2K8MA

S100a13-c2a binary complex structure
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
128
structure length
128
Chain Sequence
EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title S100A13-C2A binary complex structure-a key component in the acidic fibroblast growth factor for the non-classical pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 21
structure length 128
sequence length 128
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2k8mA00
3CSFA 3L08A 3RPBA 3T8MA 2CM5A 3APDA 3JZYA 4PS8A 2ENJA 3APFA 4LDCA 2DMHA 2WXMA 5KJ7E 4ANWA 4QJ4B 3CSTA 4HVBA 3NSJA 2WXGA 4QAMB 4TV3A 3QAQA 4G11A 4FJZA 3F00A 4DNLA 4Y1TA 2K4AA 1K5WA 3L17A 2WXPA 3APCA 2WXJA 1DJYA 1W16A 2NSQA 3FBKA 4FJYA 4WEEA 2CJSA 3FDWA 4WWOA 3PYCA 4ANUA 3ZVVA 4QJ3B 4F1SA 3ENEA 2ZKMX 4XE0A 2WXKA 2ISDA 4L1BA 2NCEA 1QATA 4KZ0A 4BFRA 4BGDA 4F91B 1YRKA 2CHWA 1DQVA 2Q0ZX 2Y3AA 2CM6A 4L23A 2ENQA 2CJTA 2QZ5A 3B7YA 3HIZA 1DJHA 4MJJA 3GPEA 4EZJA 2QZQA 4JPSA 1DJGA 4L2YA 1BCIA 2R83A 4EZKA 4FADA 2DMGA 1E90A 1E7VA 3NZUA 3PREA 2K3HA 3KWTA 3SD5A 2CHXA 1UGKA 5H4ZA 3PRZA 3TJPA 2N1TE 3HHMA 3ZIMA 2WXOA 4NP9A 3RDJA 2WXHA 3W57A 3F05A 5CCGE 3DBSA 4F92B 3TL5A 3QARA 3MJWA 4PS3A 1DSYA 1DJWA 3L54A 4NPKA 4A55A 4LT7A 4TUUA 4FLHA 4WWNA 3S2AA 4FHKA 4ANXA 2FK9A 4FHJA 1RSYA 4XZ4A 3ML8A 4WWPA 4OVVA 4DK5A 2A4ZA 1WFJA 4NPJA 1RH8A 5JHBA 3QR0A 3IM1A 4TS6A 1TJMA 2FJUB 4QJ5B 3DPDA 3NZSA 4GB9A 4URKA 1DJIA 2CHDA 4GNKB 5G55A 1V27A 4EZLA 2D8KA 3L16A 4IQHA 3P2BA 4OVUA 1HE8A 4AOFA 3ZW3A 1DJXA 5G2NA 5JHAA 1E7UA 3QR1A 4XX5A 4AJWA 2WXFA 2B3RA 2A5UA 3OAWA 3KWUA 2CHZA 1DJZA 2LHAA 2K8MA 1UOVA 3PFQA 4LCVA 4PS7A 4ICXA 3L4CA 2WXIA 2Q3XA 2NQ3A 3W56A 1BDYA 3IBEA 5EDSA 2WXLA 3R7RA 4FULA 3TWYA 1A25A 3F01A 3QJZA 1QASA 3HN8A 3R7QA 3L9BA 2BWQA 2RD0A 3L13A 4KITB 1E8ZA 1E8XA 1CJYA 4L1LA 2V4LA 1GMIA 4F93B 4NS0A 1RLWA 4WAFA 4Y1SA 1E8YA 1BYNA 1UOWA 2WXRA 3QK0A 3ML9A 4FA6A 3F04A 5CCHE 5T8IA 4HLEA 4ICWA 4ANVA 2K45A 5CCJA 3PS6A 1WFMA 2YRBA 4IHBA 4J6IA 2YOAA 2KI6A 5H4YA 3M7FB 4KZCA 2X38A 2WXQA 2WXNA 2ENPA 1E8WA 3N5AA 1TJXA 2UZPA 2Z0UA 2EP6A 4V11A 3OHMB 1W15A 3LJ3A 2JQZA
chains in the Genus database with same CATH superfamily
2VLJB 4FQ2H 1ACZA 2JIXD 3KR3H 4G6JL 4OTXL 1PG7W 1WZAA 2DQDL 2PR9A 4P2YA 4XPAH 4HA1A 4WWKD 4LSUH 3GXMA 4XN8A 3VFSA 2EDOA 1GJIA 2BVQB 1RMFH 4E41E 1LK2B 2LGNA 4TQIA 1IM3B 4XWOC 1OT1A 5AVRB 3DX2A 4XBPA 1H9VA 1BX2A 1ND0A 3FDWA 2OX5B 4QMEA 4JY6A 3UG4A 3NIGF 4I3GA 3BC9A 3ZR5A 4OLWL 1LNUA 2AXGB 4WJG3 3KJ4C 3KLHD 2OR9H 3VD3A 1UXWA 2R1WA 2Q76A 2OMUA 3F5WA 3BP6B 2R7EB 4J3OG 4KH2A 2J8UA 5ADPH 5DS8A 2X9XA 1LDSA 4PYHA 3TEZA 1WAAF 1R24B 2N59A 4G6AC 4Y5XB 3V0VA 1JHTA 2R56L 4LLWB 3CFJA 2P8MA 3FK3A 5FCUL 1CICC 3IPEA 4OLUL 3T2PA 3TF4A 1CFQB 2YBRB 4WQOA 3T0EE 5HYSG 2CIKB 3NABH 2OMWA 1AZUA 3GSNB 2D2CC 1M7UA 2DIJA 1U8IB 3EG9A 3L3KB 4WU7A 5EZJB 4PS4H 2YKLL 3B2VH 4JKWA 3TV3H 1BQLL 3BH9B 1AXTH 3B8SA 4U6TA 3U9UA 4S1DD 5J06A 3FB5A 4PBDA 5CILH 2ROYA 1P7HL 1NBVL 2B1AL 4X6FB 4HEME 4NQUA 4ZNEA 3II2A 3P9LA 5F96L 1JGVL 4JO4H 2VABA 3WGUB 3WIIL 3NGBB 3LX9A 4FKKA 4FQHB 2MTPA 4L29A 1MFVA 1CU4L 5I1EL 1ZS8A 5D7EA 3G6JA 4ICXA 1HHHB 2YN5A 3DGGA 1S3KL 3ZT6A 3FHQA 2X4PA 1B6UA 4OKDA 5F9JA 3WXVL 1P84J 4ZXBD 3N85H 1CDIA 4IGBA 4GAYA 3RQ3A 1T83A 2WKOA 2FZ3A 1TZHA 3VFNA 1JWMB 4N8PA 3GJFB 1AH1A 2C9VA 2IAMD 4WJ5B 3NFPB 4LAJH 3GLEA 1EERB 3BISA 3KE0A 1QPXA 5EC2A 2X3CA 2GFBB 2Y0SA 4GQRA 1E4JA 2TSAA 3MRIB 4A6YH 4QAWA 3GK8L 3QJVB 4KUCD 2Q5BA 1A9BB 1RD6A 4I9WD 2VDRB 4TSAH 5EO1B 1OK0A 3ARBC 3UGXA 2QQNL 2NY7H 3F7KA 4KJQC 4M1DL 2ZXDA 3DI2B 1N4XL 2DWEA 2WAQA 4OD1H 5FYKE 4L0ZA 4PD4K 2IDSA 3THML 3BWZA 4YSUA 1KIPB 4ENZA 3CCHB 2GJZB 5LXGH 4L3CA 5D1XD 3WE6B 3A6CH 5K9KB 1MDTA 1Q0XL 3MRPB 3NSJA 3SPVB 2J8OA 1UC6A 1KLGA 5KN5A 5KVGH 1DEEA 5IREA 4JZNB 3CN0A 4EF3A 5D7LE 3MLWL 4AQ1B 3X13A 3K74B 3X3FH 2YIHA 3C9NB 1N6QL 2WMPA 3C2SA 4RGMC 2EYSA 4IMKC 3LEXB 3DTXB 2WWKO 3GNML 3PDDA 4FQ1L 4MA3A 2P8LB 1ILUA 4I18B 4NERA 2V2WA 4AJYV 3AUWB 4PRHD 4B7LA 1CFNA 2ENQA 3K80A 5ITBL 1PLBA 1DVSA 5DFWH 4IDJH 5ENWB 1MAML 5I0YA 1GGIL 4NRYB 1SN5A 1O6VA 3MLZH 4HJTA 5CO1A 4ATWA 3QZOA 4WUUD 3GSUA 3LEVL 2HUHA 4HCFA 2EQDA 1M7IB 1EFXD 3RG1C 3E3QE 4LSSL 4R4FL 1B2WH 3AITA 1HTYA 4J2XA 1ZHBB 5DO2C 1GZQA 5D2NB 3QIBA 3K72A 1EJ6A 1TQBC 5IMKA 1DBMH 4ONFH 5L2JB 1PLAA 4ELKB 1NMAL 2X70A 4WWKA 3TJEL 3WI9A 5TQ2H 2VXSL 2XHNA 1EDHA 2QBWA 5DEJA 4Z3HA 3NIDE 3EFFB 4FOMA 4UZSA 1DBJH 4FNPA 4G5ZL 4U1MA 1Z2KA 5EU7E 4U1KA 4Z7WA 1UD4A 3QG7L 2DOCA 2FYYA 4DWHA 3MRQB 5CJ8A 1XF2A 4PV9B 5E9AA 4KKCC 5AZEL 3FRPB 4DTGH 2H32B 5IVXA 4RAUA 3TBVA 1CT8B 2ZOKB 4MAUH 4C83B 2ITEA 1DVZA 3I6GA 1KBKA 2ETWA 4JDZB 1UYWL 4J3OD 1CD8A 1SM3L 3OLIA 3BWAB 3BRFA 4PJ5D 5D4QA 1A22B 4UOJA 2XWZA 5JYMA 4IOFC 4DUXA 4U2ZA 3FQXA 1PNCA 3VXPB 4BKLA 3NJLA 2Y5TB 2NOYA 4BFIB 1LXMA 3OF6D 4GRWB 5D2LE 5KYWB 4YS4A 4JHZA 1OLLA 5D6DC 1CE6B 1XGPA 5I1CH 4N8VA 1A5FL 4L3ED 1KJVA 1R75A 4QHMA 4DT2A 1KENH 5D4JA 4JY4A 1REIA 4QRRD 2PYFB 1T2XA 3CG8A 1UJ3C 2ZZUT 3EOTL 1B9ZA 3OAZH 2Q3ZA 3W11C 4ZS6C 1AP2A 5A2BA 3ZTCC 3CXDL 5HDBE 1HAUA 4ZFOA 1QSEB 3DX0A 1W72L 2ZUWA 1FE8H 1P5UA 