2K8MA

S100a13-c2a binary complex structure
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
128
structure length
128
Chain Sequence
EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title S100A13-C2A binary complex structure-a key component in the acidic fibroblast growth factor for the non-classical pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Putative uncharacterized protein
total genus 21
structure length 128
sequence length 128
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2k8mA00
2K45A 3NZUA 4L2YA 3F01A 3HN8A 4PS7A 3IBEA 2Z0UA 3L16A 4L1LA 2A4ZA 4QJ3B 4WEEA 2WXGA 4URKA 4A55A 3L4CA 4OVUA 4WWOA 2K8MA 4MJJA 3L13A 3L17A 4IHBA 1YRKA 2KI6A 2N1TE 1UOVA 1A25A 4HLEA 1RH8A 3GPEA 4F1SA 2Y3AA 3TL5A 5CCHE 4TS6A 4Y1SA 5EDSA 4TUUA 1W16A 3QJZA 3R7QA 5KJ7E 2JQZA 4EZLA 1E8YA 2CHZA 2R83A 4L23A 2V4LA 1CJYA 2NCEA 3L08A 3KWUA 2DMHA 4ANVA 4NP9A 2WXPA 2ENPA 1QATA 2BWQA 1E7UA 2ENJA 2FJUB 4FULA 4KZ0A 2ISDA 4QJ4B 2CJSA 3LJ3A 4XX5A 1UOWA 3MJWA 3OAWA 4LDCA 2WXOA 1E8ZA 4WWNA 1WFJA 4IQHA 1BCIA 4ANWA 3DPDA 4V11A 4F91B 5JHAA 2FK9A 4JPSA 3ML9A 4ANXA 1DJWA 2WXFA 3QAQA 3SD5A 1DJXA 4DNLA 5G55A 4WWPA 4XZ4A 2WXJA 1DJYA 2NQ3A 2WXIA 3L9BA 3NSJA 2Q3XA 3FBKA 3IM1A 3OHMB 4J6IA 4WAFA 4ANUA 4OVVA 5H4YA 2X38A 4AJWA 1RLWA 4Y1TA 3QK0A 4FJYA 2A5UA 1QASA 4EZKA 3QR1A 3RDJA 2LHAA 4LCVA 4PS3A 2RD0A 3TJPA 4FADA 4KZCA 3KWTA 2WXLA 2DMGA 3RPBA 3PS6A 4ICXA 1W15A 1DJHA 2ZKMX 1TJMA 4NS0A 4GB9A 2QZQA 2WXRA 4TV3A 1UGKA 2ENQA 4QAMB 3L54A 2CHWA 2K3HA 2CM5A 2WXKA 3CSFA 2D8KA 4QJ5B 4FA6A 1HE8A 3QR0A 3F00A 4F92B 3P2BA 3JZYA 3ZVVA 4G11A 2YRBA 2QZ5A 3PRZA 3PFQA 2Q0ZX 1TJXA 2WXQA 4L1BA 3ENEA 2CM6A 1GMIA 5G2NA 1E8XA 3ZIMA 3APDA 2CHDA 4GNKB 1BDYA 2EP6A 4F93B 1DQVA 4DK5A 5CCGE 1E90A 3ZW3A 4FLHA 5JHBA 3T8MA 2WXMA 4BFRA 1V27A 4NPKA 5H4ZA 3DBSA 2B3RA 2CHXA 1DJIA 2WXHA 3M7FB 4NPJA 2NSQA 3W57A 4XE0A 3QARA 5T8IA 1K5WA 3S2AA 1DJZA 3ML8A 3W56A 4PS8A 1E7VA 1E8WA 3FDWA 3N5AA 4AOFA 3NZSA 3F05A 4FJZA 1DSYA 4FHKA 1DJGA 1WFMA 3F04A 5CCJA 2K4AA 3APFA 4KITB 4EZJA 2CJTA 3R7RA 3APCA 4FHJA 4LT7A 4BGDA 3PYCA 4HVBA 3B7YA 3HHMA 1BYNA 2YOAA 3TWYA 3HIZA 3PREA 1RSYA 2WXNA 4ICWA 2UZPA 3CSTA
chains in the Genus database with same CATH superfamily
5A16A 1FL5A 2WPGA 3ZHFA 2J5LB 4I3GA 3TBYA 1LE9B 4M7ZB 2F18A 3ILDA 4L9LB 4KXAA 4Y9GA 5C9JA 2F53B 2O5ZL 3TN0D 4JG5A 5L4MA 5BQDA 1QTYT 1I3UA 1K6QL 1CE6A 1AO7D 1UZ6E 4YSSA 1I7UB 1G9NC 2FZ3A 1JZJA 2EC9U 3CFNA 3ES6A 4NO2B 2H1LM 4AGLA 1CLOL 1XCQB 1J8HB 3N44F 4Y4KB 4N3TA 2F54B 3IDUA 3TO4C 2B5IB 1DQML 5CP3A 2AXGA 2OMXA 3LX9A 5DD1L 5F1OB 4ZXBD 3T08A 1C5DA 1FN4A 3KPLB 3LIZA 1ZT1B 2ENPA 3FQ1A 4CC1A 5K9JH 1NM4A 3CK0L 1KJMB 3ARRA 2GUOA 2Z91A 43C9B 1PIGA 2P28B 3FT4B 5D7LB 3S0PA 5DYOA 2BNQE 1XH3A 5AG8A 1YDPA 4XNQA 4W6XB 1X9QA 4TVUA 3CSBA 3FT3A 4Y1SA 3L9BA 1U92A 3MRJB 4KKNA 43C9A 1TITA 4HJIA 3QZNA 5EU5B 3T2PA 1KV3A 3EUUA 4YR6B 1AGBA 1VZHA 1HHIA 1L9MA 3L3DB 2MNJB 1YSOA 2OKMA 1RJYB 2XZCH 3BP5A 3DOSB 3HRZB 1J9TA 3TEXA 3EYVA 1NBZB 4R90H 1EPFA 2AC0A 3ZDZE 3FU3A 4Y2DD 3P73B 5E24E 3Q8FA 3EG9A 3VXMD 2X4SB 2JH2A 4R4NC 4LEOA 2D9CA 4HWBA 2MNWA 1Q0XH 4UIMA 5H94B 2G3ZA 1RZQA 1MVYA 1YMME 1NQBA 5DQJB 1A14L 3APDA 3NCEB 1FPTL 2Q9OA 2F8XC 5I16A 1AGDB 1B0WA 3BRGC 7FABL 2A38A 3QEUB 3V52H 4Q2ZB 1AY1H 4Y9BA 1KBPA 5JUEL 4JKWA 1R24A 3FQTB 4WJKB 4B97A 4J3OD 4B41A 1E8WA 1QABA 2AKRB 2XVLA 2UUDK 4YIQA 4YBQC 5AVSB 4BFBD 2IJ0C 2IANB 1CU4H 2YD0A 3STLA 3DRQA 4NC1C 4NX0A 1MQKH 3IN0A 1MPAL 1S7UB 4ODWA 4X6EA 5LGHL 3IXAA 3BGFC 3KCPA 1XHHA 2DJUA 5DHVH 1IQDB 2A83B 4KKAD 3JUZA 4Y4HA 1YEGL 1D6VL 3MNWB 2FIRT 1PEZA 5DYFA 5FUOH 4MJIB 1GSMA 4LSSH 5C0BD 2O4EA 2YUZA 3LQAH 4JRYB 4NHCH 5C0FB 2FJHA 1CGWA 2A9NH 4PLJD 4XXDA 4KV5E 4I85A 5F7KC 5I6XB 5L2KD 3P3SA 4K55A 4ZFOA 4FP8H 4YDLB 4GG6A 5CD5C 3G6AA 2CRIA 2B2XH 3NMEA 4NN7B 2J1KA 3KVDD 3MNVB 4M6OH 3STLB 5JR1H 1J5OH 3C12A 4GG6B 2DWTA 3FQ4A 1QD0A 4OLZH 2WCPA 5E95B 3DA0A 4FQ2L 2CLZA 3OB0K 3QJHB 4AL8H 4UIKH 2OJ1A 3ARDC 4JRYA 3L7EB 4TQEL 3F7QA 2ZXWB 3K6SA 1OSEA 1MZZA 4HKXA 4AEIL 5KW9H 1CICA 3QI9A 3SPJA 1RXLA 5HJ3A 1F4HA 3UO8B 1WBXB 4G8GE 3FU8A 5F8QC 4P49A 5EZOL 3U48A 4AJWA 2LABA 2IPUG 2EYSB 4M43H 3MUGB 1GOHA 4XB3A 4EZKA 1YC7A 4Z7WF 4OFIA 1FFTB 5AZ2H 1O5PA 4NNYB 5IKCA 2X4RB 3NCJL 5EG6C 1TVHA 3KPPB 3IRZA 4HFWA 2DBLH 4JO1H 2ENQA 3B9KD 4M8VA 4L3CB 4KY2A 2YAFA 4M9OA 3RWJB 2P8LB 4KRPD 3IJ7A 3KYKH 3WO4B 3ZVVA 2P46B 4L8SC 4ZDHB 1UXMA 1IBGL 2D73A 5BRQA 3VQ1C 1PL3A 1AR1C 1CZ8H 2CDEA 2ZUTA 1SMOA 4PWIA 5C0BA 2ZYSA 1FZKB 4O9HL 4D8PA 3HLKA 4KO5A 5D6DA 1OAXH 4KZDL 1A5FH 2GAZB 4KI5D 3TO2A 3U9PH 3U4KA 3OMAB 3QZWB 1K85A 4JPWH 3NTCH 4EEEA 1PEWA 4P23A 4P3DA 5I1GH 3ET9F 2W59A 3VE0A 2FEDD 2QADD 1ZLUK 1IGYA 3ZKXB 1XXDC 4HK0B 2C1PB 5JYMA 4ZAKA 4XP5H 2FGWH 1CYGA 2X6MA 3OZ9L 4YSAA 5L0QB 5DVOA 5MEND 4CGUB 2XZQL 4LVNC 4XCNA 3S35L 2BSTA 4BFIB 2FX7L 3MRMA 3S37L 5J0BA 4POZD 2XZCL 1PZDA 3HNTH 5AW5B 1J5IA 2BS9A 4OUOA 2R9HC 4URKA 1MF2L 1NGZB 3PNWB 1VDGA 3H9SA 4Z78B 2F53D 4OSUH 3TN0B 3UTPD 1YEEH 2PTVA 4IGBD 1M7UA 2OK0L 3VXOA 2J88L 3RZCC 4PV9B 1DVYA 1R3LA 2B14A 2AVGA 3VRJB 1AIZA 4JAMB 4JKNA 4NAQA 3TTYA 1NDGA 