4GFTB

Malaria invasion machinery protein-nanobody complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
126
Chain Sequence
EVQLQESGGGTVQPGGSLKLSCSAAPERAFSNYAMGWFRQAPGQEREFVAGITGSGRSQYYADSVKGRFTISRDNAMNAVYLQMNSVKAEDTAVYYCAARVVPVFSDSTKGYVYWGQGTQVTVSSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the D3 domain of Plasmodium falciparum myosin tail interacting protein MTIP in complex with a nanobody.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Protein binding, immune system
molecule keywords Myosin A tail domain interacting protein
total genus 33
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2012-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gftB00
3QA3B 1INQB 5HGHA 5LXGH 4ZAKB 4QRQB 4K9EH 3P9LA 2QQQA 3E6HA 5DT1L 4G6AC 5KVEL 3FL7A 2H26A 3MBXH 4RMTA 4Y4FC 1FZJA 4QRRE 4LOUC 4G9DB 4X9IA 3EO1A 1S7UA 2JB6B 4NO0D 4FQHB 3MRJA 3FT2A 1PGRB 4JO4L 1PY9A 5FOBA 2FX7H 3C5JB 4OQTA 1M7IB 2A73B 3O0RH 4DEPB 5L2JA 1GAFH 3ALWA 5T1LB 4F7EA 4JDTH 4KKLC 5L2JB 1T2JA 1HINH 2VB5A 2DQGL 4AIXA 4G8GE 1FFOA 4KQ4H 4NWUH 4K7PL 4XPFH 3QG6B 4XWGH 4W4NA 1ZHLA 1OARH 1TJGH 3HI6L 5DEGB 5HDBF 3NZHH 1MRCH 1RUAH 4JQIH 1CD1A 3AXLB 2VXVH 3L5HA 3PV6B 5DJ8A 2CR6A 2DKSA 3TYGL 2W1NA 3LN4B 3VFVB 5B21A 1L0XA 4JFYA 1UFUA 1EEYA 3DV6B 5HPOA 1NFDE 1G0DA 1GAFL 1VFUA 2VDRH 5SWSD 1NCAL 3L5XH 4J3XA 4Z95L 1CLOL 3SPVA 4FFWD 4ZNEA 4OM1L 3DV4B 1OGTA 4PGZA 5J6HB 5CKGA 1QSVA 4XPGL 5HVFB 4AEHL 1GOHA 1QSFB 1TTFA 2QSVA 3QDGE 4K55A 1MIML 3HA0A 4RZCB 1F97A 2W60A 4EI5A 2AV7B 4WFGD 4X8XA 4M1GH 4OZGB 3RVTD 4NZDA 1KIRB 4UNVA 4PBWD 1LWRA 4HS3B 4HH8A 5HHMB 4PJ7B 2WP3T 4WFEE 3HTLX 4AK1A 1VADB 1IGML 3PWUB 2PYEA 2BY3A 1RIHL 4KQ3L 4LCYA 3PL6A 5FV1L 2E6PA 3UBXB 1A9EA 4NWUL 1WEJL 4ZFZA 4LLVA 2EH8L 4HFUL 5GHWL 1PZ5B 3VI4E 4OD3L 3BMVA 5MEOA 5B39A 4DZ8A 2F19L 2GKIA 5C0JB 3PWJB 1ORQA 5FUZH 1RUKH 4PJDB 2VLRA 2B1HL 2P5EA 3T1WA 2VLKA 4HW6A 5DSCA 1C08B 4JFHE 1IM9D 4YK4C 5EO0B 1MWAH 5JDJA 3HFML 1W72L 4M3KB 3WIHA 4UDUB 2KUTA 2DTML 2OI9B 4FN0A 3VE0B 5DK3A 2K1MA 2V7NB 2EDTA 1HXYB 5J7CC 4JFQB 1YN6B 1IC4L 5FK9A 5IIEB 4YX2H 1KN2H 1U6AL 3FOLA 2CMRL 5F1SA 4Y2DD 5HHXL 3ABZA 5JDSB 5I1CL 5MENA 3DO7A 1KJ3H 1GHFL 4Y4FB 5HPMA 1A1OB 1X4YA 4OCXH 1NCAH 1S9KC 2F58H 1DBBH 3RBSA 3UYRH 5BVPH 5K9KA 1KIUA 5F1KC 3QPQC 1D5XB 3LN5A 2A38A 4EQ3A 3PL6D 2A74B 3LH2H 4FFWC 8CGTA 5I1LB 4P4RA 1QBLH 1IT9H 5FB8A 3PWLA 1U2CA 3DTXA 1U93A 4OKVA 4OLWL 2CO7B 3D9AH 4K94H 3NIGE 4R4NC 4AH2B 4YBQD 1MI5B 3K4ZA 3B83A 2Z9TA 5MEPB 3RL1B 4BQ9A 4CVXA 2AXFB 5KSBB 4WFFD 4Z77B 1MCEA 2WWKO 3H3PH 1EEUA 4W70A 3J7HA 4M1GL 5C1MB 2VAAB 3QIBA 5KSUB 1HSBB 5MEQA 4MVBD 4KPHL 4Q9CA 2Z35A 4KH2A 5D2NB 3R8QA 3GKZA 1A3QA 4YDJA 3AAZB 4EDXA 4HUWA 5TF1L 3LMJH 4NDMA 3QQ4A 1IILE 3JUYA 3OKDB 4DZBB 3O2DL 1T83C 4OFYD 2NZIA 3SE8H 1ZHBB 4G6AD 3GI8L 5EFIB 1KIQA 1RULH 2D4FA 2EYRA 3KPPA 3L1OH 4MA7H 4OLVH 1NBYB 2DBLH 5CD3A 3BVNB 3QWOA 5TJWK 1C5CL 1FAKT 3WXWL 5DJAB 1Z9OA 2Y7QA 1AIFB 2FGZA 2VO5A 4ESKA 4GG6F 1A3LL 4MNGE 3BH9B 1MRDL 4ZSOB 3OTTA 5LVEA 4NJAH 1JZ5A 1P4BL 5JOPD 4IRJB 4JPWL 1F2XK 3EFDH 3D2UB 1IQDB 1P7QD 3OJMB 2B2XL 4K71B 5HYJB 4TOYH 4LDOB 3EJYC 3MNWB 3IFOA 2X70B 2CIKB 3QUMH 4JJ5A 3C9NA 4Z8FH 4PPTA 4W6YB 3V5HB 4PYHA 4QRSA 3UJTL 4IRSB 3ARBC 2APFA 3U83A 1NGQL 3ZTNL 5IW6A 3ARQA 4K3DH 4YAQA 3GRWA 1CE1H 5E99L 4Y4KB 1Y0LA 3ZKXC 2BSRA 1DDHB 2HVKA 3N1MC 4CVWA 3SQOL 2PYFB 5HGDB 1NAMB 5D7IA 4F15B 5T3XL 1BBJB 4HJGB 4GKNB 5F1IA 1XR9A 1P7KB 1DEDA 5JXAL 1NQBA 2DQTL 5EUKA 4NZRH 4PTUB 3HAEH 4XPHL 4UQ2B 2NYYC 2NX5B 2IQ9H 2P8PB 2F5AL 4NRYA 4RFEB 1Z6JT 1LEIA 3REVA 4LHJB 2NY4C 4I1NB 3EDFA 5C08A 4ZTOL 3N85H 2V9QA 3G9VA 1FFQA 4C56A 2KDGA 4NQXB 4X5LA 1ZGLB 1L7TL 2OK0L 3ILPA 1FCGA 1IBGL 4JG0H 4N0UE 3O11B 1MI5D 5JZ7C 4QHKI 4MA1C 5KZCD 4I8DA 1CGSH 3QCTL 2NLJB 3NIGF 1S7QB 4NQVA 4YFDB 2YZ8A 5KJRL 1Z3GL 5IBLD 4NM8H 4XNMB 4RFOH 3RIFF 3LQZB 5C0AB 4LLQB 3BP5B 4HK0B 2FSEB 5F9JA 3WL9A 2JTDA 5AD0B 1ONQA 4OQTH 5IEHA 1KNOA 1RIUH 3G6JF 5EA0H 3LRSB 5DFVC 5CJXC 1MFBL 3SKUD 2C5DC 4LCWA 1U95B 5FV2A 4Z7UB 1CFNB 1YC7A 2DYPD 1I7ZA 3SO3C 3B2UD 3VH8A 5C0FA 4CW1B 4I0CC 3C6LB 1HKLH 1L7IH 5ENWB 4AJ0A 3EDDA 3RWDB 4YHKH 4FFYL 5J8OA 4YE4H 5TDPB 1VSCA 5EU7C 3VG0H 2VDNH 4NC0B 4JB9L 4BQBA 2QADB 1I7TA 1HZHL 3BRGC 1KT2B 1NFIB 5HGBA 4XAKE 2ZUUA 4CVZA 2PXYC 3TVMD 1QHPA 4EI5D 3C8KB 2DIAA 1J8KA 2GFBB 3HUJA 2GSIB 1CLOH 3B5GA 5EIIA 4X6CE 1AI1H 4F57L 3CVIH 2GFBA 1U8JA 4L9LA 4LLWA 1FE8H 1KEMH 4BFIA 1N4XH 5DJ0B 4KV5E 3C8HA 3QR2A 2H3NB 3DHMA 4GG6E 3OJDB 3Q6GH 4G6JL 5TQ0H 4P46B 2Y36H 1BX2B 2R69L 4I3SH 5ICXB 4O02L 5DRNA 3D1MC 1BIIA 1IT9L 3O6ML 2KZWA 3WJLC 1NUDA 4ONHA 1XGQB 4ZAKD 2DYPA 4PJBF 1M4KA 1DSFH 2QEJA 3R06A 4IIQC 1DEEB 3V6OA 5IT2L 3JBG7 2FL5A 1CGWA 5C0FB 5GZOD 3QJFB 1N8ZA 3H9SA 1CICA 4HSQA 4I9WE 3RU8L 4QXWA 1U8LA 3ORJA 8FABA 4DVRH 3BOVA 2ZZUT 3MREA 4GRWH 4XMKH 3BZDA 3GSUA 5JNYA 3G6DH 4LSSL 2W38A 4J4PC 1GYAA 4N0YH 5J13C 3MLUL 3K74B 4KUZL 3ILQD 5E8OA 2YZ1A 4X9HA 3NIFE 1IC5H 3MJ7B 2FSEA 2BSSA 4I0PB 2AJZB 4LCIL 3ECBA 1H3GA 2ARJB 3B9VA 4HUKB 3NCEB 4KRPD 4NQCD 4PJAE 1I9IH 3O3BB 4XP1H 4HG4K 4QF1B 3U1SL 4RRPG 1FP5A 3JWNC 5CLTA 2HN7A 1KELH 4IRZH 2E8ZA 