3ULUC

Structure of quaternary complex of human tlr3ecd with three fabs (form1)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
210
structure length
210
Chain Sequence
SVLTQPPSVSVAPGQTARISCSGDNIGSYYVHWYQQKPGQAPVLVIYEDSERPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCSSYDDPNFQVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 3
publication title Lateral Clustering of TLR3:dsRNA Signaling Units Revealed by TLR3ecd:3Fabs Quaternary Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2011-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uluC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uluC01
2YUZA 3EJYD 4AH2A 1U8KA 4YWGL 3VA2C 5F7HA 3KYMB 1JZ2A 4ODVH 1EO7A 2MSPA 4CJ1A 1MJJB 4OGYL 2P8PA 4YBLC 4YR6A 3RWFB 2IMMA 3BPNC 5CCKH 2ICEA 3FAWA 4H5SB 1RZJL 4TNWF 5GRZA 2VITB 3KWWB 4DGVH 3ISWA 3DROB 4FXKA 3NFNA 2EDXA 4S2SA 4HXAL 2D7PA 1QLEH 4R4ND 4GFTB 4IDLA 2R4SH 2XFXA 2WINA 5J57B 3N9GH 4NQVB 5C0DA 1S7QB 3IF1A 5ID0A 1HSBB 4JFYB 2IANB 5E08L 4N8VG 5JXEA 2Q86A 4OFYD 5SWQA 3FN0H 3HRZA 5DJ6A 5FOJA 3G6JF 1QNZH 1U2CA 3WN5A 4JFEE 2HT2C 3JVGC 5K9OA 2UUDK 2GUOA 2BC4A 3MV8A 4MWFA 1XGYL 4LSDA 2KPNA 4ZFGL 3WO3B 1F6AA 2CGRL 2ADIA 4JFFD 4OI7A 3LKSB 3NZ8B 4JPWL 4YXKH 4AL8L 2X89A 3HE6B 3WJLA 5L2JA 3UX9B 2MCPH 1EHLH 2KZ1B 1JPTH 1MJ7H 1UWGL 4MA8L 3TN0B 3GUTB 3KYKL 3IRZA 3VFMB 4GAJL 3FRUB 1FRGH 2QR0A 3QQ3B 5IMMB 5HYJA 1A6AB 1JNHB 1X5XA 2HT2D 5EBLB 1LHZA 3RU8L 2YXMA 5I30L 1I7UB 3K2MC 1MCNA 3L5HA 4PRIE 5HHPB 3MLVH 1ZVSB 4LPWA 1G6RA 4N5UA 1E4WH 5DRZA 2Z93A 1RZGA 3MLSL 2EDWA 4WEMB 3GBNH 4EOWL 4MDJA 1F3DJ 4KJWD 3QUXA 4X6CA 3U1SH 5CJ8A 3PGDA 5E2VL 3PXHA 1JF1B 5FO7B 1WC7A 5IEKB 1C12B 4G8IB 4OI9A 2MPAH 5FYLD 2IADB 2V5MA 2O93L 1HDMA 1SEQH 1BWWA 3BWAB 4NKIL 4JO3L 1U3ZA 6CGTA 4EOWH 4XNUL 4LSRH 4XMKL 4LCIL 2DOCA 3OQ3B 3OPZL 2M2DA 1FG9C 3GI8H 4EUPG 4GRMA 5DJAB 2HJFA 5IHLB 4AG4H 1GHFL 2VDPH 2XTLA 1WIUA 2Q8BL 1FO0A 1M6OA 4Z7NE 1CL7L 1L7IH 2V2TA 4HEME 5IW1B 4LCIH 4Z76B 1FNEB 5CSZB 4LCCC 4NP4H 2Q3AA 1DLFH 1MUJB 4LGSB 4OSUH 3ULSA 4D9LH 2FYYA 2XZQH 2VLMD 1BF2A 3UTOA 2DTMH 4P4KA 4PRPA 1RFDL 4D3CH 5FA4A 3MJ9A 1MJ8H 4P3DA 1BGXH 1ORSB 5CIPH 2A6IA 2B1AH 1MJUL 1UCTA 4HFUL 4JQXA 1QR1B 2R29L 1JTTA 1NEUA 3GMNB 2G60L 1D9KB 2FHCA 4HAFA 1IGYA 3AXLB 4P2QD 3SCMC 1ED3B 3EJZC 3VFTB 1LEKB 2PO6C 4X6FB 1JGEB 2XKNB 4LDEB 5E6ZA 3GRWA 3WBDA 4LPYA 4DEPC 1KELH 5IBUG 1E6JH 4BZ1H 2YD4A 3W0WD 3IXAA 3QO0B 3P2TA 5BMFH 3F62A 5CZXD 5HYIA 1KEGL 1T5WA 3RDTC 3FQUB 2ARJB 3D18A 4TTDC 3KPNB 1KIQB 2X1PA 2A0LD 3KLAB 1RZIA 1S7TA 1BOGA 4NM8L 1I1FA 5DZLA 1IEHA 3UTSA 5TDNA 3WFEL 2PW2B 2PXYC 2HA1A 2J6EA 5J89A 1XF1A 2QLVB 2EYSA 4Z7QE 1J88A 3QPQD 2ARJQ 4JKKA 2PO6D 2GJ6E 1RZ7H 2HFEB 5BCAA 3ZSTA 1S9KC 4CMMA 4LSVL 1ZHNA 1HHHB 1BBDL 5JDSB 1BJMA 4YNYA 5I6XB 5KVDH 1ZS8A 2CMRL 5TPWL 1BX2A 2P24A 4PGEA 4H1LB 4MSWA 1W8NA 1F8TL 1CDBA 2YPLE 1IC7H 4TTDD 1N2RA 2WBJD 3DWTA 3NCFB 3MLPA 1Z5LA 1IC4H 3GJFB 1E4KA 3ROLB 3O2DH 1WIOA 2V7HA 4O58L 3GJEB 3RNKA 2E8YA 2EDOA 5ICZA 4M8QB 4DUVA 1MQKL 3K80A 4UB0H 1INQB 4FQ1L 4EI5B 1ZSDB 3IXTA 4FZEL 2APBA 2BVQA 2X4OB 3ARZA 1WBYA 3TBTA 5CD5C 1D5IH 3WNPA 2JCCE 3VXUB 5TE6L 4LOUC 5ADOL 5DRWB 1BOYA 4M61A 3QEGH 1Y0LA 4WW2C 5DHVA 5BV7B 4NBYB 1SJXA 4HC1A 5JIPA 3M1BA 1NCWL 3ZYOA 1X5GA 5D72H 3MODH 5KS9E 3BKYL 1EFXA 1CWVA 1YY9C 2MFNA 3RAJL 4KXZH 4PJHB 3FZUD 2BX5A 4DFHA 3RWEA 4LEXH 3WIHL 3TNMB 5GRUH 5E00B 3R1GH 4ZUTA 1EO8H 1DBML 3IDNA 4X7SH 5A3ID 4XP6H 4K23L 2IH1B 5HHOB 1I9JH 3BGFB 1EEYA 1JZ3A 1BFVL 3I3BA 5AEAA 2IPUK 5DYOB 4RAUA 1MF2L 4U1GC 3T77A 5E8OA 4NO0A 3PGFL 2ZG3A 2VN4A 2X7LB 2VZOA 4Y5YA 2G5BB 4L3CB 3VG9C 1QFHA 4KK5C 4C83A 5GGTH 3KAAA 3S5LG 1JFQL 4X99B 2X2YA 1OPGL 4CRPA 2BXYA 1FLRH 1HXYB 4KUCF 3FFCE 2NY5L 5T1KA 3U9UA 4MJ5B 1UA6L 2OZ4H 4JLRA 4OM0H 3VRIA 4KUCD 1ZT4B 1T22B 4MB5A 4FQ2L 4PGDA 5IQ9A 2CRIA 4QWWC 2EECA 1MRFL 3E3QC 5JXEC 2AJYH 4G9FA 2GJZB 4QXGH 3BN3B 5I73C 5BW7C 4E5XA 3CX5J 4LVNB 3T1WA 4U6XA 4LCWB 3OB0H 3WN5C 5BS0B 1HKFA 1G7JB 4JQVA 1IAKA 5DK0B 3C9NA 4DTGH 4F7TA 3LIZH 4LQ1A 2XZCH 4FXLA 3MXWH 5E1AA 5KSAA 1NLBL 1M05B 5ALBH 4LASH 3WJLC 4YHIB 3QAZB 4JE4B 4KHTL 3GSNA 1OM3L 2AKRA 5I17B 5FGCB 2X4PA 2ZPKH 4S11A 3VFNA 3HZKA 4LMQI 2O5ZH 1F6LL 1CR9L 1RIVL 1RJZA 1UACL 2VAAB 4WI6A 5H94B 1KCKA 2V7NA 1NFDB 3L3JB 3O3UN 2NPLX 1AGEB 2FJGB 1P6FA 1LK3L 4JM4L 4O02L 4GAYA 3VXPB 5EU6A 1FGVL 5BRZE 3QIUD 1BQLH 4J23A 2W0FA 3SPVA 2J8UB 4MJID 5FM5O 2NY3B 3B9KC 5FYLH 4NN7B 3WL9B 2Y07H 4OFIA 3QUXC 5B38B 2DBLH 3WSQH 3MRBA 5E2TL 5GGSA 3SO3C 1LNUA 4ZDHB 1KFAH 4ZO6A 1NAML 1VHPA 5E95B 1KOAA 4HDIB 1S7UB 3HI6L 3E8UH 4RX4A 4JO2H 4ALAH 5ELIA 1S78C 1OAZL 1N3NA 3ZKND 3H3BC 1B90A 1KLUB 5B3JF 2EZ0C 1UEYA 4HF5L 3MRFA 3BP5B 4Q2ZA 4M7JH 5GSVA 3VI3E 1V8HA 4KKAC 2LVCA 4HMDA 4WU7A 2QADC 4P48A 3BRGC 3REWB 4NGHL 4QTIH 3T0BA 3H9ZA 3AM8C 5SX4H 1P4BH 2J4WH 1Z2KA 3KPSD 4I77L 4F2MA 2VRAA 3WFCH 4HKXB 2Q20A 4JEGB 4JFXB 1IM3B 2JJUA 1NC2D 3EIFA 1YEJL 2L7UA 1IAMA 1J1PL 5CIPB 2HJLB 3L7FA 2NLJB 1UZ6E 3ARXA 3NABH 5CWSA 1C5DA 3GBLA 1AIFB 3P0YL 2YWYA 4P2RA 