2K8MA

S100a13-c2a binary complex structure
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
128
structure length
128
Chain Sequence
b'EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
molecule tags Protein transport
source organism Homo sapiens
publication title S100A13-C2A binary complex structure-a key component in the acidic fibroblast growth factor for the non-classical pathway.
pubmed doi rcsb
total genus 21
structure length 128
sequence length 128
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2k8mA00
3QR0A 3ML8A 3HHMA 4XX5A 2LHAA 4AOFA 3FBKA 3ML9A 4F92B 3DBSA 3HN8A 4WWNA 4BGDA 1UOVA 2K3HA 3IM1A 2ENQA 3QARA 4TV3A 3PREA 1BCIA 2WXHA 3L4CA 4HLEA 3TWYA 4DK5A 1DJZA 2RD0A 4V11A 2UZPA 3L08A 2CHDA 2ENJA 2WXJA 4Y1TA 2WXGA 3KWTA 3F04A 4FHJA 4L23A 2WXRA 3DPDA 3L54A 3L16A 3OAWA 4TS6A 4URKA 4ICWA 4WEEA 1V27A 1TJXA 1UGKA 1QATA 2K8MA 4LDCA 2FJUB 4LT7A 3ZW3A 2WXOA 2DMGA 2N1TE 2WXPA 5CCHE 2CM6A 3RDJA 4HVBA 3NZUA 2QZ5A 1DJWA 4PS3A 3ZVVA 1E90A 1DJIA 3L17A 1RH8A 2Z0UA 4EZLA 4IHBA 3PYCA 4GNKB 2DMHA 2Q0ZX 1WFJA 1BDYA 3NSJA 2ZKMX 3IBEA 4AJWA 4L2YA 3GPEA 2WXMA 4QAMB 1DJHA 1E8XA 3F05A 2K4AA 4G11A 3PS6A 3W57A 1DSYA 4FULA 2A4ZA 1RLWA 4L1BA 1E8WA 1GMIA 5G55A 4ANUA 2WXIA 3PFQA 3R7QA 5JHBA 2CHWA 1E7VA 4PS8A 1QASA 4ICXA 4JPSA 2NCEA 4Y1SA 4PS7A 1UOWA 4OVUA 3APDA 3P2BA 5H4YA 2X38A 3CSTA 4L1LA 5CCJA 4GB9A 4KITB 4TUUA 5EDSA 1E7UA 4FA6A 4J6IA 5KJ7E 3R7RA 3APFA 1DQVA 2WXQA 1DJGA 4NPJA 2JQZA 2K45A 3ZIMA 2CHXA 4QJ4B 4QJ3B 4WAFA 3CSFA 4DNLA 4BFRA 3JZYA 1RSYA 4ANWA 2A5UA 2B3RA 4F91B 4F1SA 2CJTA 4FADA 2Q3XA 4ANXA 3APCA 4A55A 2NQ3A 2R83A 3S2AA 4FJYA 2KI6A 3TJPA 2NSQA 3HIZA 3NZSA 5CCGE 3ENEA 1BYNA 1W15A 4WWOA 3FDWA 4XZ4A 3LJ3A 3MJWA 3QR1A 2YOAA 4KZCA 4EZKA 4NPKA 2QZQA 5T8IA 4ANVA 2D8KA 4MJJA 1K5WA 3M7FB 3QJZA 3B7YA 1W16A 4NP9A 4EZJA 1TJMA 4QJ5B 1E8ZA 4NS0A 2WXFA 2ISDA 3RPBA 1A25A 4FLHA 2WXNA 3W56A 1E8YA 3T8MA 4F93B 3N5AA 4OVVA 2CM5A 3F01A 3OHMB 4WWPA 3SD5A 3PRZA 3QK0A 2CJSA 2BWQA 2CHZA 3L13A 4FJZA 3KWUA 3L9BA 4LCVA 2EP6A 4XE0A 5JHAA 1CJYA 5H4ZA 1DJXA 3F00A 4IQHA 3TL5A 1DJYA 1HE8A 2ENPA 2FK9A 2WXLA 2V4LA 2Y3AA 3QAQA 1WFMA 4FHKA 1YRKA 4KZ0A 2WXKA 5G2NA 2YRBA
chains in the Genus database with same CATH superfamily
1OTUD 2LHAA 2E7MA 4JCLA 4QRTB 3BXNB 1JHLL 3FMGL 3COOA 5MEND 5MENA 1JD7A 4QRPE 4U1IB 2A9DA 1RZKC 4S2SB 2W0FA 2F6AA 4X6CF 3FL7A 4YPJA 2D4DA 5IK3A 2WXGA 4B9KC 1M6OA 1I75A 4JM2A 3MXVH 3WFCL 1XCQA 4OV6F 3N6YA 3WHXA 4L4VA 1SLWA 4OFKA 4KJQC 2P52A 4UI2A 4YDVA 2CBOA 5B38G 3K6SA 3KLAA 4WGWB 2X1OA 4B9FA 1JNHB 2I5YH 4RBPK 3CZLA 1U8CB 4H8WH 1QUNB 1U4EA 4Y1AB 4XN2A 2ODIA 2Y23A 3K80A 1F2QA 5AW2B 3IYLW 3GO1L 5CP7A 5GJSH 5LB1A 4UU9A 5E5MA 3RNQA 3TOPA 4IBUA 5T3XL 5TFSH 3ABZA 4LOUC 2F7OA 1YMMD 2H47C 3ECBB 4NJAL 4Z7UA 4ZNEA 2OSYA 1JHLH 2ITCA 3EYOA 2OL3H 4Z18A 4XXWA 5IK3B 3RDTD 2CKNA 3S37X 4KROD 1KEGH 4W9JC 4DKDC 3ZL4H 4B9PA 1E4WL 2CLZB 4S1QL 2UXTA 3LYRA 4YXLH 5K1NA 1P69B 2WZAA 1QZNA 2IBGA 1IT9L 1KIRA 1LDPL 5IVZA 5TDPA 1MI5E 4RMSA 4GG8A 3UZVB 4BFRA 4DEPC 5IW6B 3ZDZE 4YPGB 1YHPA 2Z31C 1CIDA 3F7YB 4XI5C 2FSEB 1QWNA 2KI6A 4J39A 2NSQA 3JUYA 1GZHC 5IJBC 1MHPL 1RURH 1AFVH 2IF7A 2Y1YA 5BZXA 2WUCL 4ZOAA 3OZKA 2BJML 2AAAA 1K4DB 4TRPH 1D5XB 1ZKAA 3OR6A 4TQIA 5CEZL 1K5WA 1XH3A 1ONQA 2DQIL 5BRZE 2VXQL 2FDBP 2XZCH 3HNVH 5GZNA 1DQIA 1UJ3B 5CD3B 1MW0A 2ISDA 1MFNA 2IAMD 1VB9A 2Y6SC 1FDLH 5FHAH 5I8EA 1JZ8A 3NIGB 5KVMC 4Z0XB 1J5OL 4DN4H 3SD5A 2B39A 4QIRA 2XA8H 1YYCA 4LBAA 43CAB 3P0VL 2P49B 4JFWA 5E2UH 1CJYA 1Z9NA 4OZIF 4P48A 2P8LA 5D5ME 1XSJA 3SDCB 3LH8A 1QSEE 3VXUA 4N8PA 4O2EB 4BEIA 4EO5A 1GOGA 3MNMA 4HJ0C 4QI3A 3UYPA 1J8RA 1ZOXA 1U42A 1X5HA 2P44B 3LQMA 5C0FA 3Q01A 2EKSA 3OHXA 2PYFA 3GEWB 4RFOH 4U7SA 3VGHA 1KWGA 2Z65C 4I0PC 5INDA 3MLZL 3WFCH 1NH6A 3EYUH 5GZOC 4JFXA 3NSDA 2HJFB 3DPDA 3ZIYA 4YHPB 4H1LA 1KSRA 3GFUA 4ZUSB 1JPSH 5HHPB 2ZCHH 2VE6B 2LU3A 3ARTA 4Z95L 2QJDA 2BSCA 4YZFE 1MHCB 4NKOB 3UTQA 2PW2B 3ILPB 1P6WA 1UM5L 5CKGA 5IMLA 3P4OB 1KFAH 1SF5A 4PGEB 3K6NA 4YHKL 5FGCE 4OZHA 5AZUA 2H1PL 5FYLD 1IEBA 3MV7A 3UCQA 1E9QA 3T0EB 2ZG2A 4H8VA 2ITEA 3QCUH 3QJFA 4JDEA 4PTUB 5DZVA 3UAEA 5CBEA 2X9YA 3PJSB 2ORBL 5E8NB 5CZVH 5I1HL 3IGAA 4IDLA 4UM8B 1I8IB 2WP3T 3ZE2E 3ZKND 1MI5B 3BLPX 3QIUB 1ES0A 3EH3B 2XNAA 4HOWA 4BFBD 1ETA1 1LK2B 3PHQA 2FJSA 4XMUA 4Y4FB 4IMKC 4J8RA 2X1PA 3HBQA 1HQ4B 1G9MH 1YY9C 4NUQA 2LLGA 4OCMC 2BFVL 1P7KA 2BY0A 3ISYA 2YK1H 3QZLA 1W0VA 3MLZH 3TYGH 4ZD3L 3U9WA 2J8HA 3EDFA 2AKRB 4ZDHA 4KX8A 5C09D 3FOLB 1N59A 4U1SA 2HFGH 4JO3L 1MW1A 1EEUA 1A4JA 1FL5A 4JFQA 3SE8L 3U83A 1KTLB 4DESA 2ITDB 1IAOB 3I3DA 4FQHA 4W9EC 3VVWA 3VRIB 2Q3XA 5BO1H 4MD5B 1F02I 1H19A 2NNRA 3QUXC 1PZSA 1EJ8A 4ORGA 1NPJA 4I4WB 5F6IB 3QRLA 1WBYA 1AY1H 4LO9A 3QIWD 4APQC 2Y9RT 1QRNB 2WLNA 2ZT9C 1W0VB 4AQ8A 1MRDH 3E7JA 2OP4L 3JV6B 1W0WA 4NS0A 3B7SA 5JO5A 4PJEB 2WVSA 1JD9A 1RZ8A 4QR7A 4YC2B 3KBFA 4WW2F 1VGKB 3PPEA 3CE1A 3QFJA 4U6XB 3Q5YA 1N7MH 2OJEB 1HIML 3HE7D 5LDSA 4XHJD 4JN2A 4LCYB 4MNGA 2BVQA 3V4LA 4E68A 4IM8A 3FO0L 3U36B 3ISRA 3W3BA 4AZ8B 2ETWA 4QUOA 3TV3L 3MX0A 4P3CL 5DD6B 1H8OA 4PV1C 3SE8H 3OWRA 4D8PA 4QNPF 