2HPTA 2JB6A 1HS6A 5B1AB 3ROLB 4QWWC 4ENED 5GIRA 4ZXBA 2HB0A 1I85C 1ORQA 1U95B 1L7TL 3LH2H 4F2EA 4B9YA 5I0XA 4P2OD 2X4QB 1KJ3H 3G5ZB 1B4LA 4FQCL 5D1QC 8FABB 3BH8A 1OPOA 3H9YA 3QCVL 1MZYA 4DAGL 2AEPL 1ZE3C 2OSWA 5D9SB 1X5XA 2E7HA 4FP8L 4J6RL 4L5FH 5IFJA 1D7DA 3BIBX 5KSAA 1YVLA 4P2AA 3ZKNC 4OZ4A 2I9TB 4NYLA 8CGTA 2PPCA 1PG7L 3IMUA 4Y0GA 2R51A 4ZTOL 1ZWIB 3PQYD 3E6HB 1A7NH 3SQRA 4HZAA 4X6EB 4JFFA 4CVZA 4DGIL 3B7RL 2G9HB 2DQFB 5DURD 3S37L 3L7EA 3VI4F 4N1HB 1UZ8B 3VFRA 1SY6A 4KJPC 5D1XA 3L54A 3IVKB 2EJ1A 4PJEB 5GZOC 2HVKA 5F3FA 2ESVD 1MWAB 5HJ3A 5F70A 2MHAB 2Y72A 4ZMVA 2OZ4H 5C6TL 4OVVA 3MDJA 4F7TB 1EJOL 1DQJB 4KK6C 4DEPB 3KXFE 3D3VA 2YD5A 2MNJB 3LNDA 4LEXH 4BWTA 3R06B 5E5UB 4G8FA 1KTKE 5I5JA 2DJUA 3GBLA 4NQDB 1OP5H 1KGJA 3ISRA 3JBG7 4AJVA 4ZNCD 1IBGL 4GRLB 4PRHA 4BQ8A 4RRPG 3VFVA 5AB1A 2WBJB 1AGDB 4FEIA 1FBIL 5B4MC 3AUVA 3SPGA 1EAPA 1MFAL 2V6HA 5D5ME 3VH8A 1TTAA 3SDYH 4WUUA 5FPIA 2WJ7A 5C3LD 2VDOB 3L2MA 1WP6A 3RB5A 1I1AD 4P5KA 4ZMNA 1QSFE 4X5PA 25C8H 4QRPE 3D39D 1QVOB 6PCYA 2YGVA 2ZPKH 1J5HA 4WHTB 2OL3A 2DQJH 3T3PF 4JO3H 3T2NL 2WO3B 1UXMA 1NKOA 1SQMA 1G5GA 4L1TA 4Z7UE 2OW6A 4AG4H 2JE8A 4UT6L 1F45A 1R19A 2VM3A 3LEYH 1KCSH 4A67A 4TULL 4E9QA 3VGBA 5TE4H 2PWFA 4PUBL 1B0RA 4N4YB 4AGOA 1XB8A 3QJSB 3QUHA 4C8XA 3OL2A 4QTHB 4H8QA 4YHML 4JFEB 4HULB 2VZ3A 1MFMA 4LASH 2PPAA 1OGAB 4L8DA 3TT1L 1R17A 3LQAL 4XCYB 3GYRA 5KG9A 2Y06H 2BC4B 2IG2L 5HHPB 2G3XA 4Z7VB 3OXRA 1NWOA 2DF3A 3VGHA 1HHKB 2CBTA 3BP6A 5T1LD 1BAWA 1WCQA 2NY6B 4N2BA 2EXSA 4N5UA 5T5NF 1SRDA 3TN0B 4HIHB 2ZX6A 4JM4L 1KN4L 1A6UL 3ESNA 3DX7A 3C6EA 2WZPD 5CJOH 2JCCE 4PJ5A 2AXJA 4PV1C 4LLWA 1P1ZA 2J6EH 1RI8A 2Q8AL 2RA1A 5EEVA 5EEWA 3OR6A 4OI9A 2XWCA 3OF6A 1MF2L 4TQ8A 5BOJA 1NDMB 2FLMA 2FBJL 3FPYA 3S98A 1U8IA 5HYSA 1WCBB 3CMOH 3ZMEA 3IDXH 2X1XR 3F05A 4OJFH 1VHPA 4QRRA 1H3PH 4AQ8C 1YYCA 5LQBH 5E0QA 3H7LA 2J7LA 3C5SB 3DVFA 4FG2A 2O6CA 3BE1H 3ULVD 1BD2E 4KZEL 2BFVH 4K5MA 3IMSA 4ODSL 1CLYL 1I75A 3NZSA 4G6ML 2ATPB 3EIFA 3QWQB 4P4KD 4TNGA 3SYAA 4NN7C 1TCRB 3I50L 4P2OA 1HHHA 2WKGA 3W37A 4CKVX 3SE9H 4NDMA 4PCTA 5JLZB 3QUZB 1F00I 2EC9U 4DQAA 2JKSA 4RX4D 4LCVA 5C71A 4HHAB 1F3JB 5IHWA 4K94H 1EO5A 4Z78A 2NY3B 2R2BA 5FWQA 4D9RD 3HPLA 4U1GC 3BZEB 1G7PB 2NSMA 4K3EL 3PQYA 2XWTB 4EN2A 2GFBA 3S48A 5KSVB 5GS3A 5ALCH 4HLZH 1IEAA 4Z7QF 1A02N 1A9BA 1UZGA 4PJGF 1T6BX 5LJYH 3STBA 4XHJC 4PWIA 4JFUA 1DQDL 1U33A 4ADJA 4YWGH 3IJHB 2DS4A 5DQ9A 2ESVA 1JNNL 4LLMA 3ETBJ 3L3DA 4XNQB 4FXGC 1K4CA 5CEZH 1KIPA 3TO4B 4G5AA 1BVNT 3NCFB 5K9KA 3MBXH 3MRPA 1EZLA 1GL4B 5AG9A 5KWYC 3SPVA 3GC3A 5T3ZL 5TE6L 1FRGH 1XF3B 1HH6A 2UXVA 2B1HL 4YZFE 4TQHA 3SDXA 5I16A 2B2XL 3A23A 2EZ0D 3W9DB 4GUCA 4Q74A 4AQZA 4JB9H 4JN1H 3VSUA 3T0EC 3ZU8A 2ICEC 3DTXA 1EJ8A 2P8LA 3V7AE 4I18A 2DV6A 1SJXA 2VDNB 4GIPD 4FQIH 1LTXA 4U1SB 3UAJA 3LHPH 1U8HA 5D93C 1AZRA 1T7ZA 1YMHB 2YXWA 4F7EA 3IMBA 3D39A 3ERXA 5ICXA 4X0KB 1T5WB 1BM3H 4EN3B 5BMFH 2H5UA 1WRFA 3OMZA 5CEXA 1J05A 1RVFH 1U21A 4MCZB 1C8QA 1L3NA 4HKZA 4NQXA 3SBPA 2VJ0A 4XVOA 3AS0A 2NXYC 4TUJB 1ZHBA 4OZGF 3HI1B 3KVDD 4CVWA 1MIEH 5IBTL 5D2NA 4Q7DA 5KEZA 3EADA 1SVZA 3JWNG 5E6RB 4PW4A 4KBPA 3B3BA 4XP9H 2FEDC 1YNTB 2JKTM 3BAEH 1I7ZA 5IVXF 2P28B 1NM4A 4XCFH 4GI8A 4OF3A 3EFFA 3MKKA 1YN7B 1F2XK 1M42A 1WAPA 4JRLA 2DLIA 3MJ7A 3Q2VA 5J8OA 2RQ8A 3RPKA 2EC9T 2D4FA 1C08B 3A4EA 3B9KB 3IU3B 4HMEA 4EI6B 4F8OA 2JI1A 2AEQH 5EV7A 2VDQH 3MRQA 5ILTL 4JO1H 4N5EC 2XXGA 1UA3A 1KCRH 4GAGL 1RIHL 3AQYA 2BSTB 2PXYB 4AEIH 1A3QA 1FNGB 2R2EA 3FN9A 3HNSH 1P4BL 4E9XA 5EF2A 3VWJB 3VD0A 1F1DA 3CDFA 5B3NA 1CFTA 4XNMB 5CINL 2JKNA 2XY2A 1HWGB 1QHPA 2WXLA 3KLAB 3TVMD 5KJRH 5E8PB 2XA8H 3CFQA 4NUGL 2QKIB 3MRFB 3BWAA 2ATKB 3UTSD 4LARH 4YDLB 2V3EA 4L1LA 3FMGL 3IMVA 1G1KA 3VXPA 3L9RA 3S96A 3IMWA 4BFIA 1UOWA 5KYWA 1BBDH 4D8PB 1HIMH 1T89C 1U8LA 5F7DB 1CE6A 3T77A 2PW2A 3FN0H 1HNGA 4Y4HB 4ZTEA 5ID0A 4F9LA 5AVVB 1PD6A 3SJVD 3P0YL 2PYFA 3TPKA 3TBBA 1NCAH 5HYQA 3LKNB 4P4KA 3H9HA 3GM0A 3FU7A 1Q9LA 4KUCF 4JFWA 3AXHA 1A1OB 2YA0A 4NO2B 1QSEA 4KKAC 1EGJL 2A7BA 3QWOB 1KELL 3MJ8A 4HEPA 1OARL 1UM4H 1QRNB 3X14B 3VG0L 3E3QC 2DQ6A 3G5ZA 3MV9E 4KY1L 4QXVA 4YHNB 4P46D 3O6FC 4R83A 3AABA 5EF1A 1OM3L 3ZKMC 2MOGA 5CP3H 1WAEA 5HBBA 2JNZA 1ZMYA 3GRWH 4K7FB 4X6CE 2XQYG 3FTXA 1ML0A 2ZNWA 4JVPA 1SHXA 2XN9E 3KJ6L 5FOJA 1J5DA 2IF7A 3HRPA 3QDGE 4D8OA 1QQDA 5DYFA 5EEXA 1QNZL 2A0LC 3P0GB 5I0DA 3Q2NA 3B4NA 1IGFL 3OPZL 4I87A 4X9YA 4HIQA 4FFWC 2Z8RA 4Z7OE 4ODTH 5I30L 5JQ6H 4ZDHA 1UZ8A 3BJ91 4LCCC 2MNWA 4FTVD 1KJ2A 5AOKA 4NM4H 5MENB 2VM4A 1MWAA 2F58H 2FB4H 3FOMA 4N2DA 5E00A 3BT2H 1Z3RA 2XTJB 4YGVB 1RZJC 1CTOA 1TSHA 4P9HL 5DUJA 3SE3C 4FHKA 2JSFA 1ACYH 1AQMA 3PXJA 2NR6C 4KV5F 3BQUB 3UTPE 4NQDA 3D69B 4M5YH 1KLFA 4JS7A 3N0AA 4N8UA 2OMNA 3EFDL 1CGUA 4GRLA 5FO7A 4I48B 1A1NB 1T6VN 4OH2A 1D5ZB 5PCYA 4EIGB 1FUNA 1CZ8L 3JSSA 3S37X 1AGDA 1E4XH 4XCCL 1KTDA 4RRPA 3SIKA 1AD0A 1NH6A 4KROB 4DETA 4DKEL 5BZDB 2C4FU 3MX0B 4PSRA 1J86A 1H15A 2FATH 2R29H 5AAPA 4Q52A 5I9QC 1KWKA 3LS4H 3DMMD 5KVGE 1AR2A 4JHAL 1QZNA 3GZPA 3VG9C 4J3WA 2XG5B 1JF1A 2VQ1B 3OG6B 1NGWB 5DD6A 1X5ZA 2IBBA 3NPSC 1NUGA 1S9VB 3LSOA 