3FC8A 3R7QA 3LV3B 5HYJB 2O5XH 5LGJB 2KC0A 4UT6A 3ZL1A 1ZS2A 1KT2B 3JTTB 3U1SH 5HSFA 3KD4A 1KELL 2BWQA 3FQ2A 3PHAA 4QKTA 4HS6A 4YDJB 2YSSB 5ELIA 1MI5E 4BCZA 4O4YL 4FQXC 5CEYB 3HC3H 4NPYB 1IZKA 3WKYA 4N8VA 2O93L 3CCHA 2NR6A 1T0MA 3NP4A 1O9VA 5K33A 4FZEH 1BQ5A 4X6CB 5D7JC 3WLBA 4XMLH 1KGIA 3RLSA 3MA7B 3R1GH 4MAYC 1HOEA 2FSDA 3HZKB 4TM9A 2Q3XA 5EUOE 3UTZA 3RDTD 5HHNA 4NAJA 1BVNP 2Z8SA 3QHZH 5EBLA 2JQAA 3TNMB 2AAVA 5AZ2L 5EIIB 3PGDB 4A2MA 4QR7A 4K23L 2NLJB 1UEMA 2ADGA 4JFOB 4PTUA 5DFVC 1X5GA 1VGKA 4OZIA 5EF0A 4M43L 3HS0C 3M8OH 3L9YA 1KXQE 1OAJA 3FB7A 3B2VL 3VXMB 4UM9B 1NJ9B 5JHLA 1XH3B 3QDHA 5T1KD 4P2RA 3IPBA 3N1PC 1AXSB 2X4TA 2AEPH 1CL7I 5G2NA 3Q44A 3KH4A 4Q58C 1Y7VA 3V5DA 1XGUB 2TRYA 5GGVY 1IILE 4JKLA 1H6TA 5FV1L 4JEGB 3J2PA 3VNYA 3NEXA 4OLZL 2JCCB 5E0QA 5FW6A 1ETZB 3GO1L 2BVOA 1KYUA 4AK2A 5IB3A 2WVVA 1FJ1A 2KZ1B 3AB0C 2X4QB 1KIUA 1SLXA 3DJSA 1UWEL 4PRNB 1EDHA 1F0LA 3GMRA 3H0TA 4PUBH 3O4LE 1PY4A 2OMNA 2AQ1A 1OGAB 2HKFL 2BSED 5F0JB 4ZUVB 2IH1B 5HDWA 1UEYA 3ARYA 4K94L 5KTEH 2XTLA 1AHKA 1OZTG 2A9NL 1T0NA 3FFDA 3LS4L 4PCKA 4YHOH 3TBWB 3EYOA 4X80H 2QV4A 1MI5A 4Z3JA 4QRQA 1NDTA 5ISZB 2FLBT 4HKJB 1LILA 4Q7DA 4R4FH 3T3PE 2AERT 4AMXA 5B39A 5IVXA 4LARL 4NLHA 4TULH 3TO4A 3GM8A 1KJVB 4XMVA 1BZ8A 2VOTA 4PLOB 5EEWA 3MJ6A 1XF5A 4ZS7L 3ARGA 3K6DA 4IOSD 4Q6IC 2H2PD 5EDSA 3NJVA 3BEVB 3QZLA 3EXLA 1NFDF 2ZSWB 4M93B 4PRPB 3B2DC 3J07A 2B39A 2AJ3A 4W9GC 4HSQA 4DVRL 4PJ6A 5KBNC 4HIQA 1NLDH 2W60B 2WXPA 4G9FA 2R29A 2GEQA 2OL3H 1E6OH 2L0DA 3T0DA 1JWSB 4GW5B 1MI5B 1GJIA 3M1BA 3HN5A 2EJ1A 3MFGB 4N3UA 3V4VL 3WIHL 4XCEB 4JG0L 2PTTB 3AXIA 4ZNEA 1VRSA 3AG3B 1KPUA 2CDFB 3FFCD 2GTZB 4QYOB 3SDCA 5GGSB 4H20H 5C07E 3RUGB 1XSKA 3FBQA 1KTKE 2I07B 4P5TB 3PY9A 4JMNA 3C6LC 4JQVA 4Y4FA 5E6YA 1AVAA 2QQNL 2CO7A 3AWEA 4OFYA 2P5WA 4C59B 4ONFH 3PABB 2V33A 4HEME 2AJ3B 4EI6B 2N3JA 4ZNEE 2OMWB 2YAPA 3QXDB 4HG4K 5IMKB 1O6VA 2Q3AA 1OARH 4FXKC 4YOKA 5B1AB 3Q5TA 4N6RA 5CFAA 2B08A 4ORZC 2XTJC 3K91A 5D4IA 5E99L 5FKAB 2JKLA 4OV5A 3VMPA 2MFNA 2AMGA 3P54A 1JE6A 2J21A 4GW1A 2R15A 2VYRE 3QCTL 1BD2D 2G9HB 1XAUA 5HVGB 3S8GB 4KMTL 1QI5A 4X4KA 1RUAH 1RZKL 5C71A 4GFXA 2C9PA 2XACC 5KZCB 3EBIA 2WQVA 4F7CA 5FX3A 3CFDB 3LRMA 5AAMA 3ESPA 1WFNA 4MD5B 1FNSL 1P9MC 2B77A 2CCWA 4UU9A 4EN3C 4Y19A 6CGTA 5ALCL 1G84A 1UH4A 1HJBC 1GC1H 4G7QB 1DQMH 3L5XH 3N5AA 3TBTB 3EJYD 5C0NC 1URZA 2EIZB 4HFUH 1Z9PA 2OJEB 4ZSOB 3EDEA 3SDXB 1S78C 3E3QC 1NC2B 4NFCA 2FGZA 1A3LH 5HYSA 3G5XB 2Z7YA 2CDGA 5K39A 1EIBA 1B0GB 4PJDF 5IZ7A 5MENB 2VL4A 1L9OA 2CJUH 3QUGA 1GMEA 4HISA 2IBBA 5EIVA 1WAAE 3ALWA 2QVIA 3OLDA 4JHBA 2CZNA 5HDQL 1N6QH 1OAYL 3QS2A 3TU6A 4M4RB 1KTLB 5E2WL 1DSWA 3MX0B 1IM3B 4EDXB 2OL3B 4UBDC 2PTUA 3DGCR 3SDAD 2LT9A 4WFGD 1KCUL 3GS7A 2VIRB 3L4UA 3P77A 5IB3B 2MOGA 4X4XA 3G5ZA 4KXDA 2Y2TA 3EYUL 3CSGA 4MJ4A 5DMGD 5LLIC 1JWUA 4QTFA 5C08A 2YPLB 1FGNL 3FT9A 2EIBA 1U3HD 1EJOL 4MA3A 4FABL 1WCQA 2ILLA 5DSCA 5GIRA 2E0PA 5AVYB 1JZ2A 2KDGA 5CEZH 2CSPA 1DYZA 2VISA 3ZE0F 3IE9A 2I24N 2BNQA 3ARED 4P8QA 3FU9A 3V4LA 1FORH 5LQBL 1IC4H 4JFQB 2J1XA 4NQTA 1FYTE 2AQ2A 4AVJA 5C8JB 1SRDA 1PZBA 3QFDB 2EDNA 3ZE1F 2Y36H 1KXTA 1L6ZA 2ZG2A 4XMUA 1WGOA 3VI3B 4JG9A 1UWXK 5AFAA 2YBRB 5D1XA 2GC7C 2B1AH 2C26A 4YXKH 4MA3B 5BZDA 3EZJB 4I4WB 5HGAA 5JQ6H 3LRSB 1YPZA 5IMMB 4IJ3B 2VL5A 1T22A 4J3TA 3FTUA 4O5LH 4UT9A 3CH1B 5LKNA 4JRXB 5EU4A 1KJ3L 4HIEA 3OKEB 4F92B 3SYOA 1PW3A 3CDFA 2YZ1A 4TRPL 4KDTC 4ELMA 1J5HA 5F3FA 2ZYHA 1TJXA 1P4UA 2FDBP 1AMYA 2GJZB 2X89A 1KPRA 3DURA 4GY4A 5IB5B 2MCPL 4ILDA 2ZWLT 3UTQB 1A0QL 1IGIL 1KENH 4QCIA 2EYTA 1U6AL 3ILQD 4NN5B 4ELME 1H3PH 1BOGB 3NZ8B 4R7XA 3ZE1E 5AVRB 1G9MC 5GRXG 3GUTA 2MQGA 4PD4K 3GHEH 1DSYA 4ZS6D 2V5SA 3WO3B 2K4AA 1QZ1A 3X11B 1RD6A 4C56B 1CICB 2P42B 2WC7A 2W9DL 2J6EA 2I32A 2NYKA 5CGYC 2FEEL 3U83A 3QJTB 3ARBA 1YQVL 1B4JL 1EFXA 1PZ2A 3WE1A 1Y18A 1TZIA 1MUJA 1BPVA 3IGFA 4Q0XH 1WAAF 1YY8A 5E00B 4PJGA 4NO0D 5MHSE 3EHBC 3Q01A 4I3SL 3S4SA 4L18A 1M7DB 1JG9A 4BYHA 2NY5C 5J7CC 3KL0A 4FNSA 3D87B 3ARDD 1R1CA 4PI2A 4HUWB 4TL4A 3J27A 3ZTCC 2FH8A 3RWCA 3GBNL 3QUMA 4HOWA 1ZKAA 4KV5F 1TTAA 4J28A 5CSZA 4P4RA 3BFWA 5IOPA 3KGTA 2DEXX 3QEQA 1H8NA 5I0VA 4M5YL 3O3AA 2XYBA 4QHLB 3ZKXC 3WTVA 4XMZA 4OZ4A 4HUCA 5IW1A 4NJ9H 2H32B 3PWPD 4NBZB 3ULVH 2VR9A 3QI9B 4X5PA 4GW4A 5CILL 3RGBA 3QEGH 3EH2A 1V7ML 3IDNA 4FCHA 1TJHL 2IV8A 4RRPG 2ZWNA 5AOJA 4QRBA 3QISA 3T0ED 3A6OA 1T7ZA 3NFPA 1UB6A 1EZVY 4S0TD 2COQA 4XB8A 3ZYZA 4JDEB 4JE4B 4JCMA 3V7AG 3FRUB 1F4XL 4Z18A 4BZ1H 2YMOA 4BWTA 2EDWA 3UTSD 3O6KL 2D3VA 4DGYH 3EJYC 4KZCA 3Q6GL 5C0ND 1CK0L 2FECL 1P2CA 4LL9A 3VYOA 5IB2A 3GXTA 4GRWE 4JE0A 1DSFL 1V3JA 1GJUA 4Z78A 2CO3A 2ZUVA 4HXAL 3DTDA 3EOBA 1SOKA 4CC4A 2P7TB 1SY6L 4M56A 1R0AL 3MLUH 5ICYB 4XMTA 2QQKH 5LAPA 3ZT5A 2XZQH 5MI0C 4MCYB 4B60A 3TCLA 4YHKL 3VXUD 5B4MD 3RVXC 4XP5L 2O5YH 4XVOA 4ZO9A 1VKXA 4UZGA 4WKXA 1DANU 1I9JL 3WFDL 2DMBA 4MD4B 4WEMB 5I1CH 5I17A 1QPXA 2E7DA 1BYOA 3LN5A 3FKUS 4KRLB 1JPFB 3VFSA 1A7OH 5I73B 9PCYA 4XVSH 1MFNA 4HPYH 1N8ZA 4PBWD 3HS9A 1G4MA 3BZ4A 4M02A 4DZBB 4OCXL 2X10A 1YY9C 2VZ1A 3UL4A 1TNMA 3APCA 5E56A 1RHHA 2CLVA 3UAJC 3LEVL 2EYRA 1VACA 