3GMQA 4PJIB 5JMOC 5TFSH 3LKNA 5F9JA 3NA9L 2DQHL 4OD3L 2UVEA 5L2KB 4KKAD 2VISA 1NBVH 4XTRC 1J1PH 4CN6A 3MRIB 4YHYB 2CLZA 2FL5B 4LCUB 4QRRE 3CVHL 1NDMB 5E9DB 1IVLA 3K74B 1GGCH 2NXYD 5HHXL 1JJUA 1DBJL 3ET9F 2VAJA 3CFDB 4IRJC 1IAII 5JW4M 5HHNB 4JDZB 2IQ9H 1U36A 5IMKA 4ZFFA 1UXSB 1UH3A 4WNQA 5TQ2H 4Z7UF 1JF6A 3BN9C 2B4CC 2X70B 3BMWA 4R2GB 4LFHD 2P43B 5JPNB 4W4NA 4QGTA 3L1OH 2DIJA 4XTRD 4A6YH 3GIVB 3HS0A 1G9EA 1QFWI 5DA4A 2ED7A 5CAYB 5LKNA 2F53B 1AFVL 1CDCA 3QUYD 4IBLT 3EFDL 3BJ91 1S3KL 3LS5H 4JG1H 2NZ9D 4ODSL 1WWBX 4RNRB 1J1XL 3X12A 4JAMB 3RWDA 2F5BL 4IRJD 4G6KL 3S88L 3ME0A 4JHAH 4ZOBA 2AV7A 3SJVD 4OLWL 2D3VA 5TDOA 3CSPA 3VFRB 1G9ML 1I3UA 4Z7VF 5KZCB 4W6XB 2F58L 3WV0A 2PW1B 4YDLC 1FL5B 1ZA6A 1QBBA 2Z31A 4HIHA 1TJGH 1MFAL 1ZVYA 4HUUA 2FEEI 3BW9A 3FO9B 3QI9B 1T66C 4NYLA 2GSGA 1NKRA 2HTKC 3LSOB 4XCYA 2D7OA 1EERB 4PTUB 3RGVC 1AKJD 1DCLA 4NO2B 2E7MA 3QNZB 4MNQB 1Q9WB 1NMBL 3V6FA 3HUJE 3QPXL 5BVJB 3LQMA 5JOEA 2FX9L 3IDJB 4F7PA 3I75B 3OAZK 2LQRA 3HB3D 5E8NA 5D1QA 5CP7B 3FT2B 1AGBB 1QRNE 1MFAH 2BMKB 3N06B 4UTAH 5CMAB 1WGOA 4YHLH 2XT1B 1CD0A 3FCTA 3D6GA 5D96B 2V5TA 3QA3A 1AD9B 3VXTB 4RISL 3G5VA 1ODAA 5DJ0A 4TNVK 1CDUA 2FB4H 3EO0A 5BO1H 5IEHA 1NGYA 1Q9OB 3T0VA 1RUQH 3HRPA 4MQ7B 3T2PA 5CGMA 4JM2D 4AK1A 5C0CA 3VGEA 4AIZA 3O6LH 3RTQA 4QXUH 1MELA 4XBGB 5GZND 4X80H 5ITBH 1MRCH 3L5WA 4HJ0C 3S4SG 3FOMB 4P23D 4NHCL 1FHGA 4J3UA 1FZKA 2A83B 1FBIH 1FIEA 1ZANH 1AY1H 5D2NA 3PNWA 2R2BB 4LP4A 2D2OA 4I18A 1Q38A 1JWUA 4ODUB 1YMMB 3T65A 3GI9L 2CDFB 4YPJA 5SWSE 3E1F1 1PBYA 1LEIB 2H6PA 4KRPD 3TO4A 1FVDA 4ERSL 4Y5YC 3G6JB 3SE8L 5DD6B 3BPNB 1K4CA 3H9SE 1VADA 4DCQB 1ZHLB 2X5PA 2ADFH 4P46A 2DJSA 4JFFB 2IJ0C 2EE3A 2P5EE 3DRQA 2EH8L 1PSKL 4IRZL 4XP4H 4PJFA 5FA3A 1J1OL 1R3JB 1HYSC 5GS0L 3IDMB 3WNLA 2R56H 1F5WA 4WJ5B 5JORA 4Y1AE 2EO1A 4MDIB 4ZFZA 5EH1A 3ARBD 2UWEA 3BP7B 5IGXL 1OGAE 3KNBA 1VFAB 5GHWH 3S37X 3IJSA 2A6DA 4KPHL 4GKSB 5HI4D 3Q5YA 4L3EB 1MH5A 4X4XB 4CUCA 2Z35B 4WFED 4ODTL 2OSLB 3MLXH 1AP2A 4OFKA 2MQCA 1ZWIB 2FD6H 3ALXA 5KSAC 3VWKA 1WIPA 4GLRI 2KH2B 3O6FA 1WTLA 3FB5A 4K94L 4ESKA 4HWBH 1CT8B 3QNYA 4D9RD 1HYSD 1CFSB 2D7NA 4H26A 3MYJA 1K3ZA 3IDGA 5I1CL 4XNMA 1KCVH 2VDQH 2H1PH 4K8RC 3TV3L 3D48R 2CQVA 3JUYA 2APFA 1SMAA 4FQHB 3BIAX 4X8JA 5K93A 3CZFB 2HLFC 1KNOB 5A16B 3L3HA 4XRCA 3CXHK 4XCNB 2AJSH 4PJCF 4BK5A 1JI2A 1HNGA 3MV9D 4G6JH 4R7NB 4G42A 4NWTH 5I1CH 3D85D 1S7RB 4LHJB 3MA7B 1GJIA 5C71A 1T2JA 3NCJL 1U95A 2ED8A 3OHXB 4YHOH 3U36A 1HHJB 3BZDA 4P9HC 2OXGA 1T1WB 3ZE1E 3DSFH 3WIHA 4XPFH 1PEWA 2Q76B 5IFAL 4K8RD 5DLMH 3E3QE 4YZFF 1L9MA 4PR5A 5DSCB 5FGBA 1GGTA 1L0XA 2EXWC 3CK0L 4ZMAT 2HLFD 5C9KA 2XPGB 3UPRB 4NDMA 5C86A 2FATH 5T1DH 3MRHA 5DMJB 2QV2A 3NMEA 3MV8E 1G7MA 4KTEL 1A6WL 4F80A 1NC4A 1UZ8A 2VOTA 4P2QB 5JO5A 1RZJC 4EDXA 2JLLA 4BK4A 1S5HB 4UV4L 1TPXB 3UTZB 4LCCB 5IWLA 3ARQA 4R6UA 3W0WB 1AR1D 4DQOH 4J3VA 1LD9A 1MCPH 4KI5E 1YNLH 3F6IA 2K7PA 3GMPA 4ZUUB 3I2CL 4PLJD 1DN0B 5C2BH 4TUJB 2E6PA 3FFDB 4JQIH 5F7EH 3L95A 1KJVB 1QFWL 3TIEA 4UZGA 3OKOA 1XIWD 2VXQH 5HYJE 2HKHH 4IMLB 3C08H 1AD0A 4AY0A 1WSST 4QCIA 3F58H 1T0MB 4A6YB 4Q6IA 4YDVA 3SE3A 4D0CA 2BSED 2PO6B 4MA1C 5I1JH 2IPTL 3TBWA 1GYAA 5J3HD 2AABH 2X1OA 4TPRL 1J8KA 4X6CE 3GIZL 4DEPB 5FHBH 4BFIA 1OSZB 3AUVA 5JOFB 4F15C 3SKOB 2FEEL 5IW6B 3MRMA 2Z0BA 5D5MF 3FHAA 4GSDL 2Z92A 4XC1H 1G0XA 2YUVA 5IFJA 3HZYB 4NCDA 4TSCH 4LSUH 3L3DB 4AIOA 1Z0MA 2ZCLL 1N0LA 1DVFD 1EAJA 5F89A 5IROA 3QEQA 1OP5K 4GUPA 2BNRD 3JWOL 3T3MF 4PY7B 2AV1A 4DKFL 4WV1A 4LARH 5B4MD 2DM4A 2QHRH 2YD5A 2K7QA 4IOSD 3KDMB 1MCCA 1RZFH 1FQ9C 3D2UB 2YMXH 3V0WL 3KYNB 2DM2A 5F1OB 5I8EA 1FG2B 2QSQA 1GGBL 2WV3A 1NAMA 2YSSA 4XC3L 5TE7L 2VXUH 3PWPD 3OZ9H 2PYEA 4M6NL 1TQBB 5F1IB 4K7PL 4PRPE 1CXEA 4JO4H 4QXTA 1FL3A 2ADJB 2IQAB 3GBML 3V0WH 4N90E 3MRQB 1X5FA 3GMOA 2Y36L 1RMFL 2XN9A 2D31B 4IMKA 5D6DC 3MBED 4V2CB 4MNGA 4EN3A 3IVKB 2LABA 4KJQC 3QHFH 1OW0C 2Q7YA 1PLGH 4IOIB 3S3PA 5HTSA 4HK0A 2R0ZL 3DURB 4U6YA 1NCTA 4WHTB 3MR9B 4ENED 2X4NA 3MROB 2AJUH 1V7ML 2AXGB 3RPIB 3QP3A 4OLUL 2EH7L 4HJGB 1HKLL 3VG0L 3ESVF 1U8IA 2CDEB 4K3DH 4TVPD 3EJJX 1MFCH 2D4FA 1GIGL 4YUEL 2YA2A 2YD3A 1X4ZA 1FZMB 2X6MA 4HS6A 5DJYB 4FFWD 3UTSE 4GG6F 4HG4K 5ICYA 5E2UH 4JKPL 3D3VB 3CFBA 2AQ1A 3MLWH 1C7SA 4I18C 5L88H 5LQBL 4FG6C 2PNDA 3QXUA 2FSEA 1I9RH 5D2LF 3L9RA 4LAQL 32C2B 3LVEA 1T21A 5GGVY 3O45A 5ADPH 1MREH 4IM8A 1T1ZA 1JWSA 2AJVH 1F02I 3FTGA 4U1GB 3QRGL 1RD6A 3NAAL 2BNQA 3TO4C 5JR1H 5FYKH 3DBXA 2A9NH 2A2QT 5MERB 4JKPH 3KPRD 4F33A 3VG9B 2ICEB 1SM3L 3MREA 3RUGF 3BI9X 5GGVH 3GGWB 2BSTA 2ZSWA 1FJ1B 4P46C 1FZJB 2BSRA 4ONGH 5KVFL 1PKQA 3P4NA 4M7ZB 1FAIL 3U7WL 2WBJA 5F6IB 5DFVC 4Q9QL 5KVEL 5EPMB 5EUKB 5CSBA 3AY4A 5C0DB 5HXMA 1J0IA 1QVOA 1C5BL 3FQWA 3QIWA 3F7VB 3GMMA 3MC0A 4FFYL 2VO5A 5I73B 2OJEA 5T1MA 2IFGA 3OL2A 3JUZA 3IDYC 4OLXL 4JFOA 1VGKB 3VGHA 2DQIH 3MRJB 4U6HA 1EEQA 1FAIH 5C0NC 5D9SA 1NLDH 3QH3B 4NT6B 2RCSL 3FHQA 1UH2A 4KQ3L 4XPBL 2X9YA 3QIUB 1JHLH 4LVEA 1AH1A 1XR9A 1IQDA 1FV1A 4MJIB 5DDHA 5EBWA 2RIKA 3VWKC 4PG2C 2DLFL 3O6FC 