1KN2L 5F1KC 4DGWC 3BD5A 4J3OF 2RCSL 3VFOA 1JZ5A 5GGRY 2PTTA 3TYFA 1FIGL 4JFEA 4OW6A 4BXVA 3CVHL 2B16A 1AXSB 5I15L 1BG9A 5EC1A 5DXWA 2CJUH 2JJTA 5C08D 1FZMB 4W4NA 3GF8A 5HHPA 4J3XA 3VTAA 3OTTA 4HMCA 4HVBA 1KXTB 2HA1A 2XWRA 1H9DA 4FNLH 5IB1B 1N0LB 3DVGA 5CXPA 5ES4B 2ICWI 2YMOA 3ARGD 3PHSA 3TVMA 3NP4A 3KPRD 3D18B 3CK0H 5D1ZB 3V6OA 5LXVA 4ZW6A 3PL6B 3NFSH 4R97B 3ZGHA 3I9PA 2ZCZA 3MA7B 4CSTA 2OJEA 3SSGA 5DJZA 2GUOB 3JV6B 3BAYA 1K9TA 3KPOB 2EIBA 4ZRGA 2CIIA 3K81A 2EYRA 3GMLB 3WFEH 5LGJB 3MRGA 1FL5A 2K9UA 2BO0A 1LK3H 3SJVA 4PG9A 4TNVF 3RIAK 1JFQH 3D34A 3JQOB 4XBMA 1MH5B 1Q1JH 5C7XH 5JW3H 3ARDD 1EEYA 1R9FA 4PS3A 5F1SA 3QXUA 1IGCL 1CB4A 2HKFH 3PAZA 4PG2A 3ML8A 3CIAA 5E6ID 3X1GA 1TCRA 1WUNT 3KD4A 3ZE2B 1UWGL 1CLOH 1ESOA 4H8HA 4UZGA 4P46A 2WV3A 5DSCA 2IO5A 1SMOA 3Q06A 3GSQA 1KGCE 3QUZA 1RUPL 2VDMH 2C4FT 2CHDA 5DC2A 1VERA 3Q5YA 4PJ9D 1JSYA 4R4BB 4BFBD 4AMWA 3LNFA 4ELDA 4L0PB 5F44A 1UCBL 5FK9B 1SXAA 4HOZA 1KTLB 1NCNA 3VI3E 3BZEA 5FXCH 4KZDL 1G7PA 4H25A 3FS9A 4JFDB 4O5LL 2MCMA 3EO0A 1F0LA 4ZOAA 5F7MC 4HK3N 5IT2H 1MFDH 3VMPA 4LHUG 3HZ3A 4ELMF 4NJAL 1LO4H 3VW3L 1SBSL 1UT2A 1SYSA 4XMZA 1RP8A 5J7CC 1TJGL 2ZKYA 1JDCA 4XNQA 1D6VH 4X0NA 3TO4A 3L3HB 3K2UL 1NBCA 3CBJB 4OCWL 1BXUA 1X5IA 5T1DH 4AM0Q 1EO7A 2AV1B 5B39B 5BVPL 2EDEA 2ZX8A 2XPGA 4NNXB 1CTNA 4L5FE 1EEZB 4LP8A 2B9BA 1AZBA 3O3DB 4JO2L 4KWUA 3H55A 3W9DA 4UTBA 1ZIAA 2WLHA 5I8CA 1FNEB 4YHKL 1KPVB 2C7UB 3LJ3A 2BERA 3CSFA 3CDZB 2V7NA 2R69A 4ZTPL 5HHOB 1GPOH 3OLDA 5HVFB 4KGJA 4JANB 4NOFA 4EPSA 1SY6H 5DLLA 3NSDA 1UKQA 2PTUA 3JTSB 5IVOA 3AREC 2G4EA 2E7LA 1P53A 1TFPA 2G60L 2NY1C 2KZ1B 4JGUA 2R0ZL 1CBVH 1YMHA 4WW1A 5E1IA 3QEGL 4X0KA 1QPPA 1IZJA 5EU5A 1R5VA 4PJ7E 1UB5B 5IGXL 3NFNB 3V6BR 4MCZA 1XAKA 4QXUH 5C0JB 2ZQKA 3FUKA 5FM8A 4BH7B 1OAYH 1Y6NR 2GSMB 4TUJA 4OUOA 4NO0D 4O51A 5C0AE 1S7RB 4P2RB 2FR4B 1YEHH 3ARXA 3GPEA 4FQXB 4G80A 4XPTH 1A4BA 4ONHB 3K8MA 4YEEA 3ZUNC 4FADA 1TLKA 2MQCA 4GG8B 5CN2A 3ABMB 5JNYB 4EEEA 1YN7A 2WXOA 1HESA 3K7UA 4KAQL 1F86A 1J7VR 1LJMA 1NKGA 4PJHF 4S11A 1JWUB 4YBQD 4TVPD 3IT8D 4JHUA 3IU3A 4AGNA 4G8GD 1SOXA 4K7PL 1A4JB 2BHFA 4KXZH 2JF1A 4OFDA 1UH4A 4QRSA 1QWNA 4UAOC 3ATFA 1K85A 3DBXA 2GBVA 2PXYA 3LKRB 3T9WA 3VXSB 3KPRA 4M1CC 3VWJA 4PRBA 3WDJA 5AVUB 4EOWL 4YK4C 4XNMA 1KOAA 1Z9NA 2C8NA 4LCIH 5CUSH 5BV7B 3ULVF 1IC4H 4P23D 5GQBA 1BQKA 4B9GA 2NYZA 4XPGH 3VFGL 3P0VL 3MRFA 4MSWA 2ATKA 2WO2B 5DFVC 3O3BA 1HZLA 2ZSWA 3U7YL 2ICWA 3SPIA 2CSPA 1FAIH 3KYAA 3BP4A 4M03A 4RFOH 1D5MB 3SODB 2ZXBA 2NY0C 1G9NL 2FO4B 4FLQA 4J3BA 3TFKD 3SYPA 4DGVL 1YG9A 3EOAA 4R7NB 1BFVL 4DZBB 2XRAH 3LRGA 4TLTA 4ATTA 4F2FA 5I71C 3JT0A 1S7XB 4C4BA 1YO4A 2AJSH 4YDIH 5E2VH 5GHWL 1KCVH 1LWJA 4WVRA 1MVUB 2OSXA 4WCYH 4N28A 4GSDH 3D5OF 4BCZA 4PB0H 5F7BA 3P73A 3W2DH 1YQVH 4JPVL 2VAJA 1XR8A 4PP1D 1C5BH 1F58L 1RJYB 2VLLB 2AJUL 4F15B 3GSNH 2IPUG 1HOEA 1I7TA 4PPTA 1QRNA 5F9OH 1XL6A 3X14A 1D7CA 1XD0A 3A0OA 4GINA 3INUL 4D3CL 4HK0B 4DQOH 3CSTA 3OKKA 1TQUA 1HYSD 3MFFA 2J72A 3F00A 2Y7QB 1KFGA 1H3TA 5I19L 4K71C 1Z3GH 4NQED 1NAKL 2XQYA 1NL0H 5DMKA 1ECZA 3HLKA 1IC5L 4WNSA 4U49A 2PCPB 3QUMB 3V0JA 2P49B 3QORB 5FUOH 2I5YL 4JFYB 1Z9SA 1JTTA 2QL1A 2G3ZA 2WBWB 1U3YA 4LHUD 5I82A 3T08A 3WKPA 5IEKB 2NYYC 3OJ2C 1VESA 3I02A 4PREB 3ZTJH 1R0AH 2V9QA 2H2SC 2G75B 2J3SA 1YPZE 2YAQA 3ZTNL 5K69A 4PHZA 2L7UA 3GJFH 3WFHB 3V79C 1A2YA 4GKZA 1ADWA 4YGVA 2V0AA 3DI3B 1NSNL 3UZVB 4ZS7L 2WO4A 1NGZB 2CU9A 3D4YA 1RL1A 3QG6A 3QQDB 2YAOA 3HKZA 1AQKL 3BQUA 2OYMA 3ME0B 3RZCC 1BFOB 2VDRH 2F5AL 5ESVB 1J8HE 3EYOB 3EYFB 2ZF8A 2N7AA 1QSZA 1BQHB 3D4CA 3LXAA 4YO0A 1F90L 3CQPA 1LEGA 2Y1YA 2ZUXA 3WNMA 4XN5A 2D8KA 2AVGA 2K9FB 4P06A 4AOFA 5CEZE 4KDTA 4HCRH 3FUHA 4WSKA 1U3ZA 2DYSB 3WDHA 4NO0A 1ZLSL 3RTQC 3OKOA 4OCMC 2KQNA 1QW9A 4K4KA 3PWJB 4A2HA 3UTTB 3IRZA 3EUUA 4YSTA 5MEPA 1ZV2A 3AGVA 3DDGA 1JHKH 3EZJB 2F08A 4ETYA 3K2IA 5DI8B 3EOYG 2P7TB 3LQAC 4NCC2 3FT3A 5EU6E 1IFHH 2N0KA 1A4CA 4JZOB 3RWEA 3U83A 4ACPA 2Z92A 1SOSA 4QHLA 3ECBB 3FXIC 5HYJD 2K70A 4HLEA 4CADB 4MD4B 3HI5H 2FX7L 1HXYB 3PU7A 2Q2LA 2MH4A 2AKRB 2F54E 3D2UD 1AXSA 3EH5B 2YUXA 4JQIA 4AIZB 3C2AL 3FYIB 4BE6A 3GGWA 1FZMA 3G6AA 3NH7H 1WTGT 2IH3A 3GDCA 4N2FA 1KXTA 1P7KA 2HH0H 5I6LA 5K59F 3MJ6A 4LQFH 5J9PA 1E42A 2R4RL 2DWTA 3W0WD 1U3HD 2DJMA 4P23A 3L3JA 2GIYA 1JNHA 2C9QA 4TV3A 1OD9A 4LVEA 1A6ZB 2CO7B 3MGOB 3KS0H 5D1ZA 2O30A 3PL6A 1J1XL 3SDCB 3IK2A 5JHMA 1T7VA 3B2DC 1S46A 4B3VA 4F7MB 3ETBF 4LL9A 3WEMA 3ZIYA 3IGKA 4AWJC 2YK1L 3LN5B 3K6DA 1D5IL 4XNDA 4AQEA 2LTQB 4K8RD 3GUFA 4UINH 2Q7YA 4MBOA 1NAMA 4K0OA 5JHLA 3O2WH 5FR3A 4WFFD 4H0GA 2A9ML 4TTDC 1OZTG 4GLRI 5LCVH 5LGJA 3U4AA 1EHXA 5GSRB 4XC1L 2H32H 1L9NA 1MI5B 3HIZA 1DJHA 4PRNB 1USZA 1SPDA 1I8MB 1S9YA 4X80H 2APSA 1DQIA 3P3YA 1GHFH 4RQQB 1MPAL 1AMYA 3D06A 1SEBB 4N24A 2R2HB 1F97A 2QHLA 3U25A 3PRZA 2K8QA 5KVFH 3B3IA 4PJIB 4MAYB 4ZUVA 1GA2A 1NBZA 3BAKA 3L3OC 5HI4D 4ZFOL 5L7XL 2P42B 3MUGB 3SBQA 2J1WA 2VLKE 4NZTL 2HJLB 3BSHA 5E9DE 4GRWH 1MW3A 4MJ5B 3RURA 1YHPA 4FN0A 5FA4B 1MY5A 4CGUB 1KTLA 4XMKH 2EE6A 2VO5A 4LPTA 5GS0H 1WH0A 3QO1A 5I73B 3P77B 1PX3A 1VFAA 5C70A 2IDCA 4WI4A 4PJCB 4UU9A 3Q7JA 