3CVHH 5J6GB 1NBQA 4K3EL 3MV8D 4PGCA 1KGCD 2D2OA 1CK0L 3CZFA 3CPLB 2HG5B 4OCYH 5FUCE 2DMKA 4JAMA 5TH2A 5GGRA 2P46B 3O45B 4ZFGH 3BKMH 3TT3H 5I1IH 2XZZA 5C08B 2C3VA 3ARFA 1ZT1A 2ORBH 1K2DB 3OAYK 3AM8A 1F02I 4LVHB 5AYUL 3ZTNH 2EDFA 4PY8I 3DRTA 3IDIB 1K4DB 4MAYC 2KPNA 4EJ1C 4ALAL 1N5YL 1Q0YL 5EUKB 3TFKD 2R1WB 3QIBD 1JPST 4NN7C 1PG7L 4EUPG 4M7KL 1INDL 2YPKB 5EPMB 3WV0A 5C08E 4TTGA 1D5IL 2HMID 3QFJD 1EEZA 4GW4A 2BRRL 2IPUG 2EEDA 1OOAA 2Y07H 4TVPH 3LEXA 3MFGB 5T3XD 1MVUB 5SV4A 4OZFB 5FIEA 4FXKA 3SKOA 4QCIA 3S5LB 1V7ML 4OD2A 3TEUA 1JYNA 1W8OA 2FB4L 1NEZA 2ZUYA 5FM4A 1CTOA 3P73A 5HHVH 1JI1A 2BNRD 1FFNA 3WJJA 5L7XH 3CFBB 5CJQH 2VJXA 2R4SH 4J6RL 1JCKA 1DLFL 2AXHA 4BZ1L 1A64A 3LKQB 4ZDHA 4N9OB 3FT4B 4Z78A 1K6QH 1QVOA 2APBA 2B1AL 3CFKB 4KK9D 2JJTA 2PTTB 1X5KA 1OQOA 3MNVB 3RIAK 5DUPL 3C6LD 3KLAB 2V9RA 1P84J 4NN5C 3HKFA 1QLRB 1FHGA 4XAKD 1QNZL 3M07A 2PETA 4LDLB 5D5ME 5CD3B 2ICWJ 2EYSA 3KHQA 1AGEB 4WVRA 3GSQA 5F6HJ 3DARA 4IRJC 4MGXA 1KIQB 1ACYL 2EYRB 2VISB 1N59A 1GZQB 3OKDA 1C16B 1EO8L 3DXAB 1FC1A 3P0YL 4W6WB 1GGBL 3ZMRA 3SJVE 1TZGH 3TBWB 5CSZA 2WUBH 4NDMB 1IARB 5DUPH 3MBEA 4K07A 2XTJE 5K9OA 2JIXB 4LPYA 3HNTH 1TLKA 4BSWB 3LQAH 4JPIB 1MFAL 3ZKND 5T1DH 3U7AA 2EXYD 5GS1B 3BD3A 1HSBA 5J11B 2ICWI 2AEQH 2C7UA 3CCHB 4OBSA 4F58H 5KZCB 1U8MB 1YQVH 5E5RB 1JV5B 5EO1A 3K8MA 1ETZB 2XZAL 5ERWB 3BP6A 1Y6MR 3EYFA 4MCZA 1GOGA 1LE9A 2FEEL 3VFMB 1IGCL 5D5MF 1FZKA 1C5DA 4YFEA 3KGRA 5GPRA 4KTDH 5C6WH 3DI2B 3LCYA 1I3RB 4MZ3A 4NCDA 4U31A 1H8NA 3KWWA 5FHBL 3V4VH 2CKBH 3BPOC 4QHMB 5FYJL 3MLRL 3NCMA 2JJVA 5ILTL 4U3CA 1CIDA 3U4EA 4X4XA 3T4AA 1RJZB 1TMCB 3P0VL 4WFGE 5D7LD 3QEGH 4D2NA 2R1YB 3WO3B 4HV8A 5GGVH 2Y1VA 5DS8A 5IV2A 5GGRY 4F37K 4MNQE 5JHLL 1KTRL 2HTLC 4LCWE 4WWKB 5F71A 2AS5M 4GMTH 1YN6A 5FK9B 3CFJA 3MV8E 2CGRH 2E7CA 4GG8A 3MRGB 4PJIB 1F6FB 4XAWH 2V7NA 5B39G 4ZYKA 5D1XA 4O4YH 3OB0K 4P2CG 3LVEA 5KBNC 2R0WL 2VZOA 4Q6IB 2VLKB 5B22A 2H6PA 5DC4B 5E9DD 4F2MB 1X4XA 5ITBH 3T0EC 4WUUE 1JTPA 3TCLA 3W0WA 1QFWI 3I3EA 1HILB 4WW1A 4MD5B 5EZLB 4APQB 3RX8A 3S9DB 1BVLA 4XPTL 3GSVB 4KUZH 3RVVC 3U4BH 3MLXL 3IFLL 5DYOA 2YD4A 3RY4A 3IAQA 4HC1L 3CMOL 1UB6A 4TPRL 1LK3L 5FKPB 4PLKC 3UC0H 3HMWL 3AY4A 3T0XA 4C4KT 2VZSA 5EOCJ 3RWGA 3NABH 1RZJH 1OTSC 1LE5A 3HNVL 4GAYB 3HZMB 4OZGA 4X98A 1QOKA 3NTCH 5E03A 4KZEH 4N0FA 3VFTB 4UOW0 4X5XA 3TH3T 5HYIA 2XTJB 5I6XB 3EJZD 4PRIA 4MXVF 5D1XD 2ZUQB 3F5WB 2VDMH 4OZ4B 2ADJA 4HKXA 5E8NA 4M48H 1XIWA 3SPVB 4APQD 1SBBA 5M95B 3SDXF 3CVHB 1JRHH 4OQTL 4AL8L 1I1FA 5AEAA 2KL6A 1CBVL 1IL1B 2ZNWA 3VWJB 1WICA 4RFOL 3FQRB 3G08A 4GBXA 1T1WA 1T5WB 2PO6C 4KTYA 1TJIL 4WNQA 5HJ3A 5J9PB 5DA0B 5I74C 3CJJA 3TBTB 1FGVH 3EO0B 3RVUC 3SDYL 1FNAA 1BD2A 5L2KA 1KB5L 4UBDC 1DQLH 5JPNB 3QCUH 1MF2H 1F11B 3PWVB 3U9PL 1V7NH 3DVIA 1P1ZB 4CU8A 4C83A 2VDPL 4ZUTA 3SDAC 3WKML 4YDLC 4HIJB 4Y2DA 4YHKL 3FN0L 5JPMB 1G7IA 3ARDD 1DBAL 3MRJB 3H2WA 4XBGA 3OR6A 1YY9D 4X83A 4XVUC 1FH5H 3CK0H 1OLLA 1CD8A 4NRXB 1EBPA 4XPAH 1UADC 2RJMA 3W9DA 3DVNA 5FOJA 2DLFH 3V4PL 3RL2A 4FNLH 3UTPE 3ZYIA 5GS0C 3R1GH 2R2EB 2F54E 4OZHE 4I0PD 4ZFFA 5CSZB 1K3IA 5C0CE 3TN0D 4PJAF 5DD6A 4AIOA 4R3SB 5DVMA 4H88H 5DJCB 4S1QL 4M48L 3NCYS 3T2QA 4YHNB 4ODTL 3S37L 4RMWA 5F7DB 1EO5A 2AABL 1SEBA 4LMQI 1MFAH 1YC8A 4UQ3A 5J12C 4FXGB 5AZEL 1VHPA 1RUPH 1ZTXL 3CFEA 4F7CB 1M7XA 2NY6B 3CD4A 3WFBL 4KU1A 1IEAA 2QQLH 3PNWA 4WW2C 2R2CA 2AAVA 3P4NA 2VE6B 3QUYB 3CUPA 4L4VB 3RJDA 2X44D 3KYNB 4RIRA 4CMHB 3G6AA 3GFUA 2WBJD 4TVPE 2YMXL 4V1DD 3KYOA 4JHAL 3U9PH 3BP7B 2PTTA 5CEZL 4P5KB 5FDYA 1YNTA 4PJFE 2JJSA 3V7AG 2AJVH 3P40A 2BERA 5EO9A 2M2DA 2CLVA 4Y5XA 5IT2H 3OGCA 5DFTA 4CDGC 4H25B 4EOWL 1ZLUK 4HX1B 3MA7A 4PTTB 2COQA 1CXLA 5DK0B 4M61B 3MLWL 4K8RL 3WXVL 3MRNB 5BZDB 5J56B 3O4LB 3C2AL 5J3HC 1MFEH 3MGOB 4FG6C 3QIUD 1VACB 4MNQA 5INDA 2EDHA 5DD1L 5E95B 3WIIL 1AP2A 1A9BA 2R1WA 3N9GL 4JREB 4NKDA 2AJ3B 5GSRB 1IM9B 1U8QB 4O00A 5GGTA 2EDDA 3GRWL 3I50L 4M03A 4I48B 4ZNEE 2ZCKL 2OSLB 3MJ9H 5GRXG 1Z5LA 1CD9B 1KC5H 2XN9E 3EOBB 4E0RA 1NAML 2HG5A 3KNBB 5KVEH 32C2B 2BSED 4J8RB 1SJXA 3MRFA 5F70A 2VXTH 1K8DA 2H32B 5BV7C 3OPZL 2GHWB 1BM3H 3JV4A 3UBXG 1JVKA 4QXGH 2MPAL 4M7ZC 4G8GD 1CG9B 1UB5B 1YEDA 1D5MA 3C08H 2VAJA 2VN4A 2XNAA 5FCSH 4LFHD 4EIGB 2DM2A 1Q9LA 3OF6D 1M71A 4JGUA 4LARL 4OZGE 1U8HB 3WNPA 5IROA 4OLXH 3RKPA 2XQBH 4ODVL 4R0LA 2AJSH 3CU7A 4JM2C 3VXTA 1TNMA 3UBXI 1OVZA 3PGDB 2XTLA 4KMQA 5FA4B 4Z7WF 2A6KB 3KDMB 3QDGB 4L3CB 1CFTA 1AGDB 4CMMA 4PGEA 2OJZL 3I75A 3EW3B 4OLZH 3E6FB 1BJ1H 3IKCA 1R3JA 4KROB 5HDQL 5TQ2H 2NY7H 1WUNT 4YHIA 5H35A 1FG2A 3BPNC 2VLKE 1U8LB 4P2YA 4MB4A 1CICB 2FL5B 1FLTX 3QCTH 3VWKC 1NAMH 1BFOA 3B9KD 5EBLB 4NJ9L 1OTTC 2RCSL 3U30B 5CP7B 2F15A 1PG7W 1FYTA 1U3HA 3CXDL 1A6UH 4JCMA 4P2QA 5EIQA 1QSZA 5CD5C 1BD2E 5IF0B 3MR9B 5I8KL 4AG4L 1T83A 4BELD 2J12B 4UT9H 4S1SL 4MJIA 4YWGH 1ZSDB 5F6IC 2QADC 2I9LA 4J1UA 5J13B 4DTGH 3HZYB 5FGCB 1NFDF 4WU5A 3BQUA 4R9HA 3F12A 1YYMH 1U8NA 4F8TA 4G6JH 1A7OH 2B20A 1I9IL 5IQ7H 1RURH 2Y25A 1X5LA 4ONFL 1I9JL 5FM8A 4G8FA 5CBEB 3VW3L 3VA2C 4Y1AD 4YPGA 3S34L 2ID5A 4L1DA 4K3HA 1CE6A 1NGWA 4ELMA 4JY6B 4GW5B 4XPGH 5DUML 2D0HA 1CVRA 3KAAA 4JB9H 1G7JA 3VD7A 