4Z9KB 3OC5A 3Q6FB 3QG6A 3A4EA 4IJTA 5ESVB 5C9JA 2YKLL 4F9PC 3LN5A 2OJZL 4K94L 2IANA 3QXTA 5EUKA 5T5FL 2EE9A 1JWUA 3QJSB 4JRLA 3PDOB 5IIEB 4ZUVA 2R23A 1WP6A 2AI0L 4AIZA 3MAWA 3OKYA 4P23C 4XP6H 3BZFB 1TTCA 3MRLA 1ZHLB 2ZTBA 1OSZA 2GY7B 1K3ZA 1M9WA 2WXOA 1PEZA 1RZ7L 2BPBA 4NZDA 2EDDA 3SGDH 4PRBA 3TM6A 4ABUA 1Q9KA 1WT5C 3QJUB 1S9XA 4BINA 2YC1A 4HHGA 1KTKE 3JVGA 2HA1A 1T3FA 2IBZX 2VZ1A 3GIZH 4TQEH 3QCUL 3RHWK 1AC6A 1WFJA 5HDBB 4GXUN 4L8BB 4HGMA 4P2RA 5J7CC 5TF0A 2EEXA 2HFTA 3DHMA 3T8XB 2CUMA 1ZVSA 2LE9A 3RGVC 1CFMA 1AHMA 5G55A 1U3YA 3V0WH 3VJ6A 2DOCA 1A65A 1RERA 1U58A 4KJWC 4TTDD 4AUJA 5KSBA 4M7JL 4PJDA 1L9OA 3AT8A 2BHYA 4PRPD 3RWIA 3ARGB 4DGYH 2XWJB 4BK5C 3C60A 3V6ZA 5FA3A 1LE9B 5J13C 4WFHD 5K9KB 4Z6AT 2KMWA 5F8QC 3SCMB 2X2HA 3QQ9C 4LPCA 1RAMA 4M7ZB 1M57B 4JM2C 5DUJA 4XNQB 4XN8A 1KPUA 4PJIA 1QLFA 1HYSD 4FYQA 4QF1A 3EYSH 4NX0A 3MLYL 1KB5B 1DVSA 2VXTL 2F53B 2DQCH 1O7VA 3HRZC 3ROOA 4NUPA 2F19H 2HLFD 4P5RA 3BE1L 1P5VA 3JWDL 4P5TB 4C54A 2WWMD 4JFEE 4LDLB 3QJZA 5EUOE 5GGRA 3CVDA 3DX7B 5C0GB 1ZD6A 2APTA 3ARGC 4FLHA 4PJFF 1TU2B 1O7DE 4IIQC 1I7RB 1MHCA 4JRYB 1SEBB 3KPRB 4UQDA 2J5LC 4LP4A 4K3DH 5D4IA 1FORH 4CN4A 3BP6A 4GUPA 4JFDD 5IT2H 2X53A 3WKQA 1BYPA 3OKDB 3G5VB 2XXMB 5C86A 5C3LD 3WFHB 4WTXA 1X5FA 2QADB 4DFIA 2B2XL 3UTTA 5I6NA 4QKXB 3TL5A 2BNRA 3ULUF 1MFDH 1X7SA 5F0JB 2PXYB 4N1EA 1ERNA 2VQUA 3TBVA 3PXJA 3VGBA 2DH2A 3IAPA 3GHPA 4J28A 2R1YA 4KXCA 4RWYH 5IBUB 4JO2L 5CHNA 1G0YR 4URTB 2DTMH 3CDGA 4DERA 3Q8FA 2F15A 1CURA 1KB5L 1NGXB 1Z9OA 4RH4A 2MTAA 3FQWA 2YUXA 4P46B 3LQAH 4JG1H 1WAAA 2XVKA 3D2UD 5KZCD 2H0EA 2W59A 3EOTH 3F7PC 3OGCA 5EF0A 2VWEC 3G7TA 4B7IA 1TETH 2DJUA 1YNTA 3RGVB 3BP6B 3TESA 3ARBD 2ITDA 4GKOA 1CXIA 2AJVL 5K9OA 2V8MA 1M6UA 1MY7A 2MFNA 4L37A 4Y2OA 5E5LA 3BO8B 5FYKH 4Z1PA 3VD4A 1YQ2A 1IC5H 3EZJB 1FORL 1AOHA 1QLEB 3MLWH 1F97A 1U30A 1Q0XL 2KLRA 3T2NH 1GS7A 4BSVA 4F7MA 3CAFA 1FFTB 1MH5A 1OP3K 2G60H 4JG9A 2Q76A 4NPYB 4ODWA 5LAXA 3MRGB 2RCSL 2VIRB 2XFXB 1A3LL 3CDZB 1FZJA 1BZ8A 2F0CA 2FNWA 5DJDB 5HHOA 5DRWB 3FO9A 3K4ZA 3ARBA 3CFKB 1IFRA 4DUVA 4DVBA 5CUSH 2IDSA 4JHVA 2OYKA 1JVKA 1QR1B 3FCTA 1EEYB 1D5ZB 1QW8A 2VSDA 3D87B 3HE7A 3O9WB 3S3CB 1IKOP 2GVYA 5HJDA 2WINB 3T3MB 3U4AA 4ONHA 3MKGA 5K9KA 4HETA 4JKPL 3CVHA 4FFYL 4ODSL 2DM2A 4OW6A 4IRJC 4UZUA 4K3EL 5DVPA 4UNVA 1UGNA 2WYIA 1EHLL 5INCA 3S5LB 1M05A 1FZJB 1QI5A 2VDOH 2DQCL 3ETSA 4KRPD 5HGDA 4OV5B 3M8OH 2NY1D 4YSRA 1FYHB 2MCMA 2H6PA 1J8HB 4EPSA 5CJBA 2YJQA 2JKRM 5H37H 5DHYA 3C60D 4KKLD 2F1EA 2UZIH 1AKJD 1ML0A 4KVCH 3QFDA 4KTEL 5GS0H 4KI5C 3NH7H 4NZTL 2P5ED 3VD7A 1UWEL 3D4GA 3F5WB 3GBNH 3FZUC 4W1TA 5FKPB 4PJCF 1TXKA 4NZRL 2NNAA 2AITA 5DEGA 3WSQH 1S9XB 3L3GB 1NEZA 2WLYA 2GJ6D 2WB7A 3QO1B 2HPOA 3DVNA 1RIHH 2C3GA 1XAUA 4ALAH 3MV7E 5ICYA 1BZEA 1MEXL 4L4TE 2EYRA 4FQQA 3WY1A 1AKJA 5DC4B 3E8VA 1F41A 1ZGLB 4Z3JA 4ODSH 1AGDA 1EO5A 3P3SA 3PDGA 4QY8A 4NIKB 4AMXA 3CVHL 4FFYA 1OP5K 2VDQH 1A3RH 4BA8A 4DHLA 4UB0H 1JL8A 1UB5B 1R46A 3RAJL 1YEHH 3MODH 1VFAB 1FPTH 1ORQA 4U31A 3AAZA 3VFUB 4GAJL 3QWOB 1U8LB 3EJQA 4PU2A 4XPHL 4OGYH 4LCUB 5GS0L 3WIFA 3TN0A 2B20A 4OIIL 5T1DH 4HVBA 3WS6A 5IJKA 1DBML 5I6XB 3Q0HA 1P4IH 4QD2E 4JMNA 3DIFB 1FCGA 3OQRA 5IBTH 3JQOB 3W11D 2ZYIA 4OV5A 1FFPB 1OWRM 4AUUA 4PRAB 5K39B 4M29A 1IMHC 2KPWA 2DQHH 5D7EA 2VMCA 1MEXH 5GS2D 4K8RL 4PGDA 2NUTB 5C6WH 4PJDE 1I8MB 5B39G 4Q0XL 1MFUA 5IF0A 2CWRA 2D9QB 1B0RA 4JPIA 5GRJL 5FCUH 1HAUA 3QO0B 3A24A 4ZW7A 4UAHA 3HR5A 1AD0A 2EQDA 1EFXD 3BKJL 5DJ2A 2VLRB 3APFA 5FK9A 1D5ZA 4FFYH 2WB1A 4HOXA 4I3GA 3US1A 4HK3J 4BQ8A 3C6SA 1FL6B 2QSTA 4FFZH 1YC8A 2F7PA 2QV4A 3QI9C 4F80A 1TVHB 4R96A 3BKYL 1FC2D 3RRQA 3STLB 3BGFB 3JWOL 4QCIB 2K7QA 4PJ9A 3M8OL 4A55A 4JFZH 3PE9A 1P4IL 3TYFB 2A6KB 5I76A 4XCNA 1SOSA 5L2KB 3WTWA 3FTVA 4POYA 1LDSA 2P9RA 1GOFA 5KVFE 4AV4A 4MAYB 3OX8A 5EF3A 1BQHB 2NDGA 2D3NA 3E6FA 1L6XA 5I75B 3U7YL 4H2AA 5IMLB 1YNTB 4E9TA 4HSCX 3W11C 3I6LD 2VSMB 3RIKA 1OT2A 1CF1A 2RIKA 1R17A 2FVNA 3TTYA 2LLLA 4ISVB 2XX0A 4LLDB 1F4AA 1YN7B 5ICXA 2J20A 5C0CE 4ZMWA 4P46A 4GXVL 3PWVB 3VD2A 1U95A 1GH7A 2HX8A 2KKQA 2VRKA 4K7PL 4P2QA 2KT6A 3JYCA 4DEUA 4OBRA 4YHIA 2WXKA 3QULB 4NLHA 4BQ9A 4Z3GA 3PAUA 3I74A 3IDGA 5DYOB 3RGBA 4PS4H 3D48R 5D6DC 4CC1A 1EXUA 1NCBH 3GLAA 3IFLH 1H5BC 1ETB1 2C3WA 5HJ3B 5C0AE 1FZOB 3SO3C 1P4BH 3EJYC 4PJHE 4JRYE 4P46D 5CSZB 3SDYL 2K0RA 3KYNB 4IKIA 5JIPA 3CVBA 3MUY1 5EU7C 3LPPA 4KK8C 1ACCA 1BQSA 3U6XA 1G5AA 1YEJH 5I5JA 3W9EB 4Y5XB 2FGWL 1G7QA 3L5XH 3S3PA 7PAZA 3D5OF 2F53E 1S7TA 2A9CA 4N20A 4DPBX 1QR1A 3QQDB 1MRFH 2CCLA 2FT7A 2H7WA 1YCSA 4YIQA 1NLBL 2YGQA 4E9LA 3PS6A 4EZMA 4D0BA 4C56D 2XJLA 4O2FB 3V4PB 3FPYA 3MR9B 4MB4A 1MCKA 3O4LE 1U6AL 3F2LA 5I9QC 1B90A 4M93C 4PS7A 3LKNA 1SUJA 4DTGL 1UEMA 2JH2A 2HTKD 4FOMA 4F58H 3C5ZA 2R0WL 3WD5L 4GG8B 2AEWA 2R2CA 1UD5A 3FT9A 3U2JA 3DV6B 5EIIG 5SWZD 3VFNB 1VSCA 4OF7A 1IGJA 5EC2B 1SGKA 4JLRA 3LXAA 1MHEA 3NN8A 3O6FC 4HXBL 4OGZA 4JY6A 1SXSA 3DO3A 3C2SA 3BYYA 4BUHA 3FCGA 3U4BL 1MAKA 4WNJA 2CZNA 4GKSB 2E27L 5HI5C 1B4JL 1G6RA 2P5EB 4L4TA 4XNUL 1DVFB 5B39B 1TQWA 5GGQH 4ZZFA 1TPXB 1O9VA 5JPMB 3UABA 2FR4A 3AWEA 1TQUA 1CICA 4OFDA 