3PGCA 4KHXH 1SHMA 1NSNL 4LF3A 4RWYH 1CYGA 5L2JB 3DVIA 1YEFH 2YZ1A 3O6KH 4M4PA 4PJ5D 1CZ8L 4ORGB 4I1NB 4HS8L 4F7EA 2VLJD 1YQVH 5H37H 5IB3B 1VB9A 1AXSB 1R6VA 4RQQA 1D5ZA 2DLFH 3BSZH 3TNNB 4MD0A 5DQ9A 3AFLA 1A6VL 1D5BA 5IBTH 4EVNA 4POYA 2OQJA 2VH5H 4HGMA 1MCIA 1WFOA 1A14L 3I3EA 2QBWA 2XA8L 3B9KB 5E8PB 3SN6N 4LP5A 3P40A 1KPVA 2Z8SA 4O2EA 4K8RH 1URLA 3VMOA 4KDVA 3MMEA 1XF5A 4HPOL 2A74A 3BHBA 4FQPA 3EZJB 1O5DT 3S35X 3A6OA 2FX7H 15C8H 3FQRB 3OJMB 4YE4L 3MCKA 2VQ1B 3T0EA 3BP6B 4G9FE 1U8MA 2WK2A 2Y06H 3PE9A 5FGBC 5JOPD 1YN7A 3MGTB 1DQQA 4G8EA 3O3EB 5FHAL 1QFUH 5DEFB 3MXVH 1OAQL 2GT9B 4P9HH 3L3OA 3U7YH 2AQ3A 3RBSA 1M6OB 3B8YA 4D8PB 3MNWB 4OZFH 4P57A 4QO1A 3U48A 1LO4H 2FCBA 2ZNWA 1OY3B 4JZNA 1OARH 3VXMA 3KXFB 2UYLB 5IWLC 3PJSA 4Z7UB 5IT2L 3HLAA 5SWZA 1YEHH 3WIIL 4JFHE 4M7LT 3DX8A 1I8MB 3H42H 3EYUH 3HPLB 2P8MA 1KPRB 2HT3C 4RSVA 4NQED 1MHPH 1T0NB 3P9LA 3HNSH 5T33H 4XNXH 2B5IC 4ZTOH 3CH1B 4KVNL 4GW1B 2X4UB 1ZA3A 4JY5H 3UCRA 3VXUE 5FECA 1CDHA 1FNSH 3AMLA 4IRJB 5EU6E 3ZE2E 2GTWA 5DHYA 3GNML 1L9NA 3SE3C 1SBSL 2WLYA 5CJQL 2OK0H 1J10A 1ZHBB 4JG0L 4GQPH 2VSDA 1XGQB 4Z7VB 3LHPH 4R4BB 3F7QA 4PJHE 1VPOH 3KPTA 5IFHH 5AYQA 1AKJB 2HT3D 5HVGB 5HYSB 2C26A 4YGVA 3LKRB 2ERJB 2X9XA 4G7YL 1OL0A 4R4FH 5CEZD 3PWUA 4Y8AA 4V1DB 3OXSA 4HJJL 3D0LA 1KTLA 3SGEH 3BYTA 2OI9B 1BVLB 2BOBB 4KROD 4YEEA 4ISVB 4WV1C 4X4ZA 1CD8A 3C2AH 1F4YH 3VCLB 4K2UL 4O9HH 1GOGA 1JCKA 1R3KA 1SJVA 4ZOEA 2APVA 2F5AH 3MJ8B 4QRSA 1M7DB 5I1DA 5CEXA 3KPSA 5DD0H 2ZZUT 4YDLB 3LQAL 3OSKA 4PJDA 3QQ9D 2BXZA 1WBXB 5HI5C 2HH0L 5DRXA 3CFIC 3STZB 4JM2B 1NC2A 4JZOB 5HDQL 2GEEA 4WCYL 5JW4N 1JWMB 4NQSA 3K46A 4MCZA 4J12A 4G7VL 4P2RE 3RGVB 3V4PL 5MI0C 2HWZH 1I7TB 3GSUA 3LEXB 4LQFL 1F13A 4XVSL 5JHLL 5AWNH 1JPGB 1K5NA 2P8LB 4UT9H 1U92A 3OGOE 4FQLL 3D25A 5EORL 4AEFA 2V7HB 5INDB 4P23B 4F7CA 1H3XA 3IRPX 3LEYH 3PP3K 4U33A 3HC0B 4IMKC 3UBXA 5C7XL 3WHE0 5MEQB 4UT6L 1MI5A 4LHUD 1Q0YH 1AGFB 1BD2A 1MFEL 1SJHA 3TBTB 3DGCR 1JPFB 1ZEAH 3HCVB 3CAFA 3MGOA 4TVPH 3V6ZB 1HQRA 4LCYB 1CU4L 1FNFA 2DQCH 4Z0XA 3QDAA 1IKFH 3TVMD 5CLWA 5ACZB 3DOSA 4OLVH 2QEJA 3TCLB 2VDRL 4BH8A 3L3GA 5D6CA 4KRPB 3WXWL 4YAQA 4XAWH 2DQUH 4XWGL 1UEMA 5ESVB 3O0RL 4AYFA 3QWRA 1MWAH 4PJ7A 1YEEH 3GK8L 4RCAA 5EC2A 4JFPA 2JJSA 4LRIA 2CDGA 5FYKU 3INUL 4NZTL 4YHPB 3BAEL 4S1QH 1I4FB 4HUXB 5IK3B 1YQ2A 5H2BA 2FECI 1U8QA 1O7VA 3CX2A 4XPAL 1CN4A 2RFXB 3P9WB 2C7UB 4JVPA 1FVEA 2VDNL 3IFNL 4U49A 3ZHKA 3ARBB 3SJVA 4PV9B 3ETBF 2AGJL 1IC1A 1P4IH 4OQTH 2QL1A 2KZWA 5M94B 5EU3B 2R2EA 2R1WA 5CP3A 2OTUA 2DRUA 1KGCE 4K9EC 2Z8RA 4GQ9H 4ZXBD 4Y16C 1A1MA 1INDH 5EO9B 1N0XH 5CINH 1MVUB 4QHLA 4JLRB 3UDWC 4AIXA 2N7AA 2AQ2A 3MBXL 5GGQL 4S1SH 2IEPA 3IU3A 4LLMB 4U6VL 5EC1B 3AY4C 4L8DA 2ZSVA 3VXOB 1IL1B 3I02A 4DN3H 4LNVA 4RMSA 3NIDF 1Q1JL 3BPLC 1JHKL 1IKNA 1RU9L 4MAUH 4OLYH 1RK1A 1G9MC 1A3QA 4FQXA 1B0RA 4QRTA 1P7KA 4EI6A 2I9TB 5C0CE 3P4LA 4QNPF 3RWCB 1FE8L 2GCYB 3VW3H 4M9PA 5ICXB 1FYTD 1YN6A 4M8VA 5C0BB 3OTTA 5F3HA 1H3TA 1HILB 3F7RA 4HWEL 3MV9B 1BQHB 4UDTB 4PJCB 2LU3A 2EKSB 3D85B 1DLHA 1CFNB 4HWZA 4GJTB 3GSNB 3ECBA 5LGJB 1H3GA 4P5MA 1QSEA 3GSOB 2XTJC 1GCFA 1KEML 3E0GA 2GTZA 1A02N 1PKOA 5D2NE 3LKOA 3CXDL 3P0VH 1A7QH 1MCOH 2YS4A 3KS0J 2VDKH 3V9FA 5SV3A 4U3CA 4Y89A 1CF8L 4D94A 4UQ3A 3LH2L 5C0GA 1NQBA 1VGEH 1G7IA 4OGXL 3K8LA 4QY8A 3SPVB 1RPQA 1G7QA 4XNYH 3CFJA 2AXJA 4NKQB 1I1YA 1BJ8A 5KVMC 1JNNL 1IM9D 2D4DA 1JGLL 3LKQB 1T2QL 12E8L 1SYVB 4CL7A 2B7DT 3UTPE 4RFEA 5D1ZD 4PJFE 2PTUA 4KUZH 3ARGA 1N3NB 1S9XA 1W72H 4MVBD 4PRHD 25C8H 5TQ0L 4C56A 2FWOB 4HUMB 3T0EC 1ADQL 3W5NA 2HJKA 4OZFB 4JDTL 4LIQH 2UWEE 1KCRH 2YD6A 3K2UL 1C1EH 4JRYD 5MENA 1QFPA 2VKXA 4R97B 4L8CA 1RUAH 5IJVB 2DYPA 4OJFL 5DUBB 3SDYH 4R9HA 1BVZA 1DQTA 3VI4E 1IBGH 1MFDH 3BOVA 3KJ6H 3WHE1 5IV2B 1Y6NR 3GSRB 5F7KC 3HZVA 4MXVF 2XNAA 3LMJH 1OWRM 4Y0GA 3CFKA 4LPXA 3IFPB 5AG9A 2DQTL 4S1RL 4NKDB 1U3HD 1JMZA 1X5AA 1XGTA 1IT9H 4MXQC 5C0EB 4NRZA 1CE6B 1KJMA 4NNPL 1MY7A 3UMTA 2WWKO 5GS0C 1KB5L 4P2CG 1RUKH 5D5MB 2CLZB 4ODBD 2FO1A 4YQXL 3MLTA 5HHVL 1T04A 1A6TA 4MNHA 4ONFH 1TZGH 1DVFB 4KV5F 4LVOB 3ROOA 2DDQL 3BPCB 5ANMB 2BNRB 1QBMH 1HE7A 3HI5L 1KYOK 2HG5B 3DV4B 1P9MA 1NL0L 5J6HB 4ZFFB 5FOBB 4XBEH 2A9ML 4MA1B 4NQCD 1ZGLP 5D7SL 2VYRE 4WGVB 5E24E 2WIIB 4BSWB 5TH2A 2CIKA 2W38A 3EFFA 3ZT6A 5CEZH 3HAEA 3PWNB 5D93B 2ZCKH 2W92A 5LJYH 4NO3A 2Q1EA 4ZUWB 4RAVA 1A0QL 2X1QA 4FP8H 3SO5A 3PWPB 1MPAH 4U1IA 4ZFOB 4GRWE 5DJZA 2B0SH 4DOHE 3BDBA 3MYZA 1CLYH 1SJEA 1GC1H 4M5ZL 3EOAB 1MLCB 1F4XL 4MLIA 3P9MB 1TCRA 2HYMA 1S5IH 3ULUD 2B2XL 4HS3A 1F00I 3RWDB 5IMLB 4GKZA 5AZEH 4S0SD 1XF3B 3KLDA 3WYRA 4JO1L 1NCAH 1QSVA 4NOFA 4XXCA 2CIIB 3KHQA 2KL6A 3QEUB 2ZCHL 4LVHC 4NC1E 1K85A 2BY1A 4HV8B 2D7TH 4U31A 3BKJL 5DXWA 1S7SB 4JFFE 3MUZ1 1NANI 4Y4KC 3VRLF 1RJYA 1T20A 2VLRD 4UU9B 4C59B 5KSUA 5FF6A 3FJTA 3HNVH 4UILH 3OKDB 1GOFA 2XZAL 2AS5M 5K59E 1LILA 3HMXL 1R5WB 2X05A 3LEVL 2BNUB 3T3PE 4PLNC 1L6ZA 2K3TA 4PJDF 2FIKB 1G7HB 4M62H 3V2AR 1XIWA 3DI3B 4GG6B 4R90L 1MWAB 1H3PL 4M48H 4OCXL 2IGFH 4MZ3A 1OGTA 3HNTL 