML 4WNQA 5T1KB 4NJ9H 2N4IA 1XGRA 4EN3A 2HLAB 1IGIL 3EJZD 5K9JH 1F6AA 4MAUH 4MVBD 2H26B 4UTAH 1S7SB 5CGTA 3PG2A 2JIXA 1U93A 5CSBA 4HF5L 4Y0GA 2I9TB 1WJ3A 3ZZ1A 1I1FA 3ULVD 4ODSL 1NMBH 3BPOB 4J3UA 5D8JH 4X9BA 2DQJL 3UO1H 1YN6A 1KV3A 3ZKXB 3MGTA 3VXUD 4G6FD 4S1SH 1KULA 4OV5A 4MJ5A 4JQIH 3O3EB 4LGRB 1N2RA 3M45A 4FFYL 5I1CL 2HFGL 3SDDA 2F74A 3DYPA 1T5XB 1XCQB 3SE8H 5D1ZC 5JORA 1CGYA 2ITCB 2AGJL 3I3DA 3QQ9C 1HOCB 3WLWD 2O5XL 4YXKH 2M8XA 2VR4A 3HE6C 4Y2OA 3SCMD 3KLAA 4MA8H 4Z76A 2X41A 1IM9B 4GRLB 5EC1B 4LOUC 1KN4H 5CKGA 3MV8D 2WAHA 1G7LA 1TTGA 4NIKB 5FO8A 5HYSB 1XT5A 1CK0H 2AI0H 1P1ZA 3QIWB 1A6VL 2COQA 1ND0A 1B0RA 1CCZA 1GGUA 1GGCL 1KC5H 1PGRB 1S5HA 2ADGB 4Z7QF 4PRNB 2CGRH 1NCWH 3OKEA 2BSRA 5SWSA 3D0LB 2VC2L 5T33L 1ZT1B 4HC1H 1T0PB 2HVJB 2A0LD 2XKSA 1OP3K 3QNYA 2DQGH 1G7HB 5E6IB 3C08H 1EV2E 2VH5H 1RIVH 4EUPB 5FUOH 1CG9A 4NQEA 2RCSH 4NNPL 3FAWA 1EO7A 4QXTA 4U6VL 2D31B 3H8NA 4LSQL 4Y4KC 5SWZD 3TA3D 4MNHB 3GFUA 3TV3H 4R0LC 1IEBB 1T22B 4NKIL 3NFPA 5B39G 3DV4A 1S9KC 2GK0B 1FNHA 2CDFA 1A4JA 5BRZE 1FJ1B 2Q1EA 1BJ8A 5I71B 1I4FA 1IAMA 3C6LD 4GKSA 4PRPE 4F9PA 4PS4H 3WV0A 1AO7B 4BQCA 3UJIH 4KV5F 4AM0B 4ZD3H 3MA7A 1XF2A 3TZVA 1KB5H 4FABH 3NA9H 3U4EB 3BOVA 4KTYA 4RCAA 4RFOL 3VWKA 1UCTA 3KPNA 3BJ91 3QT2A 3O9WC 3O2DH 2GITA 1NAMA 1KLFA 3B5TA 2PYEA 2V5TA 4KMLB 1AGFB 1DQMH 3E3QE 4OFDA 5ILTL 3WJJA 1WFTA 3ULVF 4PJDA 1A7PH 2OYPA 5DJXB 3BSZL 4GG8A 4XRCA 3HC0B 1RZIB 5E9DE 4JFEE 3THML 3P77A 3VXUB 4G6FB 3WBDA 1Z2KA 2P45B 2VQUA 2CD0A 4JLRB 5BV7C 2E9WA 4ZODA 1NKOA 4TVPL 3HNTH 3HUJF 4RGND 4B41A 1K4CB 3EFDH 4HGMA 3IT8D 3HUJB 3MSPA 1GOGA 3F65A 4QRUA 3AS1A 1WAAE 4OD1L 2ATPB 1UXSA 3LB6C 3SCMB 4AL8L 3S5LG 1S9XA 1ODAA 2ITDA 2NX5A 1KGCD 4QHNB 4HIIA 4LAJH 1EZVY 2R0ZH 4HQQH 4PLOB 4PLJD 4F7EB 4M6AA 4UNTA 5I76B 3MV8B 4AENB 3HC3L 2IMMA 4NOBA 5E6ZA 2X4TB 1HXMA 3GSOB 3MRPB 2I24N 3L95A 3FONA 3GSQB 4P4RA 5JDSA 4XBPB 