3F7QA 5DLLA 3MA7A 4KMTH 4JLRB 4HG4K 1XGRB 3U9PL 1OPGL 5I1AB 1ZEAH 2YC1B 2CNZA 4F15C 4KRLB 3KE0A 4NNXB 1LEIA 1IBFA 3RWHA 2V9TA 5ESAA 3LB6C 4I3SL 5DWUL 3SY0A 1V7NL 3KLAB 2H9GB 4GT0A 3U1PA 3OKNA 3F84A 2JJUA 2NUPA 3PNRB 4NQVA 3ARBC 1HEJC 2B1AL 1J5IA 4WO4C 2G5BB 3FT4A 4OH2A 3IXAB 4RA0C 4EF3A 3NQIA 2I60L 3ESVF 3SO3B 1CD8A 4NGHL 3KYOA 3ZXAC 3MMEA 1MIEH 3IU4L 4DSYA 5IP4A 2ADGA 5EZJA 5LG6A 2I9TB 2CJ3A 1LNUB 2WQSA 3D4ZA 3SKMB 2QKIB 3OG6B 1T2XA 3FUKA 4H88H 2COVD 1CQYA 2XACC 2PP7A 1TQVA 1FO0A 4OSUH 1JGUL 1LQSR 2L7EA 5TQ0H 2XY2A 4EQ2A 1MLBA 2Y22A 3UH8A 3FQUB 4CAGA 4ZOCA 1TOXA 1Z0MA 4GUCA 2YMXL 4E9YA 2VAJA 2ZCHL 3HG2A 4GIPD 2F58H 2R4SL 2BCKB 5I74B 3GZKA 3NPSB 4QTHB 1ANUA 1T6WA 4M93B 1L5GA 4P4KB 5CGYC 5DI8A 5I8EB 4YDJA 1BGXL 2FAUA 5I1IH 3P3UA 4CILA 5KZCB 5C2UB 5DURD 4DZ8B 3I6GA 2H1PH 4V2BA 3LNEA 3DYPA 4PRPB 4Q89A 1P7KB 5DFWH 2XQ0A 2MMXA 2EVJA 3VCLB 1AHWC 2JKXA 1YJDC 2X4OA 3BH8B 4UZSA 4ETYA 2PTUA 4J8RB 4WK0B 3F83A 5IVXE 3WENA 3UP6A 4B3VA 5JW4N 3BAYA 4JFYB 1JYWA 2NCEA 1VACA 2EDBA 3WG7B 3FUFA 5AVYB 5T1KA 5ICZB 5IM7B 5E2WH 3BWUF 1CL7H 5GGSY 15C8H 2UXVA 1QVOA 1OANA 3EADA 5TQ0L 4BWTA 3PHOA 4B27A 1SMDA 4XVUC 4O9HH 4JFED 4QJ4B 2YGPA 1JV5B 1ZT4A 2MPAL 4X6EA 4J3OD 4PV9B 2H8PA 2SEBB 2B3RA 1IJNA 3D18A 1W6LA 1ZS8B 3VWKC 3K4AA 3S2AA 3VWJA 5PAZA 1AAJA 4BWUA 4EBQL 5BO1L 4BH8A 5DZLA 3ENEA 4PJBB 5G5DA 1AHWB 2AABH 2A6IB 2XPGB 4WWKA 4P2AA 5ANME 2F53D 3FB5B 3MV8A 4A2DA 4C55A 1J8HD 5D70L 3B2DC 4HGWA 4Z95H 4U6YA 3O9WC 3X3FH 5JXED 2XTLA 4HS3A 4YHIB 3RPKA 3VA6A 1IAKB 4K7PY 1JAEA 4LHQB 1BW8A 1RK0A 4C4UA 4MD0A 4YHKH 4X8GA 1F3JB 3MUGA 1GXEA 4LCYA 4MNGB 3SGJC 4X4YA 3S35X 4LCVA 3WS3A 2V6HA 5I0WA 1MXDA 5H4ZA 2J8UE 5CZVL 3BUYB 3UADA 2V4LA 4OCXH 5F3HB 1DQKA 3BP7A 5F9OH 3MA9H 4PJIB 4R8WL 1Q94B 4DKTA 5CLZA 5L2JA 1JBJA 2CO7B 4AV5A 2HX7A 2KHAA 5T5NG 4PJIE 1ACYL 1T7YA 1WHPA 4U1GC 1OALA 5GGVY 3T6VA 3H42L 1RD6A 2GQHA 2IH9A 4KK6D 4QRPD 3QS2A 5ACZB 3PUCA 1U3HA 4DK5A 4PREB 4RX4D 3HW7A 4FQIL 1QTYT 3VXMA 1B0IA 4D94A 3BGMB 2E6QA 2IFGA 2VDRL 5FB8A 2R7EA 1BEYH 3I6KB 3VSVA 3EJZC 4E5XA 4YDIL 4PRIE 3TN0D 4N86A 4LSVH 2VO5A 3NSXA 4GRWF 4IDJL 4KJYB 5SX4I 1NCDL 2DYPB 5JIQA 2CSPA 1KT2B 5EH1A 3L17A 1A7PH 3AGWA 1CCZA 4RCAA 1YPZB 4H8WC 4Z7QE 3BJLA 1W6WA 3ZTNH 3JV4A 1LO0L 1OCCB 3IBEA 4JHUA 5K9QG 3FU9A 5I6KA 4FABL 2XOTA 3ZMRA 3DVIA 5FOBB 5MENE 2OTPA 1CTOA 3QIWC 4APQD 3EOAA 1KJMB 1KGXA 2BY3A 5B38B 3L3GA 4NC0B 2PR4L 1H8LA 2NNFA 4XZUB 1TKWA 3ZDXE 2WLHA 4B9YA 3SY0B 5I8OL 1TQCC 4GKNB 4J3XA 4XH2A 4K5LA 2CIKA 4OLYL 1U8JB 2VH5H 1JV2A 2JJTA 5MEOA 1FFQA 43C9A 3OB0H 1MFCH 2ZZUT 3J2PA 1Z5HA 4ORZC 1AANA 2IFFL 4IDJH 4LSSH 4CN1A 1F4XH 1GGCH 4KNSA 2XBDA 3KM1A 3LXCA 1N64L 1IGYA 1YEIL 4HT1H 1UB5A 4FTVB 3OZ9H 2XQYA 1HEZB 2XN1A 3FQNA 4L48A 1JPGA 3KGRA 2YHGA 4W9IC 5IROA 4QTFA 2ZXWB 2QZQA 4L2LA 3ZKNC 1AMXA 4EZJA 1QPKA 1T5KA 5EIIA 2X4SA 5KTEL 3D07A 3H0TA 1J1OL 3CFKA 1IL1A 3BQUB 3P9LB 1QUPA 4YGAB 1HQRB 2DQGL 1RZGB 4PRBB 4AIOA 1SY6L 4PN6A 3IAGC 3RTQA 3RVVC 2ICES 5I8OH 3MCKA 5DS8A 1A6WL 2CPCA 4NO5A 5CJQL 7FABL 4P5KB 5MERA 2LAAA 4B95C 1A47A 3P02A 2IAMB 2Q20A 4FHKA 3A0OA 4UUJA 2CKBA 4YXKL 1A7OL 1HHJA 3PWJA 4YDLB 5D7SH 1QLEL 1RJYA 2ODHA 4K7PX 1MCRA 5KYUB 4M7JH 3S8WA 4N0YH 4NHUB 4KZDH 3OR7A 5D7IB 1KCWA 4Z7QB 2VC2L 1X5IA 5DRZA 4BCZA 4ONOA 2IQ9H 3TF4A 3HHSB 4EI0A 3VFMA 1CTNA 5KEZA 3BN9C 4FNPA 4H4NA 2AF2A 1M3JA 1HHGA 2AP2A 3DXAB 4G7VL 5TH2B 3S4SB 5F70A 4RSVA 5AOZA 3DX7A 4GRWB 3RDTA 3IPEA 1X44A 1EHNA 1G87A 1TZIB 3QEGH 4R2GD 4LHUB 4DOHE 1PCXA 5HXMA 5C09A 5AKTA 4EIBA 2IAMC 2Y6SD 4QPEA 3BE1H 3S96B 4MWFB 4DVBB 4X6DB 2NSMA 1TFPA 2X2YA 1QEWA 1ZHKA 1RU9H 3P3TA 5HI3C 4AZ8A 1E4HA 3NK4A 5HYIA 4C47A 3TIEB 3C87A 3VG9B 1WK0A 4WU7B 2HJKB 3IJEA 3RU8H 1RZFH 2XZAL 1OO2A 3CPLA 1Q9WB 5F7FA 1N0LA 5IFAL 4XI5D 5C08E 3QEQE 4GB9A 4G59C 1NPUA 2B2XH 1UZ8B 2YEZB 4AENA 1NGZB 1XBRA 3CG8A 4FA8A 3DOSA 3EZ8A 1TZOA 2ROXA 3NESA 1IV8A 2IDUA 2YR3A 3LIUA 3O4LB 2KYIA 2Q3AA 4EEEA 4N5ED 3OGCB 3IETB 1KDJA 3U48A 3ECWA 4K5MA 1PAMA 1CLZH 1ZSDA 1CBVH 4NO2A 2ZAHA 4XBPA 4XWGL 2NY6B 1T03H 1BYNA 4Z0BH 1GSKA 2C8NA 1ADQL 3MV9E 3WE6B 5JOFB 2R0LH 1YEEL 3KPQB 5KYYB 4HD9A 3VG9C 5FKPA 3QUMA 2Z93B 4OF8A 5I6LA 4YDLC 3KHQA 5FWQA 2FUQA 4OLUL 1CLVA 3IPBA 3ULUH 1E4XL 1ZS2A 3H9SA 4AYID 5IJVA 3IJ7A 2HN7A 3GZOA 3LKOB 5B22A 2JCCE 3B43A 4IMLA 4WK4B 3T6WA 4UQBA 4XPAH 4OQ1A 4TVPH 4CU7A 5J6HA 2ENPA 2DQDH 4XRCA 3BCDA 2WWKO 1OE1A 4PG2A 1TPXC 3FT3B 2IEPA 2FH8A 4OLZH 4XPGH 4BE6A 5IW1A 5CCHE 3WU1A 3EXJA 2PW1A 1KBWA 4A2EA 5BMFH 3KZ8A 3LEVL 1LJMA 3CX5K 5CJ5A 4YHML 1YEGH 2QMJA 3WTYA 3SDXF 2IQ9L 2GJJA 3ZDWA 4Q8BA 4IGBD 4Y1TA 2DEWX 3AREA 2WZ5A 4LCUA 3CBKB 4JFDE 2B3IA 5KN5B 3GJEB 3ARWA 3CQQA 3IMWA 3H6AA 3RY4A 4WKZB 1OB0A 1TNMA 3OD3A 1YAZA 3UBHA 4AQOA 8CGTA 4LU5L 1S9WB 4JM4H 3FPXA 1S7RB 1HCZA 1PZ5A 2W94A 1XIWA 4EVNA 5E6ID 4GKZA 5E6IA 5HHOE 3E38A 5H35B 1U41A 2VUOA 2MH4A 1KLFB 2AQQA 3AB0C 4RMRA 5DRXA 4EN3A 4AK1A 2VR3A 3DSFH 1MG2C 3N3EA 4GQRA 3VFRB 1KLUB 2RA1A 1CU4H 2Y0SA 3L3HA 1WIUA 4BV1A 3FN3A 4XPGL 4IKNA 5JHBA 2DBLL 5EZPA 3FB6A 1PG7W 3BD4A 5E23A 4KROB 1MFBL 4YE0A 4L1LA 3LSOA 2NNAB 5DD3L 1D5IL 4F3FB 2J4WH 5D1QE 5JW3L 