3LS4L 3K81A 5D2LB 4ZS7L 1U93B 1KTDB 2IPKA 4TRPH 4Y4KD 3T4AB 3U4BH 1F2QA 1VEMA 1RSFA 1QKZL 4LEOA 5C07D 5J6GB 3L5WB 1HHKB 1FCGA 2WWMC 5LXGH 4QRQA 4HUVA 3DMMA 3KHOA 2YHGA 5B21A 1YY8A 3RUGB 2D03H 5FYLE 3LS4H 3U83A 1G7PA 3QEQE 4BZ2L 4XGZB 1JGDA 5E94A 5F3BB 2ZKHL 3PNWB 4Y2OA 1S7WB 4I18B 4MHHI 1JWUB 2CH8A 2AJXH 4PJ8C 5I1IL 4PJEF 4R8WL 5K9JL 2Z4QB 2OR8A 1PEZA 4UOW1 2IMNA 4G8GD 4E41A 5F9OH 5FUCE 1OB1A 3QT2A 4NKMB 4P3CL 3TO4B 3ZSSA 4YFDB 4LPCA 4C54A 5EA0H 5A40E 3TIDB 4K7FB 4J4PD 3C5ZA 2GKIA 1VADB 4AJ0A 2MHAB 5ISZA 3ZT7A 2XWTB 3EYQC 4YHKL 2DQDH 2AEQL 4MQXC 5IB2A 4CVZB 3FMGH 4I5BB 3MRKA 4Q9BA 4NIKB 1S7VB 3HE7A 4PRDA 4JHZA 1TNMA 5HJ3A 1KCUL 3C8DA 4D0BA 4XXDA 5FGSA 2H2SC 2XN9E 5FA3B 3ZL4L 2E7HA 1IC5L 2R2HA 3JWOC 4MNGE 4OCMC 1MSPA 4OLZL 3O8XA 4Z95H 2R2CA 3K1KC 4K9EH 2EDLA 2VLLA 1IKNC 2JIXA 3MBEA 4X5XB 1DQMH 1LP9A 3GHBH 5J1TC 3IDYB 2B8OT 4FQXC 3W9DB 4PP2B 3WKML 1DBAL 5I16B 4PJ9D 3CFCH 2WP3T 5DEZA 3QJFB 2VXSL 1RZ8B 2NTFA 4I9WE 4RIRB 4WDIB 1KLGB 1P5VA 2H3NB 5DC0A 3BZ4A 5CBAB 1Q0XH 4FXGB 5J4MA 5M95B 1WV7T 1MHHA 3K7UA 3QDMA 4QRPA 9CGTA 3FB5B 4ETYA 4I3RL 4ZG1A 1RURH 4QOKA 1U8NA 3NGBC 3S96A 4R26L 3TBSB 3G6AB 5FDWA 3TCXA 2L0DA 1MCRA 4XNMB 2V9QA 4BKLA 4EDWL 1LO3H 2IALA 4OB5H 1CLZH 1DQJB 5ABDE 4I13B 5DUMH 2AK4A 1UWEL 3SKJL 2LU7A 3CNKA 4KK8C 3U6RB 2FBJH 2BNQE 3I50L 4WFHD 4K71B 5I66A 1FIGH 2DQFB 1XGUB 4IHOB 4C4KO 3BZEB 5C9JB 4GMSH 1TZHB 2YEZB 3BEVA 1DL7H 2LAGB 3F5WA 5E8EB 5CBEA 3KPRA 5DJ2B 1DBKL 2AJZA 4MJ6B 1AQDA 2FGWH 3ZKQD 2XWBA 3Q48A 1IQWL 3MFFA 4OM1H 2JK5A 1EXUB 4JR9H 2R8SL 3ARGC 3BGMA 1X5YA 2EYTA 4GAGH 3ZE0E 4TUOA 5DMGD 4F57L 2XI9A 4GW4A 1LO2H 1CLOH 4HIJB 1YMHA 4NQEB 3R0NA 5GZOC 5AYUL 5E2WH 4EXKA 3QZWG 2B1HH 2F54D 4RDQF 3VXRA 3MRHB 3QWOA 3S37H 3F12A 5FUOH 1M71A 1V7NL 3DX6B 1YYLH 3AREA 4F57H 1LK2A 4JFQA 5LWYL 1O7SA 3O2VL 1GZQB 3VGGA 4PD4K 3W9EB 1C16B 1KSRA 1ZHKA 1Q9KA 1V3KA 2VB5A 4XPGL 3VH8A 1NGQL 4R0LA 3GMPB 1H3WM 4AQ1B 2KQNA 5DT1H 1YUHA 1ZT7A 4PJ5A 4K3GA 3L95B 5GS3A 2J1KA 4X6EA 2B5IB 2XACC 1BIIA 3GSWB 4PJBA 2VLJA 2VZ3A 5F7YC 4W68A 5HD8D 1K4DB 4K3EL 2FJFB 2EO9A 1RUML 3SDXA 4TVSa 4KROB 3NVQA 5KSBA 4JDVB 3MACH 3T09A 1P9MC 3CSYB 3CLEL 5J11C 5IESH 1DEDA 2NY7L 3P3YA 5HI3D 3MOBH 5LBSL 2BJML 3FONA 4MYWB 3EO9H 4F37F 1YECL 3IS0X 3VGFA 5E8DL 3QDJD 1FDLL 1R24A 1CE1H 1K8DB 2OL3L 4JRXA 4QRUB 1U8HB 2V6HA 3ULUH 3BUTA 3RWHB 5JA9A 2VIRB 2RBLA 1XZ0A 4PJXA 5FKPB 1YYMH 1MIEH 2NY7H 4I3SH 3SBWC 2F8VA 2BOCA 3CFEA 3C6LD 2AV1B 2FO4B 3K4AA 3QG6A 4WI8A 3CLFL 4LHUB 1RUPL 3P0GB 4MLSA 3QCTL 3ILQD 1J87A 3B2UD 4TULL 4L4JA 1W72A 3D39D 4XT1C 3BO8B 4JN1H 2NYYC 3QDGA 3SE9L 4YIQA 4PG9B 4UINH 4UNVA 3TVMB 3TT3L 1T4KB 4KAQH 3TPUA 5GRYA 4OBRA 1NAMB 3KPOA 1W8OA 5CKAA 1JF5A 3P11H 5MI0B 1LGVA 2JJTA 5SWZE 5J9PB 4U1NA 2QQKH 2PYEB 4TULH 5ITFA 4YXLL 3DRTA 1QSFD 1P7HL 5JHDB 1ADQA 1PG7X 2BRRL 3VXNB 1AHWA 2DL2A 4Y4FC 3KYOA 3AMKA 4PJAF 1CGSL 2X4RA 5DVNA 2R69L 3VMNA 4LPUA 4NZDA 2ARWA 3RJDA 3ZDXE 1IZJA 3DVGA 5HGHA 4LKXB 3UYOD 4PLKD 1YEIH 2NYYD 4OT1H 3HA0A 3O6MH 2ZJSH 3HC3H 4KDTC 4QYOA 3H9HA 3SQOL 1W0VA 2P5WA 1TVHB 1BM3L 3EHBC 5KG9B 4LFHG 1BZ7A 4CW1A 5I2IB 4PRBB 2F19H 1BZ9B 2V2XA 4I2XA 3CVIL 3OX8A 3L3IB 4ZXBB 3DMMC 1CIUA 1IAIH 3UO1L 1KB5A 2KKQA 4Y4FD 4M6OL 3QUML 5I8KH 5HVWA 5DMKA 4UDUA 1AO7A 4LRNL 3CVHB 4TSAH 4OCRH 4UTBH 1TVBB 3BESR 3QNXA 5GSRA 5FEBA 5EUOA 2Y6SC 3V7AG 3CVIH 3RNQA 3T2QA 3B5HA 3C6SB 7FABL 5E03A 3SKMB 1T1ZB 5JUEH 1MIML 3KPSE 3ILPB 3FTGB 5EFIB 2AK1L 1MCEA 3U4AA 5GJSL 4OKDA 3VXSD 3O9WD 5C70A 1FFOB 5FK9B 2FLBT 3C5ZC 2AJ3A 1A1OB 5HYSG 3T0DA 4XP9H 5DQJB 4Y16B 1N59B 4JB9H 3U7AA 5EIIA 4ELKA 3LOWA 3OGCA 4H88L 3CDFA 4WWKC 1CFTB 5EULV 1PKQB 1SBBA 3VWJA 3HE7C 1OP3H 1PW3A 5I0ZA 3OKLB 2AXHA 1KN2L 1MHCA 4LLQA 2DJUA 1MI5E 3O8XC 1WCBA 1BD2E 4G6AD 3BPLB 5I18H 2IH3A 5BZWA 3V0VB 5HHMD 4U6HB 3LQAC 5C6PB 4UNTA 3JV5A 1WT5A 3LZFL 1ORQA 2VZSA 3QFDB 4JHWH 3OKKA 2IAMC 1KN2H 1JK8B 4UQ2A 1AI1L 2D9QB 3MTRA 4APQD 4X6DF 3CSBA 5C92A 4OUOA 5AAWA 4ZPTA 1IQDB 1FFQA 4XP1L 4JPIA 4WWKD 5EIVA 3V52L 1H5BB 4L4VB 3SOBH 1LO5B 1NCDL 4AEEA 5GRWA 1IM9B 4PJ7E 5SV4A 1GRWA 2DM3A 5TE4L 3KLHC 3OAZH 1UQSB 1VACB 2VLKD 3WD5L 3V8OA 3HMXA 3IAPA 4XPTH 1TIUA 3TC9A 1WFTA 1MHEB 5BXFB 3VXQA 1KIRA 3TT1L 1WTGT 4ZSOB 4B0MM 5K9QG 1LE5A 5EN2A 3SJVE 3QXDA 1WK0A 3NCCB 2WMPA 1FH5L 2IAMD 1RK0B 4JRYB 4X4MA 1UCBH 1Y18B 1SQ2N 3U9PL 1I3GL 4LU5H 1TZIB 4B50A 1N8ZA 3B5TA 4DAGH 5EZOH 3SDAD 1UJ3A 4CVXA 5H35B 2QQNH 2QSCL 1I9EA 5GS1A 4F9LA 4W6YB 3NN8B 2ZOKB 4DVBA 4OGAD 2C3XA 4XVTH 2CO6B 4GBXD 5I74C 1B4RA 3BHBB 4Y19A 1U3HB 5L9DH 1A5FL 2NX5B 1YEGH 4ZUVB 5GRJL 3T0EB 3MNZB 4Y5VA 3HPJA 4WUUA 3RVVC 2NXZC 1OWWA 1CD1A 1N7MH 2ESVA 4I8DA 1WAAE 4KKNA 3TYFB 1JYVA 2R0KH 1HEZB 1T1YB 3OR6B 2Q6WB 5E99L 4UV7L 3WJJC 1NDGA 2IBZX 4XNZC 3LN5A 4HPYL 1TFHA 3AREC 4MCYB 3V7MA 2HTLC 4HCRL 4XVJH 1FYTA 3B2VL 1F3JA 3BH8A 4NQCB 3QUKA 4GXVL 3VXMB 3D9AL 4YDIH 3B6SA 3SGKA 5C0JB 2CRZA 4JY4A 3QULA 4R0LC 2GSIA 2X4TA 1Q9LB 4MXWL 3SDCD 3DPBA 1I9IH 3T2OA 1RAMA 4G8FA 2YXFA 3CC5B 5DWUL 4HKZA 5C0RH 2BHUA 5IF0A 1UM4H 3NFSL 