1CDHA 2X9YA 3L5XL 3SGKC 1FL5B 1H5BB 3VMPA 1T1YB 4POZD 3L9RB 3HR5B 2G75A 4WY7L 3GMNA 1VFOA 4QT5A 3V6FA 1BZ9B 3TP4A 1T0PB 4FA8A 4MA1B 1QA9B 4EVNA 5D1ZB 1K6QL 2J7LA 3LKSA 1RZ7L 1YMMA 1XIWD 4ODTH 1HQRA 5LAXA 5LGJA 3HE6B 4MQSB 1MHPL 3BH8A 4WW2F 3U9UB 5C6TL 4O51B 4OLUH 1BOYA 5EUOA 2YD7A 5BVPL 3DLQR 3ARWA 2XRAH 3QIWA 5CWSB 4MDIB 5IMKA 4HIXL 3PUCA 3WLWC 1NMAH 5L2KE 4WDIB 1QYGL 3EO9L 3GO1H 4HKZB 3O2WL 4YHZH 2HYMA 3FB7B 5IW1B 4IRJD 1TTUA 3Q1SL 2VABA 1NBVH 4Y5VC 3RJQB 3L3OB 4M7JL 4XC3H 3C5SA 4HKJA 3MMEA 1VGEH 3GMNB 2QBWA 1H3XA 4P2OB 2YEZA 4M8QB 4LSSH 3SQBA 1BFTA 2VXUL 3VGFA 4OSUH 5KVGH 4PYGA 3U0WL 4P57A 1XR9B 3FQXB 2VDKH 3T0EE 5BRZD 2A6IB 1TZIA 3OKNA 1UXWB 1E6JL 1NAMA 2OP4H 5BV7L 4KK8D 2FJFB 5IFJB 1Y0LB 4F7PB 2B4CL 5T1KA 5GGQL 2IFFH 3X17A 1X7QB 1U92A 2IADA 3VU2A 3CX5K 4JFEE 3RQ3A 3QI9C 3BO8A 2EIBA 1FNFA 4DKAA 4HEME 2LU7A 4IJ3C 3BHBB 1NLDH 3SQOH 3IFOB 2DQHH 5FECB 4Y1AB 5C0RL 5C09E 1PEZA 5I1AB 3BQUB 1OGAE 4HPYH 4CVUA 3MV9D 5D6CA 3IDNA 2GJ6B 3QIUB 2WM0A 3SDAB 1LO5B 1LDPL 2YPVH 5LXGL 1EHAA 5GGTL 4P23D 3L6FB 3HLAA 4YDVA 4JFFD 1HCVA 2CQVA 4F15C 3TWCL 1REIA 1EERB 1RHFA 3JVGC 1X44A 2ADGA 1D9KD 2R2BB 4Y4HC 1WIOA 1SY6L 5A2KH 4X6EB 3DX7B 1MHCB 1LO0L 4QTIL 3ARFC 3HI1B 4YZFF 3V4UL 2UYLA 3MUGB 5MERA 4ZD3H 4HH9A 4R90H 4B7LA 2DDQH 2UVFA 1ZHNB 5FGCE 3H42H 1HNFA 1F58H 4QHNA 4RGNC 3PGDA 3BN9C 3TJEL 5CCKL 3MLVH 5ALBL 1VGEL 1U8HA 4M62L 4R96A 4CVXB 1JZ6A 3K8LA 1MI5A 5MEPA 3AVEA 4D9QD 4RISL 3QUZA 3DTXB 1WBYA 4K7PX 3FFDA 3OZ9L 4YHML 3ZE1E 3SE9H 5HVWA 4ISVA 1W0VA 1KCKA 2PTVA 1X7QA 3DI3B 3MX0A 3NMEA 2YD5A 4MX7B 5J4MA 1AO7E 3I3BA 2UZIH 3W39A 2GSGA 1C7SA 3QWRD 2LU3A 2O5ZH 1AE6H 2J5LB 5E5MA 3FQXA 2NXYD 4MXQC 2VXQL 2IBBA 5KOVC 1FGNH 1OL0A 4P0DA 2YEZB 5D7LB 4YK4B 3QDHA 5I8CA 3QUKB 1RULL 5IQ9A 4XTRD 2BOBB 4NZTL 4WY7H 4NOFA 1BFVH 4XAWL 1DBMH 2EE3A 3ET9F 1MEXH 4BKLB 4KRNA 2VKWA 2YD2A 2A9MH 3V7AE 4FG6D 4NKIH 4L4TD 3VXMD 3VMNA 5E56A 2DWDA 5F7MC 1C08A 3BP4A 1QO3B 1VERA 4YLQT 1FZMB 5GSVB 2Q8AH 1FFRA 3BHBA 5AZ2H 3ROOA 3SDXA 1GGBH 3T3MF 4WRLA 5GS3A 4PJ9C 4TNWK 4M61A 2X4QB 5JR1H 4EXKA 4HLJA 2DTMH 5DEFA 1NANH 2PW1B 2QKIA 1A9EB 4HT1H 2XZQH 3AGVA 2MWCA 5IMMB 5E8DL 3ZE1F 3N06B 5FO8B 1NH6A 5HHPA 4PR5A 3JTSB 1TZIB 1YNTB 1AQDA 4JRYA 1NCWL 1FVEB 3CLFL 2OM5A 3BP7A 2DQEH 4M8QA 3MOAL 5D2NE 2QL1A 3NIDF 5BZWA 3CUPB 1Z9LA 2E6JA 3CLEL 3UYRL 2Q20A 2CKBB 1YEIH 1E6JH 2OI9C 2DJUA 3DUSA 1DBAH 3MV7B 5C71A 3IDYB 2VZUA 3CIQA 3QWQB 4M7LH 3UTQA 4OF8A 3UEZA 1CWVA 2DIBA 3RIAF 2Y07L 1HDMA 2HVJA 1ZT4B 4J7RA 2DL9A 3IETA 1XGPA 1JNLH 1U8NB 2BVOB 2OYPA 5DMKA 2EE6A 3KPSE 4H1LG 4UI2A 1OP5H 3FQWB 2NY4D 4OAWA 5C92A 3REWB 5H8DA 3RX7A 3K2UH 1ZSDA 4QWWD 1V3KA 3B6SA 5EBGA 4Y2DB 2DLHA 3V0WL 1XGYL 5C0BD 1WC7B 2XI9A 3U4AA 1NGPH 1MJ8H 2V2WB 1T1YA 1UWEL 2APVA 2ITCA 4BFBD 4F7EB 4UOW1 3DIFA 3GSNA 2VLJD 1U8OB 1RK1A 4ZPVA 5HDBE 5KN5B 1YN7B 3C5JA 3NCJL 1BD2B 4OBRA 1MFEL 2XIDA 1H15B 4PREB 5EU5A 1XH3A 3RGVB 3WKNA 1FAIH 5HJ3B 3TO4D 2DQCL 5HYJE 4GSDL 1SEQH 4Z7OF 5EUOE 2R15A 1MFCH 3VXMB 1P9MC 3QIWD 1Y18B 1ZLUH 3SBWC 5E00A 2AGJL 3DX8B 3FQUA 3OKMB 3P9LB 3FO1B 4QOKB 3PE9A 4KMTH 1F2QA 2C3WA 3FMGL 2LFGA 5CGYD 3HN3A 3UJJL 5FYKE 3EJYD 1F4XH 5KG9A 1RHHA 4U1IA 2ZCLL 3E2HB 3SE3A 4LCCA 1A6VL 4LNVA 5E8PA 3VXTB 4NOBA 3GNMH 2BFVL 4YNYA 4XXCA 4ACPA 1UJ3C 2Z8SA 5ECJE 5C0CB 4J1UB 5FCUH 2EC8A 3ARRA 5CCKH 3GMPB 1IGTB 3VXSB 2EO9A 3HMXL 2HT3D 3VFNB 1IAKB 2VL4A 2YXFA 4BSVA 1RV6X 1VDGA 2JIXD 5BS0A 5IGXL 3JV4B 5AG9A 3GSOB 3ULVF 1FYTB 1U3HB 4MCYB 5I73C 1UB6B 4HIHA 4UTAL 2YUZA 2HRPH 5LCVL 1UGNA 2IH3B 5DVNA 1AO7A 2YPLE 3QT2A 1AHWC 5F8QC 1ZVSB 1SYVB 4DN4L 4EN3D 4AEFA 7CGTA 4ORGB 3VDCA 2W65A 2O5YH 3O0RL 4YFLF 5GRVK 3WNKA 2ADFH 2X2YA 4CN1A 4H5SA 4LSRH 1F90L 3E6FA 2NX5D 1P2CA 2PW2A 4Q0XL 4NKDB 3FN0H 4L3CA 4JKMA 4WEBL 5B8CA 2X9WA 3WFZA 1A2YA 2ZG3A 4U1HA 2WQRA 5INDB 1FFPA 3Q6FB 1VACA 3SE4C 4FOMA 3I02A 4ZQKB 3O4LA 4PLOB 1PKQE 4XHJC 4HQQL 5IV2B 2B39A 4F9LA 2R1YA 3UYOD 1M6OB 1DUZA 2L7JA 3DX9A 3F7PC 5HY9B 5IBTH 3VFWA 3I6LE 4PJEB 3MV8A 2O5XH 3PWPE 1DUYA 4Y16B 4HGWA 4KJYA 3LAFA 1F6AB 1IGYA 3SGEI 4YHYB 1UENA 5FUOL 1NGYA 4HBCH 1MREH 4GUPA 2E7LA 3OG6B 1JPSH 1Z5LB 3SGKA 3LEVL 2Y4SA 5ICZA 1BHGA 2ICEB 4MA3B 3MRQB 5JIKA 5GS2D 1FZKB 3CFCH 3HG1D 4JPKH 2NTSP 2FBOJ 5IP4A 2GY7B 4LPCA 2GQHA 5FFLA 2VXUH 5C0DA 3S4SA 3GKWL 5IEKB 3TYFA 1OAXL 2JF1A 2ZSVB 3MRLA 1FNSH 1NC2B 1KJ2H 3VCLB 1MCRA 3O3UN 5D1ZD 4WV1B 3RPKA 5D9SA 5F7DA 4RFNB 2OL3A 4JM2A 5TDOA 5D7KE 1N2RA 5TDNA 1KEGL 4U05A 1HQ4B 1NCBH 4E5XB 5DK0A 2MNUA 1S78D 4FQ2L 5TDNB 5C0BB 2IPTL 5D7IE 1CR9H 1RFDL 3EGSA 1GZQA 2FATL 1VA9A 1VFAB 3CDFA 2ZWLT 4XP5L 4OZFH 1UACH 4DQOH 1MJJB 2C1PB 3SKMA 4HIJA 2PO6B 5FUOH 4J3UA 1T04A 5E2WH 1AC6A 1QLRA 4OT1H 1CU4H 4PP2A 4OF7A 1S7RB 2IAMA 5HTSA 3G6AB 4LVOB 3I2CL 1LP9B 4P9HH 5E08L 2ICEA 5LWYL 4FXLA 1T1WB 1JMXA 4NRZA 3VGBA 2VR5A 1MCCA 4LIQH 1IL1A 1E4KA 1JGUL 1NC4A 1I8KB 1J12A 1T7WA 1DUYB 4Y16A 3TIEB 3VI3F 2UY7A 1Q0YH 4PJXA 1D9KB 2EECA 4U1NA 3WN5C 3DX9B 4YHLH 3GSWA 4PJHF 2K9UA 4M43H 1GXEA 4GMSH 3HNSL 3FQNA 4HD9A 3B9AA 3LEXB 3DVNB 4PRIB 3V5DA 2BNRB 3ULVL 4P2QD 4ZFGL 1A14H 2D0GA 3GBMH 1EEZB 1YJDC 4JZOA 3OR6B 1FFPB 3NA9L 43CAA 2DM3A 