2AQSA 5D7SL 5AQ0A 5J3HC 3VFNA 3BUIA 3BKJH 1FL3B 3SDCB 4PJCB 4BQCA 5FGCB 3T4YA 1V7NH 3HC4L 1PKQB 4GAAA 3PP4H 3GC3A 3F7VA 3HAEG 3EOTL 5ECJE 1IKFH 1OCCB 2LLNA 3N40P 2ESVB 3TBTA 3BZ5A 1WWBX 3K8LA 4CNIA 1XF2B 3BXNB 3UJJH 4DP0X 2KZKA 4TYUA 5E08H 5TDNB 2TSBA 3CPLA 2VDMH 4NIYE 1I8IA 4IEFA 5BXFB 1YNTA 2UWEA 2V7NA 3R0MA 3PJNA 3VXUA 3FUJA 3MRRB 3N44B 3FHQA 3D39E 4WHYG 3IDJA 4WW1B 5D96C 3CN2A 1H6FA 3AREB 2L7EA 1ITBB 4I3RL 1O7VA 4B7IA 3V0IA 5AB2A 3CDZB 5ISZA 4FQ2H 1XR9B 1RURH 5BUAA 4AENB 2KQNA 1V05A 2CR3A 2UWEE 2WGXA 3SKOA 4AX3A 3HRZA 1OTTC 3DMMB 2VDPL 4TVSa 1HEZA 2J5LC 2HVBA 3UGXA 4QRRD 5IW6B 1QASA 3MN8A 2B2XL 2ZXQA 1EXUB 4U1GC 3O8XC 1QFWH 3OWEA 3BT2L 4PEEA 3VRIB 4AG4H 4E0RA 3BZEB 3NJHA 1JK9A 1ASQA 1JCKA 4H1LG 4B96A 3VWJB 3LRLA 3FB6A 4F2EA 3NN8A 2BNQB 4MZRA 1KC5L 2F61A 2GYSA 3KLAB 1NIAA 1GSKA 5GZND 1MIML 3FT4A 4P2RE 2APXA 1CFSA 2UXFA 3FU7B 3VGBA 1T5XB 2OZ4L 3BE1H 4W9EC 3VD0A 1UCBL 5CIPA 2F5BH 4IRZH 2DQEH 2E76C 3BN9D 5D7IF 4IM8A 1CFSB 4UBDD 1BX2A 2YUWA 1TT6A 1TZHA 1EBAA 1XH1A 3LKNB 1IBHA 1JRHL 2N7BA 1QSFB 3PL6C 4FZ8L 4RIRB 5D5ME 5CN3A 3HOGA 1WICA 1E2ZA 4MLSA 2CO7B 1NMBL 4PRID 1A4AA 4ZXBB 2ED8A 3LPOA 3VH8A 1NFIB 2VN5A 1DO6A 5JUEH 4NZJA 1ONQB 3NZSA 4XNYL 5CFHA 3CV5A 2BVPB 1U95B 4MQTB 3HPJB 4XZUB 3FQUA 4D9RE 2VNCA 4FA8A 43CAB 5E7BA 5DJXA 3O3DA 2VC2B 3FO2B 4UIMB 4YQXH 1W8NA 1Q0XL 4JDTH 5KSBE 3LNHA 3KYAA 5E1IA 2M2DA 3H2QA 5DHDA 2W38A 3O81A 3QEQD 2GY5A 3VMOA 2ICWA 2CKBL 5FFLA 3PJLA 4PJ9B 4WWKD 3TLRA 5HGGS 4YH6A 1LDPL 4X83A 8PAZA 3GIVA 4JPKH 2ATAA 3QUYD 4YPGB 5DMIH 5GGQH 5JNYA 4ISVA 5JW4M 3MDJA 4TUKH 2F1AA 3ILPB 2GSIA 3V10A 3ZKMC 4K7PL 4YSCA 3FYIB 1XMWA 2E6PA 4GW1B 5D1ZI 4DQOH 4JN1L 3EOAB 1ACYL 5IROD 3PXLA 1JS4A 1X5FA 5K9JL 3HBPA 2EDQA 3IE4A 3HLAB 1GZHC 3GB7B 5E1AA 4XWGH 5EORH 5C09A 2BVTA 4MA8L 5GRJL 4XAWH 5IMOA 1R34A 2EH7H 3DX0A 1XWVA 1RK0B 1ZS8A 1DLFL 5T3ZL 4HT1H 1FDLL 2FUQA 3QK0A 3V6OA 1PF3A 5D5MA 1IU1A 2ZAGA 3UIYA 3UTSB 2ZX7A 4LHUA 5C0JB 2P5EA 4KHXH 2ALWA 1KWGA 5DWUH 4ZW6A 1PG7W 1ODUA 3QNXA 5DMJB 2QPSA 3I2CL 4F3FA 3ULUF 3JTSB 4U1SA 5EBWA 1TTGA 4DP4X 1ZSDA 4RLDA 2DQIL 3ILPA 1JGUH 1QG3A 3MLWL 4AEEA 4ABQA 2A9MH 3PWJA 3E8VA 2LQRA 2ZONA 2YN5A 4KPHL 2ITDA 5B3NA 4FXGA 5K39B 5LGKA 2DWSA 1OL0A 3AREA 3DROA 1L6PA 5IESH 5GRJH 3JV6B 4GSQA 1G5GA 2PWEA 4FLHA 1BG9A 4NRXA 1E5BA 3QDGA 1QPKA 1ZIBA 2FLRT 1KLUB 4PWEA 5MEQB 3EAKA 5ALBH 4ERSH 5DK2A 1LK3H 4JHWH 3ZSTA 4NEHB 3QWQB 2HT3D 2YA1A 2LLLA 5CHNA 1BA9A 1HILB 2J6EH 3CZSA 4FCAA 3UMNA 3RTQA 2Z8VC 3F05A 2NT1A 3Q48A 4BH8B 1KCRL 1EH9A 4CKQA 3VGGA 5EPMB 2WO4A 3GWJA 5L6YL 2Z4TA 2XSKA 1HXYA 3OAZH 3L3KB 3RWEB 1YN7A 1NGZA 4DPBX 1AO7E 4LCCB 2WN3A 4KVPA 1MCPH 2BMKA 4KRMB 3GSQB 5I18H 4LCWA 4K5OA 1KYOJ 3SDDA 1SLUA 3K4AA 5SWSE 5EMYA 5DLML 1NIBA 1C12A 4JREC 5HDOA 1M7IA 4MJJA 4FQHB 3QQDA 5I19H 3FRPG 4PMFA 3QUMH 5AVVB 5BZWA 2GIMA 5EV7A 1UOVA 1EBPA 2Z65C 3WEXA 4JDTL 5B1JA 3T09A 4D0DB 3GSVB 1IGJB 3RILA 2VZTA 2X4SA 4DO5A 4HWEH 4M6AA 4ZFZA 1ND0A 3LNDA 2B4CL 3L7FB 5JLZA 2VM4A 1FCGA 3BFQG 2AW2A 3S96A 1DQTA 1JHTA 1E8YA 2Y25A 5ID0A 3BDBA 2CUHA 1T1YA 1R3HA 1P4BL 1QFWI 4KRPB 1DL7H 3OHXA 3ZTNH 3TEZA 3QXTA 1FIGL 2KS0A 3G6JE 3GIZH 3H1ZA 2OMZA 3RIFK 2NY6D 3ZE0B 1YO4A 1OF2B 3CQPA 3SPCA 1I8LA 3UABA 1ZGLB 1RZ8A 4WEBL 2AK1L 1LQSR 4ZUUB 1MJ8L 4MNQE 5CEZE 1EZLA 1JPGB 5F72S 4KVNL 3KL5A 3BESR 2NX5E 5KN5B 1BLNB 4OZIE 2WXIA 3QQ4B 1JV5B 4OB5H 1CCZA 2HRHA 4AV5A 1M9WA 3LNFA 3AFLA 3QA3B 2KUTA 2GIYA 5HYJA 1NBQA 3BE1L 4ZUUA 4YL9A 4CBPA 2XETA 3FFCE 3WNMA 5JW3H 2Z4QA 4OFYD 3CTTA 3NZ8A 3PS6A 4FD0A 4PG2A 1JHKH 1X9UA 2GJJA 3EO9H 3T65B 4P2CG 2WXRA 4PJEA 3MRRA 2GJ6D 3NIFB 3AVEA 2IGFH 2Y06L 3VWJD 1TIUA 3L4VA 1WA2X 1ZPUA 3FFCA 2H3XC 1NGYA 3ZYJA 1UACH 3L7EA 4KKCC 3MLTB 3RPIB 3CHXA 5DUBA 4M8UA 1F3RB 1P1ZA 2F1EA 1G7JA 2X9WA 3NH7L 1OM9A 4IGBB 2X87A 2X4QA 4B9FA 1PD1A 4I0PC 4YFLF 4YHPA 3QDJD 1CLCA 2YKKA 1MVUB 1NGWA 4GIOA 3P0VH 4JFUA 3N55A 5FO7A 3UO1L 5HYJD 4RQQA 3ULVC 2CO1A 2DD8L 3B56A 1SMDA 3QARA 4RGNC 2CU9A 5FUCC 4HUVB 4JG1L 1AQMA 5BW7A 3MLSH 3NZHH 4GAYB 3BIAX 3VFGH 4F37F 4AENA 3IT8D 1HS6A 5ES4B 5KBLA 1XGTB 2AV7A 4FYQA 4PLJC 1JERA 4EE2A 1TYRA 3EJJX 2NNAB 5DJ2A 3TP4A 3UTTA 3WHE1 1NCUA 2WCGA 4R0LA 4PCYA 4H40A 5FWRA 4RISH 2BIIA 3O4LD 3A21A 3O6FA 5KSVA 5E2TL 3LZLA 4JJ5A 4QWWC 3GDBA 1GKOA 2DQJL 5IVZB 5SX5K 3G6JA 1AFVL 1WCBA 1LVEA 2DWXA 3I85A 1JNNH 2NUTB 2A6KB 5IG7B 1FA4A 1D5XA 3BRFA 1MCOL 1MCFA 1DQLL 4PLKC 3QWRA 4HDIA 3RDTB 3AUVA 3FAWA 3O9WC 4HYTB 4J4PD 4PRBA 5AW4B 1CFBA 5I5JA 4U1JB 4PJ9D 4WWKB 1OPOA 3GLZA 4JM2A 3GSNB 3B2PA 4U1LA 2F15A 3VJ6B 3KAAA 1C7SA 3MJ9A 5GISH 2VR4A 5FYLD 1V5JA 1NGQH 3VQMA 3T0WA 4PJHE 5D2LB 3QEUA 1JF1B 2QR0B 2ZAHA 3EGDB 4H25A 4Y1AA 4OZGA 2EEXA 3Q9PA 2CJSA 3B83A 1MHHB 1A9EB 2L04A 1KJ2L 2XQBH 4Z6AT 3BHBB 4G6AC 4YNYA 1AD9A 2W65B 4XNDA 3UZEC 4G80A 5B7MA 1EEZB 1KCBA 1PSKH 4QO1B 5HHPA 4CMMB 4LNVA 4BA8A 1QTPA 2Y3NA 1UUNA 1K2DB 4HJGB 3U6XS 1EK3A 1IGYB 4FC3E 5EN3A 4HUXA 4JQIH 5F1KC 1JNLL 3D69B 2Y6SD 3E2HB 3MUJA 3N85L 3VXOB 1H3WM 4NQDE 5JPNB 2OXGA 5C08E 2C3HA 3ISRA 2APBA 2I9TB 3R06B 4QI3A 5MP6L 1PZ3A 4GO9A 4LEXL 4BK5C 2X6UA 2R29H 3CIQA 3F84A 5D1QC 4TV3A 3UDWC 