2DLEA 1JZ2A 2QKIB 1QD0A 1AI1H 1QPXA 2I27N 3GMMB 2VKWA 3FQRB 5IBUG 2P8PA 2LFGA 2APXA 1Q9KA 4S11A 2CXGA 3MRHB 3VDAA 4XP5H 1N64L 1NGWA 3MLVH 1QPPA 5FHBL 1PQZA 4C4KO 2AXGA 3K4AA 3MC0A 4GMSH 1KCSL 4LLMB 2ADJB 4HUMB 1Y18B 3VRJA 4XX1G 5IHUL 4P4KD 4X99B 1A6UL 1N0XH 4K7PL 3L3KA 3LN4A 4I4WA 4HIXH 3CJJA 5SWZB 3BP4B 3TA3B 4GXVH 4C54A 1FFRA 3GHBL 3IS0X 2ZG1A 4L8CA 1XGPA 3S3PA 4LVNB 4M1CC 3W81A 3L7EA 5D7IE 1IC7L 3C6LB 1XEDA 3K2UL 3O2VH 3V4VL 1ONQB 4MD0B 2ADFH 2XWBA 5EOTA 1YUHB 3QFDA 5SX5K 5FYLL 1UKQA 4PTTA 1HDMB 1D5MB 1YEKL 5KVFH 5HVHC 3GMRB 3VGGA 4CADA 4QF1B 1A1NA 1FGNH 2AK4D 3DIFA 5JXED 1ZANL 2Y25A 4PR5A 4BELD 5HI3C 1EGJA 1C16B 2E8ZA 5KS9F 3PP3H 5E7BA 1ZA3A 5LCVH 5EU6D 4G7VL 2ZUVA 1A6AA 3UPCA 5KS9B 4X98A 2IFFL 1XF5B 1FNEB 3DLQR 2BFVH 3GSUB 4YWGL 1CIUA 1BQHA 2DIAA 4KFZC 4K3JL 5AYQA 5LGJB 3C5JB 2H2SD 3BEWB 3TIEB 2UY7A 2ZUSA 4RGNB 3SDAA 1P5VA 5INCB 4J1UB 2Z92B 4DN3L 4LLUB 1F4AA 5IFAH 5DFWH 3PQYD 2N56A 2YWYA 3RZCD 4RGMB 2NY5L 5F7LB 3ARSA 1RUML 5C08E 5FYJU 1O5DT 4PUBH 4G6AD 1CGSH 4M9PA 25C8L 2BNRE 3SQOL 1IQWH 3ZL4H 4XP1H 3LOWA 1LO3H 2DKMA 4P23A 3Q6GL 4I2XE 4JPVL 3VH8G 2EO9A 2FHFA 2NY2D 2VXQH 3EJJX 3QCTH 5E2VL 4WHYG 2UY6A 3QUMB 1QHOA 4N0CD 2OI9B 4ZOBA 3TO4D 2AQ1A 2XTJD 1Q0YH 3BKYH 3F58L 3JV4A 4Z8FH 4X7SL 1X6NA 4EBQH 3QO1B 4HKZA 5BW7A 3DX6A 4DUVA 3OKLA 3GRWA 3W5MA 1LD9A 1BZ9A 2DQCL 4X7EC 5ADPH 4ODTL 4K2UL 2YD4A 4P4KB 2LV4A 4YX2H 4YGVA 1MUJB 1MCCA 4L8DA 4YZFF 1XF4A 3BKCH 3L5HA 4OKVB 1WSST 3TF7C 3SE9L 1MREH 2ZSWB 1KIRA 4RMQA 4FG6C 5HGHB 3WNNA 1WIOA 3WS3B 1H0DB 1QEWB 4NQVB 3BMVA 5F7YC 3FT4B 2X89D 3OKKA 3QDMD 4Z7WA 4Y5XA 4MCYA 4DAGH 2HJKA 4LLQB 5IHZB 2AK4B 1OF2A 4OD3H 4Y16D 3PWPA 4R2GC 3I6GB 3UZVB 1S7QB 3RUGF 1CDCA 4XXCA 5EU6B 4YHLL 4Z0BH 5HXMA 3RUGB 4E0RB 1AXSA 1TVHA 4ZOAA 2ZCLH 1I8LA 4LCCB 5JHDE 5T1LD 2X4UA 1S7VB 2IQAA 1AC0A 3WN5A 3F62A 4MNGB 4S1QL 1DBKL 1T03H 4GG6E 1FORL 4Y1AD 2F54D 3GDBA 