4N0FB 3VFTA 4MWFB 4QGTA 3IDYC 2WW8A 4H88L 3LV3A 1AD9B 5B3JE 1GZPB 4ODVH 2IBGA 4OD1H 4LCWD 4I9WD 4L4VE 4PGDA 5HVGB 5T5FL 2P5WB 4NZRL 5FA3A 1RZJC 2XZCH 4LMQE 4C54A 3P9WB 5L88L 3IDIA 2IAMD 1FH5L 3CK0L 1P9MA 3WD5L 4QGYA 2MPAH 2VIRA 5BW7C 4L5FH 1Z2KA 2FO4A 1DANT 5D7SH 5GZNC 3G08B 4GBXB 4N9GA 5CGTA 3O2DH 2GI7A 2X7LB 2AJXL 5B3JF 5IMOA 5DHYB 1IGYB 3IVKB 5B3NA 1KCSL 3UJIL 4MLIA 4JFOA 2AK4A 3CH1A 15C8L 3H9HB 1KYOK 1L4IA 5EU6A 1YMHA 2A6JA 3MUHL 4P9HC 4X5WB 4HWUA 1KTDA 1A7QH 4YBHA 2D3VA 12E8H 4U7KA 3EOTL 4UINH 3VFNA 3VMOA 4S1DD 1XCQB 4KGJA 3VRLE 4ZO7A 1P4BH 4XZUB 4TTDC 3Q6FA 3D5OF 4LEXL 4GG6A 4J4PD 4PJ8D 1QBBA 1BOGA 4O02H 3WUWG 3MV9B 3S35X 5ETUA 1AD0B 1LHZA 4M5YH 1FQ9C 3QXDA 3FB5B 3VFPB 5HD8C 5JNYB 4NQDE 3VDBA 4F58L 5BMFL 5FKPA 4KZDH 4R0LC 1ZLVH 5JHDD 3QHFH 1I75A 4UV4H 2P45B 3RWHA 3H9HA 5EU4B 2O5ZL 3O8XC 1T0NA 4ZAKC 1MJ7H 4FQ2H 1QR1A 1XGUB 2BY1A 5GRJL 2BNQE 4U0RC 2IMMA 3QEHB 3ZKXB 5A3IC 1KB9J 4NQDB 4ZUVA 3W0WB 3MQIA 1FLRH 3TCLB 3DETC 3MZTA 1RU9L 1U91B 5ESVA 3UAJD 3T2OA 2X4RA 2OMBA 1MELA 1Z0NA 1T1XB 3DVGA 5IB5A 4Q6IA 1MUJB 4CU6A 1IC7H 4XNZB 4TUOA 4QRRA 2JCCB 5JQ6L 3LV3B 5IR1B 5CUSH 4EI5C 5MEND 3LD8B 1BQLH 2YOCA 4KTEL 4JZOB 1Q1JH 5EN2B 2NY3D 3KYKH 2IMNA 3IXAB 2EIEA 4HWEL 4JDZA 4MZ2A 2X4PB 5E8PB 2GT9A 1MCIA 2AXGB 2HVJB 4NNXA 4S1QH 5L0QB 1J1PH 2YSSB 3GSWB 1HDMB 3U7YL 4ZTPH 4D3CL 5DMGD 3NAAL 4IOFD 4O9HL 4X0KB 4ZSOE 5BOPA 1I1AC 4K7FA 4NC1E 2VISA 2BNUB 3H3BC 3RWDA 4KHXH 3E2HC 3KWWB 4LSDA 4XP1L 3FTGB 2EYSB 3C6LA 2ILLA 3VFSB 2DI9A 4XHQA 2CKBA 1JYVA 2D03L 5D96B 2Y06H 1XH3B 4LSPL 3RGVA 5I8OH 5BZWB 4YDIL 3KLAA 5FDWA 4FFZH 1BD2D 5FCUL 1RK1B 4ZPVB 1IC4H 4WI6A 1WISA 5C8JB 4JY4B 1FSKC 1ETZA 4Y0GA 2FNBA 4L3ED 5DO2D 5ANMB 4ETYA 1KNOB 5HHOA 3UTTD 3LQMA 1A1NA 4LIQL 5GS1A 3FQWA 3FMGH 3L7FB 5ISZB 2PW1A 1FNEA 1S9VA 3BZ4A 3K80A 3QFJB 3KJ4B 1ZT4A 3EOYG 4JVPA 5JZ7D 1WV7T 2LABA 2PUQT 4KKAC 2BNQD 1S78C 2GAZA 3I6GB 1OAQL 4JKPL 2OTUA 4L4JA 3FCTB 1CU4L 3QI9B 3K7UA 3O11A 1SQ2N 1XMWA 2DMCA 2DKMA 4C56B 5FYKU 1XR8A 4FMFA 1EHXA 4U7SA 2YKLH 3BZFB 3DUSB 2OQJB 4X7SH 4WHDA 3HE7D 1GGYA 1K4DA 3EHBC 3HMXH 4LAQH 4F7TB 1RZJL 2MSPA 4MDJA 4MAUL 4DVBA 4JFDB 4OCWL 1YZZA 4JFHD 3BIAX 4NIKB 4XCYB 1BBDL 4M93B 1QVOB 2R29L 3FT4A 4WEUD 1A6ZA 1R3HA 3KPTA 4G6KH 4AEIL 3MLXH 1KLUB 1J0HA 3JTTA 3B9EA 1WIPA 4NO3A 5IHZB 1E28B 2Z0BA 2B5IC 4GOSA 4OD2B 2YS4A 4OGYH 3S3SA 4QRSB 4QF1A 5DD3L 3VD4A 2YK1L 1Q9KB 1TQCB 3WDHA 1WCQA 3QUZB 2DBLL 4KY1H 3RI5F 4WFED 4OB5H 3TZVD 3I02B 4ZQKA 1MRCL 1RUAL 4KK5C 5CJQL 3V79C 4YO0A 5FYKL 2R0KH 4CKVX 5HI4D 4U1HB 3ZLQC 1Q94B 4O2FB 3UO1L 4AG4H 2DQUH 4ZSOA 5E2TH 1JF1A 3ME0A 3BH9A 1UYWH 4NKOB 3GSUB 3VXOB 4L4VD 3DRTB 5DLML 4KKNA 3TO2B 4HH9B 4YXHH 4HIIB 5DJXB 5D2LB 4MNHB 3T77A 2W65B 3S88L 4KPHH 3NIFF 2OTPA 2ESVD 5FYLL 1WZ1L 3NPZB 3X3FH 25C8H 4ONHB 1UCTA 1CGSL 3DUUA 5FUCC 3LKNA 4PGCB 1XCTA 2X1WL 3EYOA 5DVOA 5IOPA 4Q0XH 2C9AA 1VENA 3O3DA 4GRWE 4DOHE 4EQ2A 1I3UA 2F54D 3D18A 4N5ED 1JGLH 4JANB 5AWNH 1SJEA 4X6FA 3VXSA 1A7BA 1IKNA 5EIIB 1YMMD 3MOAH 2GSIA 1UWXK 3OKOA 3LOWA 4PJFB 3ULUL 3LZFH 5JORA 3RHWF 2XG5A 9CGTA 4MQ7B 3FO0L 1OP3H 1NSNL 1OHQA 4ZUUB 3SO3B 1S3KL 3BEVA 1M1SA 3JWDH 5D1QB 1CIUA 2VDKL 5FB8B 2UYLB 1GGTA 4NSKB 2VLME 1WBXA 3OKLB 3STZA 5I15L 5F44A 1HWGB 1QKZL 5BO1L 4RNRB 3UJTH 4CDHA 1WGOA 2GTZA 2DYPB 1FNHA 3TVMA 3B9KA 4XMLH 3MJ8B 1IVLA 3MRKA 1J8HE 1YN7A 4LKXB 1U8OA 4TUKL 1UWGL 1W0YT 3L3DB 3L3GB 4S0TD 1RVFL 3WBDA 4PRNB 1A3RL 2FHFA 4HGKC 5HHMD 3SCMC 3EHBD 2F53D 1YPZE 2A1WH 3PIQB 4PJFF 2XKNB 4PRIE 3QQ3A 2I9TA 1N0XH 4XVSL 3B3IA 2ZOKB 2C1OA 4U6YB 1G9NC 5HHOE 1GIGH 2X4OB 5IW1A 2CK2A 1AJ7H 3D69A 1NFIA 1OQXA 5IB1A 2VLRB 2ZUXA 1QRNA 3PWJA 1HH6A 1EFQA 1CL7H 4PBVC 5EUOB 5M94B 4M43L 3DRQA 5GS0H 3KJ4C 1JN6A 1XF4A 3D0VB 1R0AH 2MOVA 3IAGC 4WV1C 1RD6A 3PABB 3C5ZA 4Z7OE 2Q1EA 2ITDB 3NH7H 1BZ7A 3GSRB 3PV7A 2CSPA 4JZJB 3SDCD 2HA1A 1HSAA 1TPXB 1NCDH 2OR7A 2FJFA 3PWUA 3RDTB 3FKUS 4EXPX 4BK4A 1SVZA 4UILL 2V17H 3GKWH 1X3DA 1A21A 3G6JA 3RVTC 2OR9L 4QRRD 3AREC 4OFDA 1VESA 3LRSA 5GISH 4Z7WA 5E2TL 5F7WC 3EFFB 5AYUH 1YA5A 4XP9H 3A67H 4JO3L 4PR5B 2VXSH 1I4FA 4JQIL 2DQDH 4Z0BH 2P4AB 5FYJE 1NBZA 2A83B 4Z7UF 3UTSD 4JY6A 4YAQB 2QKIB 4KQ4L 3MRBB 4RAHA 3O8XA 1WBZA 3AREB 2R4SL 5D70L 1BMGA 1S7QA 3DV4A 4LGPB 2PN5A 2NLJA 3P11L 2CDGA 1OAZH 4Z5RB 2EE2A 1KELL 2Q86A 4NQSA 2CJUH 1CN4A 4NWTH 5IJKA 1FRGH 4XH2B 3WFDL 1GGIH 3ALPA 4HAGA 5CKAA 2FR4B 4XCFH 4YQXH 5I1HL 3BH8B 4IRJA 4OFVA 4JPVH 1EJOL 1BGXH 4WI8A 3AS3A 4BKLA 4N5UA 4XNUH 2XG4A 2CRZA 1ZHLB 3G5XB 3SDCA 1TVBB 5GGTH 3IJHB 5CEZH 4NRYB 4KKCD 4RFEA 4YDLB 5SX4H 2XWJB 3D85A 1MF2L 1F45A 3P77A 4PIRF 3RWCB 4PG2C 1P7KA 4UTBL 4M4PA 4RBPH 4CMHC 5CMAB 3V52L 5BQ7B 2A73A 5E94A 5IVZA 3F7YA 5ACLA 5ITFB 2ZJSH 5FUZL 3WJLA 3K1DA 2HFTA 4NM4L 3DETD 1ZHBA 2BSRB 2RBLA 3B9KB 4U6TA 2A9ML 1RZFH 3EO1B 2MCPL 3C87A 2HT2C 2GTZB 1I9RH 5IVXE 3BJ91 1FZJB 2FRGP 1CXIA 4DJMA 4GRMA 1CK0H 4YPGB 5T1KD 4NT6B 1AGCA 2RHEA 4BZ2L 3LHPL 4DUXA 2AQ3A 1G6RB 2DS4A 2NCMA 4R2GB 5F3BB 2O61B 2F8XC 3OF6A 3QDJD 3SDDC 3LKRA 2XY2A 5DDHB 1PSKL 1NJ9A 3DPBA 3QIBB 3ES6B 1OD7A 2IG2H 1XZ0A 2VITA 1A22B 3OKOB 4Z76A 5HHQB 1AY1H 2I25N 4RGND 5T3ZE 3MLUH 5EZJA 