4IOFC 3S35L 3QXTA 4QTHA 5H37G 4QT5B 4ODXA 3UPCA 1BQHG 1OT2A 3A67H 1SEBA 3L3KB 2C1OB 4KTDH 4KK6C 3BKCH 5ESQB 1A2YB 3UTQB 5A2IH 1BBJA 1HIMH 3LRSB 1BVKA 1LE9B 5DD3H 5IW3A 3S35H 1XCTB 3O3BB 4RGNC 2JTDA 5DI8A 4PJBF 4UIKL 4C56E 1S9VA 2VLRB 1EEZB 5D1ZA 1S9YA 3OJDA 5IHZA 2EYRB 4PRHA 5L7XH 3BKML 1EUTA 4Z7WA 1I3RB 4KMTL 5MENE 5I15L 5CFHA 2N1KA 4O51A 5C0IA 5DC9B 4PY8I 2WIMA 3I6KA 2JKXA 3EDDA 3WHXB 1EA9C 2BVOA 5CJOL 2YK1H 4X9GA 4XCEB 5KJRH 4MS8C 1PZ5B 4WFEE 5KSVB 1U8JB 2APTA 2JE8A 4GRLA 4PJXF 3ZDYE 1RIUL 3FKUS 4P49A 5I1LA 3THML 2GK0A 3MO1B 1KC5L 2E27H 4Y4KB 2R4RH 2PYFA 3MRLA 5LAXA 4H0IA 4OZFG 2D0GA 5C07B 1K5NB 2GQHA 2DF3A 2HT4D 3C60D 4OUUA 4YJZL 4Y4HC 2I07B 5ERWA 3GB7B 1A3RL 2CXKA 4MD5B 3ARFA 2DLGA 3HC4H 4OFVA 3RWJA 1B4JH 1AHWC 3DYOA 3PQYA 4PTTB 3BQUD 2F74B 4N8VA 5IVXF 3GSXB 4RMVA 5DQDH 1QPXA 4OCYL 3QFJA 5C0FA 1A7OL 1OSPH 5D71H 3WMSA 1NAKL 1HQ4B 3NIGE 3BXNB 1WZ1H 1JPST 1DBBH 2YWZA 4PJEB 3KS0H 4I0PD 3OXRB 4BH8B 2NR6C 4TTGA 3QCUH 2HLAA 4OZHF 1YDPB 3DETD 3L6FB 3SY0B 3MV7A 3OKNB 3V5KA 1DQDH 2IAND 2NMSA 4L29A 1TJHL 4KVCH 2BSSA 4F3FA 2PR4L 4PJGF 5KAQG 3DHMA 5F7MC 1XR8A 4R3SA 4CADB 4KKBD 5DD1H 1GXEA 3EO1A 2WW8A 3K8KA 1JPSL 3N85L 1PZUB 1OAUH 4NKOA 1IFHH 1R3IL 1RULH 3BZFA 3Q3GA 3T0WA 3UZVB 2AEWA 4FTVA 4KY1H 4WTXA 1QBLH 2NW2A 4PJ8B 3PV7A 3QYCA 4GO6B 5CILL 2OP4H 2ED9A 4Q0XH 4JPVL 1C5CL 4KWUA 2VKWA 2HKFL 1F11A 2OL3A 5D8JH 1A3LL 3NIFF 2HMIC 1I1AC 4ZAKD 3TN0D 2LU4A 3KPMA 3WE6B 5C0AA 4J3WA 5HYEA 4L4TD 3VWJC 3HZMA 2YPVH 2FJHA 2BFVL 4JY6B 4M5YL 1N4XH 4BSVA 3D0VA 5M7QA 1N64H 2VWEC 2WLZA 1IGCH 1SYSA 2Y5TA 1H0DB 5FIEA 1CGXA 5AZ2L 2PUQT 1ZVHA 3L5XL 5ID1B 3QB7C 1FLTX 4XH2B 2A38A 1I85C 3A6CH 4CNIA 1U8LA 4J1UA 5DMIH 1RVFL 1YEKH 1A7PL 3JWDH 2R23B 1B2WL 2W9DH 1SVZA 4HQQL 3PL6A 4Q9RH 2G2RB 1RY7B 3BP4B 4G43B 4O5LH 4U1MA 5ETUB 4NO5B 3MFGB 3W39A 4PBWD 1A6ZA 2XRAH 4FFVC 2DN7A 3ZTNL 3CPLA 4J3XA 5DVKA 1ES0B 3LKPB 5IQ7L 4TOYL 3B3IB 1GGYA 1II4E 3NGBB 3QO1A 1BMGA 2BNRE 2ADGA 3OJVC 3ULVL 1A4JA 5F93C 2IBGA 5DK2A 4NRYA 4PD4J 3Q5OA 4OTXH 4UQ3B 3TBYA 5T3XD 4E41E 3MRNA 2HN7A 4JREC 4QY8B 1NCBH 3MRPA 3PUCA 5I8CA 2V17L 3I3DA 1CFQA 5KVGL 4Q97A 3BH9A 5ISZE 5GS1C 2FZ3A 4F9LC 5KS9A 4KC3B 3TZVA 2I60H 3WLBB 3BD5A 3F7PC 2VABB 4WI2A 4FFVD 4WI5A 4G6MH 1Q94A 5CD3B 3X13B 1HWGB 1MFBH 1UWXH 1D5XB 3M8OH 1MCSA 5DJCA 4M00A 4XB7A 3VFOB 4NHUB 1A7NH 1E27A 5F1NA 1ND0B 3ORJA 1T83A 4Y5VC 4HZLA 4PRNB 5EOCL 3MJ7A 3UYRL 2DIAA 3BE1H 1LP9E 2DQGL 1T7ZA 4X6BA 4LBEA 4YLQT 1FC1A 1JV5A 3EUUA 3VFWB 1HH9A 1XH3A 3C5SB 4ZTPL 3CUPA 1FFNA 3O2WL 4JZJA 1OD7A 3WKNA 3MRRA 2NY2C 1U3YA 4PJ9A 2FX8H 2WNGA 2W65A 5MEOA 2B20A 3FB6B 3CFKB 1KIPA 4H20L 1XGTB 1QA9B 2CLVA 4X4YB 3TH2T 4YDKL 3JTSA 1UB6A 1SY6H 5KW9L 5AD0B 2BVPA 2MQ0A 3RVXC 1NGWA 4KGJA 5KOVC 1VFBA 4WO4A 2XG5A 1EFQA 1DDHA 3LAFA 3MLUH 3OAYH 5MHSE 1KACB 3BRFA 2WWKT 4N0UA 1QLRA 3MLTB 3LPFA 3UJJL 2AK4E 4MNHB 3BDXA 1D6EB 5D7JD 5CEYA 3D69A 2YBRA 3VJ6B 4EQ3A 1MCHA 1HHIA 1AGDB 4NSKB 3H7LA 3NCYS 1VKXB 4X0KB 3LQZA 5KTEH 3RA7H 3KPRE 2VXVL 4OZIA 4HIXL 2J3SA 3GM8A 4O4YH 4M6MH 3V0AC 5FO9B 3OKEA 4G3YL 4U1JA 4W6WB 4YXHL 5B8CB 2QJDA 2DLTA 2W1NA 2H32A 3LPWA 4ZO8A 4E0RA 4OBSA 5A1AA 3RVXD 3MRGA 5GQBA 4EI5D 4LLDA 1FGNH 1DFBH 5HDLA 3I9GH 3UJIL 1FNGA 3SDDC 4NUJB 1QSFB 1D6VL 4JFED 2VXVH 2OCFD 2YUXA 3DXAB 4IRSA 1GPOH 1M7IA 2F54A 3P4OA 2CK0L 2VR4A 2FHFA 4KKCC 1GGIL 3X3FH 4Z8FH 2X40A 4PJAB 1FO0L 2BDNL 4ZQKA 5FAAA 1J8HA 3E6FB 5JNYA 5JPMB 3F7YA 1FL6B 3PWVA 2OR9H 2X4QB 4GRLC 3Q6GH 3S5LA 5FM8A 1A9BB 3IDXL 2DWEB 5FCUH 1RJYB 4OZ4B 3WFBL 3ZZ1A 2H41A 1T20B 3VRJB 1T3FB 4HH9A 1BEYH 4NUGH 4XPHH 3NFPB 5HHOD 5I1EH 4KQ4H 5F70A 3FO0H 4PJ5E 3OR7A 3RY6C 4HGWA 4CJ0A 3TYGH 2X4SB 1I8KB 2QQLL 2VLJE 4Y4FB 1ZMYA 2EC9T 3W2DH 1DANT 5HGDA 3SDXE 2ZOLA 4LSPL 5KSBE 5IB4A 4EZMA 5INCB 1LO0H 4R96A 1MEXH 4Z78A 2VC2L 1J0JA 4HCRA 2R1XB 3VD7A 1I1RA 3FQNA 3VXSB 1OF2B 3O9WB 4JRXE 1KPUA 4KU1A 5ILTH 1J5OL 3RY5A 2A6KB 4RGNE 5FB8A 3IJHA 4KZDL 1RIHL 5LGKA 3M45A 4X9HA 1ZTXH 3STLA 1YY8B 3WUWA 1JTOA 2DM7A 4LCWD 3KYAA 3MRCA 1DUZB 1G7PB 5HYQA 2VJXA 3WO4C 4QRRA 2P44B 4IS6B 4NCC1 1E4XL 3BT2H 5JOPE 1MRDL 1A9EA 4Z7NF 1NFKA 2XYCA 4WTWA 2LTQC 3G08B 3C6LA 3R8BB 4G5ZH 3TO2A 3DUUA 3FQXA 1KXQE 3DX9B 3C8KA 1UB5A 4AT6A 3QRFM 4H8WC 2O5YH 5DR5L 5EWIH 3C5JB 4U1LB 3TH3T 2X44D 3D39A 3R4DA 3QXWA 1F4WL 4HWNA 2F15A 4OD1H 4P2OC 3H7BB 4OLEA 1WLHA 5C2UB 5DFWH 2VDML 1KG0A 3IKCA 4YPGA 1E28B 2WSKA 4RMWA 5FFLA 4X6DB 4WWKB 3HG1A 1UENA 4WEBL 3RZWA 3HE7B 2VERN 2EDNA 4LHUG 5D7LA 2VLKB 4KKLC 5C08A 4ZPVA 3K4ZA 2J88L 1PD6A 2BY2A 3Q6FA 1AE6L 3L7EA 4MX7A 4G9DA 2P5WE 4LSTH 3DNKA 5B39B 3FB8B 4NZUH 4P2OD 2IAMB 2P48B 1NFIA 1EDQA 4HC1L 3ARDD 5CJ5A 3CCHB 1UXWA 1CFVH 3BZ4B 4I2XE 3FT4A 1T5XA 2OJZL 4MQTB 4FQQA 1KTKE 3IAQA 2BVEA 1NEZG 3SDAB 1U8PA 2CUIA 4HHAB 5ENWA 1BAFH 4QRPB 4N0CC 4Z7QF 1QRNA 2CR3A 3RQ3A 2YPKA 3FB7A 1AO7E 2I9LA 4PV8A 5T3XH 3S96B 1I8LA 5MP6H 4NNXA 4WU5B 1HH6B 5EUOE 2E5EA 3PP3H 4U1SB 5EZIL 4GKNB 2IALB 4I48A 3BDYL 4Z5RB 2ZG2A 5DJ8A 4OCSH 1A6UH 1KBGH 1R3HA 3O4LA 3QHTC 4OZGA 5D70L 4Z6AT 3DVNB 