4LLVA 3VXOA 3IFOB 3PQYB 3C8KB 5IJVB 1EBAA 5D2NA 2V2XA 3ARFC 3RZCB 4F37F 3JTSA 3DVFA 3P3YA 2RQ8A 2FX9H 1YDPA 4PJ9C 4I13B 3MYJA 1ZSDB 5CCKL 3EFFA 1C5CL 1X5YA 3X12A 5IHLB 1U8JB 2AEIT 2YUVA 3JBG7 3FO2B 3RWGA 4CDHA 2NY2B 4L8BB 3MNZA 4YHNB 5JW5A 3VI3E 2A9NH 3TO4B 5I16B 1S9WA 2XTJB 1BGXH 1FCCA 3LPFA 2P46B 3EYUH 2NXYC 3HCVB 2WIMA 5F9DC 3WHXA 5I15L 4GRMB 5DD0L 1DQLL 3CDCA 3DROB 4YUEL 5C2UB 1CBVH 3CZJA 1N5AB 3O6ML 2VITB 4XPHL 3OJ2C 1L0QA 1A3RL 2HN7A 2CJUH 1UJTA 3MV11 4HEPG 5EORH 5IB4A 2E9BA 5ABDE 3HR5A 4FQHB 3SJVE 3SGKA 5KSAC 4MXQC 1PX4A 3IVKB 2PTUA 4H1LB 4HH8A 4RAHA 2H41A 5CBAB 4L4VA 5DA0B 1NDMB 1KEML 5KN5B 4U1SA 3BE1L 5ITBL 2ZNWA 2VLRE 5F1NA 1VEMA 3UXFA 5KVDL 3SKOA 1PYWA 3FFCE 4O2FB 1NGQL 3QDMB 4U05A 3L3HB 3ZMRA 3IDYC 1F4XL 4NKDB 3TC9A 4YPGA 4QXUH 3PJSB 5B8CC 5I17A 3RWIA 1I8MA 1AP2B 3LHPH 1S78D 4ZUUA 3I6KB 4LHUG 4Y16B 1QSVA 4NRYB 5HGGS 2FSEA 2QR0B 3PIQB 4XCFH 4A6YB 5H35B 4WI3A 2IADA 1EGJH 1MWAL 1F4HA 1WGOA 5T1LB 1P6AB 3RNKB 5DQ9A 4OZ4A 4MXVE 3U7WL 3QEGL 4PGEA 3LEVL 5SX4H 5CP7B 4Z78A 4Y1AB 2F54B 1YY8A 4XPBH 4GW5B 4LVHB 1DBBH 3H6JA 2ZUWA 4QHUA 3GHEH 1ORSA 4HFUL 3ZT6A 4K8RD 1PX3A 4OGYL 5AZ2L 1HKLH 3RWHB 1IC1A 1W0VA 2FJGB 1LEIA 5GS1B 1JI2A 2XOTA 3NA4A 1G7JB 2UWEA 3UBXI 2EDDA 1NGZB 3PABB 5HHOD 4I9WE 5CZXC 3CUPB 5ESAB 2ICWB 3KYNB 3VI4F 5IKCA 2DJSA 4I1NB 1YMME 3MRFA 3X3GL 1X5HA 5TE7H 3U30C 1KFAL 4CN1A 3QG6A 2J8UB 4JR9H 3KHOA 4IIQA 4P49A 2QQNL 4U1NB 1CFNA 1UB5A 1HSBA 4HK0A 5DD3L 1KCUL 2VAJA 4NSKA 5EPMA 1KG0A 2CMRL 1EH9A 2FLRT 3TH3T 5DSCA 1LEGB 1J05B 2QQQA 3N1FC 4JKWA 4YHPA 4NFDA 5DJ2A 4I0PA 5J12B 2XZQL 1JNLH 5H8DA 4KQ4L 5F6IB 4O5LL 1AFVL 2OM5A 5AEAA 1JWSB 3JUZA 3J7HA 4UQ2A 1EFXA 2MMXA 1FIEA 1NL0H 5BQ7A 4B53A 4JPIB 5DWUH 1B2WH 4F7TB 1NGYB 5I1LA 4IM8A 3WXVH 1Z0MA 4ELKA 2XZAL 3QH3B 3X3FL 4OKDA 4E5XB 3W11C 5C0JA 2J88H 4ZUWA 3SBWC 2FX7H 1MIEH 3RIAK 4EZMA 3V5KA 3MUY1 5CJXC 2A6KB 1OB1A 