1KXVC 2EYTB 4L3AA 1MQKH 1I7UB 4FXKA 1DTUA 3AXLA 3LRSA 1F11B 3T3PB 5L2KA 1HILA 2BM3A 4Y9FA 3VG0H 3W2DL 2GC4C 1DVYA 4Z7OB 5LQBL 3LPWA 4KKCC 3TYFA 2ZUWA 4LU5H 3WXVL 3SJVB 2R29A 5LGJA 1OEZW 3KL0A 3K5RA 2L7UA 2OMTB 4FLRA 1NCOA 5HHMB 3V4VA 1ZLSH 2ZUQB 3VFGH 1ACXA 3IF1A 5CIPH 5AOJA 4OM1H 2DQMA 3T3MF 5IOPA 4OIIH 1E8ZA 3QIUC 2AJZA 5FYLH 4MAYD 3DPBB 2WXNA 4UT7H 4PW4A 4N24A 5D7JB 2MHAB 1LTXA 4PTTB 2ZD0A 2QSQA 3AY4C 4JPIB 4UNUA 4HJGB 5INCB 4B9CA 4LAQH 3WBDA 1IAII 1BJ1J 3FT1A 1GGUA 3S36H 3IDXL 5EU4A 1GY2A 2QPDB 1WGOA 2WXLA 3WLBA 3X2QB 3C08L 4G3YL 4PJEA 4PJAA 1WZAA 2FRGP 3MRQB 4HKJB 5HVWA 3S8GB 4HIEB 1BVZA 2NTFA 5J89A 1FFOB 1DEDA 2HUHA 2PW1B 3KXFB 4PRIA 3R8BB 3SDXA 4UAOB 4CBPA 5BZWA 2A0LC 4HIIB 3TBWB 4GP4B 2PO6D 1I8LA 5FOJA 2WWNA 1UD4A 3IF1B 3L6FA 3WXVH 2WQXA 1KXTA 1MFEL 1B6DA 1BF5A 3I2CH 4PJXE 4IRJD 2WC7A 3V0EA 4GUOA 2EVHA 4WDIB 3C5JB 4QKTA 3OAYK 1BVKB 5HHNB 1HWWA 4CN6A 2N59A 4ADJA 2QR0A 2C1OA 2Z31B 4MQ7B 2DI7A 3D39D 3ZTEA 4D0CA 2UWEF 4WTZA 4NN6C 4R3SA 4CMMA 4W9CC 4K8RD 1O5PA 3TCLB 2OMNA 3FC8A 4YAQA 1TYRA 2N7AA 2EDWA 4AYMC 2NMSA 5FGRA 2ZKMX 4BBWA 4BKLA 3FOMA 3KPMA 1CICD 2L3BA 3E0GA 5ID1A 2GJ6E 3QAZC 2GAZB 5MEPB 3ALPA 4MNQE 3D08A 5IKCA 5C08D 3KBPA 1QNZL 2CRIA 1T6BX 4X5LA 3GJFB 1G9MC 4J12A 4K2UH 2BERA 3C12A 5DU7A 5F9WB 1S2EA 2H0PA 2IWEA 3OLGA 5CR8A 5L9DL 4KUCF 3D0VB 4N6QA 4X4YB 1CFQA 4Z8FH 2NY5L 5CJXA 2R0WH 3WD5H 1HVXA 3MJ7B 4S1DC 3VXPB 5EOQL 5C07E 3ZRSA 2WXQA 3C5ZC 5IFJB 3Q6GH 3BGFC 1IU1A 1ET7A 2ESVA 2GT9A 2H6OA 1A14H 1FG2A 4HQQH 4O4YH 4ELKA 2NXYB 3IVKA 1UXWB 3DSNA 5ID0B 2PPDA 3WIIL 4ZUSA 1UATA 1K5NB 5CD5D 3KPLB 3ABKB 5IF0B 5F8RC 1LL1A 3MV9A 1OGPA 1VF5C 1XGPA 4NKMA 2BP8B 1NCAL 2PTTA 2HWZL 5AZ2H 5CSBA 5A43C 1ESOA 2DQEH 4HC1H 1T83C 1E6OH 4KRNA 3FSVA 4RGOH 1XR8A 5TPWH 3U6RA 3UCRA 4ZMAT 1HHIB 1THCA 3V4PH 4L8SB 4IOSD 2FT6A 1SYSA 1XF4B 4P3DB 1GGIH 2X4NB 4RMQA 3MACL 5DC2A 2OMBA 5C6TL 4Q4EA 2A77H 4NP4L 4LSQH 5D96C 3OXRB 3F00A 3BKCH 4ELKB 3T0BA 2MIZA 4XB8A 1Y1UA 1MJUH 1WFMA 1GHFH 1YYMH 3EFFB 3MLSL 3JVGC 5DT1L 4NKQB 4Q2ZA 3H3BC 2GBVA 1N59B 3E9TA 4U1SB 4JZNB 4X98A 3WUWA 4PMFA 5AWNH 3SHSA 3PQYB 4L1TA 4I3RH 5SV3A 3HG3A 1SNRA 1J0KA 3N04A 5LXGH 1CXKA 4PJ5B 4GG6E 4OFPA 4QGYA 3S48A 2XVBA 4OD3L 4E36A 5DJYA 4H7VA 1EQWA 1WZLA 3BH4A 4Y5VB 3UAAA 3S3BB 2WO2B 4W9FC 2MOQA 3UTPD 3IDNB 3MLTA 1HILB 2JJSC 1C5BL 2DN7A 3P9MA 2OL3A 2CM6A 2YMXH 4QHLB 2KDYA 1JRHL 1RULH 3LH2L 3PXLA 2C9AA 3DJZA 2F54A 4S1SL 3I6GB 2YZ1A 4QO1B 4YHNA 2J8UF 4UQ9A 4AJ0A 5A6LA 8FABA 1CLYH 1ZLWH 3V6OE 4LPTA 5BCAA 1HXKA 5ES4B 1NC4D 3RGVD 1R24A 4R4BB 1JE6A 3MU3A 4BHUA 2XICA 1M71B 4AXWA 3CFDA 1MCDA 1ZEAL 4NAQA 4U6HB 1GCFA 1U8NB 3M88A 4U33A 3RNQB 5H8DA 1RCYA 4OZHE 4OVUA 3P3YA 2A1WH 4PGBA 5H4YA 3CN0A 4GINA 2VMJA 4KFMA 4OJCA 3SKOA 3U2IA 5ESVA 5I0YA 1BBJB 2AS5M 3LZPA 1QZ1A 1UA7A 4OZIA 3WMSA 2UZYB 2JB5H 2N7BA 1S7TB 4OZGA 3MX0B 2CDEA 3X1BA 3ERXA 5BOJA 2XPGA 1NJ9A 3MUHL 1A6AA 4LGSB 4O9HL 4F9LC 5JW4Q 2GUOA 4KQ3H 3RVWC 4FADA 3IDUA 4Z7QF 3B6SA 3ETBJ 1IBHA 1KGYE 5HHME 5AVZB 4OSUL 4NCDA 1W8EA 5I0DA 4X4ZA 2OLDA 1FIEA 4WO0A 4S2SA 2EVIA 4CSTA 3U0TB 3OKKA 1Z9SA 5CEZH 2IDFA 1SJMA 1WE5A 4OZIB 3W9DA 1HH6A 3ZMEA 3CH1B 4BA0A 2Z35B 3KBEA 1U0QA 4KUZL 5IEHA 3SKOB 4LCIH 3VRLE 1JDAA 4ONFL 2LOEA 4U1KA 4OI9A 3EDJA 1TO4A 3WXWH 3ATAA 5BS0D 5HHXL 3LIZA 3O6ML 5ACLA 2FIKA 1OOAA 2PCYA 1SEQL 4QT5B 1BQLL 3FT2A 3QUKB 2MJWA 1VZHA 3B7RL 1ZVSB 5BO0D 2H26A 5I16B 3BVWA 3KLDA 4FYSA 1I7TB 5ID1B 1XWVA 4KZ0A 2CBPA 2QFRA 4XMVA 3FTGB 2ZX7A 2NLJB 4U0QB 3A6OA 2L4OA 3LH9A 5AWNL 1LVEA 1OXYA 4KQ3L 3SGKA 3VFSB 1J8SA 1O6SA 4ODHH 1F56A 4OJEH 3L3KA 4ZW8A 2DBJA 3ZT7A 4DAGL 5AVSB 2ZUUA 1F4YH 2A9NL 1U36A 4RAUA 1OP3H 4BKSC 2NCMA 2QPFA 2NXZB 3DGGA 4W9DC 2ZF9A 3QHZL 1IQWH 4KKQA 1PVHA 3LX9A 2WSPA 2NXZD 1A6UL 3RIFK 5ITBH 3MXWL 3MJ6A 2YPLE 3UC2A 1PLGL 3LH2H 4IBQA 2DWEA 3E8UL 1G84A 5CU9A 4CL7A 2VCOA 3O2VH 1XBDA 1ZT1B 4HS3B 5AKVA 4PS3A 3NOIA 2NY2C 3FU5A 2E9IA 5JDJA 1N8ZA 1DBBH 4G5AA 4KHTH 2CIIA 3VAEA 2X12A 3FTWA 3RA7L 1HOCA 1X9QA 1HZLA 4NKIL 2APWA 3KR3H 2HJLA 3CFBB 4KI1A 2NNXA 3H85A 4ZPTB 5DJ2B 5ISZA 2BVEA 1DJHA 3DROB 3IXAA 4EOWH 1U8LA 3BUIA 3DX2A 4OD2A 3BUPA 4X7SL 4A6YL 3K0WA 4NQXA 3SQOL 3R06B 1AJ7H 4FQXD 1TSRA 2CK0L 3QZPA 5FAAA 5B8CC 1J0ZA 4BJLA 1LEKB 1B0GB 2BP3A 1GJIA 5GGUA 1MREL 2EKSB 3OHXB 3B2MA 1YAIA 4GP5B 1SXNA 2Z34A 3BVVA 5CEYA 4F2MB 2QVFB 4ZUTA 3O0LA 4PJAE 4TLTA 4HALA 3MA9L 3Q8EA 4R4ND 4MAYA 5E8DH 1YA5A 2X05A 2JVUA 1JZ2A 2EIEA 4GRWH 1R3JA 4MMYB 3QDGB 4P5MA 4JFEB 1PLGH 3JZYA 4JRXD 2V9RA 4ZO9A 4Z3EA 4NFDA 3CBRA 4YO0B 4I0PD 4L3CA 3K72A 1QLFB 5FO9A 3VRIA 3MJ9L 1L9TA 3IJHA 4GLRI 1IEAB 5KOMC 1RZGA 3WY3A 1L9QA 3MRPB 3CC5B 4B9ZA 2YOAA 4LRNH 2K6WA 4FEMA 4M8VA 3A21A 1O5DT 3RY6A 2Y06H 2FEDD 4AL8H 4LL9A 1IAMA 3ARUA 4BXVA 4RA3A 5K9OB 3ESPA 3M1OA 5GS1A 3R1GH 3ZO0A 2FX7L 1IAIH 5CWSB 5EO1A 1EUTA 2WK2A 2R8SH 2NY2D 1KGUA 1Q9OB 2BWQA 4I1NB 5JLZA 3RURA 1R1CA 1T89A 4OZGF 3H54A 4FDWA 3OAYH 3ZO9A 4OZFA 3D06A 1E5ZA 2NXZC 2ED8A 3OAZH 4ZUVB 5EIQA 1WTGT 2YD1A 1DL7H 3ML8A 3FO2B 1J0HA 4AC4A 4U3HA 3MN8A 1J10A 2YAQA 2PXYA 2WLLA 4X8XA 5F88B 1VADA 2YAHA 1UEYA 4JBSA 4NO3B 4DP0X 4YMPA 4HKXB 3C5ZD 