1F8TH 4MJIB 2HJKB 4KI5D 3QCUL 2AXJA 5ID1B 2JJUA 3CFDA 3MUGA 2MQ0A 5MERB 1YEHL 4RX4A 3M17A 4H1LB 5CEZE 5CEZD 5D96C 4IIQB 4M62H 2BP3A 4GAJH 1PQZB 1ZGLP 1DQJA 3KNBA 2W9DH 1BFOB 1UVQA 4KAQL 3P11H 1ADQA 2DQCH 3V95A 1KLFA 2P48B 3O6MH 2YWYA 4HXBH 5D2LA 3U30C 2R0WH 2H2PC 3F7VB 1N0XL 1NANI 2AKRB 2IAMC 5JIIA 1GRWA 3FT3A 4U2YA 3MC0A 5EU3A 1JF1B 3C8DA 3T0BA 3OBAA 3L3IB 5DTFA 4HPOL 3KPRD 1UWGH 2I24N 1M71B 3F8UB 4NM4H 4L4TB 5GGVL 5FECA 2FX9H 1J7VR 2BFVH 1HHJB 1NPUA 4PRBA 1FORH 1ORQB 1YEDB 5HI5D 2R8SH 5C0JA 3ZT6A 1VGKA 5B39B 4Y88A 5HHNB 3OR7B 4QY8B 1K4CB 3BEWB 5CGMA 2A74A 4Y5XB 5I1LA 1MCDA 3DGCR 1MHHA 2PCPA 3K46A 5DMJB 5SX5H 4WIQA 3QNXA 4PRPB 5EBWB 1FYTD 1U3HD 1YNKH 5CINL 5DHXB 3OKNB 2WIMA 2JCCE 2AJYH 2CH8A 2YKLL 3PWPA 4MQTB 2B0SL 3SO5A 1C5BL 1OP9A 2CUHA 5BS0E 1A8JH 1MHEB 1J0KA 5D6DC 4L4TE 3FOLB 4LRIA 3K4DA 4AQOA 4R4FH 5TPWH 4ENED 2VE6A 3QUYA 5FHAL 1HH9A 3VXUA 4O4YL 3PNWB 1ORSB 4Z7WE 2NY6D 5F7YC 1MJ8L 4PRDB 3DMMD 2YPLA 1K85A 5DHVB 1A6UL 5JIPA 1NGXA 3NFNA 3NGBB 5CJXA 1BREA 3B43A 5HHXH 3IDJA 3KYKL 2WQ8A 1A7PL 5L9DL 4KVCH 3KPRB 2P5EB 1P6AB 2QHRH 3FCTA 4GW1B 3IF1B 2OTUB 3QIWB 3LDBC 5CWSA 5C3TA 5IMKB 2NNAB 2X5PA 5HDOA 1EEYB 3DV6A 3L5IA 2EDKA 1J1OL 5MEOB 1WZ1H 3X3FL 2VUOA 3MA7B 5GXBB 4Z8FL 3RL2B 3PV6A 5DJ8B 3HE6A 1C7TA 1A4KA 3L7FA 1MY7A 4EEEA 3O6FB 1NEUA 4G6MH 1QD0A 3ZHLA 4PS4L 1F3JA 1UH4A 1P4IH 5DZNA 5CJBA 5TF0A 5C0AD 4FTVA 1G9MH 6FABH 4XVTH 1T80A 4C83B 2DQUL 1YPZA 1T3FA 3NZ8A 1JTTA 4ONOA 2BRQA 2AJSL 2CRIA 5KTEL 1F11A 2ESVB 3KYNA 4RIRB 4C57C 1G7JB 3C08L 5DGQA 1F4AA 5A2LH 4ZO9A 5E4EB 1IEAB 3JVGA 1S7UB 2JB6A 2VXQH 3O9WD 3L3HB 1TJHL 4LPUA 3ZKQD 4N8CH 4FZEL 2J6EL 1QRND 1UWXH 3MV7D 2ZSWA 3SE4A 1SBSH 4MLSA 1KJMB 4ODWB 5MHSD 1BVKB 4WW2B 1AH1A 4R2GD 4JFZH 1G7QB 2FIRT 1KB9K 5IMLB 3VFUA 2R2EA 4HXAL 12E8L 3MCKB 2BMKB 2R29H 2X4PA 1CD1B 3AXLA 3HE6D 1FC2D 4KVNL 1CFSB 1UJTA 4TPRH 4XCNA 5JMOC 4Y8AA 4RWHA 1FLRL 3IAPA 1FFOB 4K3JL 2VDRL 1G84A 1F58L 4ZUSA 5JXEA 1LO4H 1BFVL 5L8JB 1YPZB 1DN2A 2WLYA 4LSTH 1EH9A 2V5SA 4PUBL 3X11A 3PP3H 5AAMA 4AENB 4UV4L 4HF5H 5E6IC 3QEUA 3FT2B 1EGJA 2EDNA 1YECL 1GIGL 1H5BC 3O6FA 4G9DA 1T5WA 2J8UA 3QEHA 1QR1B 4EN3C 3GSVA 1BVLB 1Q38A 3D39E 1DQQB 1U58A 2BVTA 2X9XA 5GRZA 4K3EH 2OS7A 4MD5A 3STLB 1I1FB 1BQHB 4PJ9A 5IVOA 5DD0L 1A7RH 5H35B 1T7YA 1A3RH 3RWHB 3STBA 4GMTL 4JM2F 1VEOA 3LS5L 1WWAX 4TUKH 3PDOA 3CSYB 1AD0A 1TPXC 3MV9A 5C0BE 1BOGB 2DICA 3D39B 3FO9B 3VXPA 1PJ9A 4O2CB 5JW5A 5T3XE 2HT3C 4GG6B 5EZIH 4LGRB 1UM6H 4GG8B 1RAMA 4JM2D 1IFHH 2XNAB 4URTB 1ZAGA 3MFFB 4WWKA 3SJVD 3HFMH 3ARGA 4GAYA 1ZT7B 5EOCL 1MAMH 3ULVC 4WU7A 3O81A 5EORH 3VXQB 2VLJB 1W2KT 4OCMC 4KVCL 4JHBA 4Y5YA 5E6YA 1RJZA 4NGHL 5CBAA 5CJ5A 3GIVA 5CGYC 3U4EB 3TJHD 5IVXA 1T5XA 1KJ2A 4AL8H 4POYA 1QBLL 1QQDA 2CKNA 2MTPA 3MRFB 3ZKMC 4RMRA 4JE4B 4RCAA 1ZE3C 5HHME 4JN2B 4JO1L 3LZFL 3RKDD 1OAQH 4JKPH 3KPSB 3QNXB 3R1GL 3BWAA 4KK6C 3HG1E 2MMXA 4E0RB 1FO0A 1BAFH 1JNJA 4KQ3H 3SCMB 5CP3A 1HI6B 1HILA 2F58L 1B0WA 1RSFA 2FO4B 5D7JC 5DUBB 5F7EL 1C5BH 3S36X 5F93C 5L6YH 1C5DB 1EHLH 4FQXC 2C4FU 1HHHA 3MO1A 2CDFA 4LK4A 1U8QA 5JLZA 1LE9B 1KUMA 4L4TA 1T2XA 3ARUA 3R4DA 3NFSH 1QSED 5DR5H 4RAUB 1B88A 3MPCA 1A6WL 3AB0C 4TN9A 2IQAB 2W0KA 4XCCH 1KBGH 1JHLH 3K4AA 2E7LC 4MD4B 1UH2A 4WWKD 3FQNB 5K9OB 4BFGA 2QV2A 1PZUB 1CBVH 1K8IB 4NQEB 2X1QA 1D5BB 3HZKA 1A7RL 1H0DA 4LLYA 4M6AA 1ZK9A 1T2QL 5CEYA 5C0IA 1HHGA 5DQDH 1G7LB 5DJ2A 5CIPA 1R5WA 1S7SB 4R7NB 4E42A 4M8VA 1PQZA 3QHFL 5JMRA 3GJFH 1HIML 3T04D 4S11A 4MS8D 3W11C 3ZYOA 2R0KL 2DLGA 4TNWF 3ZHDA 1WFTA 1UA6L 1MOEA 4XC1H 1WTGT 4LEXH 3H7LA 4NC1C 1XGYH 3N1GC 2C3HA 3VFMA 2CGRL 3BPLC 1MCPL 5KVGL 2MFNA 1AI1L 4LF3B 3CFKA 3TO4B 5IBUG 5CS7A 1I8MA 1UZ8B 1U41A 2PO6A 4F80A 5HYSG 3LKQA 3MXVL 3QXTA 4K2UL 1NAKL 1T1ZA 1LEKB 1S5HB 2F8OA 2BHZA 3T09A 5F7HA 3LB6C 5DDHA 2X4NB 4DUVA 1LGVA 5DD6B 4KDTA 2VZTA 1ITBB 1AFVL 4NNYA 5IB4B 3VG0L 1Q72H 3MBEB 3HUJE 2M1KA 4WI3A 1FV1B 1PFCA 1N2RB 5F1OB 4AMKH 3IDGB 4NRXA 3ZKSD 1A6AB 4F7MB 5I18H 2OL3B 4JM2B 5CZXD 5TDOB 4NHUA 3THMH 5IESH 2HFFA 3HRZA 3L7EA 4ODBD 3SE3C 4BQCA 5GRUH 7FABL 4PJAB 1G7IB 3UMTA 4KFZC 1RUMH 4R26L 4MJID 2AI0L 3PQYA 3NBNA 5BQ7A 3W0WE 1LO2L 1R24A 3OG4B 2CRMA 1MPAL 1MWAB 3VXUD 1MSPA 4MNGA 3SDAD 3NACL 5ICYA 4U2ZA 3PWVA 1JWMA 3HCVA 1EJ6A 5L2KB 2YRLA 3C60A 3JV6B 3MRQA 4DGIH 1S9WB 3TA3D 3JV5A 3GHEL 1ZT1B 2XA8L 4HBQA 3BZEB 1NGYB 5CJ8A 5GGRB 3GHBH 3CMGA 1DE4B 3T65B 1CGVA 1JHLL 4OI9A 1WTLA 3CVHA 5FYJH 3CFBA 1JNNH 5KVFH 4NCC2 5HYQA 3P73B 3QUXA 1NEZB 5J6GA 4W81A 3H6JA 3ARBB 4ZPTA 4MHHG 4N1CA 3WS3A 2MKWA 2WV3A 3U6RA 2ERJB 1RK0B 5ID0A 5I71C 4UV7H 3ECBB 5GIRB 3EZ8A 2AJZA 4G8GB 4U6XA 1CGXA 1EO7A 1RJYA 1HYSD 5I16A 3UTPD 4NQED 2GUOB 2NY4B 2NY0D 1B6DA 2IAND 4YWGL 2DQEL 1FN4B 3WSQH 2ZNXA 3PGFL 1TCMA 3EYQC 3SKJL 3UPRB 2R23B 3VFRB 4P3CL 3ULUF 4ZUWB 2DKUA 4UNTA 5T1DL 3D2UD 3CC5B 1KOAA 1MJUH 2WLZA 1AGBA 2VDML 1I1CA 1BM3L 1JE6A 3ARFB 5DYOB 4GKSA 5T5NF 5CEXB 2NTFA 2R0ZL 1OGAB 2V5YA 1IZJA 2ITDA 1B2WL 5EOCH 2WWMD 1I7RA 5B38A 4GLRH 4MXVE 2DRUA 1U3YA 1UM5L 3CPLA 4TSCH 1S8DA 4NFCA 1H8OA 3HAEG 5FGBC 3HZVA 1NDGB 3I3DA 5KVFL 4R97C 2QSTA 3B2VL 4I18C 3GSOA 1CDBA 4LNRB 3GNML 1BEYL 1WSST 