2J8UE 1HQ4B 3WN5C 2HJKA 2PNDA 2YEZA 5LDUA 4GG6E 1HAWA 2VDPL 1IE5A 1E7UA 5AVQB 1CS6A 4QTIH 4U1JB 3GFUA 3N50A 1NCTA 1QTYT 4KXCA 2H45A 4LHUA 1F4AA 4OGZA 4XNBA 5B3JE 3AS2A 1LDPL 5JOEA 5HSFA 1WEJL 1NLDH 2W94A 5EDSA 5TDPB 1VEOA 1XGRA 4NOBA 3R8QA 3VX0A 1AKJB 1XV8A 3ZDWA 3VSTA 1W2KT 1EBPA 3F7LA 4GP5B 4HG4J 1JGEB 2X6MA 2UYLB 4PGJA 3L3HA 4NWUH 1ZA6B 1CJYA 4DKTA 3RVWD 2DAVA 1UKSA 3ABZA 4TUOB 5B39A 4M7LL 3SKJL 2QPSA 5JOPD 4RIRA 2BHUA 4Y88A 4JM2C 3O11A 2OMBA 3O3DA 4OGAC 4JJ5B 5F8RC 4C4KT 4D9LL 3P4OB 3DKHA 1N64H 3CDZA 1XGQA 5HHOA 1IX2A 4X7TB 2Q86B 2H9GB 4L1SA 2YS4A 3T6VA 2G2RA 4B53A 2HTLD 4JANA 5E4EB 4UIMB 3F64A 4FQ1H 3TFBA 1BWWA 3D85B 1URLA 2ZYHA 4XC1H 4D2NA 3G6JE 1SOQA 4YDVB 1MY7A 1WZ1L 1R6VA 4GXUM 1MWAH 1XFPA 3DLQR 3ZE0F 3WY1A 1ECYA 1IQWH 2B14A 2OK0L 5IEHB 1BAGA 1QLEL 3WSQH 2H0EA 5F6HJ 1DVYA 2ADGB 2FVNA 2PP8A 3B34A 3PXHA 4GS7C 4XC3H 3OZ9H 3PGFL 3PP4L 5FKPB 3F12B 1A7RL 3ARPA 4N6RA 5C0JA 1RULL 5K9JL 3WO4C 3CPLB 1G7MB 4XZUA 2ZCHH 2WUBL 1HSAB 1F1AA 3MBEB 5FECB 5IFAH 4TSCL 1JTOA 4P2RA 2OL3L 1YEDB 1TITA 2CG9X 2WPGA 3OXSB 1AD9A 4NJ9L 9PCYA 2L0DA 5HYJA 4BSWB 5JNYA 5LAPA 4GSXA 2BOCA 4L2YA 1YUKB 4WI3A 3D2UA 3FO0H 3DX1A 3HRZB 4ONGL 4NRZA 2CO2A 3CWGA 3E8UH 1T3FB 3JUYA 4ACTA 2VDOH 1HI6B 1MG2C 2Y07L 3AG2B 1ZHLB 4Q14A 1M6OB 1Q38A 4M61B 3A6BL 3RDJA 1NDGB 1CK0L 1AFVL 1MCNA 3VMNA 1XCWA 1DSFL 3IMRA 3W0WA 4IRJD 1U3HA 2Q6WB 4FLHA 1AZCA 1RSYA 2K6ZA 1NIBA 4XPHH 1A64A 4G1EA 4JHVA 5I17A 2WTPA 5DYOA 3K6NA 4UDTB 1BZOA 1E5UI 1XT5A 3JV0A 5EZOH 1IGML 4ZMXA 2FGWH 3HNTL 3I2CL 4DW2H 1TKWA 4RGNB 2EDBA 1CF1A 1KC5H 2YSSB 1RCYA 4L9LB 4N85A 4MMXA 4XO9A 1H3UA 2DZEA 1INDH 3OKMA 3FC8A 4Y9FA 2C3GA 2WLZA 4Z8FH 2EVGA 3O9WB 3KW8A 5CLZA 5I2IB 2LU5A 1NIDA 4K7PX 4ODHH 5F3BB 3WHE0 1MHPH 2XQYK 2VLME 1RZFH 1S5IH 5G5DA 1BZDA 3S5LB 3EJYC 3EH4B 1BG1A 3MREB 4XNAA 4GIOA 1SXBA 3TZVC 1MHEA 2OKMA 3F04A 4P57B 4PJBF 1XEDA 3CDYA 4FG6D 5JMOC 1RJYA 1AGEB 2ERJC 3SQOH 4NC0B 1D5XB 2BDNH 4APQD 2WLLA 5E1HB 3H4HA 4HK0A 4Z7WE 43CAA 4CVUA 3MV01 1KBGH 1E5BA 1BHGA 4D9QE 3NJGA 4IMLB 1W0WB 2MTAA 4QLRA 3BKML 3SDDC 2BCMA 3FQ2A 3SKNA 1CFSA 4D7BA 2Q20A 4HKXB 4BWWA 3BFQG 1A7OH 3NESA 2NY2C 4KK8D 3QSKB 1QD0A 2Z1PA 3GEFA 3MXWH 3QUMA 2GEQA 2WZ0A 3QORA 3ATEA 2B4CL 1W91A 1LWRA 4P9HC 5JHDD 1WITA 3VO0A 2VZ1A 5KSBF 1E9OA 3PP3K 3F58H 4XMTA 2YPLE 4Q6IB 5E94B 5EN2A 1TPXC 1AI1H 2A9NH 3SGEI 5AAWA 2ZXCA 2FH6A 2V17L 4HOMA 3KVPA 1QLRA 2G4GA 3GMRB 4LLDA 2W9EH 2Z31D 4JR9L 5DD1L 3HE6C 4Y1AD 2LLNA 5D72H 1SXZA 1T1XB 2P26A 3LRHA 1OP3H 1LLAA 1EHKB 5G4OA 2WBXA 1SMDA 1RLBA 4XCNB 3H7BB 2IQ9L 1BFOA 1YEGL 4MNGB 5LWYL 4GI6A 4WK4B 2Z91A 2YMXL 3B2XA 5EBMA 3X12B 5IWLC 1U8JA 1C7TA 2DMBA 3EYFA 3FT2B 5I1LA 5A3ID 3IE4A 1ES0B 2VITB 5BVJA 2OP4L 2TRYA 4MS8D 3S34H 4NPYA 3IGFA 2FJFB 4YHLL 1ZHKB 4YN3A 4Z3EA 2W60A 2MPVA 1WUZA 2ED7A 3EJSA 1DJIA 3GLZA 4OVUA 3C5ZB 3S6CA 4UTBH 4I9WE 1OCWL 2ZOLA 3CUPA 1GJWA 3EGXB 3UTTA 4FA8A 2GHZA 1TJIH 4JFFE 3ZYJA 2VDNH 3N41F 3RNKA 3O0RL 4BA0A 4FTDA 3T65B 4Y2DD 5HYIA 4BQBA 3ECBA 5AW2B 4WFED 4KXZI 4ZAKC 1OE2A 2BY3A 4MD4A 4WV1C 5EFIB 4CADA 4I8DA 1HXYA 1D7BA 1GYCA 3CZSA 4S1QL 2AKRA 5AL0A 2PCFB 3HG1B 3ZJAA 4Q9RH 5E2UH 1PY4A 1YEFH 3KZ8A 3IF1B 2DWSA 2AZAA 3RUGF 1XB6A 3VXQB 3D3VE 4UB0H 4ANVA 3MLPA 1M1XB 3UACA 4Z3JA 2DQTH 2F19H 1B4JL 5EOCH 5BO1L 5SWSB 3B9EA 3DPBA 4X8GA 4YUEH 2EDYA 4JFQB 5DUBB 2QSCH 1T0OA 1KV3A 1WWBX 4M8RA 4E9WA 3WTVA 1M6UA 1A6ZA 3MTRA 3SDCA 4MDIB 3IDGA 5E2WL 3L08A 3QE5A 3H3BC 4KMTH 1IEBB 1ZANH 2NX5D 1JG9A 3TONA 3V5KA 3BZFA 3QRLA 4MZ3A 3T6WA 4K94C 1F4XL 3ZXAC 1W0VB 2ADYA 4OCXL 3ZDZB 4WUUE 4Z77A 2A73B 3N6YA 4BFOA 1BMZA 4G8AC 3PHOA 2CUAA 1JV2B 2J55A 4Y5VC 5DUMH 4DUVA 3RNQB 4YL4A 3V6ZA 1JZIA 2VXTH 2CPCA 5GRJL 3L1GA 3NZHH 4L8SC 4KJWC 4OLEA 5FDWB 3IAQA 3NMEA 4QXWA 4KGLA 4F24A 1I8MA 1VSCA 4YSDA 1DUZB 1OWWA 4NN5C 3RJDA 5IJKC 4XNXH 3ULVL 5E08H 3QNYA 2VLJE 2CPUA 2CJTA 5KYYB 1MCKA 5EORH 2BCKA 2ITCA 3D25A 3D7PA 3H9SB 2CHNA 1FC1A 4KMQA 5F9WC 5I6OA 4MAYA 4APQA 3RVXD 2C9PA 1WGVA 4P3CL 2HMIC 4GXVH 3QHFL 3CN1A 3G5XB 5HDWA 2XWXA 2Z8SA 4HSAC 2HJLA 3D0LA 2ARJB 4MJ5A 4PB9L 4BFNA 3OQRA 3KS0J 2NXZC 3UYRL 5ID1B 3N2JA 4WUKL 5BZZA 1LO0L 5ESQB 5LNDA 4DVRH 3SE4C 3PABA 1CFVH 1J1PL 3HC3L 4PW9A 1TG8A 5JHBA 1ASPA 1HHJB 3D0VA 3BGFC 4NBZB 3KYMA 5JHDA 1EV2E 1LMIA 3DPDA 1U0QA 4LO9A 4U1JA 4E9RA 2VJ8A 2E7MA 1D6EB 1ULVA 1Y6MR 3R1GL 5C2BL 2AVFA 3DX9B 1ZT7A 1JWSB 2KDYA 3E38A 5TDPA 4TNFA 2IAND 5AUMB 2H26A 3MLRL 4EJ1C 1RUML 3NTCL 3LIZA 2XZQH 1PEWA 2K8MA 4P5TB 1QFWH 3NCJL 5AQ0A 2Z31A 2AK4D 2F8VA 4PGEB 1KJ2L 4Y1AA 4AL8L 1HL9A 3BH4A 4BRJA 2OBGA 2ORBL 1Z9OA 3BKCH 1TEYA 1EHLH 2HRHA 4M93C 3V0HA 2UWEF 2ZKHH 4KVCH 4QRRE 3MCLL 2Q9OA 3KL5A 3PG2A 3UPCA 5T33H 2A38A 4JZJA 1YMMA 4ZUSB 3JVGC 1NMBH 2XWDA 4B9JA 1GCYA 4XVUC 1CIUA 2H9GA 4OBSA 4RWYH 1ZLEA 4UIMA 3RPIB 1SDAB 3LZFL 2JWYA 4PM1A 4YDVA 3D6GA 5E8DH 2I25N 1CL7H 4YL9A 1RZ7H 5IEHA 3L48A 5D1QB 4HUNB 4KQ4H 4I9XA 4X6BB 3ZMRA 4DFHA 4I13B 1HH9B 1A14L 2AMGA 2E0PA 3F12A 1CI3M 4JFPA 3C5XA 3T6QC 1UOKA 1KEMH 5DUPL 1I4FB 2X0VA 3PQYE 3WTUA 3IAPA 3MBEA 3HN5A 4HIJA 4DH2A 3QCTL 1Z9PA 1A6WL 3OXSA 2XIDA 4R7DB 2YC1B 2O61A 1WA1X 1F13A 