4KC3B 5IR1B 5F9JA 2ALWA 2A74C 1ECZA 4AVKA 2QQLH 1TKWB 2AV7A 3Q2CA 4MBOA 4L23A 5DR5H 4HAGA 3TJHD 3MXWH 4H0HB 4GRLA 1E28B 5GS3A 1X5LA 5BRZB 1IBBA 4PJIF 2EVGA 1NAMH 2WXPA 4XMLH 5MP6H 1F4XL 1GGCL 5MEOB 4U3CA 2VZSA 5C09B 3KPSE 3DX4A 2Y1AA 4MBRA 2NSXA 1E4KA 1OAJA 4K3GA 2ZUYA 4Y2OB 5IBLD 1S3KL 4BQ6A 3PAYA 3ZHKA 4HHAA 3D69B 1KN2L 2H0JA 2EXSA 4UAOC 3BH9A 4QXGL 2O5ZH 3ZDZB 4HCRH 4XP5L 4G11A 2DYSB 4JKWA 1SLVA 3JXAA 3SYQA 5JHDA 4EQ3A 3A67H 3SZKC 1BM3H 2I9LA 5F89B 4YXHL 2VIRA 2CGRL 4OKVB 1UWGL 2QQKL 3FSOA 3O3EB 3QYNA 3NCJH 3RVWD 1AD9A 1OPOA 1KN4L 4NC1E 4D9LH 4UYQA 3MRJB 1XCTB 5JW4R 2VW4A 4X2UA 2G9KA 5DXWA 4AQ1C 1FRGL 3CX5J 1OP5H 3RL2B 4HJUA 4OQTL 4G1MA 4LFHG 3OSKA 4RWHA 4M6NH 2G2NA 3WE6A 2WUBL 3I6KA 5D2NE 1E2VA 3SOBL 3T2PA 4PM1A 4ANWA 1N5AB 1MCEA 3QAZB 1N6UA 2QV2A 4G7SB 4GYBA 2APSA 1CLZL 4PAZA 4AUYA 4JRYA 4F7PB 4JO4L 1HJCA 4ODUA 4MMXA 3MROA 4HZ1A 5JR1L 3HB3D 5JIMA 3MNWA 4Z0BL 2D8KA 2QSCL 5EOCH 4ZSOE 3V5DB 1HL9A 1A21A 2VR8A 1UM4L 2EEBA 1KIQB 4ZAKD 4ES9A 4Z7WB 3A67L 3SKNA 4JAMA 4UT6H 6PCYA 1I8UA 2C9XA 4HUVB 4DP4X 2O93L 5LNDA 1DQTA 2XQYG 3O45A 4TQHA 4P2OA 3VI4B 1NDMB 2R4RL 5CFAA 5IQLA 4A2LA 2XZZA 1SJVA 4UQCA 5HGHA 1GGBH 2JKLA 2IALA 3EO0B 2VDQB 3NEEA 3SCMA 2DYRB 4TNEA 2XTJE 2Y5QA 5K1JA 4AGPA 4N2NA 3VDAA 1LEIB 1MCHA 4JDTH 4F20A 1WG3A 4ZFQA 2NX5B 3ES6A 2G9HB 2ROYA 5J1TC 3W5MA 1VFUA 1SJHB 3KLLA 1YLBB 2ENQA 4TV3A 3SDXE 1KXHA 4D9RE 1M9SA 4H0GA 1K4CA 3KDMA 4Y4HD 1BAFL 2QL1A 4XMKL 5F7KC 5GRWA 3T04D 4Q6IA 2WUCH 2X1QA 2F53A 4Y4HC 5ADPH 5LWYL 4WJ5B 3BWAA 4XXDA 3Q3GB 2X3AA 2DIBA 5TK2A 2P42B 4LOEA 1JJUA 1KACB 2DEXX 3RJDA 2DQIH 4HUMB 1OM3H 1OAQL 1KPUB 5CF3A 2YPKB 2JJWA 4LLVB 5FHAL 2EH8L 4U1IA 5I66A 5DVKA 3OR7B 4JDVB 2VLKD 3QW9A 4N8VB 5IM7A 2FB4H 4Y4KD 2JFCA 1ADQH 3ABGA 1A64A 4OGQC 4EIGB 4GIAA 1CFSA 4EI5A 1A7NL 4TLUA 3A4DA 4PG9A 5E6IC 1OHQA 3MBEC 4NHCH 5GGSB 1T0NB 2M1KA 2H2SD 5CZKA 5DRNA 5LCVH 3FU7A 4QHUA 4YHOL 4LAJH 4UT9L 5D5MB 1BX2B 2FYVA 5I82A 1BSIA 3LNHA 3NCJL 3QNZB 4LIQE 2F5AH 1AP2B 3GDCA 4A7VA 2ZWKA 1A2YB 2XQYK 2J8OA 4BGLA 1NKRA 1QO3B 2ATPB 2LW3A 4OQTH 3CPUA 1WAPA 1USZA 5DJAA 5IJCC 5EB9A 1XZWA 5F7LB 2HH0H 3FFCE 3ZTJG 2GBUA 1B3JA 5DMGD 4DP6X 2Y7OA 4PRID 3PNWB 2H1XA 2VMEA 3V55A 4GLRH 2X4TB 1F3JA 3MUGB 2MSPA 1H5BB 2A6DB 3QCTL 3T5WA 3U2SB 1RZ8B 3MBEB 4XZ4A 1YQVH 5EOCL 2VW7A 1KYUA 1AXTL 3VXSD 1INQA 1JGEB 4KK5D 3FSWA 5EU5B 3DDGA 4ETQB 5HPOA 3IMTA 1VFMA 3GLEA 3M6DA 2DICA 3BP5A 4HIHB 1SXAA 2E6JA 3NCBB 5DQJB 5IHZB 1YEFH 1JPTL 3NIDE 2DL2A 1BOGA 2BW5A 5KVDH 5DSCB 1TVBB 3Q2WA 3I85A 4PJAB 3FTUA 2ZKXA 4BH8B 3S5LG 4LQFH 3MV7D 4H1LH 4PCTA 2DLFH 2YA1A 4H8PA 1K2DB 2VOTA 4JQXA 1R24B 1BWMA 1KMGA 1YN6B 4ZMPA 4KFZC 1NIBA 3VQMA 5FYKD 1GIGL 2GT9B 4BSVB 4F7MB 4Y4HB 4J4PA 4KKPA 1N3NB 4L1SA 1NUFA 1IGFL 3LHAA 4HWUA 5A2KH 3T0XA 2X4PA 2GTQA 1XD0A 4G9DA 3KEHA 4YH6A 3VFWA 2FWOA 2IPKB 3IJ8A 3DXAD 5DVMA 2EDEA 3G04B 3VFNA 4MMZA 4NI3A 3SE9L 2BS9A 4PGCA 2AVFA 5DMGC 1YEWA 2HRPH 3TPUB 1UYWH 1GTFA 4RAHA 4F9LA 2AK1H 3QIBB 3VXRB 1RK1B 3BCFA 1TENA 3H3PH 1J8KA 3FFDB 3FOMB 3KPNA 3TWCL 4JGJA 1U93B 1RZPA 4GW5A 4IJ3C 4AQAA 3G5ZA 3VD0A 3B4NA 5EWIH 1PF3A 3LOWA 3FHQA 1U2HA 3G6DH 2BC4A 1UKSA 5K93A 3MO1B 5BVPH 1IIIA 2HG5B 2QLYA 1I3VA 2XZQH 3B9EA 1G7QB 2HLAB 5J11B 1OVZA 1VJSA 2H6PB 4WFGD 3DURB 2PETA 1C08B 4L05A 3CHRA 4PBVC 3LY6A 3JWNE 4ZRGA 2V17H 3ZL2A 4JM0A 4ZFFA 3BAEH 5EU4B 5DDHB 1BLIA 2BSDA 4ODVH 4RGNB 1AGEA 4M61B 2NUTA 1ZHNA 3EJPA 4N8VG 4EXPX 2XHNA 1DQJA 2FEDC 4H8UA 5I9QB 4V1DB 2A2QT 4HF5H 5D7JA 2CCVA 2D3LA 3DK2A 4Z8FL 1IZKA 4P0DA 1QTSA 1F4WL 3ZRFC 4A37A 1UYWL 3TCTA 4Z7IA 4YHZL 5J9PA 1SQMA 1ZTXH 5JHLL 3L7FA 2EAEA 3FMGH 3UBXA 1FH2A 2WKLA 1U3JA 2Y6TE 3QEHB 4Z7VF 5KN5A 4QMEA 4I2XE 3QEQA 4OBSA 2VM9A 2PCPA 4IOFD 5J11C 3II2A 4PIBA 3RJOA 3UJTL 5SWSD 1R34A 4XNYL 4JO1L 2VN4A 4U1JB 3WNLA 2VXVL 4GFTB 1NGQH 4JR9H 3MOQA 3MV8D 4FKHA 4TNWF 1G9NH 4NCC1 2OSWA 4MJ5B 2HKHL 5JPMC 2TRYA 4MX7B 4NXSA 4GSXA 1BQHA 3VI3E 4EDXB 1WDAA 2CJUH 2K6YA 2EDNA 1T20B 4IK7A 4NDMA 4BH7B 2WVUA 4YX2H 5PCYA 3GDBA 4LQFL 4NNYB 2BDNH 1ZLUH 4ZW5A 2CA3A 1CLOH 1FGVL 1KJ2A 4E41A 5F7UA 2BVOA 3KPOA 4J8QA 4NQDA 3DV4B 4F7EB 2O6CA 2R2BB 1GW6A 2YQ2A 3BH8A 1OAKH 1HDMB 2WKOF 1GMEA 1UJTA 1UJ3C 2KZWA 3AXLB 1QFHA 3CDYA 2VITA 5GSRB 4ZXBB 3RHWF 1TJIH 4A7UA 5E8EB 1RPUA 3QJQB 3INUH 1RZKH 5FIEA 3MLXL 4YVNA 3KYMA 5GGUB 3BEVB 4WHTA 3VXNA 3ULVD 1T66D 3MLYH 1AQKH 1XGTB 3APMA 4QOKD 1JERA 4Z7UB 3OKKB 2XKNA 5HPMA 2WIIB 3W0WA 4JY4B 1XCWA 2LTQB 3EOBB 4YLBA 3RZCB 1ZHBA 5FF6A 3QZMA 2CDFA 3TH4T 4I87A 3SPCA 3U9UA 3QDGA 4IIQA 2XIBA 3FQUA 4Y2DA 3TEWA 3NCWA 4HWZB 2FWUA 2VDKL 4BK5A 3LN5B 4OZFG 3BVNB 4DQOH 4NKDB 1DVXA 1HH9A 4HGKC 4H25A 3QNXB 1NFIB 2YOCA 2FO1A 4E9QA 1I85A 3BHBA 4HWBL 4WUUD 2Y07L 1HE7A 2WXMA 1T22A 1Z9MA 4NKMB 1WBYB 4ADGA 2CLVA 4W81A 3FONA 4Y19A 1II4E 2GBAA 2P8LB 2Y7LA 3FTYA 1E7VA 3EJZD 4BHUI 2JKSA 3S5YA 2WIIA 2X38A 3W0WB 4NQUA 3ME0A 4E5XG 1T7VA 3HTLX 4OZGB 1RUAH 4EUPG 1OCWH 1XXDC 4IHOB 4H8QA 3IN0A 2JELH 5BV7L 1FYTA 4AQZA 4Q74A 2Z4QA 4XCEA 1FBIL 1GHFL 1YYML 2X9WA 4JG5A 1XF2B 2GBTA 4XMWA 4HZLB 3G9AB 3TV8A 5I6OA 5KSBB 2ATAA 3RTQC 4G1EB 3MLTB 1G7JB 5FYKL 5M7QA 3WFBH 