4RGOH 3HMWH 1BX2A 2HN7B 4RDQF 4P46A 4MMZC 1JGUH 3MNZA 3T0ED 2Z31D 2QR0A 1NLBH 1OAXH 3GSXB 1NCCL 4U6YA 5DJ0A 3NH7L 1F3DH 2V2XB 3B3IB 5D93C 3D3VA 3QQ3B 2I9TB 3B9DA 1ZV5A 3WNMA 3B8SA 5C0CA 1WCBA 2FGWH 2DWEB 5B4MD 3VXSE 1EFXB 3S7GA 3RWEA 3PJSB 1WT5C 2C3GA 3W2DL 4JRXD 4LCCB 4LHUB 4UU9A 3BISA 3OMZA 3SKJH 5DMIH 1I7TB 1LO0H 4QTIH 3QG7L 3MRKB 4X6DA 3ULUD 4U4BA 1YEFH 4KDVA 4DKFH 4QHMA 2EZ0D 3OHXB 3BWUC 5E1HB 1OT1A 4OGAC 4GKZB 1NUFA 2YUVA 2Y6SD 3MCG1 1Y18A 2AK1H 5GS2H 5F7FA 3RTQC 1J0IA 2SEBA 4IOIA 4PLNC 1AXTL 2FIKA 5MP6H 3RP1A 1WWWX 3HG1B 1CFNA 3NCBB 5B8CC 4X6DB 2A6DB 4X8JB 5D1QA 5D6DA 3LPFA 4XCCL 1BIIB 3BEVB 1D5IH 5DRNB 1OTUC 1U95A 1KC5L 4Y5VA 4L29A 1JHKL 4LAJH 5IBUB 2D31B 3UTTE 2CDEA 2ITCB 3MXVH 5I1GH 3D85D 2H3NA 1N64H 1NFDA 2JELH 3RTQA 4JDVB 4NHCH 3TNMA 3BE1H 5JW3H 4Z7VB 5C0RH 4Q6IC 3W11D 5JA8B 5DQ9B 5F1NB 5SWZA 1JYWA 1G6RL 1EV2E 5DJ6B 3PDGA 2J6EH 3A6OA 2EIDA 1E4WH 1VPOH 4YHOL 4KTDL 3TT1L 1N5AA 5BVJB 5HGGS 3UTSE 3ZKNC 3MNZB 4OCYL 4KUCF 3FO0H 3TBWA 1HEZB 2RFXB 4X7TA 1KT2A 1TNNA 1P6FA 1QBML 5I66B 1WEJH 4J3VA 5TDPA 1EPFA 1RJLA 3H9SE 3A6BH 5FXCH 2CD0A 4P4KD 4RWYH 1UKSA 4AQ1B 2FEDD 4G43A 1MCNA 4XNQB 3KG5A 5JOFA 4O5LH 3MLPA 3VGAB 1AGBB 3E3QC 4HIIA 5DJXA 2VQUA 4X4YB 3AMKA 4Q9QL 1A5FL 1U6AH 5GRVL 2EYTA 4FQXD 5I0DA 1KCUH 4EN3B 4JRYB 1KLGA 2P24B 4M6NH 4Y16D 1DQDH 1BP3B 4HS8H 1ND0A 1S7VA 2DQIH 1X5JA 1QLEH 5T1LD 5AD0A 1DDHA 1NMBH 2NY3B 3MRHB 4UOJA 1JFQL 3GHBL 2A0LD 1FFNB 3S88H 5EIVA 1P5UA 3EO9H 4JG1L 1MNUH 3FAXA 3G5VA 4ZXBB 4HWBA 4QYOB 2Z91A 1MAKA 1A6PA 1S7WB 3G5VB 3TBSB 4WEMB 5BXFA 1GGUA 3QO0A 3QUXB 3BMWA 2VDQL 1T22A 5LCVH 1XF2A 5JO5B 1KLUA 4K7PH 4XPFL 1A6ZB 5D72H 1MFBH 4OF3A 3ZL4L 2B0SH 1MFDL 2XXCB 4FQQA 5E9DA 1YPZF 5C09B 1C8PA 4M5ZL 3M1BA 5SWSA 1DCLA 3HNVH 3IT8D 1M7DB 1M7DA 3VFOA 2BVPA 1N6QH 3Q3GB 4KROD 5DHVH 5SWSB 5JHDB 2AERT 5DJAA 4PJCB 2E27L 4RGNE 1MWAA 2OQJA 4KXZH 3QWOB 3WIHH 5KVMC 3M8OL 3KS0J 5C09A 3OZ9H 1BBJA 1R3KA 4PRHD 2GY5A 3KYMA 3QYCA 2FLBT 1CXFA 4RSVA 4NYLA 5HGDA 1FJ1B 4FQCH 1DQDL 4HS8L 4LVNB 2W07A 1I3VA 2CK0H 4Q58C 4NQTA 1FVDB 3JSSA 4EBQL 2NY2B 3QO0B 4XB7A 1ZA3B 3P2TA 4JFED 2CXKA 1TFHA 3DXAE 5E6ID 4PG2A 4XX1G 3IU4H 3RY5A 2ZG2A 3ARTA 3NFPB 4O5LL 4N8CL 5C3LD 1ZVYA 4KROC 5F7EH 1D3CA 4LHQB 2VLJE 3LEVH 5KW9H 4D0BA 1A1NB 3MJ7A 3MRHA 4Z7VA 1T1ZB 3TNMB 3NCJH 3RTQB 4PJCE 1IQDA 2BDNH 4PUBH 2X4UA 4RMVA 5GJTH 4FABL 3ILQC 3AU1B 5EZOL 3O6KH 5IFHL 1URLA 2VDOH 3TA3A 1BPVA 3VXRD 5I75C 5FDWB 5EC1A 1JI2A 3RNKA 4X4YA 1RUQH 4OUUB 5JA9A 2XKSA 4FQIL 5E24E 2VZVA 4UTBH 3FTGA 5IJVA 2G60H 2O26U 4X6EA 5C2BL 1R3IL 4I0KA 2FD6H 3MRCA 2B4CC 4LQFH 2ADGB 3VW3H 4X0KA 5IHUH 5TGBB 1T21B 4NBXB 3O9WC 1QRKA 4Y4FA 3QQ4B 2GIYA 4R8WL 4JPVL 4UU9B 1Q0XH 2W0FA 4D9LH 1FRGL 1KPVA 1OAUL 3PJSA 4BFIB 1LO5A 4Z7QF 2IQ9L 4UDTB 2IQAA 4POUB 4WI2A 2D4DA 4PY7A 1N7MH 4LLUA 5JXAH 1IM3B 1YEFL 1I1RA 4DKFL 2Z31B 4JZJC 4FABH 2Z93B 1MUJA 3EAKA 1OM3H 2BJMH 2CXGA 4Z77A 2G5BB 5HGBB 2AJYL 3RL1A 4LNRA 1NEZG 2OP4L 3FB6A 1U8PA 1OD9A 1U91A 5ESVB 3VFGH 2YHGA 1AR1D 3P0VH 5C0NC 1HI6A 1YUHA 4D0CB 3P0YH 1T89C 1CQYA 1J0ZA 1G9MC 3G04B 1P84K 4GKZA 4JR9H 4UILH 2HTKC 3QQ9C 3VH8B 4F9PA 4HUNB 2OTWB 5EU4A 5FHBH 4CN6A 1VFBB 4HCRH 4JO2H 2HFGL 5TFSL 1A6VH 2NY7L 3GJEA 5CZKA 1NBVL 3GGWB 4P57B 1TETH 3MLSH 5E2VL 5JDSA 5MP6L 3SDDA 2GUOA 4OV5A 4XNZC 3DSFH 5GRJH 2R39A 3RWFB 2AV7A 4C59B 2Z92B 4RGMC 3AROA 4GQ9L 3X13A 1D6EB 5TE7H 1QHOA 1QSFA 4QRPD 1Q8MA 4XNMA 3QEQD 4OLVL 4GSDH 5I8EA 1FCCA 4OLEA 4UDUA 3VRLF 1IEHA 1U3HC 4LPWA 3CSYA 2FECI 2QQNL 3FB7A 4UZGA 3ARBA 1EVTC 3MACL 4MDIA 4PB9L 4NBZB 1JWSB 5J57B 1UEYA 4K23L 5K59F 2D7TH 4I3RL 4YZFE 4JFYB 5C7XH 3F7RA 4I0PC 3VFVA 2P5ED 5HI5C 4O51A 1PZ5A 2IH1A 3WFCH 5IMOB 1FYHB 5FM5M 1P7QA 1FO0H 4UV7L 3DURA 4Q2ZA 4XVUD 1DLHB 3V2AR 1JFQH 4I3GA 1OF2B 5EG6C 4JR9L 3O3AB 1AY1L 3HR5A 4RX4D 1NGZA 2QSQA 2Z31C 2NYYD 4GKNA 5F1IB 4R7DA 3TJEH 3H3PL 2X1PA 1CFBA 3TIDB 3H42L 1R5VA 5D7IB 2PYFA 3D9AL 2H8PB 4RZCA 4FQHA 3NVQA 3QPXL 4OZIB 3BGFC 2EDJA 4ELMB 4KWUA 2BJML 5EC2A 4XXDB 1EHNA 5FKAB 3U6RB 2NY2D 2BMKA 3DBXA 3G5YA 4TQEH 3EDKA 4GO6B 4QRQA 5HSFA 2XACC 1S9YB 5AYQA 5HGHB 1SY6H 2VQTA 3ARBD 5E4IA 4PJXB 2DI7A 4U1JB 3HC3L 1KJMA 3CSPA 3MNWA 5E2UL 3TIEA 5HYSA 5HYJA 1NMCC 4KI5C 3DROB 3I6KB 1SY6A 3THML 2CMRH 2RIKA 3BZEA 4NCC1 4WU5B 3P4OA 1Z9SA 2HFGH 1U8KA 4NKMB 1CE1L 2BC4B 3TN0B 3ZO0A 5AUMA 5JW4Q 2I9LB 3EYUL 1I3GH 3BUTA 2AJUH 3NN8B 1ZLVK 3MRIB 4OZFG 1KFAL 1WT5A 1QFUH 4AZ8A 1NUGA 1JGDB 2G60L 3SDYH 5T1LA 2YD3A 4GLRI 5D7LE 4F33B 4XP4H 1J0YA 3MTRA 1IRAY 2DM4A 2B2XH 2XN9A 4KHTL 4J12A 4LLMA 4QTHA 3RVVD 4HWZB 3IDGA 1HHGB 1YY8A 1WF5A 5KSVA 1MLBB 5GJTL 4PJXF 1FG2B 2GK0A 3DXAD 4ZD3L 1TZHA 5CLWA 5F96L 3B5TA 1DL7H 1OAUH 3H3KA 3CNKA 7FABH 3IFNL 3K81A 3FZUC 3WDJA 4KKCC 2FATH 4I5BA 4Y19E 3TYFB 1H3TA 1EXUB 3GUTB 4L8SC 2OR9H 4LQFL 4WJ5A 4AH2A 2HLFC 3LEYL 5DMYA 1HHHB 3MO1B 1D5MB 2VC2L 4OCSL 4YBLB 1EZVX 3VXNB 1DQML 1S5IH 2R8SL 2OL3L 5FYJU 4JQVC 4WTZA 3PWPB 4Z0XA 1Q9OA 2YMXH 3KPSD 3RFZC 4W4OC 4GRWB 4OCLC 4DOHB 3ARGC 1A7NL 2E7MA 1TVHA 3LB6D 3N1PC 4ONFH 5K9KB 2H45A 3PL6C 1GGCL 2Q8BL 4Q9QH 4L8BB 1JWUA 3FQTA 4I2XB 4DCQA 2E6QA 5HPMB 4HWBH 1H3PH 1ZWIB 3W9EA 4Y4KD 