1L0QA 3GZQA 5EZIL 3PP3H 4N2GA 4AXWB 3AWGA 4BSWA 4TSBL 4YC2B 1U8NB 1Y0LB 2ESVE 3MRDB 4HKBB 4B9KC 1XAUA 3ZX1A 1T3FA 2EXYD 2J1ZA 3V9FA 3TWCH 1ZTXL 4JPQA 4D0BB 4ODUA 4M61A 4JFSA 3MSPA 5DMIH 5FM4A 4J23A 4KX9A 3OX8B 2WUCL 4TPRH 1PEZA 2QJDA 1E90A 3QB7C 2ZG1A 1T66D 3I9GL 3RWFB 3T6XA 5EA0H 3EYQC 3VXRD 2WNKA 1UCTA 4UV7L 3RVUD 4FFYA 2H1PL 2GJ6D 4ZPTB 3FU0A 2NX5A 4YXLL 3DRTB 1G9NC 4QHNA 1IC7H 4WWNA 4KQ3H 4UDTA 4NM8L 4FNSA 4Y4KD 1XH0A 2DWXA 3MOAH 4MCNA 3VAEA 1UVQB 1WFIA 3W5MA 4GG6F 2YSSA 2VSDA 3U0TB 1GAFL 1JPGB 4L9LA 5F88B 2X10A 3MZGB 4UM8B 3D39E 2IPUK 4GNKB 4ODXA 1NLBH 1J0ZA 3KLQA 4DGUA 2F9BT 4L8BB 1MDAA 5JHAA 1FYHB 1PPIA 3DJ9A 1BVKB 2Y5QA 3Q8AA 2NNAB 1IBZA 5D7JD 4TKWA 3WJJA 4MHHG 3B7UX 5ITFA 4OR1A 4LLYA 5DZPA 1WIUA 3DRQB 1KCKA 3EHBD 1I3UA 4IK6A 5D2NE 4A2GA 4D0DA 5FO9B 1IBBA 1X5AA 2CA4A 4P2QD 5HHXL 1FNSL 1GOHA 2EXWD 3N9GL 1YUHA 5CLYA 4KOBA 5MERA 1MQKH 1L7IH 4IGBC 4P57A 3MUJA 1N5YL 4LSDA 1T83C 4JBSA 4H5SA 4XOAA 1PKQA 1HILA 3GKZA 2DH3A 4CRPA 1K2DB 2HZHA 1TTBA 3MGTA 2XZZA 4EBQL 2W65A 2XZCH 4LU5L 3WTSA 2BJML 3BHBA 2WN2A 1PQZA 5T1JA 1N9PA 2YD7A 4RMVA 5JORB 4IMLA 1W0WA 4UOZA 3OMIB 5EU3B 1MCWM 5LN8A 1TETH 2EXTA 1SJEB 2VDLL 2NQCA 3KLKA 1UWEL 5F6IB 5I1JH 2IVFC 2IANA 4AV0A 5T1KB 1KYUA 3EGSA 2A6JB 4CU8A 3JWOH 2CMRH 5KVFE 3C8KB 4HKJB 1KEGH 1HQRB 4PY7B 1K6QL 3WNOA 1E4HA 4M7ZC 4JW3A 1DFBH 1MELA 4N2EA 1WGOA 3RX9A 2BOBB 2OJZH 4GRWE 1OD7A 3ZOAA 2RHEA 4NKOA 4X9HA 3GB7A 4X98B 3QUXC 4AYFA 5I1DA 1OCZB 4I4WA 1XCTB 3EGDA 4M62H 1UM5L 4AT6B 1RFDL 4NC2B 1SNRA 2XN1A 1FYTB 1TJHH 2ED8A 3H7BA 4MNGA 1IAIH 5I6MA 5I6XB 3CN2A 4I0PB 5EO9B 2AQQA 4OKVB 2ZUTA 3DSNB 3RIFF 2EDLA 3VFWB 1QSEE 2R69L 2VLRB 1ES0A 1L9QA 2VITA 2O5XL 5DLMH 1BXVA 2GY5A 3TEUA 3ZYZA 5CR1A 3DIDA 1S4IA 5KVDL 2I07B 1P7BA 3JZ7A 5HYFA 4LPCA 4LSPL 5DMJB 3QIBC 1NCCL 1I8UA 1MNUH 5KAQG 5DRZA 4OSUL 4U1GB 4WWKC 5DTFB 3I9AA 5KS9A 3WBDA 2P80A 1WYJA 3C5ZA 4JRYB 1NANH 4N0CC 3LKPA 1UURA 3EGXA 5GGUB 2X6AA 3U2SA 1V27A 5C0FA 1FGNH 4NQCB 4A2MA 3FTWA 1OCRB 1QW8A 1AO7D 3DC0A 1DQLH 3O6KH 2RFXB 3GKWH 3GJEA 3BPLC 4FXGB 1NGPH 3KPPA 1UFGA 5MEOA 2BVUA 3RWHB 5ACMA 5IFHH 1SUJA 1PZDA 1ZY9A 1KGUA 1ZDQA 1GMEA 2PCFA 3NRFA 1KFAH 2ZWYA 4RNRB 5C7ZA 1E5ZA 4RMQA 3IF1A 2EDNA 4WTZG 1RZKL 1DBJL 5D8JL 4ZD3H 3VXQA 1JNJA 5CCKL 3VXRA 1XCXA 3ATDA 3NSCA 3TIDB 4JFTA 5A2CA 4JDTL 3BP7B 1P6AB 4XNZC 4FYQA 5LLIC 4NQDE 3WFBL 4JQXC 2IGFL 5BNXD 3UTQA 2AQRA 3T0EB 1XIWD 3GSRA 4R26H 5DD3H 1E2VA 4G9FD 4IRSC 5GRUL 3TP4A 3WTYA 1PIFA 1WWWX 1B2YA 1WSST 1JE6A 3U7AA 1U4EA 4HWBA 4F8LA 3QEQB 3DX4A 2QPFA 3KBPA 2CDFB 2R23B 5KZCD 5FEBA 1TZ8A 1JZDC 1S2EA 3SY0B 3FQWA 4MHHI 4TUKH 2A73A 3APDA 2Z6FA 5D7JA 3OWRA 3ZDXF 2IFFL 3RNQA 1T04B 2A74C 5HGHB 1MJUL 2DM4A 3U6RB 1LWHA 4QHUB 3RA7H 4OZFG 2NXYB 3BLKA 5FDWA 2IV8A 1GGUA 3IJEA 4WW2A 1P5UC 2ADFL 4P2QA 3HE7D 1ZT1A 3EBGA 3GMMB 1RQ5A 5BV7H 4A7GA 1LO5A 3GI9L 2R0WH 1ZLUK 5CBAA 2FDBP 3RVTD 1KIUB 1Y6KR 3H53A 2E7BA 3CFDB 1TEGA 2QLVB 4JG5A 4NEHB 4KHXH 4E5XG 3H9SA 1KGIA 4A7VA 5CFHA 1I1YA 2QVFB 3QEUB 4M6ML 4NCC1 1P2CB 5EOCJ 2D7PA 4YXHH 3WFZA 2DQHH 2Z7YA 3G5XA 2FIKB 4JFHD 4JFEE 1LVEA 5KSAC 3MC0A 5DCCA 1OGAE 4CKQA 4PJ8D 1LEIA 4KH9A 2J4WL 1X44A 2EO9A 4Z1PA 3IFPA 3NOIA 4HJIA 4HJJL 4RDBA 5GJTL 4C57C 2EE0A 1J9TA 3F83A 3S5YA 1PZSA 4JRXD 5ESQA 1IGTB 1OAUH 3NJKA 3OJVC 4DP7X 4RH4A 3L7FB 4HAFA 1A7QH 3EJZC 2X4TB 4Z95L 4HPYH 4QRUA 2H6PB 5HY9B 4XZ4A 4H13C 3V6OE 4QPEA 1OAQL 4CW1A 1EAQA 3NCYS 5D71H 5C0IB 3DX9A 4I3SH 1JWSA 4TS6A 3HLAA 5MP6H 5AOMA 3V4PB 4C47A 3FONB 5AUMA 1J5OH 1ZGLB 3HS0B 4PSPA 1CGXA 2ZWLT 4P5TA 1OHZA 4HSCX 3L16A 4JLRB 1W9XA 2C3VA 2CGRL 3TGXA 1S8DB 1YYLL 4KRPC 2CBOA 1C5CH 4PJFF 3RVVD 2OMZB 2VISB 3BXNB 3MLUH 5D7KD 3WHXA 4AMXA 4ZUSA 3UIYA 1COBA 4HT1H 3QUMH 2PW1A 2YD2A 1FVDB 4XAWL 1OALA 3QI9C 2LAAA 3QR2A 2AEIT 1HINL 2WAHA 1JXKA 2P8PB 1K8IB 4KFMA 1IKFL 4M7JH 5DQDL 3QUYC 5GGVH 3LCYA 5CP7A 3D05A 2KS0A 2XZAH 4PWKA 2HP4A 1PCSA 4UT9A 4OLZH 5GRVK 5CGBA 1QI3A 3I6KA 3FQTA 1HL5A 5K33A 1OPGH 3SCMD 1TZGH 2WOYA 2X89A 1HH9A 3BO8A 5M7QA 3HB3D 1MRDH 3SOBL 1YY8B 1KB5L 4PBVC 4U6XB 1DBKL 5KJ7E 4YE4H 3MV7D 4DPBX 4PTTA 4Y2LA 3MO1A 2AJYL 5IQ7L 2PWDA 2JKRM 1JOIA 3B56A 4XR8C 1MCOH 3REVB 3VU2A 3CHXA 1W16A 1PVHA 2AJ3B 3ROOB 4HKBA 3R0NA 1QHOA 4B6ZA 4TVPL 5CEYB 3FSAA 2BWIA 2V9UA 4H8PA 2HLAB 3JYCA 4OLYL 4ZUTB 4AQAA 2FE0A 1L9PA 2XFXB 5DVOA 5AW1B 3NSXA 1VZHA 4JQIL 3MNVB 3WMQA 3N42F 4QRAA 3RWFA 4MJJA 4F9PA 5DT1L 1MCIA 4U6YB 5F7EL 4Z6AT 5E6YA 5ALBL 1DJGA 4DVBB 4G9FA 1B90A 1LMKA 4OJYA 4N9GB 4YNYB 2GIXA 4ISVB 1EAJA 4U1NB 1G6RB 4IRZA 3RX8A 5D2LB 1KCWA 4HIIA 2GTQA 3D9AH 4BZ1A 2XU9A 3FQ4A 3MJWA 1FNFA 5FB8B 1S7QB 5DK3A 1JPGA 2H3NA 4M00A 4MD5B 5GZND 5F3HA 1CDYA 2Z93B 3BIAX 1T7XA 5AKRA 2L04A 2EVHA 4CAGA 1CD0A 3RY4A 2OTUB 4L8BA 3VWKB 1NAML 5JHLL 2BNQB 4LKXA 2F2HA 5I9QB 3UYPB 3O8XB 4BSVB 2VCOA 3HE7A 5HDBB 1X7TA 3T0DA 1E30A 5I66B 1VF5C 3VG9B 4HS6A 2CRYA 1F5WA 3RWIA 1HE7A 1EXUB 1DCEA 3HG3A 3CFKB 3T3ME 4XRCB 3NPSB 4OB5H 5J1AB 3UO8B 1NA8A 1DBAL 1QMUA 4PJ8A 5SX5H 1A6VL 1CF8H 1J88A 3OMNB 1OCCB 2F7IA 5TFSL 4JRXA 4F93B 1NOLA 2MRYA 3VFMA 5INDB 5EUKB 3FB6A 4Y1SA 5A6MA 2WCPA 1TVHA 3RGVD 5MHSD 4N2CA 