2DQTH 4NNYA 2ZPKL 5BZWA 4DN4L 2ZCKH 3CK0L 1JGUL 4OZIE 1RV6X 4NKMA 2Y1VA 4AQ1B 4BSJA 3P4OA 4HKXB 3G6JE 2C5DC 4OZGA 3T2NH 4I77H 1JK8B 43CAB 4MXWH 1QBAA 3RVTD 3BO8B 3BEVA 3LZFH 3NCJH 4WHTA 3GUTA 4CVZB 4XNUH 3BP7A 4ETQB 3H42H 1NLBH 1JVKA 5JLZB 2A73A 1Z5LB 3O0RL 4KDTA 4BK4A 4U1MB 2IPUG 4M5ZH 5TGBA 1CLOH 1TPXC 4R26H 4ERSH 5I1HL 2IPKB 3RRQA 4HPOH 1LO0L 4G8FB 1DBAL 1MHPH 4NNXB 4NRZA 3VGAB 4LSTH 1MF2H 3SE3C 3JWOL 5DVNA 1HZHL 2FO4A 4X9IA 4XVTL 1QYGL 1A6PA 1XIWD 1AHWC 2QSTA 3OZ9H 5LGHH 5HHOB 2BOCA 2R56H 2V17H 5LBSL 1I3VA 5A3ID 4HHAA 2NMSA 4HMDA 4HV8B 2EYRB 2GCYB 8FABB 2Y6SD 4Z77A 1JIBA 3W2DL 2PETA 4XPTH 1NFDF 4PJ8C 5I2IA 1NFDB 4G43B 4HKJA 3SKMB 1NC4D 3X14B 1UCBL 2F53A 5KTEL 2LABA 1WC7B 4G8GE 4IMLB 4XAKE 3LQZB 1A1OB 4BH7B 1J5OL 1UWEL 2BC4B 1B6UA 2D0HA 1HNGA 3QZWG 1YYML 3GBNL 3HMXL 2A2QT 1ZHBA 3F5WA 5CZKA 5HYQA 4XCYB 2XG5A 1A4KB 2VDOH 1H3PH 5EUOF 3D69A 2EZ0C 4JHAH 4JM2D 4OZFG 2M26A 4OLVH 5EUOB 5GZOC 2X4OA 4MJ6B 3KPRE 1RK0A 1N59A 1LP9A 1NBZA 1D5BA 1G9EA 1SEBB 2JJWA 5DJAA 5DMJB 4DTGL 4YHMH 3VFSA 4EVNA 3DBXA 1GRWA 2HT3D 5T5NG 4WO4D 4P3WA 3T0VA 4LPVA 2P5EA 3GMLB 3EO9L 1VFUA 5F1IA 1N7MH 5EBWA 3VFUB 3P9LA 5A16B 1IGIH 2FR4A 2G75B 4XC3L 2R1WB 4P9HL 4NQDD 5IVXA 5D1QC 3WHE1 1M7IB 3EJYD 2YHGA 2XY1A 4TTDC 4HF5H 4LLDA 4PRHD 1M6OA 2XIDA 3AB0C 2MQCA 4R4NC 4MHHI 2VZUA 4YXHL 5IMLB 4ODSH 3STLA 4MJ2A 2X2YA 1W72B 1SYSB 3KWWB 3MLRL 1T2XA 1Q38A 1JF5A 4FFYH 4OIBA 5I1CH 5JZ7D 1MI5E 1XIWB 1KELH 2AGJH 3BZ4A 3MBEA 2V2WA 5GGQL 2O5XH 4FQCL 1BBJA 4NC1C 5HYJE 1BIIA 3QDJD 2PCPA 5E5RB 3D18A 4WEMB 1CD1A 2E7MA 2Z35A 4JB9L 1II4E 32C2B 3B3IB 3FB5A 4Y88A 5EZJA 3FB8A 3O81A 4HIJA 3FCTB 4A2MA 5DEGB 4GLRI 1A6VH 1NC4B 4Q2ZB 3RVVD 4LAQL 5JQ6L 1JRHI 3QG7H 1GGCH 4Y5YC 4ZPTB 3C8HA 3HHRB 2BHZA 2MQ0A 3L3DB 5SV4A 2R69L 5T33H 5BS0D 4PLNC 1R5WA 3E6FA 1MCWM 2I9LA 4GOSA 5C0DA 4JFDE 1QSEE 1S7WA 5IMKB 4JM2F 4L4TA 5E5UB 4NKQB 4YGAB 1PKQA 