2ZCKH 4X7CC 4BM7A 2B59A 4JR9L 2YD6A 3LRLA 2DQFB 2B77A 3SKJL 4Y8AA 3TO4D 2Q8BL 4HYTB 3CH1A 2O6PA 1XT5A 2Y07H 3T0EA 4YE4H 2XRAL 3RI5F 1X9LA 4YX2L 4LZKA 4XVSH 4JFDB 3T8MA 3U7AA 1P5UC 3QE5A 3MRLB 3C9NB 3D34A 1NBYA 3WKNA 5IG7A 3D50A 3POHA 4JANA 2AK4B 3K81A 2Z1PA 1KGIA 4NFCA 4XBGA 3FYIB 1A22B 4D0DA 1OAKL 3MOAL 3RL1A 1PX3A 4M3KB 4X4XA 4HXAH 3DMMD 2DWDB 2C3VB 2DWYA 4LLYA 4MMYA 4P5MB 2ZWNA 2JLLA 1RZKL 3NA4A 5D8JH 1TU2A 2DWXA 1JV2B 4J3OC 3L5IA 2A1WL 5ERWA 4F7KA 5CSGA 2ZKHH 1UB6B 3TJEH 2RD0A 3GSOA 3HFMH 3PCYA 3W1ZA 4TS6A 2OJEA 2XQBH 1NCUA 2YZ8A 4G43B 1ZGLM 1F8TH 2W0PA 3DLQR 3FRUB 2I7OA 2UY6A 1IQWL 3LKQB 1MJ7L 5J6GA 1NUNB 2R0KL 2V37A 3TONA 2FQGA 2ED6A 5C1MB 1A6AB 2C26A 4NZRH 2YSSA 4MA3A 3O6KL 3QBTB 2FL5B 4CW1A 3WAJA 3QEUA 2X4QB 4F2EA 3LKRB 5B1JC 4MKMA 4MCMA 1KT2A 2R1XA 2DWSA 5AUMA 3F05A 1VDGA 3A47A 3SYPA 3FUJA 5T3XH 4NEHB 5TFSL 2E46A 4A04A 2XV6B 1S4IA 4HIXL 2EC9U 4HDIA 4A6YH 4GSDH 3BSGA 1WIPA 3MRCA 3T0VA 3DO7A 1F00I 5D7LE 3RTQB 3QYMA 1MCOL 1AQDA 4K9JA 3BDBA 2DD8H 4NHUA 4ZQTA 3POCA 5C08B 2XTJD 4R83A 3T65A 3ZQXA 4AIXA 1Q72L 2XYCA 4JQIA 1AQ8A 1HHJB 1QD0A 3TV3H 2CGZA 3ZE0E 4YS4A 3JVFC 1U21A 1OP9A 3P73B 2CBQA 1OIOA 5ETUA 4RAVA 3QPXL 1BQHG 4OCYL 1WBXB 3ZE1B 5GRXG 2KZBA 2R0KH 4JRFA 2XNAB 3ESOA 4CKVX 2BOBB 1XGQB 1KBGL 4FYRA 5HDBE 1RURL 3HLAA 4LBEA 4OFQA 4CVUA 4JPVL 2X2JA 3NZSA 1NBCA 5I24A 4YEEA 4IBSA 4N6RA 4M7KH 3V8CA 2J71A 2WQAA 3KGSA 3QPKA 1ZJBA 1JWUB 3TNNB 5IY5B 1QBBA 5J3HC 3WTTA 3CFBA 3T65B 3L3JB 3MNVB 2ZCZA 5EO9A 1HN1A 2L0DA 3FB5A 3MV8B 2BO0A 4Y1AA 4B53A 1ILUA 2ZSWA 4HIXH 2NTFB 1A1NB 5D9SB 1J9SA 4LCWE 1TTBA 2LVCA 3GIZL 5IB5B 2YS4A 2XA8L 4B96A 4F24A 4R7NA 5H94A 3TIEA 4DKFL 1IAIL 2CK2A 3K6DA 1P5UA 4KXDA 3NJVA 2BCMA 3NMEA 1KXTB 4OFVA 1G1CA 4PB9L 2O1AA 4I13B 5D7HA 1J1XL 4I77L 5F6HI 1KFGA 1QEXA 1EXGA 1GR7A 5EF1A 2H6UA 4BKTC 3L1OH 2EYSA 4G5ZL 3TF7C 4A38A 5JO5B 4O2EA 1F1DA 1DL7L 2E7CA 2GW5A 3N85H 2G3NA 2WBJA 5E00A 4DGYL 4ODUB 4XNMA 3TVMD 4KNTA 2V0AA 3VE0B 1CL7I 3O6FD 2DQUL 5DJDA 5HHOB 5B39A 2AMGA 1L7TH 3FU0A 4HEPA 1MPAL 3RWIB 2XWBB 4HK0B 1FN4B 3N1PC 5IWLA 3RQ3A 2H32A 4GPVA 5MEPA 1UCTA 2WCPA 4GBXB 5EZIL 5EUOF 1T5XA 4LLQB 2VDLB 2DI8A 1JYXA 5DHVH 1LMIA 3I9GL 4FNQA 4FXGA 5D7JC 3P77A 2W1NA 1QAWA 1LO3L 2N4IA 3QZWG 4LCWA 4AY0A 1WC7B 1G7HB 2O26U 4I2XA 3BVTA 1QKZH 4N0CC 4PI0A 2BZ7A 4GIOA 2WLKA 1OSEA 5JDSB 4WUUB 4EKJA 3ZN6A 1A6TB 1GKEA 4KITB 4E0RB 4IU2B 3TA3B 4ZNEE 1G1KA 3NJXA 4ZTOH 4OCRH 1M1XA 1NCCH 4WV1C 5TE4L 3SDAA 4CJ1A 3VWKD 4MD0B 2QKIA 2WM0A 2AJXH 2JMRA 4X9HA 2QQQA 4P23B 1ZMYA 5ISZE 2I27N 3GHEL 3A4AA 3PWPD 2NZ9C 3X12B 3W38A 3QT2A 3T4YA 1R5IB 4AENB 1HEZA 3QFGA 3SPHA 3MGTB 1FRGH 4R5VA 1INDH 1CXEA 3S3SA 5BW7C 1QRND 1OM9A 1HHHA 4XPBL 3GXFA 4MCZA 1XGYH 2HUEA 5DVOA 1AR2A 5JW5B 4MNHB 1TG8A 2XWXA 3OZ9L 4K94C 3SPVB 1OLLA 2ZOOA 2O5YH 5KSUA 4HUUA 5D71L 1W15A 4DN3L 3NUKA 4JO4H 1WRFA 2WSDA 4OU3A 3HC4H 2OS7A 2VDNH 1NANH 2ZJSH 1RHFA 1XXFC 4NM4L 3X12A 1Z3GH 2GHWB 5I30H 3WL9B 4MMXC 1IVLA 1JF5A 5GRUH 3IGFA 1IC7L 1GAFH 4GSUA 3QC6X 3QDME 2OSLA 1N7ML 3ARDD 1SJEA 5ADOL 2QKSA 3F85A 4Y9EA 3AS1A 1JXDA 3QJOA 1OGTA 3BPOC 1J5OH 4JRXE 1MVUB 1TZHB 3FO0H 1NCJA 4HCRL 4XP5H 1C16A 1T5WA 1OHZA 2E9JA 1UT2A 2GI0A 2ZUXA 3B83A 5DJYB 3RX7A 5F97E 3TIDA 4GI6A 3FXIC 4FI6A 3X17A 1HHKB 4EDWH 1K8DA 1CGUA 2NXYC 5C0ND 3F7VB 1TLMA 3R4RA 4YXHH 4YN3A 3PQYD 5T5FH 3LV3A 2WGNB 5KYUA 3Q9QA 1MIMH 3QUML 1CD9B 4M7LL 5DD1L 32C2B 1ZY9A 3ROLA 2WQVA 1FFNA 2VKWA 1TVDA 3WFDL 4F57H 2QELA 5I17B 3BOVA 2FECI 2FZ3B 2H3NA 2WYTA 3FUEA 2JXMA 3APNA 1MCCA 3PWUA 1TZHA 1BVNP 4G8GB 3QNFA 5FW6A 2VDNL 5C0EA 5K59F 4Q56A 3SOBH 3KM2A 1A4JB 5I71C 1LP9B 2OMZB 5LGYA 3ULUD 1FNHA 4N5UA 3HN5A 2YPLA 4YNYB 5CJXC 5L6YH 4JDVA 3WJLC 1AGDB 3HS0A 4HZAA 3LB6D 1S9WA 6PAZA 5I8KH 1ZANL 3TURA 1E4JA 3GRWL 4MJ5A 4QRUB 4CVZB 4M6MH 4W68A 2WZ0A 5BQ7A 3GT6A 1N3NA 1UM6H 4B5ZA 4Z76A 3K74B 3R0NA 4JN1L 4BFIB 3D9AH 1ZK5A 3KPPA 2MRYA 3O8XD 3DI2B 4JVPA 1E28A 4UT6L 4ODBD 3NJJA 2XXFA 3WSQL 4A6YB 2VGLM 2Z1KA 1BBDH 5C8JB 4PVBA 1N70A 2AJXL 4MXQD 2E9WA 3EGDB 4YSCA 4K8RC 3MV11 3WEAA 3AGVA 5IMKB 3B5GA 2WTOA 1RIHL 5IR1A 2HKFL 2EXWC 3ARED 4CBZA 5FEBA 3AW5A 1MWAL 1HC1A 2PNDA 4CJ0A 4Z3IA 3CHXA 3KYAA 3TYGL 1CDCA 4IBVA 4KI5E 4HIEA 5CILH 2OXGB 2ZOLB 1Y1DA 3P40A 4JDTL 1DYZA 3F12A 4L1DA 5I1CH 3QWRD 5EFIB 5FHBL 3STZA 5BS0E 3WN5B 2ZUVA 2O5YL 5E4IA 2VLME 1SMOA 5A2JH 1YEHL 1GYUA 1FVCB 3CD4A 5A16B 3JWDH 2IV9A 5C0JA 5D1XE 2QVMA 3EYVB 4NM4H 4FFWC 2JTYA 5A7EA 3KBHE 1Z66A 3ULAB 4PW3A 6FABH 1C5DA 5JA8B 1DVFD 2VERA 2ZUSA 3FZUD 3HZMB 4PJDF 4XRCB 2NLJA 1JPTH 3BDXA 1HINH 3C6LC 4KI5D 5I2IA 5HHMD 2WO3B 2ZXDA 4WSKA 1QA9A 2C1PA 4TL4A 4WI0A 4HSQA 1BX2A 5CN3A 5JZ7C 3RIAK 3VM7A 4UDTB 1RUMH 4KK8D 3HC2A 5BV7C 3C6EA 4HEPG 1NMBH 4GMTL 3GMRA 3MRKB 4MAYC 4NOFA 3QRFM 1XVSA 4KRPC 2YGNA 1T89C 2W8CA 4IGBB 4S1QH 4QXTB 3KCWA 4NENA 3RL2A 1KCBA 3D4CA 1CFSB 4EI5B 3M17A 4LSTL 5FK9B 3ZE2B 4NNPL 1JK8A 3CV5A 1K8DB 1UT1A 4G70B 2MWCA 4CU8A 1KZQA 3LZQA 2K3HA 3CPLB 1GPOH 5E8PA 3H9YA 2JIXB 4KKCD 4OI8A 1F58H 2WXJA 4LHUD 4AVHA 4Q7DA 5D7KD 2OAAA 1ZLDA 4F33A 1D2PA 1KBBA 3JTTA 1NWOA 1D6EA 4RQQB 3HMXA 4WSGA 3NIFE 3ZKMD 3H9HB 3EBGA 