5HGDB 5TE7L 5JORA 5FYJH 1AJ7H 4XMLL 1S7SB 1JGUH 3E2HB 3JV4B 5F71A 3ESPA 1SEQH 1JGDB 1W6WA 5HHVL 4L0YA 3RTLA 1SJEA 3HBGA 4RCAA 3DO3A 4F58L 3FCGA 2X4SA 5T3XH 1IGJA 3BKJL 3I6LD 4NT6B 2O6DA 1DLHB 5ALCL 1MCQA 3STLA 2FJGA 2ZT9C 1GGBH 3C8KA 1U93A 4MXVF 4PTUB 5TK4A 1FDLH 3OKDB 2JLLA 5I8OH 4S1RL 5GISH 4WFHD 5B1KA 3F7VA 3CVIH 3PNWB 5AYUL 2VMCA 3NQIA 3Q13A 1M05A 1XCTA 4UTAL 4OT1H 35C8L 3LH9A 3UZEC 4I18C 4GEJA 1LM8V 5L6YH 4JY5H 1ZLUH 4FEMA 2DLTA 3J2PA 4YH6A 3UAJC 5D5MB 4I0PA 1NUFA 1XZ0B 2VAAB 4BELD 2J43A 2DL9A 3VFWA 3GZKA 2EUWA 4LNRB 1Z5LA 4WO4D 1QSFB 1VGEH 1NCOA 3LIZH 2RTTA 2JI3A 2QPUA 2X2YA 1CXKA 1GC1H 3BOVA 1QRNE 2BIOA 4IDLA 1A7BA 1DVTA 5C0DB 1PF3A 2WW8A 2YGNA 2I07A 3IDIB 4JN2B 5D7SL 4M6NH 2VQ4A 4R4NC 4XTRC 4TQEL 1B0IA 1D7FA 4ORGB 4M48L 4NENA 3C09C 3QZWG 2JELL 5D2NC 4FABL 5BRZA 1CN4A 1ED3A 3DUUA 3F2LA 3E1F1 5DTFA 1T03L 1EHAA 3RAJH 3MV7A 2Y1VA 3BVNA 3RE0A 3ZTEA 2R8SL 4OZHF 1CDUA 4S10A 4HYTB 5GJSL 2HUEA 2XDHA 4E9TA 3DV6B 3DX6B 3ZBMA 4PR5B 4PWFA 1NOFA 1MRFH 2AI0L 4K2UH 3GSWB 3LIUA 3FJTA 5C07B 1WBXB 4MXWH 3P2BA 4UQEA 4AVKA 1X7QB 2X3BA 4XX5A 2H0PA 3PWLA 4RNRA 1RJLB 1ONQA 3IFLL 3CFEA 5JIPA 2XTJE 3W56A 1DN0A 4FQLL 4OLVL 1SQ2N 4WTZA 4DKAA 1FVEA 3UJTH 2XG4B 1O7VA 3EH3B 1L9RA 4JPKL 4GMTH 3IJSA 5FC9A 1QO3B 2DI9A 4EI0A 1N2RB 3VB9A 1KT2A 2BMKA 2NW3B 5AKTA 3ZZSA 4ZMAT 4WW2F 2DB8A 2HT3C 3QEQA 1BVLA 1L5GB 3UJJH 1BLIA 2R23A 2D3NA 1KIRB 1M2VA 3MLSL 4PRDA 3KPNB 5DZOA 4LIQL 4HIEB 5JPNB 5D70L 4K8RL 1JV5B 4XGZB 1HWWA 3EUDA 5CKGA 4F33B 2XETA 5GS0C 4MXQD 4F9LC 3C6LB 2JTDA 4HZLB 2PABA 1MCWW 2NUTB 2Y3NA 1I53A 1T04A 1TMQA 4N3UA 1DBBL 1RK1A 4O9HL 1D9KB 4I1RA 2XNAB 4GSQA 1X9LA 4GXUN 5IHUL 1FZOA 4XP5L 1QR1A 1JL8A 4FFYH 1WFUA 2GG1A 3FTUA 1I3GL 3M8OL 1TVBB 7PAZA 1JAEA 3L5HA 2BVTA 32C2B 4HQQL 4OZFA 1KCBA 1YA5A 1FL3B 3FQNB 3VXUD 1AZNA 1C16B 3IU4H 3ZR6A 1V05A 4AKQA 3CZGA 5DJ6B 1BAFL 3M6DA 1WBYB 2X3AA 4LSTH 7TAAA 1Q0EA 2B8OT 1HX0A 4LAQH 1PDKA 4QHKI 5DJYB 1IE4A 4XNYL 5E8EB 4E5XA 3PPSA 1NFDB 1P2CA 1U8MB 3RWDA 4LBEA 3QIWD 2FIKA 4B0MM 2K0RA 3CFIC 5AB0A 2BX5A 3RGVA 2YPVA 1II4E 3GXFA 2ZWNA 3RBSA 1DUYA 3IDJA 2X2JA 5DVNA 3FPXA 3S97C 1AE6H 1FA4A 4WHYG 5C92A 1BGXH 1S7VB 3L7FA 4WGKA 1OAKH 4I5BB 5C09D 1R3IH 1HL8A 4NQVB 4DKDC 4N0UB 3HMWH 2BW4A 4N2KA 1JGLH 4AL8C 3D87B 3FQUA 1AGFB 1V8HA 4IU2A 4L4TB 5C0IA 1T0PB 3FH7A 2HPOA 1N26A 1YEJH 5GSVB 1ZGLA 3FONA 4HF5H 4YHOL 4J5VA 2EZ0C 4DN3H 3CXHJ 5ISZD 3FTSA 4NSKB 4IJ3C 4JLRA 4XXDB 1PBYA 2I60L 2MOVA 3B7SA 3O81A 5I8KH 3DARA 4JG0L 4UT7L 1W72B 4PJEF 4GRLC 2QFPA 4ZUUB 2XV6B 3AMKA 3CGTA 2JKLA 4EXPX 1EEQA 2MNUA 3DTUB 2BP0B 5DZVA 2QMKA 2WBJC 4LCWB 1HNFA 2AW2A 2QGBA 4HGWA 3P30L 2X9ZA 4GO8A 2P5WD 1FVDA 1MCPH 1CE1L 2M26A 3K8KA 1RU9H 2P8PA 4X7DC 1K8IA 2M83A 4Y5YB 3I75B 3MVSA 5INCB 5DD5L 3ZE2E 4WKZA 5E99H 1DFXA 3R4DA 1URIA 2WLMA 4NS0A 5FF6B 4QF1A 3HFMH 4C56B 4PWJA 3WL9B 2HG0A 3RWGA 3KHOA 4GT0A 4N8CH 1QI5A 3P11L 3CIQA 1YLBB 5A2LH 3A4DA 1RUAH 1BZQK 1A4KB 4BQ6A 3OAUL 4F2MB 4LEOB 5FYLH 4K71B 1PYWA 4JFDE 4J6IA 3MRCB 2AK1H 3T1FB 3W1ZA 2WZ6A 3MYJB 4X6DF 3GHPA 3SYCA 2DQCH 3ECUA 1HHGB 1UA7A 3VX1A 1LP9F 3WFCH 1JPTL 3U36B 3WNLA 3ETTA 5FFOA 3KLLA 1NPUA 2WLIA 4B97A 2JJTC 4YEFA 2AJ3A 3P3RA 4OCSH 2Y23A 1SVCP 1SMAA 5CEYA 3ALWA 4K3DL 2XFXA 2NY6C 2GPZA 4UQ2B 3TN0C 1HN1A 1UHVA 3C60B 5CN1A 2VR7A 3ZY7A 3TVMC 1BXAA 4P59L 3MNVA 3V6OC 3V52H 2MFNA 3DURB 1LO3L 4PY8J 2WXKA 2UZXB 4KNTA 4UBDC 3FQRB 1MIML 4MA7H 1EQWA 2HKHH 3IJYA 3GXNA 5HHOE 3BGAA 4Z7VF 5JIKA 4ISVA 2ITFA 4EZJA 1BEYL 1G6RA 1S7UA 2ZAIA 4R90H 4Z76B 3KPLB 1SVBA 3VD4A 4JCMA 3FZUC 4PJAA 5FB8A 3T4YA 4CVXB 1YEKH 3HMXH 1OF2B 1XF5A 4MWFA 3P3TA 2VW7A 2BWDA 4NNPH 4MD5A 2GTWA 1TU2A 3W81A 5C0CB 3LPWA 4AVHA 2I24N 1F4WL 1IB5A 2IH1B 4BD4A 3VWKA 1MLBB 4XVTH 4BSVA 3O8XA 4R0LA 5DRWB 5DWUL 4M7KL 4Q9QL 3QYMA 3VXUA 2GT9A 2XLLA 3V10A 3WS3A 1DSWA 3MLYL 4HJGA 4P2RE 5AVWB 1ERNA 4QEGA 3OZLA 2HFGH 5B1JA 4P46C 4G8IB 3TA3B 4OM0H 3MV9B 1JFQL 3QUZC 1HHIB 4HD9A 4IQHA 1QFWM 1C1EH 5J1AA 5HYJE 3QIWA 4AC4A 1IAOB 1U92B 4Q58C 4B60A 3ZW3A 1PX8A 4HOWA 5DD0H 2V2XB 4UUJA 2NY3C 4X6CB 1Q94B 2HKFL 2FJHB 2O5YL 4DCQA 2WXIA 3DJTA 3QUKB 4HWEL 5H35A 1A25A 2UX6A 3CSYB 2I26N 3AAZB 3G04A 2NNXA 4BFJA 3V8CA 5C09A 2RD0A 4ZT1A 1S7SA 5FS5A 3JV4A 1G0XA 2EDFA 2EECA 2XTSA 5D6CA 4W9HC 3VXSE 4AEHL 4FXLA 3ULUD 1PLGH 1DE4A 1MFNA 1T5KA 4Q97A 1ET5A 2PPFA 4PBWD 4OZIB 3RDTD 2HT2D 4IOIA 4UYQA 1P4IH 3VM7A 3TO4C 3UAFA 2XXMB 4KO5A 1IQDB 4NT6A 3FQ1A 1DLHA 2LFEA 1F8TH 1UUNA 1YAIA 2JCWA 3K91A 4IHBA 4LMQE 4WFGD 4D94A 5EIVA 4LRNL 1DVXA 2R1YB 2VL5B 4NNYB 1AKPA 2WSKA 3X11B 1S78C 2WLNA 5DVMA 4NZRL 3MCYA 5HJDA 3Q5TA 3M7OA 1SOKA 2DM2A 5E1GA 3KGRA 5DDHB 4DN4H 1O6SA 1BVNP 4FDWA 1U8QA 3H0TA 5E6UB 5J56B 2P5WA 5JZ7C 1QFUH 5BUAA 1OSZA 2KPWA 4QRTB 4PY8I 2E7LC 4LP4A 2CJSA 2YD1A 3WLWC 3PAUA 3EO9L 4N2OA 3RJQB 4EN3C 1MCBA 1NDTA 3QHTC 5C0DA 4KI5F 1J0IA 4TL4A 2C9AA 4Z0XB 3MLTB 3PHQB 5KVEH 5C6WH 5IB4A 4KK5C 1Z1WA 4UQCA 6FABH 3C5JB 3NK3A 4NAMA 1SDDB 4X8JB 3NN8A 5C0EB 4PJXA 3RWCB 4CDGC 3QZWA 2J56A 4X7CC 3MHZA 5HGAA 5J6HA 2OQJB 3DO7B 2WQXA 2PPDA 1OQOA 1BYPA 2YD3A 3BUYB 3E80A 1RIUH 4GW1B 4XH2B 2W92A 3TO2B 1J9SA 3DX6A 