5LKNA 1K85A 4NNPH 4JM2B 4ELMF 5F6HI 4ZNCD 2FZ3A 4HPYL 5HHME 1RSFA 3FQXB 4LSQH 4RRPG 4ELMB 2C1PB 2DJ4A 5C0EA 4Z7NF 3FQTB 1X5FA 3AY4C 2H9GB 4C56E 2CSPA 4NQEE 1S9YB 4PG9B 4QWWC 3I2CL 4NKIH 4P2RA 5ISZE 4E41A 4UNVA 1NCDH 2J5LB 4JRXE 4WO4B 3ZKMC 2EDQA 3CSYB 2VUOA 2V5SA 3PGDA 2NLJB 4PGDA 1CGUA 3RIAF 4RBPK 1ED3B 3DXAD 1P4LB 3ZTNL 1JHLL 2P48B 8CGTA 2AJ3B 2W60B 4IRZL 3VD5A 4OCSL 4PRBB 4RFOH 5MEND 4XNMA 5AWNL 4NQDB 1MJ8L 1RZGA 4N1CA 3IDGA 3BH9B 4Z7VE 5INDB 4JFQA 4M02A 4JKMA 2QQLL 4PRHB 4MJIA 5ILTH 1DQDH 1J11A 3FFDB 1HI6B 3BSZH 1A2YA 3BXNA 5D1ZD 5F97E 4U1LA 3THMH 3O8XA 3HE6D 3HI1A 3MV01 2J4WH 4WY7L 4NWUL 3CMGA 1AIFA 4U6HB 2WANA 4TVPH 3OKMA 5ERWA 2FGWL 3LPWA 1M05A 4LOUD 2EH7H 3DUHA 1D6VL 1CGWA 2K9UA 3LKSA 4M93C 4UT7L 3AAZB 3KPMA 4OD1H 4K7FA 4LCWA 1BQLL 3MCG1 1ROWA 3QDJB 1HHJB 1FZOA 3QEQA 4DZBB 1ZLVK 1JNHB 4ISVB 3BUYB 3HC3H 3KPOA 3E3QC 4FTVE 1FIGL 4LLWB 1FLTX 2E9IA 4F15B 1HH9A 1VFAA 1G9MC 3GJFK 4IJ3C 4KJWD 1BD2A 1L0XA 2CO7B 1NMAL 4JQXA 5EBMA 3NN8A 4PJFE 3CDFA 3RX5A 2RB8A 1ZTXL 2P5WE 2ZOKA 3F7QA 1INDL 2CLZA 3EYVA 1XZ0B 1GJIA 2Q3ZA 1CD9B 4H25B 3INUL 4Y4KD 5BS0B 2CIKA 4LP4A 4HSQA 5FHBH 4JO2L 4MNQD 3HPLA 5HPMB 2C1OA 4J3WA 1K8IB 2OTUA 3KAAA 1KCSH 4HS3B 3VFVA 3S3SA 3JTTB 2IANE 4DZ8A 6FABL 3IJSA 4JFPA 1FBIL 5IHUH 5ELIA 3RA7L 4K7PH 1NAKL 1OW0A 2VLJA 1I9JL 1HEZA 3GHBH 1WUNT 1NGXA 4HEME 4AK1A 4M7LT 3O9WD 1IC7H 1YNTB 5GS0H 5GGUA 3K2UH 4GRWE 3V4VH 2VL5B 1TNMA 1MCPL 3ULVL 3DXAB 1WBZA 5FCSH 4ZUSB 1T89C 4U1JA 3EDJA 5FYLH 3DECA 1BAFL 4FQIL 3IETB 4O51B 5MENB 2AERT 1DEEA 2KUTA 2A83B 1BVLA 1JRHL 1CFVL 1ZANH 5GGVY 2KZ1B 6CGTA 1MWAA 4XPAL 3QUXA 5FO7B 4LSUL 4NWTL 4G7VH 4KC3B 5DK0B 3ULSB 5D1ZB 2BRRL 2IFFH 4ZS6C 1LK2B 5C8JB 4YWGH 3HE6B 5M7QA 4U7SA 3LB6D 3KPTA 1DVFC 3DSFL 5J6HA 4K3JH 5I6XC 1CWVA 3X17A 1Q9LB 2V6HA 3GSRB 4DW2L 2C4XA 5KW9L 3BGMA 5FECB 3BRGC 4QRPE 4DN3H 4UZGA 1FGVL 1U2HA 1K3ZA 1FL5A 1ACZA 3MOAH 