1QEWB 4POZC 3PWLA 2OTWA 4PREA 4TQEH 1FAKT 1ZLSH 3Q1SL 2YPLD 3BEVB 2V9TA 5EO0A 3VFVA 3TZVC 4JFDA 1NCCL 4Q6YA 1A7BA 1L7TL 2AJZB 3IGAB 3MRDA 1A1NB 3EW3B 2YKLL 4UI2A 2EDKA 4DZ8A 2C3VA 5I74B 4R7DA 3ZYJA 3BVNB 2HFFB 5D1XA 3UTTA 3QIBA 2W60B 3VFGH 3RKDC 4DN4L 4HXBH 3JV4A 1I7ZA 1YPZA 1T83C 3QCVH 3V8CA 2JCCF 5D7IA 3VDBA 4S1DD 5EOQL 4YBHA 3SDCB 5I71C 1RHHA 3X11B 3N1QC 2NXZB 2C4FT 3OF6D 1CK0H 4O2CB 4DKEH 1W0WA 4WGWB 4ETQA 4R2GD 3F12B 1CG9B 2MNUA 1HI6A 2WUCL 5KS9F 3GEWB 4XNZB 1D5MA 1TCMA 4PY8J 1V3MA 3DGGA 4MD4A 2PTTA 1XGPB 4FQCL 5CJXA 3MJ6A 1Z3GL 4FQJH 5JW5A 1FN4A 4DVRH 3CSGA 2P5EA 3O11B 1ONQA 1K9TA 3VD3A 2CLRA 3MUGB 1CBVH 2VNCA 3RKDD 4XX1G 4NWUH 2GIYA 4ODWA 5J12B 4XMLL 3WS6A 5F7WC 1YNTB 4KRLB 5JW3L 1ZT7B 3WXVH 5E6IC 1TETL 4H1LH 3HMWL 4XNQB 1KJ3H 3T8XB 1OGAA 5F96H 3GJFH 1IGJB 3QI9D 3KPLA 3U2SB 4X4ME 5BV7L 4UT7H 3I6GA 2DICA 1EJ6A 2GY5A 2ZUXA 1BLNB 1UVQA 3FFCD 3T0AA 3DIFA 2OM5A 4CMHC 3IFOA 5L8KB 1OCWH 1R24B 4TYUA 3ARTA 5DFTA 4NQDD 4Y19E 4FN0A 4MAYC 3T1FB 1H9VA 4GBXA 1CICC 5CCKL 4XB8A 1ZT1A 1T03H 1NBQA 3RIFK 5DO2D 3QSKB 4DGVL 4WUUE 3U30B 3C60B 4ELMA 43C9A 1UKSA 1OAYH 3PHQB 2ESVE 4P2YA 1ZLUH 3U0WH 4TNWK 2H9GA 3PWJB 1QLEL 3BQUB 3QG6B 4IRSC 4Y2DA 2R4SL 5DS8A 5TDPA 5IIEA 2JB6A 2JELH 1Y6KR 1NCNA 4ZYKA 3N9GL 3DV6B 3WFZA 2J7LA 5IVXB 3PDDA 4XWOC 3VD5A 1FYTE 2NNAB 3FN0L 1EJOH 3U4EB 5DA0B 4V2BA 2COQA 1QNZL 4MAYD 3EDFA 1H8OA 4I0PB 5FM5M 1T1XA 4M4RA 35C8H 1HXMA 2H8PB 3HI1A 4RZCB 1YMMD 1IEAA 5DD5H 3TF7C 4OZHB 4Y4HB 2ZG1A 3AU1B 3ESUF 3OB0K 5T5NG 3WEXA 2P7TA 1HHGB 4YXKL 4Z77A 4GKOA 3BEWB 2QKIA 4M43H 4PUBH 3VFPA 5BRZD 4PJGB 5IMOA 2MCPL 1EHLL 3RL2B 2VN7A 3IDIA 3P73B 3QUZA 2XZZA 2OYPA 1JPTL 1MJ7L 2DTSA 4KRMB 3S36X 4DW2H 3EYFB 1HCFX 4QYOB 3H9HB 1IGMH 1FRGL 4ONHB 4LSSH 1GOHA 3GKWH 1P2CB 4M1CC 3S34H 2V2XB 4UNUA 5C09A 2BHZA 3MLVL 3VI3F 5FYJU 1E4WL 5L6YH 2CRYA 5F1SA 3UPAA 5I1GH 1IGIH 4YHMH 4ZAKB 3P77B 2SEBB 3UYPA 4I4WB 3GBNL 4L4TB 4PRHE 3U1SL 4Z7WE 2VL5A 5JIKA 4L8SA 1JTPA 3GSVB 3KLSA 4BUHA 1JYNA 1J18A 1FNAA 4XCCH 3WFDH 4ZUSB 4L3ED 2QSVA 2G9HB 5LGHH 5BZDB 1UZ6F 2MPAL 3VFUB 4XZUA 5K9KB 4YO0A 4GG8B 1SEQL 4LSRL 3GI8L 2ICWA 2JJWA 5AG8A 4GMTH 4UUJA 3PABB 1XGRA 1IAOB 1I1AB 1BFOA 4AG4L 3VFSB 5I76A 5EIIB 1J05A 2VDPL 5ESAA 2ZWLT 2J2ZA 4RBPH 5DJDB 1K8IB 1PG7H 4XHQA 4H8WH 1L7IL 1DQLH 3MLZH 4PGBB 2KQMA 2RGSA 3PQYE 4YFLI 1CDYA 4NP4L 3B43A 1DLFL 2C1PB 4OSUL 1OHQA 3KYMA 4D9LL 3EOTH 5GRVK 3QFJE 2ATPB 4MA7H 2XZQL 5C8JB 1PDKA 2WM0A 2DTML 3X3GH 3IETA 4D3CL 1VSCA 5H8DA 1MJ8L 1NANH 3RWFA 2GJJA 1BGXL 3F8UB 2B1AL 4H5SA 5SX4I 2Z91B 2VITA 1IGFH 3DROA 1TXKA 1EGJH 4YDJB 3MV7E 1S7XB 5E5MB 4Z7OE 1IE5A 5IHUH 1QLFB 1XF4B 3GMRA 4NQVA 1S7QA 1AJ7H 3O3DB 1HSBA 4J6RH 2IANA 4JFYA 1KELL 3TBVB 3HR6A 1E6JL 4BZ1L 5DJXB 2UZIH 4CBPA 5BMFL 2CUMA 3IFLH 3ULUE 4P9MH 4WHYH 2D7MA 1WICA 4FTVE 3O41B 3LN4B 5IG7B 3TA3C 4NPYB 4AM0B 3MJGX 1NBYB 2HVJB 1P7QD 2O5XH 4JREB 3HUJF 4PPTA 1MNUH 3LD8C 2A1WH 2VZUA 3LKSA 3NZ8A 4HX1B 3HE6A 1S8DB 1X3DA 4HKJB 5GS1B 1X4YA 5C0AE 1RZ7L 1FSKC 4KJYB 5HVHC 1WZLA 4NM4H 1GZPA 3GUTA 5D1XC 5HHQB 3QIBC 3FRUA 3QQ3A 4U1HB 5IMMA 4G6FD 1NCUA 4G80B 5E4EB 1A6AA 1JNHA 5KVDL 4EIGB 5EBLA 3PXJA 1QYGH 1UM6H 3SEPA 3WIFB 4Y5VB 3SCMD 1I7UA 4U0RC 3EJZD 3VGDA 3RWGB 5HHPA 1IC7L 2G75A 1ZVSA 1IC4L 3RL1B 1UM5H 5HYFA 4RRPG 3O2DL 2IFFH 2ID5A 1LDPH 3M07A 5D7JB 2NY2B 5GGRY 4UB0L 1JF1A 5FO7A 4YEFA 3QEHB 3RDTD 2E9JA 1I8IB 3AAZB 3PHOB 2P46B 5IEKA 1C12A 1K2DB 3QUKB 4G8IA 5T1LD 3STBA 1D5IL 2IADA 1JNLH 4GXUN 2F8XC 4Z0BH 3B6SB 2DWDB 3BWAA 3QEGL 2PXYD 1L0QA 1U6AH 4NC2B 5I8OL 1A4KB 3IU4H 5D72L 3GMLB 4E42B 3MODL 1U91B 5DJAA 3D2UD 5JQHC 3WNMA 4G8FB 4HIIB 5SWSD 4PS4H 5JW4R 2XA3A 5IVZB 4PP1C 5JIHA 2BP3A 4LEXL 4WIQA 4JFEB 4LLYB 5IF0B 5GRUL 1JZ7A 3R1GL 3CDGB 3MV01 4UIMB 4OIIH 4U05A 1EO8L 1ZV5A 3H9SD 4G8GE 1CFBA 4KRNA 5I8OH 5IW1A 4Z76A 3RZCC 1F58H 1FNEA 4JFZL 4X7SL 5CSZA 4XP6L 1MUJA 2MCG1 4P59H 3RX5A 1I9JL 1ZLVH 4WW1B 1A7RH 4LLVB 4OF5A 2CXGA 3IT8D 3DUSB 1J86A 2LAAA 1KUMA 1BVKB 4WI4A 1OD9A 1ORSA 3H6JA 2IBZY 4Y1AD 4BELD 1WJ3A 5JLZB 4P5TC 3A6BH 4PB0H 5GGTL 2FIRT 4JFZH 3SDDB 3OJDB 1QR1A 5CD5D 2IC2A 3GMNA 4XI5C 4D9QD 1PYWB 1D9KA 1FLRL 1RZKC 3NACH 4WW2F 3MOAL 3AXLA 4LOUD 5FUZH 2OZ4L 1ED3A 3V6BR 2EDQA 1C08B 3KR3L 4OM0L 3VFTA 1LEKA 1QQDB 5F9AC 4Y2DC 4PRIB 1JGEA 2XKNA 4RFNC 4CU7A 2DKMA 1ACYH 3FT3B 3RHWK 3B9AA 5JZ7C 1G9NH 2AJYL 1YY9D 3QO0A 1DE4B 4QXGL 1NGZB 5E5UB 4NC0B 4NZRH 4NQXB 4C58B 3FQUA 3MOAH 5LVEA 3KR3H 5I1LB 3MCLL 3KPNA 1KIQA 3ZKMC 8FABB 4U1KB 3D3VD 3KLAA 2E7CA 4P5TD 2ITDA 3MRLB 4NOBA 4DTGL 3K4DA 2PW2A 4CN1A 3HFMH 3LIZL 3RWJB 2XZCL 5C6TH 3EDEA 3MXWL 2A73A 2ORBL 4TSBH 5I19H 2FHBA 4N0UE 1S9WB 5ALBL 5F7UA 4LASL 4JANB 4ZS6C 1BREA 4NN6C 2HFEA 3MCLH 3QUZC 4KK5D 2ZPKL 5IB5B 1HHHA 2O5ZL 1ZGLB 5JDSA 5HVFB 3VD4A 1JGVH 4WFHE 4J7RA 5GGUA 3ZE1F 2ORBH 4H1LA 3QXAB 4OZIE 4PGCB 5HY9B 1U8OB 3GJFA 1AXIB 4QWWD 3ROLA 4QHUB 4L3AA 4KI5C 3V95A 1BQLL 3GJEA 3WUWG 4X83A 3PV6B 4JN2B 4IJ3B 5JXED 4M8QA 3WDJA 2R1YB 1INQA 1JRHH 5FYLL 2AI0H 2Y07L 2Q87A 1OT1A 1XR8B 2DBLL 1ZSDA 4N0FB 