3K0WA 4NI6A 1CR9H 4P9MH 4PR5A 3KPSB 5DHYB 5D7IA 1HXMB 4AW4A 4QO1A 2G3NA 5C07A 2VSMB 1WBXA 6CGTA 2GK2A 4UT9H 3TS8A 1OSYA 5IJCC 1YNTF 4NRXB 2PXYC 1B9KA 4L05A 1ZE3H 3ESMA 3NQKA 5GRVL 4X5LA 3ZT5A 3VWJC 3BLBA 4N2MA 3A67L 1AS6A 1PZCA 2PN5A 1VB9A 3GIZH 4M1GL 4JM2B 3BKYH 1BEXA 4XXWC 1SF3A 5AYQA 1QO3A 2QKIC 3E7JA 2RMNA 4IBVA 2X0WA 4YDLC 1TCMA 4GMSL 3ES6A 12E8H 3HAEB 3WEOA 5I76B 1ZSHA 1L5GA 2MPAH 5L8JB 3QXAB 3KPNA 4BQCA 3AACA 3QJUB 4W81A 5JPNA 1FWXA 4XGZA 5FGCB 1QP1A 3MUHL 4Y4HC 1Q0YL 3VD5A 1UXSB 3T71A 1BZEA 4LKCA 1KYAA 4HZLA 2WNXA 2EIZA 4KXBA 1JVOA 3WNIA 3AM8C 1D9KA 4FG4A 3U9PL 4AE1A 3O2VL 2HRPL 3OPUA 4UV4L 4RGOH 2E7DA 2Z34A 3NIFB 3ZYOA 1MFEH 2YQBA 3IPBA 4X9FA 1KULA 4NUQA 3UTTE 3FQNA 1IBDA 2VM9A 3I3EA 2B0SL 3RL2B 1KPUB 1WBYA 1IEHA 3RY6A 1NCDL 1BQSA 1H0DA 1GGCL 1U8MA 3N0PB 4AUYA 5SX4H 1UWFA 4E9SA 3CJJA 3UBGA 1F4YL 3NK4A 3UFIA 4DK6A 1GGTA 4LPYA 2WY3B 4I1NB 1E9PB 4OQTH 3PYCA 1TQTA 2PYEB 2QADD 4XP1H 2NNCA 3P9MB 2IXQB 5I74C 2QTEA 3RFRA 5DA4A 5B38G 4JCWA 1A3LH 1IAIM 2VXUL 3L1EA 3NJHA 5CGYD 5FGRA 3GIVB 3U2IA 5GRZA 3RDTA 5EMYA 1G7JB 4S1SL 1BECA 4DQOL 4FLOA 1I9IH 3NIGB 5FUZH 1T2QH 4N0UA 3LNHA 5TGBA 3ABLB 3GLDA 3HG5A 3O4LB 1AGFA 3ARFD 2QDVA 2I9LB 5BZXA 2O5ZL 4HJEA 2IAAC 3AY4A 4OD3H 1M3JA 1JERA 1PZ2A 1UM6L 1MJ7H 2BIQA 3QARA 3SHSA 2Y6SD 2VR5A 2NY4B 4JHWH 1LO2H 3CX5K 3CDGB 4WEUD 4C54A 3BQUC 4XAKE 1RPKA 3L5XL 3RB7A 5AVSB 1WISA 2CBQA 2A6IA 2GITB 1IT9H 2BINA 5FYJE 4EZMA 1L9MA 4H40A 3VGGA 2ZJSH 4LCWA 2KZKA 2Y7LA 3K5RA 4A2FA 3LH8A 1S7TB 2PMZA 1MFBH 3RIKA 1WZMA 3GHEL 1NCUA 5JO5B 4KDTC 5T3XE 2D7QA 2CHZA 4HPOH 4GKSA 2W0FB 4KKNA 4Y5YA 4YDKH 4XPFL 3I75A 5INCA 1WPCA 2LW3A 2ERJB 4NFDA 3GT6A 4JDVB 1LE5A 5FF6A 4PH8A 4PMFA 5FDYA 1J1OH 2BNRB 1QASA 5C0AB 4TTGA 4R96B 4K7PY 4UIKL 4A04A 5J6GB 5IBLC 3U4KA 2BSRB 3WAJA 3BRDA 5EUOF 1SF5A 2I69A 2EIKB 4F2MA 3GO1H 3NCBB 2ZUUA 3IFNH 4OLXL 3MRCA 3FT9A 1HK6A 4JQVA 4ZMPA 2YXMA 3BAIA 4KKPA 2PF6A 4GAJL 2IV9A 1HHGA 4LOFA 3O3EA 4HXAL 2EKJA 1RK0B 4G72B 3RGBA 3DROB 3MODH 1E28B 4ZG1A 3LKSB 2F5BH 2WQAA 3MLVH 3N5AA 1HEZB 1IGIL 1W0YT 2XKNB 4G7YH 4X7EC 4QXTB 1IARB 1ADQA 4HFWB 5EZLB 3RWJB 1XSIA 5A2FA 4MNHB 4N2HA 4NQQA 2WXGA 1JHLL 4F5CA 5CJXA 3RI5K 4P23C 4MDJA 1MAJA 5HHNA 2TSBA 2O93L 3MRHB 5D1ZC 5TPWH 4IBUA 3GMNA 2P24B 3L95A 3PL6C 4KVNL 4R97C 5CMAB 1ZA3B 4H0LC 4XNUL 1YMME 4NFCA 2J2ZB 3D08A 2F7QA 4NO5B 2YD0A 4YQXH 3H6JA 3TFKC 1TNMA 2B5IB 5IHBA 1MEXH 4OF0A 2PUQT 3OKNA 4U7KA 4S0TD 2WGXA 3F6JA 1EMTL 4HWBL 4U6HA 3D2TA 1RURH 3B1TA 4F7CA 5HD8C 1LD9B 3IDYC 5JIMA 3QFJD 2X5PA 3BN9D 4YOKA 2F53B 3O6MH 1I1RA 3UO1H 2IH1A 3TJPA 3IJ8A 1A1MA 3BX7C 5DRWA 4DK3A 4MQTB 1JXGA 4RMBA 5FV1L 1FVCA 2P5ED 3DXAB 3O2DH 4U0QB 1M71A 4NBXB 3CVHB 3BZDA 4IEFB 3JWOC 5KW9H 1T4KA 3FT4B 1P6FA 1K5NB 4ZAKB 2JJWA 3EOBB 1Q94A 2B59B 4PMEA 2FJHA 4P8QA 4P3DA 3BDXA 4F57L 4XCEB 5HJGA 5SWZB 3CSYA 5E4AA 4KTEH 2GKIA 3LVEA 4O02L 5L9DL 3SYOA 2BY1A 5L8LB 4M3JA 1IU1A 5HI3D 2J20A 3SD2A 4FFVD 4DO5A 1INQA 2IEPA 3ARFA 2LVCA 3MRJB 3EJPA 3STZB 2NX5E 2XICA 5ANHA 1CUOA 4Y19D 2XWBB 2ZYRA 5CGMA 2HRLA 3AXIA 2CUHA 3V0AC 3CTTA 4JNXA 3UGEA 2JXMB 4RGNE 4U1HB 5AOIA 5HTSA 3HZVA 5T8IA 2R1YA 4N0YH 4JO5A 4X4YA 2AXHA 4LLQB 4X9BA 4XWOD 5DDHA 1J8HB 2XWJA 1KBVA 5AAMA 4L8SB 3DWTA 2E9IA 4FQQB 3WEXB 3FAXA 5FYKH 4ZX3A 2JQZA 4PRIB 2YAMA 4IKLA 4NN5B 1QSVA 2E8YA 3AT8A 4PJXF 4QDGA 2FX8L 1S7WA 1OB1B 3CU1A 2ZX7A 4YPGB 5EWIH 3UADA 2CCLA 5IW6B 1TVDA 2DPKA 3S35X 5F9WB 3V4PH 1U2YA 4JG1H 3H4FA 1E5YA 1H6UA 5IV2B 3W39B 4J39A 3KYKL 4G6AD 4AEFA 5IF0A 3CH1A 5ERWA 5D7IF 3KYNA 1A7PH 3PJSA 2ZWZA 1MLCB 4YXKH 3VYOA 3PHQA 1CICD 2W0KA 3PDGA 3QEHB 2NXZB 4G6FD 3BRGC 1IJNA 3WIHA 1N0XH 2GTZB 1FJ1B 3DV4A 3C5JA 1QKZH 4X8JA 5DFAA 2ADJA 1R46A 4XMPL 1CURA 3OSKA 3WOVA 3LOWA 3Q1SH 4XODA 2IGLA 2F1AA 3U4BL 3OKLB 1DDTA 4J12A 2IFGA 4LPXA 1GY1A 3U9WA 3B43A 3KPSA 5H94B 2F54B 1MAKA 1HXMA 4K23L 5BS0D 2AS5M 3EKCA 3S4SG 1J5IA 3L3GB 2O5NA 1SBBA 2R4SH 4U3SA 1FL6B 1GW0A 2BSED 4L1DA 4EUPG 2F74A 3QDJD 5A6LA 1A8ZA 2WCSA 1DP0A 5ACZA 1YN6B 5K9QI 3MAWA 1FLRL 2GSGB 3MRMB 3O6LH 2F68X 4BZ2L 4U1LB 2XVGA 4YDJB 2LR4A 1W8OA 2GQHA 3FHAA 4M5TA 4MNGE 4K8RC 4KHTH 1MOEA 5LBSL 3DYOA 1G9ML 2E75C 2BVPB 3T0XA 4WLCA 5CJQH 3H3PL 5K9OA 1Q9OB 1ETB1 2HJFA 4GW4A 3ARBD 4LF3B 4IRZL 3ECVA 4KJQD 3QFJA 3KPQB 1N70A 5I1HH 3F7QA 2HFFB 4BZ1L 5IHZA 3JXAA 5LAXA 2QVMA 2AQ1A 3B5GA 4H8WH 3MU3A 3P2DA 4NIKB 5ETUB 4M6OH 5DHDA 4HU8A 4WTWA 2MCPL 5KS9E 4I2XB 4NZJA 1TNNA 3US1A 3LMJH 3GHBH 3U79A 3VFSB 2WQ8A 2DLFH 5E8PA 3ULUF 1G6RH 4ODHL 2GBUA 4KNUA 4XBPB 2X12A 1UA6L 1NZRA 1HDMA 1ND0B 1ICTA 1VFOA 4OGYH 1TJXA 1E6JL 1NFIB 3JUZA 2DBLL 2Z0UA 2EE9A 4JY6B 3T3PB 5HDQL 3OHMB 1JYXA 3T1WA 1NCBL 2YXFA 2OR8A 1FO0A 4PHXA 1UXWB 2R1WB 1NCWL 4Y7MA 1GRWA 1M1SA 2Q76B 2OMUB 1GJUA 2DQGL 6PAZA 4TN9A 1NGYA 2ZSVA 5BOPA 4G6JH 4OTXH 1EFQA 1LHZA 3LZLA 2J8UB 2DQDH 5DS8B 3VXRE 3V0VB 1JHTB 3QORC 3QPQD 3CFJB 1S9XA 4Y19A 4U7SA 4W4OA 1MHHA 1SHSA 4OLWH 2OMWB 5DO2D 3HHSA 2CHWA 3O4LA 4RZKA 2I9LA 4WU7B 5T5NG 4FMVA 4R3SA 4HIXL 2VXVL 1KY6A 2B1OA 2HVJA 4TF4A 3CPUA 3FB5B 3ZDZE 3A47A 4K9EL 1WAAA 4PLOB 2ZG3A 1U8CA 1UGKA 5FA3A 5E8NA 2Q10A 1BWMA 5GGSB 