2IH1B 3Q0HA 4RWHA 3ARGA 4PJBA 3Q2CA 5T3ZE 1KNOA 1RUMH 2BSTA 2VWEE 4X5XB 3TP4A 4PB0L 2DBLH 4QCIB 5I1AB 4PP2B 25C8H 4LQFL 3SQOH 1WZMA 1A21A 5J9PA 3F7YA 2MJWA 1N8ZB 3FQWB 1PG7W 3RVWC 1B0WA 4JPVH 5HGDA 5MP6L 5E2VH 2HRLA 1NFIB 4OD2A 3CPLA 2APVA 4E42A 5DK2A 3OXRB 4WWKC 2XXCB 1NDGA 4Y4KB 4CKVX 3NPZB 1BFOA 3LDBC 4QRSB 4WV1C 4MNQB 4WWID 1KJ2B 3F58H 3KYKL 2PXYC 4PJCF 4X7SH 3P4NA 1MIMH 3UTPD 5KBNC 5CHNB 3U0TA 2I26N 1S7XA 5E2JA 5CSZB 4CNIA 1RI8A 1RULL 2Q8AL 3LKOA 3QXAB 3MV9E 1SVZA 2DQCH 3OAUL 4M1CD 2VAAB 4ODTH 4D0BB 1V5JA 4WI7A 1KCRL 1HQ4A 1QLRA 1EVUA 2PUQT 1UWGL 4EQ3A 4RNRB 4Z7UA 3L3JA 3VG0H 3SE9H 5I9QC 3UPRB 3MLXL 3O9WB 5EO9A 3GI8L 3BKML 1NPUA 5JPMA 5ENWA 3EIFA 4MQSB 3ES6A 3WNLA 5DEFA 5HI3D 2RHEA 3VWJA 3DUUA 4UQ3B 5KSBA 4P59L 5IEKB 4NQCA 1RVFL 3STZB 5ALBL 2E7LC 5ITFB 1C8PA 1WFNA 3CC5A 3QRGL 4H0GA 1KLGB 3L6FB 4LEOB 3TCLB 5DUPL 2X1PA 4Y5VC 3KXFD 2P24B 3C6SA 5D7LD 4PJEA 2VDKL 3ARBA 3PWPE 4X4YB 3VFOA 5EULV 5D1XC 5BVJB 1TJGH 1FG2A 1WT5A 2CKNA 1F8TH 1GZPB 4NM4H 2HG5B 4WEBL 1WWBX 1O0VA 2D9CA 2B8OT 4S1QH 4MD5A 1DBKH 3P4MA 2BVPA 3CCHB 1FORH 3P9MB 4OSUL 3EZJB 2ZSVA 4LLYA 2GJ6E 1YEJL 1QR4A 4PV8B 3S8WA 3UYOD 3VD3A 3S36L 3QUML 4ZAKC 2HTLC 3CZFA 4JDZB 2W0FB 2FDBP 5FFLA 3W9DA 5D2NE 4HFWB 2NTFB 5CCKH 4P5KA 3T1FB 1C5CH 3GGWB 1GSMA 2C4FU 5DO2C 1I85A 1S3KL 4JG0L 1LMKA 3F7RA 1RJZA 5F88B 1VACB 1FZJA 4N0YL 3OKDB 3GJFB 4PGJA 3PP3K 4MCZA 4BFBD 2UYLA 5C0AD 1T3FB 5GS0C 2O61B 3A6CH 2MNUA 4GKNB 1RZ8A 1HXYA 3GMPA 5I15H 5FYJD 3FB6A 2NNAA 5DD0H 4X6CA 4YUEH 1MAML 3QUZC 3DHMA 3CXHJ 3O6MH 4XPHH 3GIZH 3ESVF 4FG6D 1KYOJ 5GHWL 2HT4C 4FQ1L 4BA8A 1XH3B 4R4FH 3HMXA 1Z9SA 2ICWI 5HVHB 4HLZH 3HS0B 3L7FB 3QULA 3T4YB 4YBQC 4KK8C 1KEMH 4GT7A 1RZKL 5FCUH 3NBNA 5ITBH 4JRYE 5L8LB 3D39D 4ODUA 3LRSA 3EHBC 4R2GD 3UBXA 5KVDH 5JW4Q 5FF6B 1NGQH 1C5DA 3HG1D 3R0NA 5DVKA 1F4XH 1H8NA 2XKNA 3I75B 3KYOA 1ZAGA 3Q5YA 4N8CL 1MRDL 3V6ZB 