5GIRB 3WSQL 4ZS6D 4M7KH 4KK9C 1KFAL 4JJHA 4L8SC 4NFCA 2DQJL 3VXUA 3MV8D 2F54E 3E8UL 5DRWA 4JO2L 4ALAL 2JB5H 2LTQB 3G5ZB 1M7XA 4IIQB 1J8HE 5AUMB 4M7JL 3UZQA 3VU2A 2X89D 1VEOA 4KI5F 4F58H 1LEGB 2OR7A 1KCSH 2XOTA 4QTIL 1F11B 2DQEH 1P4BL 4PJHA 4P2OB 2J4WL 2DQJH 3ARDB 3WFCL 3TNMA 1KJ2H 5E00A 5GRVL 5FO8B 5GISH 2VDLH 5JA8B 4AENB 5LCVH 5HYJD 3NABL 4GOSA 2IH1A 2X1XR 4BSVB 3GHEH 2I5YH 2E7LA 4H25B 1XF2B 2EIBA 3FOLB 3QQ4B 1WEJH 5DYOA 3OKMB 1IGTB 4XBPB 1BWMA 3BIKB 5TFSL 3NZHH 4X6CF 3B9KD 5DC4B 2GJ6B 2OTPA 4KDWA 4EUPB 4CNIB 1NBVL 2X7LA 3QUXD 2G5BA 3EYSH 4L3CA 3PDOB 5DURB 4HBCH 4ZO7A 1VCAA 4CVWA 4X99A 1CTNA 3UAJC 1HXYA 4JCMA 1GGCL 4HK3J 4MJ5A 4NBXB 1S78D 1ZT4A 1T22A 3QDJE 2IQ9L 4JPKH 3D1MC 2EZ0D 2YPLB 2R9HC 5AAMA 4P4KC 5F1KC 4HKBB 3UBXI 3NH7L 1IAIM 3VE0A 3R06B 2QADD 5TQ2L 4MB4A 3CPLB 3QG7H 1R0AH 1OAKH 3X14A 1JE6A 3QO1B 2BY3A 4JQXC 4LCWA 5TGBB 1YZZA 2DMBA 3G6DH 3L1OL 5JIIA 5BS0A 2ADGB 1G7JA 4A6YL 5T5FH 5DK0A 2GAZA 1NJ9B 3VGAC 1B0GB 5F7DB 1P4LB 1INEH 2JCCB 3NH7H 2J8HA 1EZVY 3TGXA 2HN7B 3UAJD 1D7FA 3LS5L 3KXFD 3D39E 4JG1L 2MWCA 1DUYB 4XP5H 1M05A 1DP0A 3LPGA 3HE6C 4JHAL 4YHIA 1E6OH 5IBUB 4LK4A 1NUNB 3FAXA 4PRPD 3G04B 2K1MA 4J8RB 5IR1B 5IM7B 5I17A 4XMPH 1U41A 3K8MA 3HG1E 1TJGL 43CAB 3QUMB 1G84A 3MZTA 5H94A 1NFDA 3AVEA 4FABH 5D7LE 5FXCH 1NMAH 3L3JA 1AGEA 5JW4Q 2FJGA 5C08E 1XCQB 1X7QB 3LV3B 3VXPA 4OAWB 1HSAB 1AQKH 1FFRA 3BX7C 2AEPH 3BN9D 5GGRB 4UTAL 3WL9A 5LG1A 4YHLL 1MCWM 5B38A 5EIQA 3MUY1 2XIDA 1OTSC 3V79C 2A6JA 3N1GC 4ZDHA 5DF0A 4RA3A 4N8CH 2FB4L 1EV2E 5BO1L 2WAHA 4HDIA 1S7UA 4NN5C 3FFCB 1E4KC 1PQZB 1RUQL 1KLUA 3UTSD 4V1DD 1CXFA 1QOKA 3O6LL 1AXTH 4NQDB 1R3LA 3H3PH 4OFPA 4QXUL 3REWA 4X80L 4DZBB 5ITBL 2XY1A 2GI7A 3KPPB 2CKBH 2NY6C 3QJHA 5FGRA 5E6IB 4CN4A 1MRCL 4NRXB 4RGOH 5IOPB 4UBDC 4HKXA 4OIAA 4QLRA 4JFXA 1IM3A 3O4LE 3D69B 4OZGE 1T66D 2W9EH 5CIPA 2HJLA 2HTKD 4B53A 2NLJA 1FBIL 3RGVD 5KN5B 2AP2A 1ZANL 1AY1L 4MGXA 1AIFA 1EBAA 4JFDE 4PJIA 5EU5B 3U46B 4YFEA 1K6QH 2IF7A 2P47B 5L2KA 3WS3B 1F4HA 4XVUC 1CIDA 3MRIA 4MAYB 4KZEH 1WBZB 3UTTE 3MRGB 4LCUA 1CICB 4CGTA 1YPZE 2NY6D 4P4RB 5E9DA 3T2NH 3MCG1 5D7IE 5BQ7B 2L7JA 5A2KH 1NBZB 1D9KC 3CFDA 5HHNA 2ADFL 4JDZA 4FZ8H 3PP4H 3FO1B 2NZIA 1YNKH 4MMZC 4KJPC 1QP1A 4IRSB 1B6DA 1UXSA 4XP4L 3CU1A 3N1PC 5HHME 4YX2H 5BRZB 4YBLB 2R56L 2X70A 3U0PB 1EFXD 5JNYB 1FORH 4HJ0D 1I7RB 4W70A 4PRAB 3C2SA 3ALPA 4YBQC 3SKNB 5IB1B 1RZKH 3SE4A 2XWJB 4M1DH 3I6LE 4WUKH 4E9LA 1NMCC 2ENYA 5FYKD 3E6HB 2F53A 5GHWL 3EOBB 5DRNB 1PY4A 5I1KH 1EVTC 4RNRA 4Z18A 4JAMA 3MLXL 4DUWA 2FD6L 4AEHH 5IKCB 2EIZB 2O61B 3VFRA 4ODHH 4HWBL 2PW1A 1FNLA 1FL5A 3O2DA 3EGSB 3SGDI 4JQVC 1TJIH 3FO9A 3QI9A 3LSOA 1KCVL 1EEUA 2VDQL 2H1PL 2VDOH 4HFWB 4L1HA 4PTUA 5JQ6H 1XFPA 4NO2A 3QNZA 4MNQA 1Q9WA 3DTXB 5BVJA 3G5XA 5EZJB 3IDJA 3I75A 5CHNB 1YJDC 5CP7A 3D87B 1KULA 1AGBA 3HR5B 5I1AB 2AJSL 2BMKA 5CMAA 1ETZB 4G6JL 4ZD3H 1C8PA 4NWTL 2PN5A 3TWCH 1RV6X 3VXTA 4ELME 2V2WB 4BQ8A 3ULVE 2EDTA 1Q9OA 4YHOL 3O4OC 1KENH 1RJLB 4UOJA 1P1ZB 4MQ7A 3DO7A 3DSFL 3BGAA 4XPFL 5C0BD 1KJ2B 3JTTA 4X7TB 2A77H 3D5OF 1U58B 3DUUB 3A0OA 2GITB 4L1DA 5DLML 2P45B 5KSAD 4P3WA 4XBGA 1T80A 4JJ5B 1IRAY 2FATL 5T1DL 3FOMA 1G7LB 4JFHD 4P5KB 1HZHH 1G6RH 5CUSH 2A83A 4N5EC 2ZNXA 1XT5A 5GGTA 5BVPH 4QEGA 2R2BA 4NJAH 3ZE2F 5T3ZD 4ODUA 2YC1B 1YMMA 2CDFA 3KPQB 4OFYA 2OZ4A 5EU6D 5JDJA 3V5DB 2I24N 2IG2H 4DQOL 1MCPL 3JXAA 1LEIA 3Q0HA 1YNLL 5MEPB 4RAHA 5DTFB 5C2BL 5J56B 3G6JA 4JQIL 4PJHF 5F7EL 3CMOH 5DD6A 1WWWX 4G9DB 5K33A 1W2KT 4DCQA 2VXQL 2HKHL 1ZHLA 3TLRA 3ES6B 1P7QB 3C08L 4IDJH 3S7GA 4OV6F 4F9PA 4JFFA 4RX4D 3F58L 4XHJC 2CPCA 2GFBB 5C09E 1GAFH 3HUJB 5J1SC 3U0TB 1R3JA 3ARYA 3IDMA 3J8F7 3K3QA 2EXWD 5I1JL 1UJTA 4WJ5A 4HT1H 2AABL 4S10A 4MDIA 5FHBL 2QTEA 4PV8B 4LVNC 4M1GH 3BP7A 3GO1H 1X5JA 4RMRA 5F88B 1T2XA 4G6FB 1VFAA 3TP4A 4I48B 4XC1L 3TA3B 3SCMB 3V5HB 1YEDA 4GKSA 2Y5EA 4L3EA 5EU7E 3MLYH 4OV5B 4X4XA 4TSCL 2Z35A 4LSUL 5DJ8B 3MJ9H 2OSLA 3S3JA 1FPTH 1ZWIA 4P2RD 4B5EA 4LARL 1AR2A 4PB9H 2QHRL 1UYWH 1CT8A 5FDYA 3FN9A 3RDTB 5HDBE 1CFSA 1MLBB 4DGIH 1RZFL 2BERA 2YMXL 3H9YA 3NPSC 5BJTB 2X42A 5T1LB 3MA9H 3GRWH 4MA3B 5FKAB 4WFGD 5CGYC 2B4CH 4YHNB 2PXYB 3RX8A 4FQHA 1DEEB 1JGUH 3CZFA 3PIQA 4LNRB 2VXUL 5A16A 3DX7B 3OZ9L 3MLRH 1VEPA 4XCNA 4JO4L 4WY7H 3EYOB 5SWSB 2Z31C 4R7NA 4HMCA 3TFKC 5JXAL 4M6AA 1S7RA 3MA7A 1I1CA 2J6EH 3OHXA 3QHFL 4OD2B 3H9SB 2CKBB 2EDEA 1PLGL 1BFTA 1T1WA 2PCPA 3JV6A 2D0FA 3DARA 4A2MA 5D1QC 1HOCB 2Q76A 3FO2B 1AGCB 2BCKA 2IANE 5JXAH 5DSCA 2AJUL 3RVWC 2XPGA 4LKCB 3UPRA 3UJTH 4EBQH 4Y1AB 4K3DL 5HDOA 5EZLB 1MFCL 4QF1B 3P4MB 2ATKB 2HFGH 5HSFA 3JV0A 3N1MC 2Y9RT 5L8JB 4P2QA 4L8BB 2ITCB 1T6WA 1HYRC 4WW2B 3ZKXC 3RTQC 5E2UL 3MLWL 1S5HA 5EOTA 5L88L 3RZCB 3UTZA 4LCCA 4LHQB 1I9RL 3W0WA 3DIFB 5D1QD 1FVCB 5ADPL 1MREL 2AXFB 4P0DA 4NNYB 4HIEB 4AMKH 2AJVL 6FABH 2ZUSA 4FNLH 4ZUUA 1DN0A 1REIA 4TUJA 4TUKH 3IB4A 3RVWD 3S4SB 1Q72H 5JR1L 1KJVA 5FYKL 4KJQD 1F3DH 2A9NL 1R5IB 5DHVH 3UROR 5D2NC 4P5TB 4IMLA 2HRPL 5GGVL 1U3JA 4X98B 4QHNA 1NGPL 1T0MA 1KT2A 4AH2B 3IDUA 