2R56H 4NP9A 2HTLC 5FCUH 1C8PA 2VABB 4ZPVA 4OLUH 3WAKA 3Q5OA 1SDYA 1I9RL 5FWRA 4QCIA 4L29B 3ZL4L 5ICUA 4P5RA 1ZS8B 1ET8A 3G6JB 2WCGA 1TOXA 2CKBA 2YKLH 4KKCD 2X4PB 1BQLH 2HT4C 1VENA 5F9JB 2WN3A 2IGTA 3H9SE 1ZVNA 4IGBB 4OCRL 4GAYB 2FYVA 4JEGB 5JIHA 1R3KA 1NBVH 2FZ3B 1TZHB 2O6FA 1NC2D 4Y9BA 3VFNB 3UZQA 1LILA 5C0NC 1UWXH 1CICA 1LE9A 1NGQL 3VXTB 2MQ3A 5F96H 1JGVH 3VA2C 3VFTB 2FWOB 5EC2B 3C8HA 3WIIH 1KCUH 1CBJA 4YVUA 3FSVA 4IOFD 2OSLA 3QC5X 4I0CC 1CU4H 3D1MC 5EIIG 5I1EH 5J6GA 4B5ZA 1Z5YD 4PRPD 4H88L 1V10A 1S3KH 2CXKA 4BK4A 2DWEB 5C0BD 3VRJB 3V4VA 4KQ0A 3VGDA 3VXOA 4QI3A 2GAZB 5BRPA 2X6UA 2ZOUA 5IQMA 3VDAA 4YX2L 1ZJAA 4ZS6D 3N1FC 3HVNA 3QDJA 1I8KA 1HEZA 2A99A 1U8OB 4LSRL 4IBLT 4Z7QB 3GK8H 5KN5B 1TTCA 1DEEB 4PJGB 2ZCKL 2QQNH 1PGRB 2VDKL 4M1DH 4MNHA 1IC1A 4QWWD 2LLLA 3X13B 2WANA 1CGVA 3IETA 3IDUA 4QKTA 5FM5M 5KVEE 1N4XH 3WY2A 1QBLL 2EYSB 3K6SA 4W9LC 1THCA 3MRHA 3PJLA 4MA3B 4CN4A 2V5MA 3SDCC 4LDCA 5CMAA 2V2WB 3THMH 1ZA3A 4K9JA 1IUZA 2VXQL 3ALPA 4RZCA 1T0NB 4PP2A 2KDGA 4LGPB 1CFNB 3H1ZA 1KBBA 1Q0XH 1NEZG 2C1PA 4MA8L 2EIEA 3ZKND 3CN3A 2LTQC 3ARBA 1N5AB 1YNLL 2JVUA 4PCKA 4RAHA 3GSUB 3MLWH 1FV1A 1G6VK 1OSEA 3MCKA 1N6QH 1JN6A 1KIQB 1HXKA 5J11B 3L9EA 4Y4FB 1LD9A 3GNMH 1CYXA 2JIXB 5CSGA 4LCUB 3K72B 4ZO8A 3EFOA 4GRMA 4M5ZL 5IMKB 5GZOD 2QQKL 3VDCA 4WWKB 1DQKA 1E40A 4FG6C 5ITBH 1AHMA 4ZUWA 4ZW7A 4KK6D 1MAMH 2P46B 1GGIH 3P1VA 4MAYC 3DXAA 1U58A 4N20A 4AM0A 2VXTL 2Y1AA 3Q8CA 3CVHA 4U1MB 4IEFA 4MMZB 3LEVH 1R1CA 2IH8A 5LNEA 2IWEA 4U1KB 4J8RA 5AVYB 2IDTA 4LSSH 3FT4A 4R4FH 4OZGB 5F7HA 2FYYB 4LE8A 4PLKC 2XSKA 3IXAB 1UB6A 3EOBA 4IU3A 2X05A 3VRLF 3FFCD 4NI3A 1NMAH 4E42A 3RBGA 3TJEH 1ZS2A 5IVXB 2AGJL 2VXSH 3GRBA 3M88A 1G87A 5B4MD 4KK8C 2ALAA 3TBVB 5BOZG 2VMDA 4PJIF 2FQGA 1A6AA 2YPVL 3MYZA 1UT1A 3QAZB 1BFSA 3I6GB 4G5ZH 1U4FA 4XNZB 2XOTA 1FNHA 5EOTA 4GEIA 5JA9A 2DIEA 4G9FE 1ACCA 4GUPA 3BGMA 3FQXB 2E9GA 3SPJA 3STZA 1GC1C 1TO4A 2QKSA 4X4MA 4BKLB 4X42A 2DTML 4PJCF 1T1YA 2CCWA 4W9KC 2JXMA 4U1HA 2QR0A 4GFXA 3S2CA 3WMSA 1XGPB 1KJVB 3LNEA 4XBEL 4QHMB 1RERA 2YSTA 4TL5A 4UI2A 4Z7NB 4JY4B 3LRMA 4HUCA 1H6EA 1UYWH 4LLQA 3BDYL 1SM3H 1AP2B 1AIFB 2C34A 1INEL 2CK2A 2IPTL 3GSOA 3L4WA 5KBLA 2NY5L 4ZFOB 1PZ5A 3WEXA 3RFZB 4PRIA 3VU1A 1CDBA 4WI2A 2FEEI 1QACA 2JB6B 3QRGL 2K7QA 2OZNA 4ZXBB 4IKIA 2BSCA 4YFDB 4ZMZA 4NX0A 4XWGL 5I1GL 1OB1A 1OP4A 3FB8A 1A5FH 2IAMB 3BH8B 5F0JB 1PLCA 2AABL 1GW6A 3OGCB 5C0GA 3PWPD 4M4PA 5IFJB 1UD2A 2DEYX 3EOTH 3RU8L 1KJMA 3DX3A 4OZ4B 4NYLB 5BO0D 2VDPB 4AENB 3MBEC 3CXDH 3QEHA 4PRPA 3DHJA 1AHKA 1W72H 5K5YA 1BJ1J 4GBXD 4Y9EA 4CVZB 5D6DA 3HN3A 4TRPL 1T1ZA 1BP3B 1U8KA 4FFZL 5KTEL 3L7EB 5E2JA 3BEVA 1L7TH 3HTLX 1AHWB 2ISDA 5E24E 3HZMA 3VFRB 1Y7VA 4GUOA 4FZ8L 4FQCH 5D1XB 1O9ZA 3OKLA 3QCVH 4DAGH 2AEPH 4ZZKA 3D50A 3KAAA 4FP8H 2HVKB 4J6RH 4QOKD 4RMSA 4HUUB 5HJ3B 2PPEA 4EE2A 4H1LG 1OB0A 4JPWL 1MFUA 4HXBL 1PG7H 2D0GA 2DKMA 4ZTOH 3S36L 3S4SA 4HH8A 3FH8A 3RGHA 2V5TA 2V5SA 4LRIA 4DGIH 2WB1A 3TBWA 4G8FB 3TLRA 3VI4A 4GOSA 3S37H 4EUPA 3AWFA 3S2AA 4PRHB 3MRMA 5FW8A 3NP3A 3L8QA 3MRBB 4U1LA 4YDJA 1X5MA 4MQSB 4ZMYA 1WE5A 5C6TH 4RGNC 3MRKA 1QLEB 1YY9C 1EJOH 1EAPB 3DECA 2C7FA 3VH8B 1OIOA 4L9LC 4WUUB 2BVPA 4NQSB 3ZQXA 5IHLB 5IR1A 3F7YA 1EFXB 3L3IA 4RMUA 1RZ8A 2X42A 5CAYB 4P5KB 4NAQA 4E41D 4QYAA 1UEMA 3O9WC 1J8SA 3UBXG 2HFFA 2OL3B 1IBGH 4FNRA 2ZE0A 3QDHA 2N1KA 2WLJA 4HCIA 5GZOA 2N56A 2BP8A 2R0KH 2DH2A 4V2BA 3B9AA 5BRZE 1FBIH 1I8IA 4NWTL 3QO0A 2Z35B 3WS6A 1E8ZA 2ZUYA 3RVXC 4I2XA 1MFAH 5DK2A 3MV7E 1B0RB 4JRYE 2YLHA 3FCTA 4LVOB 4XVSL 2ZOWA 1UT9A 1ZXQA 3VGFA 4MVBC 5I8EA 3UC0L 3QGVA 4NQCE 4XE5B 5F2FA 3O3AA 2YWYA 2PTVA 4L8DB 1K72A 3ATAA 1WFMA 1NFIA 2Y25A 4JJOA 4HX1B 3GRGA 5KG9B 4KTYA 4Y7OC 2CDEA 3FFCA 5CHNA 4XMVA 2X9YA 4V33A 3T2NH 2DQEL 4KZCA 4ALAL 3OXRB 1AS8A 4LDEB 1TZIA 4UT6H 2YA1A 3GTNA 4TULH 3GXPA 1RPUA 4PUBH 4DESA 2A6KA 3Q1EA 2HLFC 4ANWA 3DX7B 3G6DL 3QPXL 4KKZA 1ASOA 2X6BA 5GPRA 4PJ5B 4B95C 3BSZA 4ZFFA 1GS8A 1P1ZB 1QUNB 4YHMH 4DZ8B 2F18A 3TT1H 2HCZX 2WXPA 3LQAH 1GYAA 3OR6B 4L3AA 4Q6IC 4AMKL 2MEJB 4KK9C 1XF4A 1XDTT 2IG2H 5HYSB 1KWGA 1HC1A 1OXYA 1EX0A 3AS3A 4L3EB 3TF7C 3QEQE 2FEDD 5IMMA 1ZLWK 5LO7A 1JP5A 2E46A 1FPTL 4QRRB 1MCDA 1KN4H 1A6UH 1IL1A 2A1WL 2EEBA 4AYEC 2KH2B 2P52A 4KKLC 4DP9X 5GGSA 1T1WB 2Q8AH 4XXCA 5K39A 3O3UN 2I7SA 4W9GC 4C4UA 1UEYA 3K0YA 4HS8L 4W93A 1DFBL 3M07A 1MF2H 5I1KL 3EJRA 3VGEA 2FBJH 4P2OB 4N5ED 1BSIA 1HKFA 5DWPA 4MB3A 4NDMB 3QXDB 2B08A 4GKLA 2LT9A 3TNNB 4UQBA 4XOEA 3NZ8B 5H37H 3EDKA 2B3IA 4Z78B 4YDZA 5FFGA 1WFJA 2R2BB 2QSTA 3D51A 4FKEA 3HPLB 3QVAA 1G94A 3TCXA 3VXTA 5ADOL 4HLJA 3VFTA 5KYXA 2FWOA 1XBDA 3PQYB 1QEWA 2YUZA 3C5ZC 4KZEH 1FLTX 4GBXA 3G5YB 3EYUL 4ODSH 1CLYH 3BI9X 4M43L 5DURB 4G6MH 4Z0BL 1IEAB 4N0FA 3I50H 5D7LD 1ZLVK 5EIIA 4FFTA 3QDMD 5EBWB 4L37A 5DEFB 1EA9C 4QOKA 5DQ9B 1I7UB 2ESVB 1LYQA 2EXYC 4LLMB 3VRJA 3K1DA 3L3DB 4ZFQA 2DIBA 3I6LE 1FF5A 2GAZA 1K4CB 4PGZA 5BRQA 1IILE 3A3YB 2CD0A 4FXKA 4Q9BA 5FO2A 4BWUA 1ZOXA 4K3EH 1NC4D 3WG7B 2HN7A 1U8OA 1HH6B 1BYNA 4ELMB 2Y69B 4KKAD 2EYTB 4PJGA 3SDXB 1CXIA 1JI2A 5I16B 2ADIA 5JW4R 3FU8A 4NLHA 1DQDH 2EDDA 2ZAHA 4GFTB