1YY9C 1NBYB 2FH8A 4R97C 2XACC 1UM6L 2EC8A 1DR9A 4HWZA 4YDJA 2YPLE 3KXFB 1D9KC 5D7LB 4FQQA 4G6KL 4JKPL 2BXYA 3IDIB 1MWAH 5DRZB 3UTZA 4F7PB 2AKRA 1BM3L 1DLHA 4HDIA 3MCKA 2CLVB 1PG7X 1YEHH 3RL1A 4GH7B 3U7WH 4XGZB 3ARFD 1Q0XL 3QEGH 1A5FH 4JM4H 4YNYA 5FO9A 4ZTPL 3LEVH 1FVCA 3RPIB 5FOJA 2H1PL 3OJMB 4WUUD 5IQ7L 3JUYA 1S9VB 3WFHB 4OFVA 5TQ0L 2PN5A 1OP9A 5IB1B 2Y07L 3HZVA 4HFUH 5DJ6B 5GGSA 3O3DA 1IJ9A 2C3VA 4PJHB 4PV9B 5GPRA 4PJ7A 1TXKA 5AZ2H 1KPVA 1A64A 3WO3B 4C59B 2X1OA 3Q48A 4GS7C 3NCBB 2Y4SA 4GFTB 4KVNL 2B4CL 3CIQA 2NXYD 2P47B 4HH9A 4FXGB 3W0WA 5L9DH 1G6VK 4BH8B 4QTHB 1TENA 3X3GH 2PW1A 1CFQA 1JNJA 5C0AB 5CKAA 3ILPA 5IR1A 1KFAH 3N0PB 4O02L 2Q6WB 3VXRA 4IRSA 4H5SB 2K1MA 2R2BB 5KSAD 4MXQD 4YR6B 4BK5A 4Q9CA 4V1DD 3PXJA 5DD3H 1KCUH 4U1IB 3RY6A 3L3OA 2YUXA 3IDJB 1D5ZA 2CMRH 2W65B 4HLJA 3CLFH 4JFXA 3GMNB 4R3SB 3VGFA 1KIPA 2JF1A 3WKML 1EEYB 1DQJB 4PTUA 1AGDA 4K71C 3W39B 1CQYA 4O5LH 2DLFL 4KXZI 3OXSB 1A7QL 3DO7A 2IWGA 1U58A 3HAEG 2ZZUT 1AFVH 3QWRA 5DD5L 4DOHE 5K9OA 4NZTL 5DYOB 2JJSA 3TVMD 4DWHA 1U8IA 5T1KA 4A6YL 3D39B 2HLAA 1VFMA 4R2GB 1QO3B 1PKOA 2X05A 2OK0L 5EO1B 4LSSL 1T7WA 4QHMB 1H8OA 3HKFA 3HG1B 2NR6C 2H26A 1S7SA 4D2NA 4HKBB 1OTUC 3ARDA 1IEHA 4OJFL 2I9TA 3K74B 5I8CB 3C2SA 3D2UD 2IF7A 5L0QC 1EIBA 5HY9B 3NIFF 2WMPA 2IEPA 2ZPKH 4QNPF 2AJVL 4DN4H 1JGUH 1RY7B 4PJGE 5GRJL 3ALPA 1INEH 2E8YA 3O3EA 1CICC 5B3JE 1OAUL 3SGJC 1T5XA 1JF1A 3ARFB 5BO1H 5ETUA 2ITCA 1HOCA 4X4ME 3TPUB 4WUUB 2KQNA 3O0RH 5BOPA 4GRLA 2W38A 5EC1A 1V3KA 5I1HH 3ZYIA 5CZXD 5HHQA 4PLKC 1LO0H 3BD3A 1DBAH 1XFPA 2IG2L 5HYSA 1VKXB 3QIWA 5C7XL 1SY6L 1HZHH 5H2BB 4W6YB 1QYGH 2Q87A 2ADGA 4U6XB 3ZDXE 4PRNA 2NXYB 4N5UA 5LBSH 3MOBL 1Q1JH 3D0LA 3DURB 5TF1L 5HDQL 1LEKB 1ZT1A 3C5SB 2HVJA 3L3GB 4G5ZL 4KMQA 2EXYC 3U4AA 5E2WL 3AM8C 4IMKC 1FNAA 5JXAL 4EUPA 4NBYB 5KSAB 1I1YB 4V1DB 3QFJE 1R5VB 5B39B 1MFDL 4KUZH 1MQ8A 4RAVB 1UCBH 2EIEA 3CH1B 