3MXVL 3S5ZA 2VQ1A 5IT2L 4KO7A 4LLWB 3DNKA 4P2RD 4X5QA 1CK0H 2G3XA 4BZ2A 4NC0B 1MFUA 1MCEA 1KEGL 1S9WB 4WU7A 3NZHL 2WKLA 4HZLA 5K9QG 1FC1A 1VENA 4OLEA 3EFDL 4WTXA 3FAXA 4X4YA 3FB8B 5DI8B 5KEZA 3P0VL 1CDUA 5DA0B 5D1XE 1YUHA 3C5SB 5IY5B 4NO5B 4W1TA 4Z7QE 1EXGA 1HXKA 4N2BA 3UTZB 1J8SA 3VFOA 4CVUA 4L3AA 3REVB 5J6HA 1DVUA 1NM9A 2OBGA 2ZOLA 2FR4A 1KYOK 3PQYB 1T20A 4JFTA 4HCRH 1KY7A 3W3BA 1F56A 4Y4FB 2YD1A 3S2CA 1CXKA 1E30A 3TM6A 4XOBA 4WW2F 3CC5B 3F7LA 4DT2A 3AG1B 3FFCB 32C2A 5SWZD 3BP6A 3X12B 4AZ8A 5ITFA 3SKMA 4PS7A 1CGSL 1UM5H 4GFTB 3ZL4H 1XSIA 1NH6A 4Y2OB 5J13B 3E9UA 4NP4H 1CGTA 3GXDA 4RIRA 2XPGB 4MMYB 2AJVH 5CHNB 5AWNL 5CINL 3FCSB 3BO8A 3QUXC 4MAYB 4PJXB 3RWFB 3ILQC 3SDXA 3UYRL 2VJXA 2ZOOA 2F58L 2XN9A 4NXKA 3BKYH 4MXVF 4YGVA 1XCTA 2YRZA 5ETUA 2W0KA 1S5IL 1BD2B 2NYYD 4NYLA 1JN6A 3MRLB 4KKLD 4XP1L 1E4WL 1AIFA 4BK4A 5B3JF 4ZUTB 4LDCA 1NCBH 2A6DA 4RMWA 1TKWB 3VFRB 1ZHNB 4YHNA 5FCUH 5IHBA 1AGFB 5F7MC 2JF1A 3O8XD 1G7QB 2EDJA 1XBRA 4O2EA 3UYPA 4DKFH 3DGGA 3V4VA 3WIHA 4ATTA 2R2HA 2NT0A 1HN1A 2ERJB 3CFIC 1P5UC 5I1KL 4LOEA 4X7CC 1UD8A 1T0PB 2CGYA 2ZUWA 4WUKH 1CC3A 1M1XA 1CQKA 3VGAB 1EHNA 1HCVA 5SV4A 1F8TL 1CR9H 2DRUA 4WI0B 1EGJH 2HYMA 2YA0A 4ZPVA 3ZT7A 3FULA 4HIJB 1N18A 5K1VA 3GGWB 3KWWB 4EKJA 4BDVA 3EDKA 3KW8A 4R26H 3L3JB 5K9OB 2V9QA 3NCWA 2CM5A 1NANI 3FUKA 4H8UA 1DE4A 3C09B 1D5BA 3RVUC 4PRIE 5C7ZA 2K6YA 2ZTBA 1A3RH 1IGCL 2NXZD 5B39G 4PG9B 2YK1H 2WWKT 4MRBA 4HUNB 1TEGA 4RMUA 2Q0ZX 2CWRA 4Z7AA 2A9CA 4MMXC 5I1HH 1WZAA 2FEDC 2HX8A 2QADC 3VFVB 4BSJA 3LD8C 1J5CA 4GNKB 1BOGA 4JHWL 1F18A 3BKML 4HMEA 1CD9B 1UD3A 1Z2KA 5ENWB 1K2DA 1TQBB 4GI6A 4OIIH 4HJ0C 4MXQC 3HG4A 5B8CC 1EAQA 3AY4C 3RTQC 3U46A 2B3RA 4DK6A 2P45B 2I5YL 3UAAA 4ABUA 4PY7B 5F9DC 1YMHB 2BVYA 3MCKA 4WTZG 4JK0D 3GEFA 4YE0A 4JHUA 2OMYB 4ZQKB 5IESL 1MAKA 2Y7MA 5CJ5A 3HFMH 3ZZQA 5KN5A 3ABZA 4W4OA 2JKJA 4HIEB 4PJ8D 4YHYC 1VFBA 1DFBL 3VXQB 4DAGL 1MWAB 3NSDA 1ZA6A 4ODXB 4BFNA 5HHQB 3QS3A 3A23A 4C56A 1NGXB 1T7YA 3L16A 1J8RA 3EYSH 4APQA 1A4JA 3OZKA 5ICXB 2IADB 1U42A 4HS3A 3S5LG 5EC1B 1BLNA 4LPUA 4PS4H 4FMFA 5DEJA 2V5RA 5B1KA 2FL5B 1WZMA 5B4MC 2BFVL 4FKKA 3ULSB 2R1XA 4Z7NE 5EORL 4CVZA 1HI6A 3S6CA 3DIFB 3CSYA 2VZOA 2Y5TB 4XXDB 1ZS8B 2X2IA 3AG2B 2BNUA 4RFEA 3KPSB 3V2AR 2VN7A 1MJJA 5LXGL 3AUWB 3DROB 1ZAGA 1A3LL 1PKOA 4M8RA 4R4ND 1IGML 2XBDA 4RZKA 4JRYE 1RUML 3MRIA 3U0TB 1I3GH 5JA9A 3JTBA 5IBLC 2XN9D 4OJYA 5BRPA 3HCVA 3ML9A 4Z7UA 3UGEA 1GA2A 1WBZA 3HMWL 1J5DA 2VJ0A 3D4GA 2EIZA 1ES0B 2ZUQC 5C0JA 4BH8A 5IHZA 5T3XD 1QYGH 1HTYA 4J5VA 2PPDA 3TCXA 4ZAKB 1LEIA 1SJEA 4Q9QH 4XT1C 2PP8A 2RCSH 2X1QA 1NZRA 3N41F 3Q8BA 4L8SA 2NUTA 4L0YA 1D5IL 2HRPL 1DQJA 1CFQB 1A3RL 3ZUCA 3DYMA 2XZAH 1T80A 1SHWA 3G6DL 1OT1A 3D85B 3S8FB 5AAPA 3CFCH 1E40A 1U91B 3ECQA 4YSPA 3L54A 4P46D 1XIWB 2DQGH 1I1AD 2ROXA 4R0LB 3GTNA 2J8UA 5CZVH 3TJHD 1YECL 3CZFB 1KG0A 2B15A 2ZXGA 2CIIA 4KMQA 5CN2A 2QZ5A 1I53A 3GKWH 4AQEA 1AGEB 1ZK5A 1ZV9A 2XNAB 3O3BA 5JLZB 3SCMA 5FM5M 1KB9K 1A3ZA 4YK4B 1JWUB 3DI3B 3UBXG 4H20L 2VR8A 3KYNA 3VNZA 1RQ5A 5EOTB 3ZDXB 4FZ8H 5FR3A 3L48A 1AHMA 5GRVK 4IKJA 2FD6L 5DMKB 4OBSA 1E5AA 4G3YL 1PZUB 2OA9A 3MV7A 3WE6A 3EYFA 1NPJA 1U9KA 4R0LC 1GZQB 3VRJA 4AOFA 4Z7OB 1NLDL 4NQEB 1LWRA 2BMKB 5F3BB 1BM3H 2VC2H 3NJLA 1AO7A 3UAJD 4PJCA 4L1DA 3CWGA 4P5MA 1T1WB 4ZYKB 2MNUA 3GYRA 4IK6A 2VXQH 3CZJA 4DP6X 1GZPB 3H54A 4ZS7H 3PV7A 4BKSC 3K72A 3PDOA 5CINH 1JZGA 1LD9A 2AJVL 2EYRB 4TULL 3T0EB 1ETB1 4G5ZH 2Z6FA 3MI6A 1JXDA 4HJGA 3CU7A 2KI6A 2VDPH 4HS8L 1UOLA 1T89A 1Z1WA 5LGJA 2JK5B 2E75C 2IBGA 4P2OC 4RZCA 2GVYA 4LHQB 4XBGA 2OR9H 3ZDYF 2WB7A 4JZNB 3HI1B 3HBQA 3IRPX 2R0LH 4JLRB 1PPIA 5LHDA 3IDMA 3WKMH 4L8CB 1QYGL 3IMSA 4PUBL 3QIUA 2R27A 3ASNB 4N2EA 5EZLB 1NCAL 3SPVB 4C4UA 3D09A 4OTXL 1IM9D 5JMRA 5B8CB 1PG7X 1U8JB 5E08L 4NQCB 2VMDA 4FG6D 3QA3A 1YNTB 1HHJB 1KYDA 4AEHH 4LP4A 4WJ5B 2JK5A 3FUEA 4PRNA 2JXMA 3HS0A 2QGCA 4OM0H 3OHMB 4PJ5A 5HYJE 4L8BA 3MMEA 2VERA 4ZX4A 5LXGH 1PBYA 5C07A 3X17A 3V0DA 1TQCC 4TLTA 2H45A 3OPZH 4ZD3L 4JFEB 5E8NB 3RIAK 3ZMEA 3G08B 3U7YH 4DO6A 1JIBA 4OIBA 3EJZD 2AQ3A 1HH9B 2DM3A 3UG5A 5KAQF 1D5ZA 3PWPE 5SWSA 5C0DB 3EJPA 3IDJB 4LEXH 2IANE 1JGVL 3MRIB 1H3GA 4ZUVA 5E5UB 3QHZL 3D0AA 3MLZH 1N5AA 3V4PL 3WS6A 1AD0A 3ARQA 2EIEA 3RY4A 1CIDA 1NFKA 3K2KA 3UEQA 4UTAL 4XNUL 4XI5D 4L8BB 3TV3H 3SKNB 2EP6A 2PUQT 3BVUA 5FYJH 2DI8A 4A2FA 3KH3A 2EQDA 4IS6B 4C4KO 5MEOB 2HKHH 2FTAA 1HESA 1JXGA 5H4ZA 2CHXA 2J71A 2ZSVA 3TA3B 3Q5OA 4WY7H 4XPBH 3CN1A 2NX5D 1I75A 1EDQA 1E7VA 3T6VA 2AK4B 5BQ7B 5C0DA 4XCEA 1M6UA 3I50H 1T6VN 5C9KA 1IVTA 4ETQA 2XBZA 5EOCJ 1FNAA 4BFKA 1E3FA 2HLAA 4L3FA 5JW4R 3ARFD 4LT7A 4BGDA 3T77A 1GYAA 4Z95L 1AJ7H 1P7HL 4TTDD 3JWNC 1OSYA 3IJSB 4N5UA 2XWDA 5JIPA 1U95A 2P7TA 4XZUA 1T4WA 4L2YA 3EFOB 3LH9A 4Y2DC 1FO0A 4O02H 2BM3A 5F0LB 1IQDA 5E9DE 1QEXA 5F2FA 3QNFA 5DA4A 3MCKB 3G5VB 4K8RH 4EI5B 3SHSA 2LVEA 4AK1A 1A25A 2HT2C 1Q94A 2FHBA 1AFVH 2Y7QA 3ARWA 3WUWG 1YJDL 2K9UA 5FGRA 2YPVA 5E2TH 3IFNH 3QJZA 3F65A 3TF4A 4LVEA 3QIBB 2G3NA 4QTHA 4YS4A 3Q2VA 5TPWH 1KN2H 1BHGA 3V6BR 1J11A 3BDYH 3HC2A 1AD9B 4UUJB 5KYUA 5CGMA 4O2FB 1XZ0A 3NJNA 3QH3B 1P6AB 5ABZA 