5E1AB 3SKMA 3O8XC 1AYOA 5TDNA 3VYPA 2ZPKH 2OFQA 3WFEL 5BV7B 1Q0XH 1WFUA 3M1BA 5I1EH 2BSBA 3ARQA 5E6IB 3DIFA 3GJFH 2ITCB 3EYOB 3P0VH 3DMMA 5EBWA 5AZEL 1T2QL 4ZI8A 1BQUA 1N10A 3ULVE 1F3RB 3UZQB 1K2DA 4Q9QL 4AYSA 5KVDL 4M9OA 3R7QA 3QWOA 3CXHJ 2K6ZA 3BAEL 4OZ4B 4H1LB 4OF5A 4PGDB 1I7RA 4XN7A 4AW4A 1SN0A 4PWGA 3BVDB 4AKOA 3IDGB 5DYOA 2D7QA 1RIVL 3CSYA 5A2LH 2HTLD 1QSFB 1UXSB 2VLJE 3QDMB 3NFNB 3VG0L 3W2DH 1OAZH 3GXMA 4PD4K 3H7BA 4MYWB 3WEXB 5C2BL 4TKWA 3NCEB 5IW1B 1QQDB 3ATFA 4FF9A 5HTSA 4DCQA 2XBTA 1HHGB 4HPYH 2BSRB 4PLOB 4X8JA 2ZUTA 3FU7B 2VDMH 5CCGE 2WQUA 2J72A 3GS4A 3II1A 1KCRL 1FNEB 3S35L 1HKFA 4U1MA 3VSTA 3ARDC 1TQBC 5E4AA 4CVXB 1BXVA 2AEQL 4HJTA 5DMYA 1AO7D 2YSSB 4MA3B 5MERB 1EA9C 1FNSH 4MA7H 1EZUA 5DGQA 1MFAL 1G9ML 4L4VE 2QADD 3DV4A 5G4OA 1A4AA 4ZFZB 4NQTA 5ANHA 1H3VA 3GKWL 1DJXA 4ZAKB 4I1PA 5E1HB 3L6FB 2TSBA 3QJTB 4N1HB 2QPUA 5GIRA 3RWJB 2B1OA 4AV0A 4M6AA 3D05A 1JZEA 3RTLA 4HIHA 5IB3B 3DX9B 3S36X 1KWKA 5FCSH 1TJIL 2QGEA 3QQ9D 3UTOA 3CMOL 4OB5L 5IQ9B 4MDIA 3TLRA 1FV1B 1BBJA 3OMNB 3ARBB 1CVSC 2UWEB 3QNYA 3RAJH 3BVNA 1ZHLA 2NYYD 4WCYL 4BDVA 4QRQA 3CU1A 3RWCA 1JFHA 3IWUA 1U91B 2A99A 4GBXD 4N5EC 3UPAA 4ZAKA 4GW4A 4KK6C 3GD1C 2D2OA 5J6SA 1HCVA 5D7KE 2PYEE 3VUAA 3VFUA 2PP9A 3HNSH 3QG7L 3GI8H 4KJWD 4TTDC 3G9VA 4JJ5B 5DJ0B 4NJ9H 3C9NA 4FI7A 2VN6A 3TH3T 1NMCC 1JV5A 1KBVA 3MGAA 3O41A 4PJ9D 2GIYA 3LHPH 4HKXA 2BP5M 4X6CB 4X6FA 4LL1A 5LCVA 5JNYB 5AB0A 4X8CA 5J5EA 3QDJB 4LFHD 4N0CD 3DOIA 1D6VL 2OX5B 2JF1A 2F54B 1CFQB 3VRLF 2R59A 2OMTA 3LCYA 1DQLL 1TTGA 1RL1A 3SBWC 1KGJA 1DDTA 2X3CA 4HH9B 4IRZL 1FGNL 4JM2B 3PGFH 4D7PA 3O3AB 4CMHC 3BN3B 1KCVL 1DCLA 3FB8B 5EEZA 1KG0A 1VZIA 2NY1C 1DJSA 2FBJH 1B4TA 3O9WD 3K6OA 4P23D 3BIKA 4KY2A 3CDFA 4NDMB 3O4LA 3CZKA 4NWUH 3VFSA 4GS7C 4N90D 4B7LA 4MRBA 4LL4A 4FQJL 4X7TA 4D2NA 2VDPB 1UQSB 3JWOC 4GP8B 2FE0A 5C2BH 4YSUA 3P4MB 4JZOB 3BN9D 3GMNB 4MA1B 3HUJE 1IJ9A 4B9IA 2VDML 3CMGA 1A9EB 3IEAA 3NJKA 3LPFA 1KC5H 2WCSA 1DDHA 3DRQB 2B0SL 3IKKA 1BZ9A 2Z7YA 4XVUD 5IWLC 1X5GA 4XHJC 3HG1E 4PWJA 2DQEL 1A7QL 2XN9D 3FS9A 4ANVA 3ZE1E 5ACZA 4CMHB 4XPFH 2BOCA 3HUJB 2V33A 2OTWA 1YYLL 4OF3A 4KTEH 3QHFL 1MNNA 1RK7A 1WVZA 3PGFL 2FJGB 1EAPA 5IVXF 1MFAH 2NY2B 4ZK8A 3EDDA 5BUPA 3ARDA 4CKQA 5E1AA 3RU8L 1XIWD 4HWZA 2A77L 3UO1H 1ICTA 2NPLX 5C0BE 1WH0A 4BFOA 2BWDA 3T4AB 2D0FA 1C9SA 3AFLA 1UB6A 3BP4A 3H9SE 1GA2A 4U49A 4JDEB 4PTUA 2EEDA 1A8ZA 5ERWB 1D7FA 3BYTA 2ZG1A 3UJIH 4HU8A 3RZCD 3AT9A 1IO4C 2ERJC 5DK3A 3VFPA 5KW9H 1GZPB 2ATKB 4RIRB 2LFGA 2C9UA 2IMMA 1OE2A 4KY1L 5IHHA 2XTJC 3L08A 1ASOA 2ENJA 4P2OB 1NAMB 4PPTA 3RGVA 1G5GA 4WUKL 4BZ1L 2J5LB 1JNJA 3VXSA 1QG3A 3GSNB 2ENSA 4Y7OC 4KDTC 3WYRA 1P4UA 1BJ1H 1SM3H 3NP3A 1HTYA 12E8L 2GUYA 4GAJH 2ESVB 1VAHA 1Z6JT 4JCMA 1WS7A 4YWGL 3GXUB 3V2AR 2Q2EB 2ZG3A 3ZT5A 2EJ1A 5I1GH 4JFDA 2YSTA 1DQMH 4ZPVB 5LN4A 3E6FB 5IB3A 2BHFA 3L95B 1KCUH 4TRPL 1NC2D 1MG3C 3J7HA 5AENA 2X4RA 5HBBA 1BD2B 4P2RD 1JYNA 4A2MA 4A67A 4NBYB 4NQDB 5AW7B 4FKKA 2DKUA 1KLGA 4ZOEA 3KGTA 1RY7B 2CHWA 3QRGL 5T3ZH 4WWKC 2MOGA 1I3RA 2FQDA 5CWSA 1ADWA 4FCHA 1T4KB 4PEEA 1S7QB 1NAMA 2WWKT 4OTXL 2H2PD 1RFDL 4WHCA 5I71B 1GJWA 1A0QL 4C56B 3VH8G 4OIFA 4PUBH 5T5FA 4JM2D 4YBLB 3TN0C 3MUZ1 1SQ2N 4XODA 3CN4A 3F7VA 1SYVA 3O11A 4X5WA 2X5PA 4HJ0D 4ZYKB 4WU7A 2QFPA 2I26N 4X9IA 5J6GB 4JFHE 4YWGH 2IANE 4KQ4H 4G8FA 3KMDA 1SDDB 2F54E 3UG5A 3N06B 3EYUL 4YK4C 1ETJA 1GC1H 4WFEE 5FGBC 3CZGA 3BVUA 5DEFA 2V2XB 2UXGA 2G3ZA 2P7TB 4XPFL 2PWEA 2DDQL 3BHBB 3D2UA 1U2CA 5CN1A 3T4AC 5IMMA 2WN2A 3FQ4A 3B9KA 4Y5XA 2G60L 1C8QA 4LCIL 1J48A 3ULVF 2GK0B 4Z23A 1J7VR 1X5AA 2X6AA 2Z8RA 3QJHA 2NY7L 3WXWL 5T3ZL 2XTSA 4L9LC 4H2CA 5C0DA 4UNTA 1XR9A 5AB1A 4X0KA 1UZ6F 1JDDA 4R5XA 5FS5A 3OQ3B 3UZEA 3WMQA 4PSPA 2DRUA 3KWWB 4CADA 1J1PH 5DD3H 3WN5C 3LNIA 5AW0B 2NUPB 2XUWA 5IZ7A 2BNRD 3ELQA 5DF0A 1MQKL 1RSFA 4PJ9C 4PBXA 3UAFA 3SDDC 4BK4A 1SOXA 2Z7WA 3PDDA 2X9XA 4KZEL 3G5ZB 1VZGA 4TNWK 4G5ZH 1CR9H 4PS4L 1ZVYA 1A5FH 4QLRA 4CGTA 4XT1C 2BS8A 3G5YA 2C9VA 3CBJB 2VH5L 2E4TA 1ZLSL 5DJXA 3TXAA 1BQKA 2ARWA 3IRCA 2LU5A 5SX5H 4Z78A 5A7BA 4FEIA 3NVQA 3SE4C 3UBXI 2ZE0A 1C5CH 5E6YA 4FQ2L 3AWFA 3HE7C 2BSSA 2UXFA 2M26A 1XSKA 1GY1A 2GFBA 3S0PA 3Q13A 4N25A 2OMYB 2F54D 1PYWA 4JHAL 4NBZB 3OB0K 1MLCA 2QLVB 1NCHA 4NKIH 4UMGA 1KCUL 5BNXD 2A83B 3EYVA 1BFOB 4JHBA 4RLDA 2B9BA 2BXYA 3O3BB 1P7BA 3NJMA 3U46A 2EICA 1EO7A 3U0TA 3UTQB 3FT2B 4PYGA 4U1HA 5DHEA 2ZWSA 2JV6A 2VLRD 3L5WA 4ELMF 1FUNA 2VDLL 4OD2B 1IGIL 1Z2KA 3L7FB 4NRZA 3D3VB 5CCKL 1X4YA 5I2IB 5CEZD 4NQQA 1H3WM 1CF8H 2R1WA 4DH2A 1NFDF 2ZOUA 5CGYD 3UG4A 1EHAA 1ET8A 3W0WD 3ZDYB 3GGWA 1GS6X 1G7PA 4R7VA 4XH2B 5C0RL 4LVHB 3TBSB 3ISWA 2BVQB 1GYAA 2XYBA 3FRUA 5J6HB 2CJTA 4FG4A 4NI6A 5JOPD 3SDCA 5FFLA 5CLTA 1TITA 3RWFA 1YY9D 1XGYL 4LCCC 1DEEA 4QHNA 1FHNA 5L8JB 4QRUA 1TJHL 4DGUA 2HTLC 4PHXA 4YDZA 1LXMA 4XP9L 1HOCB 3UPRB 4HX1B 1WAAF 4JREB 4D9QE 3QUZC 1C7TA 4MDJA 3FUMA 1OARH 4JZJA 2H1LM 1JGDB 1AG0A 2AKRA 4ZDHB 1BXXA 5DUBA 1FIGL 2VDLH 3FCSA 1AO7A 4WW1A 2DWEB 4UINH 2V5TA 3WUWG 4UILH 5DJCA 4M9PA 3MLUL 3NFSH 4I3SH 4JFPB 5FCUL 3U1QA 3VTAA 1KF9B 1FSKC 4QCIA 4QRSA 3RKDD 1L0QA 1UZGA 4ZFOB 