5ICYB 5KTEH 4MNHA 2R1YB 1R3IL 4ODHL 1IEBA 1T22A 3UPAA 1I3GL 3PP4L 3HI6L 4HJJH 2GK0A 4S0SD 3RHWK 5DC9B 2WQ8A 1OD9A 1FJ1A 1A14L 4PBXA 1J5OH 1UWEH 3IDYB 4APQC 4D0DB 3LN9A 4R7NB 1YYMH 1FN4B 4X80L 3HMXH 5B8CB 3TVMB 1A47A 1AO7A 2YN3A 4UAOC 4NCDA 4OI9A 3EYSL 3NOIA 3DETC 5EZOL 2DLTA 3U4EA 2QSCL 3QIBC 4OT1L 2MCPH 5CJ8A 3B5GA 4D9RD 1RHHB 3ZHDA 5F7UA 1WBYB 1NC2D 4F9LA 1BJMA 1AGFA 2Q7YA 4DTGH 3D2UB 3ISWA 5DJXA 2C3XA 2VSCA 2HJLB 3HZMB 3HC0A 1RZIA 1OOAA 3HAEH 1DQTA 4N68A 2FYYB 3HE7C 2JJTA 3EO9H 1UWXH 4P57B 4K8RL 3T3ME 4P2OC 4JLRA 3CMOL 1GHFH 3PWJA 4XC3H 3S5LB 1F00I 4P9HH 1K4CA 3HUJA 5E99H 1YEIL 3MODL 2IQ9L 5ESQB 2H32B 1U8NB 4KQ3L 4LK4A 7CGTA 4MAYC 3CFBB 3SCMA 5IVXE 4G9FE 2FNBA 4QHNA 1O7SA 1OLZA 4F7EA 2XICA 5GRXG 1IGJB 4GAYB 3V0VB 5I76A 3MV8A 4AENA 2X4TA 3MRKA 3GSOA 3MRPA 1S7RB 1U2CA 5TPWH 4XB8A 2ZUQB 3MLRH 5IBUB 3VXSE 3GSQA 2PYFB 4YIQB 4XBPA 3MXWL 3OL2A 2QKIA 5HYFA 3EO0A 5KANG 3VD4A 3GMMA 3FQRA 4JN1L 5JOPD 1WIPA 5GGQH 4FQCH 4PJ8D 5IROA 4OF0A 3MRHA 5C1MB 1TITA 3QWOA 1RHFA 5F8RC 2ICCA 5HVGB 4J6RH 2O5YL 4G6ML 4FOMA 4JB9H 5I30L 4XZUB 1P7QD 5D2LF 2DWDB 4LLMA 3MV7E 1OSPL 3KPPB 1F11B 1ES0A 1R3KB 2ADJA 4JFFD 1W0WB 1Y18A 4LMQE 3BX7C 1QFPA 5D2LB 4X99A 3BRDA 5EDXA 5SWZA 4ZTOL 4GRWH 4RFNB 3TA3A 4LAQH 5JDJA 5JQ6H 4BFEA 1SJVA 2X4PB 4GW4B 2JCCF 2EZ0D 4K94L 5GZOD 1H3TA 2JCCB 2R69H 4JGJA 1BECA 5TDNA 3C6LA 1ONQA 4MD0A 3UTTD 1YUHA 2GSIA 4JJHA 1D5MA 1HDMA 5AG8A 4HXAL 3CXDL 3GMRA 3KDMB 1IC5H 4HPYH 4QF1A 3U9UB 3PF2A 1WT5C 2AJSL 1PKQE 1NC2B 4LIQL 5C09E 4IEFB 3J8F7 3I2CH 4HT1H 4PJXF 5IFJB 1C16A 1QHPA 4CVUA 4HZAA 4PJXB 1YEEL 5KS9A 1C1EL 1XF5A 1FNEA 4PG2C 5GRYA 3GSUA 1RIUL 1XGQB 4TTDD 1OGTB 3ZTNH 2Y36H 3L5WB 5LGJA 4MWFB 1QNZL 3S88L 3EYQC 4YFDB 4R4ND 3BEWA 4X8JB 2WNGA 4NPYB 4IRJC 4Y4HC 3TIEA 1U91B 4OCSH 1W72L 1TPXB 4G8IB 4YAQB 5INCA 1RMFL 2K7QA 4J1UA 1MJ8H 4X6DB 1EAPB 2Z92A 1GIGL 4LLUA 4ZMAT 4L3AA 3FQNB 1RPQA