1W72L 5AVXB 2FEEI 3DPDA 2DQUL 1BZDA 5H94A 4RFNC 3TBYB 1OXYA 2XQYA 1LE9A 1RK0A 5DS1A 1EA9C 4IKIA 1D2OA 1NCBL 4PGEB 4XMKH 2VXVH 5CBEA 5E8OB 3C6LD 2B59A 4EXKA 2VDQL 4NWTL 1UD5A 4GKZB 5ANHA 4HHAA 4QXGL 1KCSH 4PJIA 1U4EA 3KYKL 3MRPA 4P07A 3ECWA 3BP6B 5ITFB 5FO8A 3TEWA 1ZXQA 2BJMH 2FX8H 2O6CA 4R7DA 4YHIA 2YKLH 3ARFA 2P80A 1I1AC 3TJHC 5C0CA 2BC4B 1EEUA 1JHKL 3TX4A 4S1DD 4ZUTA 5JW3L 3ELQA 2EUZA 2F1BA 1UT2A 3SGEI 1YN6B 3CLEH 3BH9A 3INUL 4HWBL 5F8RC 4PJFF 1CLZL 3QEQB 1AQ8A 5DJZA 1V54B 1E8XA 3DGDA 3PE9A 3CG8A 4ZS6C 4HS3B 2X3AA 3RG1C 3VFOB 5E9NA 3WTTA 1D5MA 4FRWA 4DVBB 3HBZA 1E5CA 1OM3H 4N5EC 2ICEB 4Z7QF 4AEIH 1F1GA 4ZFOB 5FIEA 3D25B 5E9DA 1PFCA 5D7KE 2EDXA 3HUJE 4QHMA 3ZHDA 2MTPA 2HCZX 1Q9KA 4CAGA 5D55A 4PSPA 4U1KB 1UB6B 2ATPA 3BOVA 4C58B 4FJ6A 1FIGH 2CJTA 3MLRH 5ANMB 2GIXA 2G2RB 2Y0SA 4JFPB 3GXNA 3FCGA 4YMPA 1EHLL 2ZUYA 1JGDB 2IBZY 3HUJA 1RUPH 3SDXF 2YLKA 1MJ7L 3CXHJ 4LHUB 4AYFB 1A7QH 1VFUA 3T8XA 2H0FA 1JGIA 1IC1A 1S7TA 3C2AL 4H8PA 2XVGA 4WTWA 2NY5H 1UM4H 2YPKB 5L2JA 1B0GA 5D7EA 3OXRB 4N0CC 1JVOA 1ZY9A 4PJDB 3D25A 5E9DB 1A6UH 1BX2B 3PHQB 3TYGL 4NHCL 5DZOA 5LCVA 2EILB 5HHMB 5D9SA 1EZUA 3E0GA 3FFOA 2V5MA 4UYPA 1CFTB 4OF7A 3H9SB 2XWZA 1VF5C 3WOVA 3ILEA 5F9OL 4UILH 2G4EA 2CDEB 1KLGB 4FFWC 3N85H 2XQYG 5I1AB 2E4TA 2XG5B 2Z34A 1AZBA 1EHAA 5L6YH 3QNYB 1H8OA 2DWDA 2D0FA 4PGCA 4FABH 3VD2A 5JORA 5HHVL 5EO0A 3LKSA 5D6CA 5F7WC 5IEHB 4P3DB 3VXSE 1OQOA 3LZFL 3SQBB 5ECGA 3W9DB 1N70A 1Z9OA 2XRAL 1ZTXL 3MOAL 4K2UL 1YAIA 1KCUH 1BVLA 3QO1B 4Z3EA 2C3XA 4LL1A 5I9QB 3FOMA 3RGVD 4ZFZB 2DJSA 3W9DA 4F2ME 2GB2A 1JXKA 1RL1A 1UZGA 4YDVA 1TVBA 5IBUG 2JJSA 3KVPA 1P7KB 3QR1A 3QAZB 4DPRA 4U49A 4Q2ZA 4S1SL 3S36X 1WH0A 1EUUA 1X6NA 3AWGA 4KQ3H 4OZGE 4Z76B 1JUFA 2ADJB 4QXUL 3ZE0E 1S5HA 2XFXA 4HIIB 4JFDD 2XKSA 5DEGB 4UUJA 2FT6A 4Y88A 4L37A 1UZ8A 2J7LA 4H4NA 3HG0A 5JPNC 1L4IA 1GXEA 3DIVA 5CLXA 3FH7A 4PJEB 4DOHB 2AS5M 2RA1A 4RISL 3L9RB 3QIWC 4KAQH 4G7VL 3GMOB 1DQVA 1IAKB 2FB4H 2FWOB 3G9AB 4X4MA 4XWGL 3JV0A 5E1GA 4BSWA 1FFRA 4NO2A 4BUHA 3EBAA 3AJ7A 1FFPB 1M7DA 3L45A 2K9FB 2AQNA 3CK0H 3SKUD 3VFMB 2CGRH 2R56H 1MRDH 3MGAA 4MJ6A 5ITBL 3VWJC 3UAJA 2C3VA 3PV6B 3K8KA 3NFSL 3TH3T 5IIEB 2DPKA 4I48B 3CLWA 3A47A 2FB4L 2VXQA 3X3FL 2LU5A 1JZ5A 2BNUB 3HMXH 3V7MA 3O2VH 4P2OB 2OSWA 1UZ6F 2WWMD 4JPKL 2PWGA 1EXUA 3B9AA 3LKPB 1HL9A 4KH9A 4WI4A 3MV9A 5J6SA 4LOVA 1IAKA 1OK0A 4QXTB 3IK2A 1YMMA 3FN0H 2QLVB 4QXUH 4W93A 4ZUWA 4EOWH 3BH8B 5F44A 2FSEA 1S46A 1SQ2N 2UY7B 1KIQA 3MAWA 1KB5L 1L5GA 3N9GH 4X5WB 3QEQE 2X70B 5EWIH 4G8GA 2FBRA 3FH8A 3SYQA 4GRWF 5I75C 4KTDL 4IRJD 5C6WH 4FFVD 1NUGA 4N90E 1M71B 1YNLH 2Y07L 1FRGL 1N68A 2BZ7A 4JVUA 3VU2A 3D0LB 3MOAH 1ZTXH 4K2UH 4N2NA 1J9QA 2EECA 4OKDA 3VWKD 3WKPA 1MJ8H 5DRZA 1ASOA 2NYZA 3B3IA 4FF9A 1D9KA 3KPPA 3S9DB 1BFVH 4OF0A 4HV8A 1TUPA 3GJFA 4DVRH 3LHPL 4IQHA 3N43B 3RQ3A 4TKWA 3OMNB 1XL6A 1JWSA 3LEYL 3F12B 5TGBA 2NZIA 1QTSA 1NCNA 3QDJB 2F7PA 1AKJA 1O75A 3ZTJG 1P4BH 5J56B 1HZLA 4UTBA 5TTRA 1G9MH 4FNUA 1EJ6A 1BQUA 4YHZL 3NBNA 1NIEA 1TMQA 1SOSA 4B9PA 1MDTA 2QR0A 3EGDA 3GSQA 4H25B 4XOCA 1IBZA 1PZ5A 4TQHA 1A6UL 5SV3A 4LCUB 3FCBA 3TJEH 3QCVL 3SZ6A 4JL1A 3M1BB 4HXBH 2E74C 5TD4A 2F2HA 3QXAA 1HHHA 2ZXBA 4AG4L 1RUQL 4UOZA 3VXME 3KPMB 1VSCA 1ADWA 3DRTB 1BZ7B 1YUHB 2IWFA 2F9BT 1IB5A 2E9WA 4FFZH 1NC4A 2E6QA 2CHDA 4QAWA 1W0YT 4BSVB 4OF5A 3OAZK 3UTSE 4ADIA 3LIZH 4MS6A 2X4OA 1ULVA 2WLLA 1ACXA 2W65A 3LHPH 4NZUH 1EMTL 1GGCH 4PS8A 1A6ZB 4A7QA 1BGXL 4LASH 1LK3L 5ALBL 4XP4L 4ERSL 1JD7A 4HJUA 2I07A 3LD8B 4G7RB 4M1CC 1YNLL 5E4OA 4HWZA 3I02B 2CD0A 2WSDA 3BVTA 1G7MA 5HVHB 4JLRA 1RIHH 1L9QA 3LRHA 1LK2A 5E2JA 3IJ8A 4WRLA 5C0AD 2Y22A 1WZKA 2UYLA 3V4PB 4U1IA 3J7HA 3DMMC 1TYEB 5A2CA 1X5XA 1LMIA 5IJKC 4NBXB 1LWJA 4W9KC 1RIUH 4X50A 3ARUA 4AQ8C 4ABVA 4V1DA 4E5XG 3MRKB 1J8HA 1SLVA 1RZJL 2DQIH 1I1CA 5IMOB 4ONGL 3RA7L 5C0GA 4TSBH 4DZ8B 2JCCA 4AYMC 3QPKA 2Q8AH 5C9JB 3TPUA 4U1KA 3CUPB 4QWWD 2OCJA 4X8XA 1PTZA 4GJTB 5AALA 1CL7H 5CO1A 1AXSA 5JW5B 3QRFM 4HOXA 3QP3A 5JQIB 4S1DC 3HNSH 2QDWA 1OHQA 3FUMA 1RSFA 3HRZC 2JCCE 5HI3D 2RFXA 5I15L 1FFNA 3CVIL 2R2EB 3MLVH 2MPAH 1S78D 2YJQA 4GRMB 3NAAL 4FQQA 1I8IB 4IEFB 3U2JA 4F9PA 5FOBA 3L1EA 3RUGF 4FQCH 1X5LA 4LLYB 1LQBC 1NCCH 2GFBB 3HS8A 3S37X 3VGDA 1A6TA 1AGBB 4LCYB 5GJSL 4S0SD 3BMWA 3I3BA 4Z1PA 4V33A 3H0TB 3AAZA 4F80A 3SO3B 4MQXD 1FLTX 5I2IA 1OE2A 3RGVB 3S88H 5C0EB 1JZIA 2HLAB 4A63A 1DBAL 3MNZB 4PW3A 4UTBL 2VAJA 2IWKA 4IGBC 4OBRA 1X5HA 3ARFC 1FV1A 4G1MA 4KKCD 1ETZA 3QSKB 3HNTL 4L3EE 3TH2T 5JOEA 3KL3A 1KCKA 5LN8A 1YPZF 3LAFA 4X6DE 3MJ8B 3FQUB 4S1SH 2AEWA 5FW8A 3GUFA 1JZ4A 2CNYA 1I8MB 1QKZL 5IFAH 1A21A 2DF3A 1U8OB 4BZ2L 1SXSA 2Z31A 1MKFA 4DP5X 3L95A 2VAAB 4U1MA 3BN9C 4QO1A 4LDLB 1IM3A 2XTJB 5GGVL 3GXIA 3I50L 2WXMA 4MAYD 5JDSA 4TN9A 2YEZB 3SYAA 3JWOC 4P23C 4M5ZL 4P4KD 5SWZA 3ZT6A 2XKUA 3WSQL 4OQTH 4NHUB 4BWUA 1T21B 5LBSA 2HKHL 2FO1A 4PBVC 3AZUA 2EXWC 5HHQA 3ATAA 5E5MB 3F04A 2DICA 2W0LA 3EGXA 3VFPB 4K3HA 3OHXB 1ZEAL 4M5YH 1HK6A 3QJFB 3ZN6A 4N6QA 3MO1B 4PJ5E 3MLZL 5A6IA 1I85A 2EH8L 2X5PA 2BSBA 3JQOB 4M4PA 1IQWL 4MVBD 4JFWA 5D70L 2PYFB 2X4UB 3T2LA 4B53A 1NC4B 5KS9E 