2J73A 3ROLB 5F7DA 3L3IA 1FG9C 2V3EA 5C07D 3NTCL 5C07A 1DSWA 4GAFB 5GZOD 4PJHF 2Y7NA 1UFUA 5IB1B 2DM4A 4R90H 4XBEL 1IUZA 4N1CA 3HBZA 3X1FA 4EN2A 3ZYOA 4XTRC 3QWNA 5E94A 1CMOA 3N43F 1LP9A 1ZDSA 1F5WA 3RBSA 3IDNA 5F7MC 4RSYA 1BXAA 1N0LB 2VDRH 1LK2A 1H15A 3IJHB 3KNBA 3V0VB 4N0RA 1EJOL 1JTOA 1X9UA 4LKXA 2K8MA 5GGTH 3F7LA 2VC2B 2YARA 3BPNC 5KSAD 1NAML 3T0ED 4XMLL 4RRPG 1OARL 1E27B 5F3FA 2I5YL 4RGOL 1D2OA 3E6HB 4YSEA 4HCFA 1CBVL 4UZGA 4ESKA 3AVEA 5KBLA 4J5VA 2QZ5A 5DQJA 5D9SA 2YFNA 5I6PA 3QA3B 4UILL 3EYQD 1P7QA 1FH5L 4LLWA 5JHMA 4BRJA 2GABA 3ME0B 2DMHA 5C6TH 3LMJH 1QFPA 2DPKA 2ZP0T 3NGBC 4PJBA 3SPVA 4NP4H 2NT1A 5JTWA 4N2BA 3L9EA 5EU6D 2D9CA 1JHTB 1KEMH 1RI8A 3K2UH 4OZFH 5CGBA 1AH1A 4P8QA 3LEXB 2HVJB 4K3JL 4LLMA 4LEEA 4UTAH 4FQXA 4IBTA 3JUZA 3WNIA 5T33H 5IMOA 3PHAA 4D9LL 4BFJA 4FFWD 5D4JA 1NFDB 3CSBA 4LSPH 3K8KA 4I3RL 1NCNA 3C60C 4KKLC 4LHUA 1KPVB 2WY3B 3DBXB 1HK6A 4OD3H 1PEWA 4DKEH 2H45A 2VQ4A 3MRJA 4M6NL 3NIDB 4WAFA 1GJUA 1ZDQA 2L7QA 5C0EB 5EBLB 4UIKL 4KROC 3QJXA 4I0PA 4IU2A 2XFXA 1P84K 1Y6NR 1KB5H 4G6FD 5LBSL 4ZMLA 2AK4A 1JMZA 4OI7A 3GIVB 5A2BA 3LJ3A 4PREA 1QWUA 5KVGL 4LKCA 3F58H 2AQTA 4MHHI 1TETL 3EUUA 2Y5EA 1XH0A 1FDLL 4FXKB 5GGRY 3RBGA 4UM9B 5LNGA 4AYBA 4L29B 1X5JA 2P80D 4DZBA 1NFDA 1SY6H 1TZGL 2VLKE 2FX8H 2VLLB 1MDTA 4DTGH 2NY0D 3MLWL 4XXCC 1IKNA 1UH2A 3FB6B 2Q7NA 1P1ZA 1PKQB 2J55A 3MCG1 2P24A 1S7UA 4I5BA 5EBLA 3TFKC 2IH8A 3IMSA 4FAAB 2HRHA 3OLDA 3PU7A 1XR8B 4LVEA 1HWHB 3BPNB 4N0YL 4WUUE 4KZDL 5HJBA 4TUOB 3NRFA 4OFIA 2V5RA 4LSTH 5KSAB 1XH2A 1L3NA 4D9RD 1VA9A 3BKMH 1R3IH 3NPSC 4NNPH 3JSSA 1T1XA 4LSUH 5CINL 2BNRB 3EIFA 1P7HL 3QRBA 1NPNA 1MVFA 5DRWA 5TDNB 5JW3H 3BLBA 1KTBA 2BNUB 2O4EA 5IROC 2FD6H 3G5VA 1JWSA 3QI9D 5DJ8B 2H9GA 4NN5C 3THMH 1NCIA 3F58L 1U8OA 3GXNA 4G7VH 3SGDI 1NC2B 2XVLA 3V0VA 1JPSL 43C9B 3VXUD 2EIDA 4PGZA 1OF2B 4Y5XC 5E8OB 4M8RA 3GBLA 2EDQA 4X7EC 4KHXL 1NCDH 5AOIA 1OSPL 1Q0EA 1S9VA 2B1HL 5FO8A 4Y4KC 1SJXA 2DS4A 1UZ6E 5JMRA 2YA0A 1RHHB 2PYEA 1WBZA 3ZTNL 3RWJA 1NEPA 5A2FA 2XTJB 3QDGE 3HI6L 3MCLH 4UT7L 1BQRA 1IIKA 4G8GA 4R2GB 3ARGD 2Y4SA 3N40F 5HY9A 3VI4E 4G9FB 1N19A 3GSUB 2OMVB 5DJCB 1NINA 4D9QD 1YNLL 3BXNA 2JK5A 32C2A 1I7ZA 1QSEA 3KG5A 1R3HB 25C8L 4WHTB 1RJYB 2VRAA 4OZHF 4WY7L 1SXBA 4H44C 1KPVA 1WIOA 3HAEH 3KH4A 2D3JA 5F9WC 1X5MA 3EJUA 1FNEA 3MV8E 1A6UH 5CIPB 5D4HA 3NIDF 5ITBL 2IH1B 4N68A 1BVLA 5FM5O 5L7XH 4LDEB 2RACA 4WDIA 1YZZA 4HLZH 5IB4A 4XVOA 5BW7A 1KJ2H 4LSRL 5E7FA 2HMIC 2JQMA 4UB0L 3ZYZA 1CDIA 1WBZB 3BQUD 4TVUA 1RQ5A 3GNMH 4A2GA 3MREB 1HJBC 3UTTE 2ALAA 3QIWA 2Y7QA 4O5LL 3TCLA 1YEFL 4K3HA 4PRAA 3KYKH 5K39A 4E42B 3B7YA 5CHNB 1T3FB 3CFMA 4NQEE 3WTSA 2PPFA 2B5IB 4W4NA 2IPTL 2GSIA 4HKZA 3DECA 3IDYB 1W72L 3IE4A 4KKRA 4FNUA 2J5WA 4TM9A 1E3ZA 1VIWA 4ZMOA 2YWZA 1FHGA 3LPGA 4TVPL 5DUMH 3HMWL 5LNEA 1CL7L 4QRPB 3ZR6A 2DLEA 2X3BA 5DQ9B 3RI5K 3P2TA 2VDMB 2W91A 1KJVB 5BMFL 1FNAA 4HUKB 5F9JB 3G5WA 3IFNH 1AGBA 4X0NA 3I9PA 4P9HC 5GRJH 5FA3B 4FP8L 1ROWA 1HI6B 1TDQA 1RVFH 3OKOA 4JJ5A 3D12B 2YKLH 4LSRH 2Y7QB 1C8PA 4LK4A 4XCYA 4DO4A 1M7DB 2WAQA 4FQQB 2X4TA 2X44D 4GW4B 4NYLA 4H20L 1Z9LA 3H4FA 3O2WL 4WI7A 1T2JA 3DVNB 3TVMC 1XB3A 5D70H 4YSPA 43CAA 4ACPA 4HH8A 4Q14A 1DLHA 4FA7B 1A6TA 1BD2D 4F8LA 5F1SA 2O30A 3IJYB 2EEFA 3ILQD 3F62A 4L8DB 4P4KC 1EHXA 4JFZL 1FG2B 2EIKB 3JV6A 2VLMD 2TAAA 1DJIA 3L4UA 3NZHL 3MYJB 4OCLC 5CD3A 5I23A 4FLQA 2BNRE 1S3RA 1CU4L 3SBPA 1TEYA 4JQXC 1MHHA 1CGVA 2X6BA 1D6VH 3CQFA 5HP5A 1SDAB 4JHZA 1GS8A 3EO9L 3RJQB 1ID2A 4IRZH 4L9LA 1KNOA 1RV6X 2DI9A 3V4PL 3KLKA 5HYSA 4K5NA 3DVGB 1TT6A 2IGFH 5IG7B 1UUSA 4ZO7A 4U1LB 3ECUA 3APDA 1GZPA 4X0KB 3UBXB 5IEHB 1S6NA 2W95A 2JJVA 5TGBB 5J3HD 1TO5A 4HMDA 1UQSA 5F0MB 3GKWH 3DWTA 3MYJA 4R7LA 2F1BA 1QFUL 3CXDL 3GEFA 2FEEL 1MAMH 5DC0A 5FV2A 1ASQA 3HG5A 1UC6A 4OZHB 5JQHC 1M2OA 3NJHA 4M62L 3I3BA 5IBUG 1Y18B 3KPTA 4MZIA 3NABL 4DPRA 2H32H 4MQTB 4AG4L 1NANI 1EWHA 4G43A 5EZOH 3BPCA 4QHMB 2HFEA 1AS6A 4OZ4A 1FVDB 3WIHH 2VMFA 1K5NA 4H8HA 3F6IA 1RK0B 5D2LF 2N56A 4RFEA 3KYKL 2D7MA 4EZKA 3SDYH 2WMPA 1D7DA 1IGTA 2YPVH 3JWDC 4Y5YB 5CJOL 3HNSL 3CXFA 8FABB 4HBQA 5JOEA 3D8MA 2WXFA 2GFBB 3GJEA 3V7AE 4WWID 4GW5B 4AQAB 3FCUB 2DKMA 4LPYA 4N2DA 5FXCH 4P2RE 2AGJL 5GRZA 4FQHB 3CXHK 2EIZB 3PQYE 1XAKA 1Y18A 3CXDH 4I9WE 1YECL 2NY3D 4J6RL 1U8KB 1M2VB 2OMWB 3MRBA 4MXWL 5I0VA 2FHCA 4ELMB 1UA6H 2LABA 4J2XA 2VDOB 2Z7ZA 2X88A 3QVAA 2DQDL 2XXCB 3MLXH 3HHMA 1HL8A 4F58L 1BREA 4P99A 3GRWA 5I1DB 4BGDA 4LSSL 1DANU 2WLIB 1PCSA 4M5SA 2VR9A 2JJTC 4YR6B 5DTFA 1CN4A 2DYPA 1LWRA 2X9ZA 4XO5A 3KS0H 1AGCA 4I4WA 4WI4A 4JY4A 5E6ZA 1NAKL 2F74A 3BX7C 1FSKB 3MCKB 1S7VA 3QUXA 4FQXC 4NOBA 3FQ2A 5CBEB 2VAAA 4OGXL 1VFOA 3T09A 1B4JH 2D0HA 4JFTA 4HIJB 1NGPH 2QPSA 1J1OH 1IC5L 4BFEA 4DKAA 4DP2X 1IKFL 1WD9A 2EDJA 5I1DA 3MUUA 1NUDA 5F0PB 2FSDA 4K23H 4BZ2H 1YECH 3EH2A 1HL5A 1Q90A 4J6RH 1XF3A 4YXKH 5L9DH 5EORL 4UM8A 1EZSA 4YQXH 1QLEH 3MJGX 3V5HA 5HYFA 4XNDA 2VLJB 1I1AB 2Q10A 2C9RA 5FYJH 1EZVX 2FLBT 2VLRE 4AEHL 2B1AH 4A7QA 4FA6A 2MQ3A 1ITCA 2FYYA 3P4NA 4V2CB 3TO4C 4GI9A 1EX0A 1PG7L 3OJMB 3AABA 4M48H 5GSVA 4IOIB 3VGGA 4PUBL 2V2XA 3G6AB 4TSAL 3X13B 1U8CA