5C6TH 5LQBH 2VLJA 3OR7A 4P3DA 2E9IA 3T0WA 2PYED 4MYWB 4PV9A 4X9GA 4WENB 1ES0B 4I3SL 2JCCF 3ARGB 1RZKH 3VGEA 3JZ7A 4PJ5B 2DLIA 4Y2DC 2JJTC 3WXVH 2C3XA 4NN5B 3PP4L 4RAUA 5IFAL 4LFHG 4MB5A 3C60D 4MS8C 1K9TA 4I5BB 3D39A 3K2UL 5I17B 4LRNH 1AC0A 4JRWA 3SDCC 5E2VH 5EO0A 3F6IA 2PW2B 2AEIT 2CDFB 4PJ5A 4Y7MA 2FWOB 3MGOA 5I75B 5A43C 3VGAC 2ERJC 3MRNA 1MLCA 4Y1AE 4DZ8B 4PJGA 5F89B 1KN2L 3T1FA 4DFHA 5I30H 4QHLB 2DI8A 1ZVSA 4I2XA 3WNOA 2E9BA 4ODSH 4DCQB 3V4VL 2CPCA 1KB5H 5FYLD 1X5GA 5I1DB 43C9A 1L9MA 3TZVB 3CX5J 2PYEB 5EO9B 5ESAA 1J8HB 4XPBL 1PY4A 1MFDH 4H1LA 4WWID 5DXWA 2XPGB 3T0EB 1IAKA 2NXZC 4OIIL 4XVSH 4NQUA 4LARH 3A6BL 2YD6A 3O41A 4HKBB 5C0AE 5EZJB 1EAPB 2GJZA 5D7JD 1QTYT 5KANG 2A2QT 2IPUK 1EXUA 4KK9C 1JNHA 3OAZH 4KJQD 4ZMAT 1YDPA 1XZ0B 2V6HA 1G6RH 3VFUB 3PDOB 3V7MA 1SEBB 4RA3A 5DFWH 4JFDE 3CSBA 4KTEH 4NHCL 5JR1L 4R3SA 2DF3A 1S9YA 4QOKA 1S9XA 1MCSA 3OKMA 5DC0A 3LN4A 2R4RL 4NT6A 1KCUL 5AZ2L 2WANA 2UUDK 4YXLL 5GGSY 3BXNA 4PRAA 2F54B 2G5RA 5D71L 4QXTA 3QHZL 1WK0A 1SYSA 1I1YA 3HPJA 1MCJA 5C07B 3TPKA 1H15A 3FHQA 2HMIC 2V5TA 5F7KC 4AENA 3TIDA 1S7TB 4JFZL 3O2VL 1UYWL 2Q7NA 3X11B 2HKFL 4GAGH 4A6YL 3WNNA 5GS0L 4FTVD 4QKXB 1DFBH 4H1LH 3LDBB 2NW2B 4D9RD 1OAZL 1F3JB 4LVOC 2R0ZH 3WXWH 3EO0A 3MRRB 5FO7B 2J5LC 3IJHA 4LDEB 5BMFH 1MAJA 3SDCB 5J9PA 5D70H 5SX5K 3G5XA 5B38G 1KSRA 2XWTA 3FQRA 2QLVB 5T3XH 3RDTD 2G9HA 5CHNB 4YC2B 5E99H 1F4WH 1MIEL 1YYLH 3HAEB 1CICD 5HYSB 4LSUH 4XI5C 1JWSA 2NNAA 1INQA 1JK8B 4M1CD 5K93A 3MXWL 1T2QH 1NCCH 1XIWB 4YHMH 2AJVL 2ADJB 4HKXB 2D7MA 3V9FA 3NFNB 1T66D 3SGJA 4KRPC 4NJ9H 3QO1A 3WDIA 2ED7A 1UCBH 2DIJA 4PJEE 1D6VL 2Z92A 1NDMA 3S96A 4TSCL 4Q9BA 3L95A 3WUWB 3HC0A 3T4YB 3SDDB 4Z7WB 1MHEA 3QNYA 3TZVC 4UNUA 3MZGB 3SGJC 5FO9A 2APTA 3RZCC 2PYEE 3ZL4H 4FTVB 2XTJC 5I6XC 2V5MA 2WK2A 1AKJA 4EKXA 3WIIH 4G7VH 3QG7H 2QQNH 2HH0L 43C9B 1YEIL 4RRPA 5IMMA 2K7PA 3DURB 3TBYA 4DAGL 3MUJA 2FJGB 4L3EB 3VRIB 4AYFA 5DZLA 1IGJB 4WW1B 2DQFA 5KS9A 3QXWA 4PJGB 1JN6B 3DRQB 5C2UB 2OMNA 2BVUA 2NW3A 4GW1A 1DVFC 4HLZG 1W8NA 3M45A 2H6PB 4Z9KB 3KPRA 4CAGA 2DWDB 2CLZB 5D5MA 4K7PY 4G42A 1BECA 1L6ZA 1NGXB 4XVJH 5I8EB 2JKXA 5A2FA 5KSBF 5DTFB 4CJ1A 2W59A 3GBNH 4JLRB 1GPOL 4CADA 2WUCH 2XTJD 3MLRH 1IKFL 4YUEH 1R3LA 2VYRE 1U36A 3IDXH 2EDEA 4U1SA 4MMXC 1UM5H 1CTNA 4MA8L 5KOMC 3RA7L 5D7LA 4PRNA 5DS8B 4QRPB 1RUKL 5C07E 4BUHA 1AQKH 1EFXD 3GJEB 3FQTB 3BKML 1QZ1A 1T21A 1CD0A 1MQKH 1BIHA 2EXWC 3VRJB 1BJ1J 3S37H 2OTWA 3PGFH 3NAAH 1UM4L 4CNIB 4IRSD 4M1CC 4NFDA 4NN6C 5GGSB 1CXHA 5E2WL 3M17B 2F5BL 5HHNA 4R97B 2OZ4L 4DQOL 3LIZH 5DD3H 1HHJA 4PRBB 2XQYG 1FIGH 4WUKL 3MJ6A 4R4BA 3GUTA 3RDTC 2WAHA 4Z76B 5KANI 3EYFB 4MCZB 3MGTB 4PJXE 4OZHA 4NFBA 4ZO8A 3GMQA 1CZ8L 2VDPH 5J06A 2VITB 3DX6A 1T89A 3VWKB 1QSEA 1CXKA 3PHOA 4HDIB 4JGMA 5L8KB 4UIMA 3RGHA 4TRPL 3UDWC 4ELMF 2EH7L 3IXTB 1TZHB 1DBKL 1NAKH 3LKRB 4ERSH 4BSWA 1D7FA 4RMUA 4N1EA 2VDLH 1E4JA 4YXLH 2QHLA 5SWZE 3OKKA 4GAFB 4J3TA 5F7NC 3PGCB 3V0VA 5KSVB 4HZLB 4LKCB 1NMAL 1KPUA 4PRPE 2OBGA 3QZWB 4I77H 4YHPB 4S1RH 3GJFK 1YQ2A 3LKNB 2P8LB 1PLGL 1IQWL 3LRGA 4OIAA 5TE4H 3R8BB 1OT2A 1V3LA 4DN3H 3BKJH 1DBJL 3F7YB 3U7YH 5IJVB 2P8MA 3RAJL 1X5ZA 4BYHA 4IM8A 4JFDD 3L6FA 4NO2B 4L8DA 4TSBL 5JHDA 4OUUA 4QRTA 2P43B 1RIUL 5EA0L 4WHCA 3RNKB 3VFOB 4GFTB 2H2PD 5I18L 4Y19B 3V0WH 3BW9B 4KRLB 2O5XL 2XWBB 3VXOA 3MNVA 3TA3B 4PJGE 3BKYL 3P30L 5A16A 1AFVH 4GS7B 1X5IA 2FECL 2QTEA 2HRLA 5EORL 1W72B 4Y2OA 4Y1AA 4M1DL 1JNLL 1TCRA 3RA7H 1NJ9B 2VR4A 1V8HA 3KPRE 5C0GA 4D0BB 3S37X 5E1AA 3QHZH 1H3VA 4HCRA 3ZT7A 3SBWA 2CDGB 1S7WA 1OW0A 5J0BA 3RRQA 4QCIB 1JUFA 1LK2A 3JWOH 4QHUB 4OZFA 1ZLWH 1UG9A 1WBZB 3AREA 2X05A 3MRBA 3SKNB 2FYYA 5D8JH 4X4MA 1OW0C 4GQPH 2PXYA 2H8PA 1FJ1A 5F9OH 3LN9A 4BJLA 2YA0A 4LSRL 4U1LA 1W0WB 1ZEAH 1X5XA 3WSQL 3OKEB 2AABH 1MQ8A 4L8SB 5H94B 4S1DC 5E0QA 4JFDA 2P7TB 3OAUL 3G6JB 3P77B 2XWJA 1VEMA 4F7TA 3MMEB 1V5JA 1UT9A 4PRHB 4OJFH 5C9JA 2OX5A 5C9KA 5T3ZH 1MRFH 1K2DA 1TVBA 1H8SA 1E4WL 1VPOL 2B4CH 4YHOH 4XNQA 4WGWB 4Q2ZB 4Y8DC 3BAEH 3UDWA 4I18B 2IANE 4FQQB 1CYGA 1FNGB 1JHTA 2IH1B 2XZQL 3BGFB 3J8F7 3SDXE 3EYVB 1KJVA 1T22B 4PV8A 4OSUL 1OTUD 4LVHC 2EDYA 1QRNB 3N0PB 5I66A 4JCLA 1XF3A 1XF5B 2Q8AL 1G0YR 4H20H 1QFHA 4KVNH 5ALCH 1IAOA 2IPKB 4LCUA 4X6CF 2DJSA 4YBLC 3TF7C 1N5AB 4DW2L 4ZXBA 3RTQD 5LGJB 1RU9H 4G9FA 1YEGL 5DJ6A 3O4LE 3QSKB 3ARGD 3LKSB 3CU1A 5DRZB 4N90E 3MXWH 2EZ0C 1II4E 5J1AB 2BSTB 3RWJB 1MRDH 4YGVA 3P30H 4OLXL 3HC3H 3EFFA 3JWDC 2XZCL 4PJ8A 2EDQA 4MAYA 4GJTB 1X9QA 4DGVH 1RIVH 4R4ND 4Y5VB 3O3EA 5B4MC 3UZVB 4X8JA 4WUUD 3TVMB 5J89A 1B4JL 4G43B 3G04A 3VFSA 2DQDL 2H1PH 1DEEA 3R06B 1KCRH 4PJHB 4MJIE 3QPQD 2AP2A 4PG9A 1G0XA 2XKUA 4S1RL 3PWNA 3KPMB 1I8IA 1U8PB 3RPIB 2HT4C 3P9MA 2GITA 1FDLL 2G5BA 2ZCKH 2FX8L 3JV0A 1DQMH 1S5IL 5BVJA 4FQLH 1J10A 2GT9B 5DUMH 4B0MM 2Z31A 3SN6N 2GEEA 4JDZB 3MLVL 1YEEL 4PJFA 4XX1E 5D7KD 5C0EA 1INEH 3UJIH 5T5NG 3FOMB 4OZGF 2R2HA 1X6LA 3MROB 3FOMA 1JIBA 4LCCC 3U0PB 2BCKB 4TVPD 4V1DE 4UDTA 4BUGA 5C0EB 4JANA 1HNGA 4R90L 3NOIA 5IF0A 3ALXA 2D31A 2FDBP 1BJ8A 2BNRE 3V0AC 3GSNL 5L88H 1XCTB 3EYOB 4HJJL 5BRZE 2R0LH 2YBRB 1I8IB 3KR3H 3OJVC 2X10A 3GI9H 4MSWB 3FONA 5IJKC 