3VG9C 3UXFA 2UX7A 3GXFA 3N2JA 3AY2A 3FSAA 3BD5A 3EO1B 5EZOH 5IROC 3S7GA 2ICEC 4QRTB 5FGBA 2BY0A 2WBWB 4NJAH 2YD5A 1OP3H 3BAWA 3E38A 1FAIH 1GCFA 2WP3T 3OHXC 3CXDL 4YAQA 1CQYA 3HE7B 3N1QC 1U8MA 4NI3A 1RPQA 5F96L 3LNGA 5G5DA 1VFBB 2F7RA 5AW6B 2DMHA 2MJWA 2WO2B 1WZ1L 2K6WA 3V9FA 4N6RB 3FB7B 2NXZB 5AENA 1I1RA 1T83A 3L2NA 4K7PY 4NO3A 5CBEB 5AZUA 3WCYA 4JY6A 3VG9B 2VW6A 1CT8A 2AGJL 2PWHA 2APSA 4ONHB 5KYWB 2AITA 1NCAH 1G7JB 2AQTA 2QVFB 1RJLA 1HOCA 3CGTA 1GL4B 1W2KT 3ATEA 2AGJH 5I66B 1CLYH 5J1TC 3Q7JA 1CLZH 1CXFA 2F7OA 2H8PA 1OWWA 4S11A 3HE7A 3GBDA 4XCYA 1NOAA 2APFA 5T1DH 2OR9L 4RNRA 1JPEA 1OP9A 3BUBA 2RD0A 1P0SE 4ZTEA 2JIXD 2MIZA 4KK5C 2P26A 4GXUN 5FS5A 3MSPA 5DJ8A 2PW1B 2UZIL 4PVLA 1R9FA 4G8IB 1BP3B 3NSFA 1IUZA 1N10A 2IDQA 3MRLA 4NKQB 4JO5A 5EFIA 2Y6SC 4G59C 3S5LA 5JQ6L 4NJAL 3TIEA 1KCSL 1ZVNA 4PJEE 4DOHE 2VXQL 1SM3H 2CK0H 1I1FA 4NZFA 5CUSH 4MJ5A 4AGMA 4NWTH 3RWJA 4Y19D 1XGYL 5I1IH 1R5VB 2VXVL 4GRLB 4UANA 1NFAA 4EI5C 3GK8H 3MUZ1 1YEJH 2NNRA 1OE3A 3OKDA 3WGUB 1A7RH 3TN0C 3TCLB 4JGNA 5AUMB 2P5WE 1ZHNA 3F85A 1FGVH 4K71B 3LZNA 2ZIDA 3NDZE 5A40E 1Q38A 4FX5A 5ERWB 4FAAB 1AR1D 5FECA 4LLUA 4GPVA 1ID5I 2OSLA 5H37A 3R7RA 1SJEB 2FJFA 2AFNA 2XX1A 3EDDA 2AF2A 4MKTA 3WSQH 4B9ZA 2P49B 2X40A 1E9PB 3X2QB 1GGYA 4M5ZH 3QUXD 4ZMVA 4PJBB 4GKLA 4LEOB 1H15A 4HC1L 5I26A 5BZWB 4FFWD 2HLFC 3SO5A 1SY6H 2V2WA 3HR6A 5JMOC 3V6OE 2R0ZH 2JSFA 4MJIE 2P5WD 3FHEA 5J57B 4YDIL 2VXTL 4PGBA 5HGAB 3IDXL 3ARGC 5TQ2H 2R69L 2VE6A 4PH8A 2GG1A 4GBXA 3KMDA 3BH4A 2GSGB 3SODB 1S7SA 5I28A 1A02N 2DWDB 1SBSL 1E5UI 1T4KB 1T6WA 2V9RA 2VLRD 3GMNB 1IE5A 2ZT9C 5C97A 1XIWD 3L08A 4HCGA 4OD3L 3DHJA 3HG1B 4MXVE 1K5NB 1NUFA 3LZOA 1QNIA 5EOTA 2ADGB 2HJFA 3ABLB 2J1WA 1Z5LA 4I0PB 3RFRA 2J8OA 3BPNB 4WY7L 3B43A 2KPNA 4JHZA 4F57L 5AB9A 1J0JA 2RR3A 1FWXA 1D9KC 4PHZA 5DFVD 2XY2A 1CLOH 4MNGA 2KZBA 3FQNB 4Z7NF 5AAWC 4UTAH 5CGBA 1BEXA 2MPAL 2XJLA 1ET8A 2YOCA 2CR0A 2NY0D 4JZJA 2VUYA 4J8RB 1I7ZB 1ZT7B 3H2PA 1KJ2A 1ZRUA 1LO0H 3G04B 1XH2A 1Y18B 3KYOB 1A6AA 3OMZA 1TEYA 2APVA 3BX7C 4HS6B 2R59A 4PWJA 2MCAA 4KRNA 5FYKH 5LG1A 3V4UH 1WAPA 1OSZA 3MOBH 3U7YL 3ECBA 3U6RA 2DLFL 5F7FA 3RDTC 4OCLC 3L5HA 5A16B 3TZVC 5L8LB 3QRGL 4HJ1A 3QWOA 3TH4T 3CFMA 3WN6A 4PJIF 4PJEF 3QNZB 2NW2B 5E6ID 4RBPH 4JPVH 3T4YB 4OM0L 4RA0C 2WYIA 3KLHC 5FO9A 4YO0A 1MJUH 2VR3A 4QXTA 3V0JA 3SDDD 2G5BB 3GHEL 5HBBA 2XWEA 2TSAA 1IFGA 3T3MB 3X14A 4GAGL 3AABA 1NAML 4OTXH 3A3YB 5EOQH 3WLWC 3VH8G 3RY5A 1J0HA 1ETJA 1XGPB 1MG2C 1MCIA 3FT3B 4ALAC 1U6AH 1OW0A 3AAZB 1LO2H 5T1MA 3NOIA 3WKML 4NSKA 5FA3B 1YEHH 5BXFA 5GRUL 1GGCL 2G30A 2R0LL 4J23A 4PHXA 7PAZA 2WTPA 2JELL 3MGTA 2CO2A 2M83A 4B27A 4GRMA 3T6QC 2IVFC 4KWUA 4TRPH 3DGGB 3V4VB 1AGEA 4AQ1C 4BQ8A 1F6AB 4S2SA 1X44A 5A7BA 5MEOA 5HJGA 5CLWA 3W39B 4PSRA 2NY4B 1OSPL 4LLQA 2OJZH 3UZVB 4B3EA 4C83A 1RUQH 2C7UA 4Q56A 1MCBA 1AG6A 1PMYA 4ZW5A 1GYCA 4AM0A 4JZOB 1JSYA 5DQJA 1CR9L 2VTFA 2QSQA 4JDVA 4L4VD 4PJHA 4QLWA 4BJLA 4HG4J 3BQUA 5GZOA 1LE5B 1SDDB 3MVSA 5F93C 4Y7MA 5SWSD 1GGIH 3HI6H 2JELH 4N4YB 4ZMAT 4F8OA 1TTBA 3FRPB 3U46B 2ENJA 5DD6A 4NUQA 1PQZA 5EZJA 3U7WL 2F5AL 3ZUNC 3QIBA 3SB3A 4QUOA 2EE2A 4LPWA 3WFHA 1IC4L 2LU3A 5HJDA 3DOHA 1J05A 5C0RL 2W60A 4G9FB 4R84A 5I17B 4M6NH 1E4WH 3HC0B 3G5VA 1INDL 3SD5A 1S5IH 4JGMA 5JPMA 1ACCA 3PCYA 2EE9A 3AWFA 3QJUB 5DURD 4DGVH 4JR9L 4R97B 3B7UX 3K7UA 3ROLB 4NRZB 3NQIA 3EUDA 3UTTE 3CVBA 1D2PA 3C60D 3ESOA 3CX5K 3GNMH 4PJBF 4QOKA 3MBXL 2JIXB 3BZFA 3DX2A 5ESAA 4DEUA 4KO9A 4X5XA 2W81C 4XBEL 3MOBL 3CN0A 3H3PL 3K6IA 3EADA 3FQRB 1RZFH 1X5ZA 2M26A 3OQ3B 4IRSB 5HYSB 2OMUB 2YD8A 1CXHA 2HAZA 3JWDH 4MMYA 3D6GA 3HE6A 4MA1C 4PV8A 5GGRA 4X7TB 5E94A 1NLBL 5D72H 5FKAA 2CJUL 3PFQA 3Q8EA 3WXVH 4P5TC 2OZ4A 4PRIA 4PVBA 5FYJD 1AC0A 2B59B 4Y19B 2DQCH 1IEHA 3AS2A 3PWNA 2OCCB 2VGLM 1UASA 1YZZA 4XC3H 1GY2A 4HCRL 3EGSB 3WEBA 3H6JA 1G0DA 4NYLB 4X0NA 1TMCB 1I7RB 1ZTMA 4PJFB 3M6DA 4R7DB 1RUMH 3BSZA 4X99A 4HK3N 3K4ZA 1IGMH 1FFQA 2CBPA 1R5WB 1BQHB 2XN0A 1MCWM 1S3KL 2CGZA 2VITA 4Z0XB 1ZVSA 3VM7A 2WKOF 3INOA 2EEFA 2A1WH 3TS8A 2WIMA 1R3IL 4QRFA 4UM9A 5KG9A 2ZCZA 4Y2OA 4ES9A 3AT9A 4AV4A 1ILSA 2B20A 3L5WA 4Y8DC 5BOZG 3ZO0A 3F01A 4ONHA 4Z0XA 4GRLA 1IGFH 4GSUA 3V6FA 1A47A 2CBMA 2DQTH 3L3DA 1JGDA 4I77H 4W9JC 5FM8A 4WW2B 1F4WL 4FE9A 1OAKH 5MEQA 2KYIA 3HPLB 4HGWB 2V3EA 5F9AC 4ZFQA 2KHAA 5DJDB 3WYRA 1MF2H 5E0FA 3EBGA 3QORD 3IDYC 1S4IA 3S3DB 5DHEA 4AQEB 4B9CA 3C6SA 1JAEA 2FX7H 1E67A 5AB0A 2PW1A 2QQNH 1HXYB 4ZT1A 2PYED 3OX8B 1KJMA 1FFOA 4H8HA 1S8DA 1BJ1H 4KQ3L 4I4WA 4RWHA 1AR2A 4H26A 5GQBA 2WXOA 4S1QH 3UBGA 5D1XC 5CKAA 1FGVL 5FKPA 1V55B 2ZSVB 3WENA 3U9PL 3BMVA 4NUGH 4CU8A 1O7DC 3GHBL 4JQIA 3QNYA 1R75A 2BP5M 4PR5A 3UJIH 4YHNB 2OL3L 5J1AB 5KS9F 3FO0H 3GMPB 5I8EA 3LZFH 4BFRA 1BZEA 3MNMA 4WI9A 4ANUA 1KPRB 4XPFL 1SF5A 5HHVH 3KR3H 2WN2A 1P4LA 1HEHC 1TZHB 2NY0C 3GRWL 1QW8A 1LO5A 2IDSA 1E4JA 1ZJBA 4FTVA 4QRAA 5EIQA 4HIHA 1IAIL 1G87A 2X0VA 2GHWB 5E8DL 5MERA 5DJ6B 4UILL 5DZJA 4AW4A 1DQLH 3TT1L 3RVWD 5HVHC 4M7KH 5BUGA 5SX5H 4OGAC 5D7LE 3OWRA 1USQA 3KGUA 4LLDB 1MHCB 4Y4KD 1ND0B 1QPPA 4MCZB 5F1NB 1VPOH 3CX5J 5BZXA 1BQSA 1X5AA 4MJHA 3SYPA 5A3ID 1SJXA 2FBOJ 5CEXB 3TBVB 5E6IB 1LEKA 1KXTB 1OZUA 1KMGA 2H1PL 3U0PB 3U0WL 2IADA 4P59H 3NIGF 4FTVD 1RUPL 2GJPA 2ZX5A 4HCRA 4JG1H 2WXHA 4LBEA 1CWVA 1U8JA 4Y4KC 5TFSL 5T3XL 3U1PA 5D7LD 3D18B 5E4AA 2EC9T 2I9LA 3D39B 2BHZA 1K5WA 1UM6L 2FIKB 2M8XA 1CF8H 3FDWA 3CH1A 3GO1H 1E6JH 1VHPA 3RI5K 5HI4C 3VXMA 3SGJC 3UPRB 3WJJC 2J73A 3QYCA 2UWEB 2EDHA 2V7NB 4J3OF 4HUVA 1JZ3A 5F7EL 4ADJA 2D7MA 3GBML 1UACL 4BE6A 4ABWA 2ODIA 5IUSA 5KS9A 5L9DH 1TCRB 3PHOB 3UTSA 4W6YB 4WJ5A 3EJSA 4NB7A 4YZFE 4KKZA 2Y4SA 1T5WB 4GT7A 3ZRFC 3IF1A 4DKAA 3ZL4L 3DC0A 4NNXA 4EUPH 5C92A 3SE8L 1QO3A 1NEPA 2DKMA 2H47C 4YXLL 3NACH 5D70H 5HPMA 3CFBA 5FUOL 3DX6B 3O6FC 1TSRA 2EH8H 1VEPA 3NPSB 5KVEL 3U0TA 5J11B 4L4VB 2QSCL 5IWLA 4JFDB 1I4FA 4KVNH 4IBVA 1WBYA 1MVUA 1NGWB 4U7KA 3TBBA 4BQ9A 2PPFA 4XMLL 2HX9A 2P5EE 5DEFB 4E9YA 4RFEB 15C8H 3JZ7A 4YSDA 4OJCA 5EUOF 3RWIA 3QW9A 4HCFA 3ZMRA 1MY5A 3BGMA 1U8CB 3W2DH 3HE6D 2WZ6A 1FL6A 3GMQA 3DHUA 3VI4B 1JK8B 2X2YA 3DJRA 5FAAA 2WLJA 2YD6A 1LYQA 1SZNA 1Y6KR 1G1KA 1W72H 3HEIB 1K3IA 3KBFA 2HH0L 5DJ8B 3T5WA 3K6NA 1V3MA 4UAOB 2O5XL 3D3VA 1F2XK 2XV2A 2GTWA 1F3JA 4L1SA 4BZ2H 5T33L 2HRGA 4GLRH 2P9RA 2VLME 2Y69B 4GP4B 2VDLH 3A6CH 2VM3A 1U8IB 3QDGE 4JO4L 2XV6B 2PXYB 1RZKC 3ARBD 2EACA 1F02I 1TQBC 1QNZL 3H7BB 4U1JA 2YGVA 5HVWA 1DCEA 5GHWL 1CFQA 4HK0A 5E2UL 2A77L 3D4ZA 1Z5LB 2EKJA 2J1YA 3WEXB 1LO3H 4BD4A 4BUQA 4D0DA 3QHTC 4OZFH 1WITA 2LR4A 1WCBB 3LKQB 4L1BA 3ZDYB 4Y7OC 4N2MA 2GABA 4EMZA 2WQAA 3KLKA 2GAZA 5IVXB 3LV3A 1T4KA 4DK5A 2KMWA 4N2FA 2J6WA 4WI6A 3S36H 1ZT4B 1U3NA 2LTQC 1TLMA 5D1QD 2WLIA 1MSPA 3SSGA 4KHTL 3WFZA 5BO1L 3I9IA 3BYYA 3W56A 4IRJB 4RDBA 4X9YA 5AZEL 5BO0D 4BHUI 4QTIH 1LE5A 1A5FL 4OV5B 5FK9B 4PRHE 5FYLE 4KZDH 1QWNA 5G4OA 2BOCB 4XH2B 2X2UA 5J89A 3NJXA 1HXMB 4A7SA 1WFTA 4NQSB 3WE6B 1GTFA 4P48A 5KBPA 1TO5A 4S1RL 1FF5A 1OY3B 1U3HC 3U4AA 5IQ9B 4YZWA 3GSWA 1EAPA 2PO6C 4NT6A 5KVMC 2DAVA 3MLTA 3RPIA 5FA4B 5FYJL 1NAMA 1ZDQA 3TV3L 1L6XA 4HIXL 2CBOA 1T1WA 2X9XA 2J12B 3AT0A 4J8QA 3RUGA 3V5DB 3UG4A 2WQUA 5SWZE 3ZRCC 5FV2A 5DRXB 4JO1L 2DBLL 3ZTEA 1NMCC 5GZOD 5DWUL 3N42F 2O5ZH 4M3HA 4U6HA 2XWTB 2DQJH 2EO7A 1BPLB 3TBCA 1JGVH 4J3UA 5IB1A 3U79A 4GYBA 5IR1A 5J3HD 4L8CA 2XWCA 4BGLA 5T3ZH 3RWGB 4AJ0A 3EJZC 3GZKA 3S4SG 2DN7A 5KVDH 1SUHA 2JQZA 2CLVB 2NY3C 4A2LA 1NCDH 4IRZA 2EE0A 3SQRA 5KOVC 3BGAA 5FDWA 1XF1A 3VRIA 5FB8A 5GZOC 2Q20A 5KW9L 3ULAB 2OV0A 4WU5A 3TWCL 5D1XD 2NPLX 1OAQH 4P2QD 5GGRB 5LUMA 4OCWL 1EMTH 4AYBA 3V9CA 1ZT1A 2JJTA 1HVXA 2W92A 4O51B 5GGQL 3Q8CA 4RMBA 4AL8L 3P2DA 2BHUA 2Y2YA 3GD1C 4JO2H 3GSUA 4AMWA 4GS7C 3K5RA 5IV2A 3ETBF 4M61A 4RETB 2QPDB 5LGYA 1G7QA 1RIVH 1XGUA 2NXZC 1PX8A 2AZUA 2PP9A 1BV8A 3FONA 4M6OL 3SKMB 4NQDB 5DRWB 4IJTA 4U1HB 5BCAA 1M7XA 4IU2B 1INQA 1C1EH 3DUSB 5T1JA 2Z8WC 1F90L 3HUJF 1SXZA 1RP8A 1A6WH 3BIKA 1FVEA 3I6LD 3IEAA 4M3JA 5E8PA 3PL6A 2X4NA 2OULB 5L0QC 3BO8B 1T3FB 2B5IC 4R5XA 4IKLA 3BH8A 2PR4H 5JTWA 4X7FC 1ANUA 1FYHB 1JDCA 1MFBH 3W1ZA 4L4VE 4MHHG 3JV4A 1G9ML 2GUYA 4J3BA 1QSVA 2GTZA 4NUPA 2WQ8A 4QYOA 2W95A 3H4HA 3OSVA 1HSBB 3FU7A 4FKEA 1MPAH 5DFAA 4PG9A 1RPUA 5FDYA 5CNHA 1CU4L 4ZMYA 2E7BA 4FTVB 1HHKB 3MYJA 2P8PB 2IIJA 5DC0A 4HJTA 4PIBA 5D71L 2HZHA 1KUMA 2E7LA 4JFVA 3F7YB 2H7WA 1FZOA 2VUOA 4QOKB 4XNQB 1MCWW 2CNZA 1DL7L 3D48R 3V52L 4KFMA 1TQWA 3QE5A 5ETUB 4DFHA 5EU7E 1SUJA 1J0YA 2X7LA 1FRGH 3A4FA 2FD6H 4L8DA 1F6AA 5E6RB 4L5FH 1MFBL 3T04D 4KTDH 1WIPA 2JB5H 4JN2B 3SY6A 2WZAA 2AXJA 4KK9C 4AZUA 3CSTA 2D03H 2EUWA 2D2OA 1ET5A 4UDUB 1ZE3C 4G7YH 2R2HB 3MLXL 3WHE0 1TO4A 1X3DA 5EN2A 1I9IH 1Q9OA 4IBSA 3I6SA 4C55A 2IPUK 3R4RA 5I1DB 1NWPA 2N4IA 3V9EA 3FQTA 1W8EA 3VWKC 4CMMA 5I0YA 1SN2A 4AE1A 1A8JH 5CCHE 1CI3M 2R1YB 3G6JF 2DQGL 3O2DH 4NC1E 3ZJAA 4NRZA 4QXVA 3HNVL 4MMZC 2Q7AA 1I7TA 4W68A 1J86A 1JUFB 4XPGL 5DO2C 3IDGB 4WFHD 3R06A 2AEQL 3O0RL 4JO2L 4QJ4B 4L4JA 2OZNA 2WOYA 4Z7QB 2E27H 4AW7A 5LCVL 3D4YA 2ITFA 1L9RA 1WJ3A 1MRDL 2R56L 1S7WB 2EDRA 2G3MA 4F15C 3VYNA 1JWMB 3HKFA 3STZA 2XTJD 4XO3A 4WCYL 3HE6B 5J6GB 1E4KC 2R7EB 1ZA3B 3KS0H 2GSIB 1Y07A 3D52A 4YDNA 2E3VA 5KVDL 4G7VH 1SHMA 5D7JA 2XYCA 4F7CB 4RAVA 5DD1H 1KF9B 1QWUA 2A9ML 5D93B 5HDLA 2B0SH 1CD1A 4ICXA 3CVCA 4I8DA 2NNAA 4XCYB 1UH3A 4Z3IA 2OTPA 1ZANH 4HSCX 3B9KC 4XXCC 1WT5A 4G9FE 4UT9L 4B9GA 3NCYS 4KHXL 2YGPA 5EEZA 3LN4A 3RWCB 2J43A 1FFNB 5DTFB 4DVBA 5L4JA 1K8DB 1N9PA 2BXYA 4S1RH 4A67A 5FW7A 4K0OA 3V0WH 3IKKA 3H55A 2DYSB 3VXRB 1GMIA 1JXFA 3C08H 4X4XB 5HYSG 1D5XB 1TQUA 4MA7L 2FJSA 4Q14A 4DP2X 1DBML 3U36A 1L3NA 1MI5D 1A22B 3BVNB 5IUCA 4AQOA 1DVZA 2XRAH 4DQOL 1P5VA 3T2NH 3HE7D 4OLUH 3V6ZA 4NQDA 5DRWA 5IB2B 1MNUH 4CADA 1JGEA 2BSCA 4HFWB 3FCSA 4R3SA 1OT4A 5A2AA 3RWFA 7PCYA 1M05A 1KYAA 2X88A 2EDEA 3C9NA 4QEGA 5FXCH 2YRPA 2EXYC 1N0LB 2AP2A 3ZGHA 4KK6D 1YEKH 3MLUL 4RA3A 4ZZFA 1MFEH 1TPXB 3GSRA 2APTA 2RIKA 1UD6A 1F13A 4OIIL 1A2YB 3D05A 1AZRA 1FBIL 1EZVX 3X1EA 3GXPA 2EIKB 3QDGB 1FZJA 2J55A 3HUJB 3PXHA 3SQBA 5KBMA 4PB0H 4LSTH 2IDUA 1N3NB 1OCWL 4ZI8A 1UKQA 4WTZA 5T1KA 5B22A 4DTGH 4FFYH 2GPZA 3P4MB 1FYTA 2NY5L 3DIDA 5I1AA 3OKEA 4FXKB 3UADA 2NNXA 2XWBA 3LZQA 3IU3A 4R26L 4P5KB 1CG9A 1OTUD 4AV0A 4UNVA 5DUMH 1C16B 