4RNRA 3I84A 2HLAB 2I60H 3GMMA 4ODHL 4GAGL 4QXUL 3O6LL 3BPCB 4UUJB 2YD8A 1T0NB 5D1ZC 2NTFB 1XGRA 3LMJL 3HI5H 1B4RA 1R3JB 5EC1B 5F9AC 3SCMD 5F7UA 3RHWK 4NKOA 2NR6D 4M3JA 3L5JA 4O2FA 2OLDA 1RZGB 1MCWM 4PGBA 1WCBB 1RJYB 1ONQB 3EYUH 3ZSTA 3TA3C 4U6XB 4E41D 4FQIH 2DOCA 4D94A 1EHLL 2V2XA 3FN9A 2AEWA 4M7LL 1XCQA 4KMLB 1ERNA 5E6IA 3GSXA 1CVSC 3WS3B 3S3PA 1K5NA 5EU7E 1XF3B 5IHBA 4NWTL 1BZQK 1DBML 5HYQB 4MD0A 4OT1L 4PV8B 3DUUB 1UJ3B 4PRPD 5JTWA 1GJIA 3GI9L 1FG9C 2G2RB 5CZXC 3U2SA 5B38B 1DE4A 1HKFA 1I7RB 3KR3L 3KYMB 3T65A 4P59H 4HXBL 3NA9H 3NGBC 4Q74A 1ZKAA 4LP4A 1ZLSL 4XPBH 4MDJB 3HNTL 1OB1A 1T03H 3TO2A 4NNPH 1JYXA 2VXSL 1V7MH 3CXHK 4N5EC 5J1SC 1UM6L 3BFOA 3FRUA 1KENH 4JEGB 4FQCL 5E9DB 3HPLA 3QP3A 5IM7A 3G5ZA 3IFPA 2V17L 1PKQA 1A4JA 4MNQB 5JO5A 43CAB 3RI5K 4NHUB 3QI9A 1G7MB 4XGZB 4Y4FD 2FYYB 3I6GA 5IW6B 2FX9L 3SKNA 5FM5O 3ETBF 1BWMA 1YMME 2XRAL 3GK8H 1JUFB 1LK2B 2ENYA 3BPNB 4QHUA 4M6OL 2NQCA 4L1HA 4DN4H 4NNYB 5IB4A 4QRPE 4ZPTB 3BESR 3KXFB 2HTKD 3QQ9D 1TQBC 1LQSR 4PRID 2QQKL 1DL7L 2CLVB 2LE9A 1LO2H 4XWGL 1LEKA 3V4UH 5ANMA 1OP5K 1OLZA 3AUVA 1T4KA 1AR1C 4JY4A 4XCYA 1UWEH 5LQBL 3BRDA 1QPPA 1JGEB 5HI4C 3FO2B 3QUMA 4LSQL 1HHIB 4DVBB 3SE8L 3BW9A 3IYLW 3QUXC 3D39D 1IKNC 1I9RL 4L4VA 4G80A 4WTZG 4WO4B 1NCBL 4JO4H 4PFEA 4F7CA 3F6LA 2V7HA 2JE8A 3CFEB 1Z3GH 4TSAL 3VD5A 3Q5OA 1JBJA 3KPPB 3G9AB 4X4ME 4F8QA 1ODAA 1FNSL 5IK3B 2P8LA 4YPJA 5C0IB 1B0GA 1KPUB 3A6CH 3HZKB 1RMFL 1L7TH 1MWAL 1S7XB 4J2XA 1F90H 1HQ4A 2FH8A 1HKLL 1L7IL 2DQHL 3D25B 4MD4A 5I1EL 2CLRA 2Z35B 4KK6D 5T1MB 1FL6B 3RKDC 3IXTA 2ZOLA 3HE7C 3Q5YA 4ZOBA 3X3GL 1QSEB 3LHPH 1OM3L 3NA4A 3DX6B 3BSZL 3KPNA 2IFFL 1JZ4A 4ZUTB 1Q9WA 5IKCA 5DF0A 3V5KA 2QSCL 4XP6L 3BYYA 1OSPH 1P1ZA 4WO4D 1JPFB 2EIZA 3MV01 3BJLA 3ULVD 3MBEC 1ZHKA 1RIHH 5AG8A 4OIIH 4L29B 5JPNA 4LSVH 1CGTA 3Q0HA 1NC2D 2A6DA 1RZIB 1G7PB 1GSMA 4NQDA 4ZUVB 1OY3B 3ZSSA 5GGVY 4NBYB 1EEQA 2PNDA 4CNIA 1IKFH 4YUEL 5F9DC 1G9NL 1F6AA 4YX2L 3KHOA 4LASH 3OHXA 2VLRE 1BQUA 1R5WB 2IFGA 3KLHC 1T5XB 4G9FE 4JVWA 3DO7B 3HI5L 3OQ3B 1KTLA 5ETUB 4XCFL 4YQXL 2E8YA 4W4OA 4OF5A 2D03H 1D5ZB 1ZLSH 4GH7B 5I9QB 3O6LH 2WBWB 4KKBD 4LU5L 5EN2A 3B5HA 5DD0H 1G1YA 1A3LH 3GO1L 4ZOEA 3D3VB 2JCCA 5DVLA 4Y4HA 4XPHH 1M05B 4JO1H 2QR0B 4P2OC 4B5EA 1OARL 1TJGL 2XXMB 2NMSA 1I1AD 1MCOH 1XF1A 4HJ0C 1IGMH 4YIQA 5EU6B 1VFMA 5BV7H 4PJ9D 4KI1A 4O2EB 2WUBL 2UZIL 3STLA 3U0WH 4HUXB 1F4YL 2AK4E 4LLVB 1FBIH 4N9GB 4HUXA 3WS6C 3W82A 1OGAA 2J8UB 4HLZH 4EBQH 2FX7L 2NY3C 4GKSB 1I8LC 1QP1A 5CEXA 2VIRB 4EI6A 4EDWL 4R2GC 1AKJB 2CUMA 2YWZA 1OAYL 2J88L 5FA3B 3QXDB 3VFPA 5FO9B 2P5WA 3VXQA 3RBGA 1KIRA 4Z7UE 2Y9RT 2A0LC 1M05A 4JFFA 4PJIE 1GVIA 1HYRC 2HP4A 3GMPA 3MRGA 4MXQD 2YC1B 4K23H 5I76A 1KIPA 2I5YH 4Y16C 5ESQB 2N1KA 3BUYA 3MYJA 3N85L 2BNRA 1FIGL 1FL3A 4RWYL 2P5EE 3FO9A 3VH8G 1FGNL 3O8XD 1KTDB 3QNZB 4P2RE 4Z7VF 1BVZA 3T4AB 4WCYL 4YDKH 4JKWA 1WAAE 3BIKB 5I1JH 4U6HA 1JZ8A 5HD8D 4H0HB 2ZSWB 1VCAA 4PJ9B 5GISL 1P4IL 1IC1A 1LD9B 1N6UA 3IS0X 5I8KH 4GRLB 3VXMA 3SY0B 5DEGA 2X4SB 1TIUA 3QDJB 3EOTH 3DHJA 3QG6A 2D0FA 4M7KH 5EU5B 3MRRA 5FO7A 1EK3A 4PJ5E 2BNQB 1YEKH 3UZQA 2ESVA 3W5MA 3B2VH 3HB3D 4V2BA 5ICYB 4MNGB 4RMQA 5BJTA 1JPFA 4HPYL 1F5WA 1TTGA 3RVWD 1R24B 2V2WA 5ERWA 2P5WD 3PQYB 3P0GB 4BQ6A 1KCRL 4ZUSB 2C1PA 2X42A 1SJVA 4RAVB 1VFAA 1I1YB 4OAWB 4NPYA 3WJJC 4JPWH 3EGSB 4GS7C 3QWRA 1NLDL 1S3KH 3MJ9A 3WE6A 2CLRB 4YH6A 2F54A 2GJ6D 4L5FL 2ZUTA 2BOCB 1D9KC 1XGPB 3I2CH 2GJJA 4OD3H 4OF6A 5IMLA 3QA3A 3QXUA 3IF1A 3KJ6H 3X3GH 4P23C 4OD1L 4NKQB 1JGLL 1I8KA 4GXUM 4OGAD 1Z0MA 4HS6B 4D9LL 1UZ8A 2WWKT 3WCYA 3ULUC 3T3ME 3UZEA 1RMFH 4NZJA 3FRPG 2I07B 4N0YL 1HH9B 3UPCA 3VXUB 3F62A 3O4OB 3U7WL 3ESVF 5C09D 1TQBB 3QH3B 1R5IB 2ZP0T 5ICZB 1JNNL 2EKSA 3FO2A 4Y19D 2UZYB 5CP3H 4RISH 4GUPB 3Q1SH 1AQDB 3ZDYE 3OXRB 3QI9D 4ZDHB 4XCEA 1ED3A 4HFWA 1J8HA 3HHRB 1A7PH 3DECA 1JRHL 5CIPB 1G7LA 1JF6A 5ANME 1A4KB 5T3ZL 1MHHB 2PCPB 5AAWA 3EOAA 3SGEH 1K4CA 1M6OA 3AB0B 4KK8C 3TYGH 1ZANH 4IOSD 4V1DB 3TBVB 2JB5L 2FBJL 1F4WL 1YYLL 1IZKA 3LSOB 1T6WA 2LAGB 1J1XH 3ROOB 1ZVHA 3D0LB 2XFXB 2FWOA 1C5CH 1EUUA 2AI0H 1HIMH 2WWMC 1XEDA 4DN3L 3GM0A 3ULVE 3VXRA 1T7VA 4P2RA 3MRLB 1HINL 2LQRA 3HPLB 2NY5L 2Z8RA 3QULB 1DJSA 2VLRD 4JFPB 1P2CB 4HMDA 5DI8A 3KPOB 4JQXC 2NY0C 5FYKD 2VH5H 4IMLA 2IGFL 5TF1H 3TH4T 4N8PA 1MIMH 5EBMB 4PV9B 5I2IB 4A6YB 5F3HB 4OCWH 4BSJA 5JUEH 3PHQB 3KPSA 1R0AL 1J0JA 3GMLA 3G6JE 4PJBE 4Z95H 1HK6A 4PJEA 2GTWB 4HIXH 4HIHB 4MCYA 3SDDD 4RDQG 5CBAB 1CGYA 4JGJA 1DUZB 4OFKA 1LNUA 3X12A 3QBTB 1C1EL 3EJJX 4WTXA 2ORBL 1DVFB 1B3JA 4POZC 4K8RD 5GGUA 4BH8B 4CU7A 5CZVL 1QLFB 3S8WA 4ZFOL 3HE7B 1KCLA 1J11A 4YNYB 3OSKA 1IQWH 1ZS8B 2FH6A 5JHLH 1PX3A 1U9KA 3L3IA 4U1IB 1XAUA 3CDCA 4X6BB 1RHHB 5KS9E 3TPUB 2VSDA 3JWOC 2DD8H 4AEIH 3S36L 3F7VA 4KXZI 2HJFA 2IANB 4OGXL 4WI4A 1T0MB 3JWOL 2VWEC 3HI1A 3TNNB 3V8CA 1CDCA 3EIFA 3GMMB 1G7HA 3AC0A 4TNVF 1R3IH 3KXFD 4AIZA 2FZ3B 4EUPB 1CLCA 1CS6A 1BLNA 4L3EE 1BGXL 5J1TC 4NQCB 4NNPL 3EYSL 4HJ0D 5I1HH 4S10A 1W72H 5IVZB 3CDGA 5IQ7L 4L9DA 2BY0A 2DD8L 2WZPD 4P2OD 2QJDA 1B6UA 1V3MA 4D8PA 3CFDB 5CJOH 3D85B 2FHBA 5CD5D 3ARYA 35C8H 4FQJH 3O6KL 4N8VB 5IFHH 3IDNB 5D6CB