3NYKA 1XIWC 3NUKA 2ZX9A 4FYRA 3TNNB 1CDBA 1TJHH 4JZNA 4MQXC 4EIZC 3W2DL 1DVQA 4GG8A 4OI8A 1IAII 4P5KA 1NMBH 3P30H 1F1AA 3MBWA 3AQXA 5EULV 2X12A 4PAZA 3DO7B 5D4QA 4ZXBC 2YFOA 3VA2C 3IVKA 2YRLA 2YEQA 4F2MA 2IOIA 3EHBB 1QBLH 2XA8L 4P46A 1OF2A 4GSXA 1OM3L 2F5BL 1R33A 3EZ8A 1UWGH 5AKRA 3BEWA 1A8ZA 3KDPB 4JFHD 4Z3HA 3CLEL 1R47A 5CGYD 2D4DA 3DX6A 2QHRL 5DQDL 5TDNA 3V7AE 2VSKB 4UINH 3VD5A 3Q8AA 4ZMNA 2OS7A 5FHBH 3CDGA 4NQEA 1IM3D 2BIHA 4PJCF 1OP3K 3ZRSA 1Z3GH 5GSVA 4Z7VF 4XN1A 4U4BA 5AYTA 2ZKWA 3QUXB 1Y1UA 3ATDA 1QFWL 3BP7B 5EDXA 1B88A 3F00A 3P9LA 4AZ8B 2QMJA 3LPPA 1B4JH 2V17H 3FXIC 4JO3L 2X9ZA 1QBAA 1A65A 1DQDH 1FVCB 2EXWD 1JV5A 2VCOA 2F53A 2VDKL 4JJHA 3M7OA 4LPXA 4Y16D 2W07A 5C3LD 4KU1A 1ADQL 2A6KA 1E6JL 5IG7A 5T3ZD 1A7PH 3CIAA 3UERA 5F7DA 1HC1A 1S9XA 4P0DA 4UQDA 4I3RH 5CF3A 1B6UA 1UM6H 4L3EB 3IFLL 4TVPH 2YGOA 3CBRA 3L8QA 5CSGA 1VCAA 3U9WA 5J12B 5DCCA 2FQEA 2GTWB 1I3RA 1QI4A 2L7UA 1HQRA 4PRAB 4IBUA 3T65A 3DK2A 4RRPA 2FJGB 1AP2B 1S9KC 3U0WH 1MWOA 1PAZA 2IBZX 1NEUA 3FFDB 3UZQA 4TTGA 1ZLVH 3JTSA 5EBWB 3KJ4B 4I0PD 1RLBA 2PO6A 2D31A 4JHVA 4TXVB 2AJZB 1VPOL 3MV9E 1LEIB 4Y5VB 5AYUL 5BVPH 2GY7B 4PRHD 4BE5A 4NCC1 3RNQB 2NZ1A 5DUML 1YDPB 4YNYB 2X4NB 2VLJE 3X1NA 1KEML 4NKOA 1U2HA 1JPST 2XIDA 3MREB 4PJ8A 1JMXA 2F19L 3L4YA 2WUBH 4ODBD 3EKCA 2VWEE 3BKJL 4IHOB 2RQ8A 4O02L 3X13A 3P4NA 4HKBB 5HDBB 1DN0A 4PJAF 5A2KH 3GRWH 4JFFA 3OJDA 2N56A 3UZEA 4PB0L 4PGDB 1EAOA 1GZQA 3OAYK 1J8HD 1DDTA 3BGMB 3DHMA 4LRNL 2JJTC 1KTDB 2XWRA 2DQMA 1R24B 5HHPB 1T3FA 1YEKL 3FTWA 1AOZA 3F5WA 5EC2B 3AG4B 3BPOC 5C7XL 1HYSC 3B5TA 3JVGA 3Q13A 1O6SB 5JIIA 4DKEL 2LU4A 1UB5B 4XPBL 3K72B 4KGJA 2D4FA 3QQ9C 1YLBB 5I0ZA 4XBPA 1CICD 4KX8A 5FK9A 1CE1H 4PJGE 3TV8A 3D9AL 2K0RA 3LVEA 4XODA 2WXJA 4PP2B 5F6IC 4NN7C 3ZSSA 1U8IA 4QY8B 1SN0A 4XNUH 1WS7A 4W9CC 3ORJA 4UDUA 5DHYB 1X7QA 1VEOA 4FNTA 3SOBH 3WFCL 3FS9A 1O5DT 1XGRA 4M7LL 4CJ0A 3T4AB 3N1GC 4HHAB 3RVTD 3Q3GB 4JGUA 4M7ZC 1CICC 1F4WH 43CAA 2YXVA 4XHQA 2PO6D 2X7LB 3CPLB 3QRLA 3TYFA 4N2AA 2DQTL 1O6SA 4GKNA 2Z31C 3ESVF 3L3OB 3VFUB 4WU5B 2XICA 4DGYL 1E9QA 3PLYA 4UT9H 3D08A 4Y2DB 2ESVA 3LB6C 1CGYA 5C0CB 2Z8RA 4N2CA 2NY4D 5EU6E 4HWNA 3VSVA 1H3TA 1JNNL 1BDYA 5IB4A 5KYUB 4KDWA 2DM4A 5JW5A 2EKSA 2IOMA 2HG5B 2BLFA 2QVMA 1D5RA 4OF6A 1OP4A 2EIDA 1EEYA 4G8GD 5KSUA 3OSKA 4KVCH 4AYSA 5CP7B 3V79C 4OAWA 1AKJD 1RUKH 2Q7NA 4YPGA 3BVXA 3MLSL 4R97C 2DQHL 5IK3A 1KLFB 2Y7OA 4XB7A 2AVFA 1EO5A 4N5ED 3DSFL 2BOBA 2ZQKA 4UV4L 3PGCB 5LCVH 4F5CE 3MMEB 3OVUB 4BXVA 3I75A 1GR7A 2ZNXA 1G7IA 3QYNA 1NGYB 2VDRH 4U05A 5ANMA 3IWVA 4H13C 1EGJA 3VWKA 1OALA 1GYVA 3IJ9A 4NRXB 5DC2A 3WIFB 4O2EB 1P6WA 1SVZA 3UYPB 3CLFH 4U31A 3WJMA 5J9PB 4QHMB 4Q0XL 2IXQA 4PGJA 2ID5A 3CHSA 4D0BB 1ZHLB 3EO0B 3K2MC 1KZQA 4ZFFB 1RUKL 3M86A 2DEWX 2A73B 4JS7A 4XMPL 2E7CA 3VXUB 2FO4B 3EO9L 4IW4C 1F6LL 4ZOEA 4UB0H 3MV7E 5DJDA 3RAJH 3RU8H 5CWSA 1UXLA 3QR2A 3GJFH 5DJ0B 4CU6A 2EVHA 1A64A 3DTUB 2EAEA 2QHRH 5DQDH 4XPHL 3MV9D 4KZ0A 5EFIB 4E9XA 5C0RH 1MCRA 3UJTH 1DN2A 4PJCE 2HMIC 5CWSB 3FOLA 3DO3A 5BRZB 4OJAA 1T7WA 3O6FB 1ZHKA 2TAAA 3C09C 4BCXA 1O7SA 3U7WH 5J11C 2ZKHH 4JRWA 4TSAL 4HEPA 1CBVH 1PX3A 3OJMB 1EDYA 3ZLQC 2V3DA 1SJHA 2HJLB 2ADIB 1I9RL 1QAWA 3P30L 3WN5A 3GIZL 1KIRA 5B3SB 5AD0B 5I73C 3NFNB 5C08B 4ZX5A 4AM0B 1T7VA 2DQFA 4IK7A 2WBJB 3RTQB 4WW2A 1USZA 5LJYH 3A0OA 1GOFA 1YECH 5GS1C 1R19A 1Q9LB 2V37A 4ZPTA 4Y2NA 3IB4A 1BMWA 2ESVD 4XOAA 5C3IA 3FTVA 2NUPB 2B1AL 3UOAB 1ECYA 4FLSA 3SCMC 2YN3A 5FFOA 1HL4A 3EYVB 1GAFL 5IEKA 2D3JA 1X9LA 3LXBA 4ORGA 5JHDE 2PTTA 3RY6A 4Q9QL 3KPRB 4PG2C 5LWYH 3TN0A 5A43C 3QXVA 1NGXA 2DDQL 2OXHB 4DUVA 3BN3B 3EBHA 3QORB 5I18L 2PPAA 3VSQA 2OR7A 3NEOA 4TUJB 3IFPA 1JZEA 3P4MA 2WTRA 4BDVB 4EI5A 3HI1A 2F8IA 2I60L 3KWXA 4X6DB 3WAJA 3DO7A 1N4XL 3FO2A 4BHUA 2P4AB 3PQYE 4PR5B 1NINA 1TENA 4JFXA 2O61A 3PJSA 3QQ4A 3F83A 1T66D 2J6EL 2BH0A 2ZAIA 2DEYX 1MNUL 1BQLL 1YYML 1E65A 2YXWA 3T2NL 4LSRH 4WUUE 3AM8A 2MHAB 2QADB 4IRSA 3PAVA 2IANA 3F62A 5I0XA 1LDSA 2XV3A 1OD7A 1WHOA 3VTTA 3VCLB 5I30L 2WSKA 1JOIA 2GI7A 1DBMH 2Z1KA 1OP5H 1QLFB 4P2OA 1LLAA 1J0ZA 2J2ZA 4GXVL 4NWUL 4CSTA 1ZA6B 3BZFB 4ODXA 4JKKA 4MHHI 1HWGB 4Y5YB 4L3EA 5GZNC 4G6KL 4L37B 4F3FB 2BWIA 3A24A 4OKVA 4OD2B 3ZKND 4X6BA 3AC0A 4MJIA 3BCDA 3BEWB 3U30B 1DZ0A 3EYSL 2IQ9H 4ZW7A 5C0IA 4J8RA 4B9YA 2COVD 2BCMA 4OD2A 2SEBA 2AJUH 1NBVL 3FT0A 4EZLA 1LO4L 2CHZA 1RZJC 1WEJH 1L0QA 1QSFD 4JY6B 4BSWB 1SVBA 3MJ7B 3P4LA 1SYSB 3WNKA 3DIFA 1A7PL 1PFOA 1KGYE 3W0WA 2VSDA 5CSZB 5I76B 4FNPA 1FHGA 4I9WE 4MA8H 5F0MB 3H7LA 2X4TB 2CIIB 4WI2A 3NVQA 2Q5BA 2V17L 4JO3H 4P3WA 3QQ3A 4AE0A 1CDJA 2OPCA 4BZYA 4X99B 4YE4H 3VD4A 1THCA 3GLAA 3O45B 4JREB 4EQ3A 2PF6A 5H4YA 1T7XA 1AQKL 2E27L 3FSOA 1MUJB 1Z3GL 3TONA 5F7YC 3RNQA 1CFVL 3I9AA 4POUB 3PV6A 5DZNA 4KMLB 3WGVB 2WJ7A 2X3BA 2MCG1 4KK8D 4RFOL 1XGTA 2AV7B 5HGBA 5K5YA 2ZKMX 4FFZA 3IDXH 1CDIA 1X4ZA 1GCYA 1TZ8A 3C6LA 4HUWA 1EO8H 1QOKA 3WNPA 3PHQA 2IALA 3E9TA 5BJTB 5M7QA 2IOOA 3T1FA 5CD3A 1F00I 3F12A 1ORQB 3Q6FA 1E4HA 4LXFA 3QUYB 5C0CD 1JTOA 4ENED 4N2DA 1S7TB 4N86A 3MLXH 4I9WD 4C4BA 1JRHI 1DUYB 4G7YL 1QI3A 4CADB 2EO9A 1UT1A 4QRPA 4R5VA 1IO4C