1U8KB 4A6YA 5C0CD 3U82B 4ONGL 4XCFH 3TJEH 2PO6A 2CRMA 2YR3A 4RFNB 3RTQD 1IILE 3V4UH 4ZYKB 2P8PB 4YR6B 1OSZA 1KN4H 2HRPH 5JOFA 3SKOA 5IW6A 1NGPH 4OF8A 4FXKB 3NFNB 3SE4C 4S2SB 2DQIL 2ILLA 1X4XA 4OF0A 5KANG 2MKLC 4LSQH 3HZYA 1HINH 2AEIT 2H26A 2XFXB 1NLDL 2WINB 4FG6D 3IF1B 5ID0B 1JHLL 3JWNC 2Q86B 5SWQB 3MOQA 3HRZB 4HUWA 5DJ6B 4KHXL 5J13C 2QKIB 3KDMA 4RWYL 3WN5B 3TO4D 3D2UA 1HCVA 4NN6B 1YEFL 3KYNA 3O6KL 4S0TD 5K9OB 3H3KA 4PYGA 2GUOB 2BC4B 1X5ZA 5T3XE 3MV8B 4MWFB 1FG2A 5J1AA 4H1LG 4YHZH 3W11C 1F6AB 1YQVL 1KF9B 4LLWA 2ADIB 4P46D 4PJFF 1OAXH 3BSZL 5F1IA 4KFZC 4FFZH 3P30H 3RI5K 2NY4C 2VR5A 5DFVD 5IBTL 2ADJA 2IQAA 3BUYA 1GSMA 2CSPA 2VH5L 3K0WA 3RKPA 3MRQA 2UWEF 3S8WA 4KI1A 2C3GA 5ALCH 2D31A 3IVKA 4HGKC 4N0YH 2R0LH 4K8RL 2QR0B 4IOIA 1OTTC 5HYJB 5E1HB 5C0ND 3VI4F 3DURA 3EJYC 3GSNH 4AEIH 1G6RB 1YJDH 2DD8H 4WHTA 3MR9A 3QHZH 3W11D 2FX7L 15C8L 5DRZB 1P53A 2Z93B 3MROA 1RZGB 2AXGA 3VWKD 2Y06L 4HJGA 4MDJB 1N5YH 3QUXB 3O6FD 2CDEA 4X6CB 3PGDB 3SO3B 1QFUL 4JVUA 3MXVL 5GGSY 5T3ZH 4P9HL 1WC7B 1N6QH 5DJYA 4R4NC 3U7YL 4OCWH 1HDMB 3D3VA 1TTFA 4M3JA 1OTTD 1MAMH 2QADB 1LO4L 32C2A 4M9OA 1OARL 3ARRA 1HNFA 4GRMB 5I1HH 2MTPA 3QZWA 2HJFB 2ICCA 2O26U 1YEHL 3FL7A 3VD9A 3RIFF 3H42L 3EYUL 3IETB 3NA4A 1FO0B 3S36H 5MERA 1MHPL 3HNSL 2R0WH 4NC1C 5T33L 2V2TB 4XNXL 5IVNA 3PDGA 3GGWA 4ZTOL 1XEDA 2Q8AH 1FJ1A 2NY5C 4F9PC 3AS2A 4JY5L 4YWGH 4GRWF 1FZJA 1FNSL 3ULSB 1HN1A 2FYYB 1F2XK 3GMRB 4PRPB 4OGYH 4P4KB 5EPMA 5EUKA 3ZDZE 5FA4B 4P3DB 2OK0L 2A6IB 1RZJH 3F7VA 3LHPL 5BW7A 1VGKA 4HXAH 4OF3A 1CI5A 3MRJA 1VPOL 4HWBA 2J12B 4U7SA 5C3TA 5IFHL 1H15A 1IGYB 1NC4D 4Q6IC 5ACMA 1MFNA 3QH3A 4NT6A 5F71A 3S9DB 1H8SA 5SX5H 3VGAB 3QIUA 2MJWA 4R4FL 5E08H 2I27N 4MJIA 1TDQA 4F8QA 4PIRF 3IXAB 4URTB 5I75C 4KJWC 3C2AL 1F4YL 1WF5A 4O9HL 1BQUA 1T5WB 2BZDA 5K59F 3EKCA 4MB3A 2F5AL 4QXWA 3T3PF 3D18B 4ORGA 4ZFOL 5DD0L 1XGYH 2EC9U 2EEAA 1GZPB 4ZFGH 1RZIB 1DANU 1BOGB 1S7TB 2CGRH 5IROC 1I1FB 5IB3A 5HHOE 3UTSB 1AXSA 4FS0A 5TDNB 4JPWH 5IUSA 4AL8H 3TNNA 1MY5A 2EYSB 4F7MA 2HWZL 3W5MA 2G75B 5AWNL 4UT9L 5B38G 1JYXA 5FUCC 1UWGH 4MA8H 3IJYA 3B9KA 4CMMB 4JRWA 1XMWA 5E8PA 1ZHNB 3LEYL 3WDIA 3KYKH 4GAJH 4YNYB 2ZUVA 1Q0YL 1ZS8B 5D7KE 3RU8H 1BX2B 2P24B 4PGEB 4MSWB 5I30H 1BPVA 2YZ8A 1N2RB 4NN5B 2EIDA 1JYWA 1ZEAL 1OLZA 1Z5LB 5DK3A 3FQRA 4TVPL 2MKWA 1PVHA 2DQCL 2VQ1A 3QEQD 1FFPA 3MLSH 3BP6A 1IKFL 3RWIA 3RNKB 1L4IA 4OLVL 1X6LA 4J3SA 5ICZB 4YFLF 4EN3C 3MGTA 4LCWE 5E2VH 3O3EA 5DEFA 3AM8A 2DQUL 4XAWL 3IXTB 5BS0E 2GT9A 2NY6B 2BVQB 1WBYB 1MWAL 5HI5D 2EDJA 4NKIH 4M61B 5IVOA 1YEEL 4JO3H 1Y0LB 2DI8A 3MNWA 4D8PA 5DHVB 4WHYG 4XNUH 2MMXA 1IZKA 4XMKH 2RHEA 2DKUA 3OPZH 2PYED 3AS3A 3KXFA 1TPXC 3M1BB 4S1QL 2UYLA 4Z7UA 1EFXB 4DFIA 1WZMA 5FGCE 5JHDD 5CZXC 1GHFH 1IJ9A 1I8MA 3HPLA 1KPRA 3RWEB 1P4IL 3ZHDA 2Q8BH 4OQTL 2XN9D 1T0NA 4EN3D 1CL7H 4ZUTB 1NFDE 1WZKA 2A0LC 3QUYA 3O3AA 3CH1A 1QZ1A 4GW1A 3IDNB 2X4UA 4GQ9L 4C55A 1IMHC 1INDL 4HH8A 4MHHG 4IRJA 1EEYB 5DZNA 3N1FC 1N0XL 5CINL 2J8UE 4RAUB 5GS2D 3QPQC 3T77B 2UV3A 4I9WD 1RFDH 1U9KA 3M17A 5F6HI 5E8OB 4S1SL 4NO0B 5HGBA 4FHBD 1ZHBA 1MJUH 1XGQA 4Y5YB 4Z7VA 4R4BA 4HFUH 5E2JA 4C83B 4DN3L 4MAUL 4OLYL 2R29H 3ABZA 2G60H 5T1KB 3U9UB 1G1YA 1AKJA 5HYSA 1NMCB 3VRIB 2WBJC 3LKRA 4PGDB 4PLOB 5IQ9B 1JBJA 1T7XA 5E70A 2ITDB 3VW3L 4V1DA 3CXHJ 3GSQA 3QIWC 1BVLA 2BOBA 1MCDA 4ISVA 1D3CA 4G9FB 2A73B 1B9ZA 3VCLA 4E5XB 1KEGH 4U6XB 3EAKA 1WAAA 1WITA 3MJ8A 3QR2A 1M7DA 2BNQD 4X7DC 1T7VA 3C09C 1ULVA 1WBXA 3SGJA 1IAKB 4NM8H 3STZA 2GYSA 4JM2A 4JZOA 3C9NB 3WFEH 1JWMA 4Y16D 4F7TB 3P0VL 4K3JL 1A7QL 1MCOL 3B8SA 5GGUB 1B88A 3RGVA 5KSAB 5E1AB 4PJIE 1I7TA 2VDKL 1TQBC 3LEXA 2VR9A 3ZE0F 5L2KE 1JPGA 2P8LA 2N56A 4QGYA 1VGEL 3FZUC 2AKRB 4LSVH 4P23A 5INDA 2X4PB 3QIWD 3W81A 1BJ1J 3VFNB 4BZYA 3HZKB 3HC0A 1NUDA 4XNYL 1BBDH 5E9DE 5MEQA 2C4FU 1BIHA 1RJZB 2PTVA 2CMRH 1AGFA 4K3JH 5TPWH 5HPOA 2V7NB 4N1EA 5A3IC 1F8TH 1JPFA 3O4OB 3HCVA 3V6ZA 4LCYA 1EMTL 4GAYB 5EU6B 4KUZL 4O58H 2W0FB 1W72L 5ACZA 25C8L 2HVKA 3TCLA 5CLTA 1MQKH 1VDGA 4L4VD 4FQ1H 4LIQL 4FZEH 1T7YA 1KCRL 3MRBB 5GGSB 2EDDA 3LY6A 1LNUB 1C1EL 5ESVA 1RUAL 2F53E 2XTJD 2WQRA 2BRQA 5TE6H 5ADOH 1EMTH 3SDYL 3MUHL 1IBGL 1MFDL 3KJ6L 4UOW0 3MRFB 4Q2ZB 5GSVB 4D2NA 4YHPA 1I4FA 1NCWH 4HUXA 4WU7B 5IK3A 2X10A 4YGAB 3LMJL 3BKYH 2RFXA 2C7UA 3RAJH 5EBGA 4EXPX 4QHMA 3ARBA 1IT9L 4PV9A 4F2MB 3WIHH 1MCWW 2ENSA 5EU3A 1DBMH 4GRWH 1RUKL 3L7FB 4MNQE 4K23H 2G5RA 5CWSB 1C5DB 5EO9A 4BQCA 4ONFL 1TZGL 1BFVH 1MCKA 5DZOA 1MVUA 4P2RB 2NX5D 4M7ZC 1QBML 1MF2H 3GMQB 3RHWF 3BISA 3LKNB 5F9JB 5EDXA 5F6IC 3T0ED 4NQDE 4LLMA 1ZGLM 1JI1A 3PGFH 4XBEL 5EC1A 2VISB 4U7MA 2VE6A 3VE0B 4K3HA 1VFOA 3VXOA 3J7HA 1IL1A 1JFQH 3B4NA 1OPGH 3X14B 5CEZL 2NY5H 4RWHA 1UA6H 1QSZA 2ZCKL 3QQNA 2I9TA 2CK2A 3RWCA 4FQ2H 3RGHA 4FP8L 3IAGC 2GCYA 5IMKB 1MPAL 2GAZB 2B0SL 5ICXA 1CLYL 2BVYA 1GC1L 4OF7A 5C0BA 2UUDH 3QIUC 5EU4A 4WNQB 1MRFH 4DKAA 3VXMD 1HILA 1S5IL 4AZ8A 3MV9A 1BQHA 4UDTA 4PJCA 3MX0A 2EKSA 3D85A 4LLUA 5AZEL 5SWZD 4N1HB 1CFNA 4K94C 1A22B 4F15B 4MXQD 1NCAL 4KTYA 3OWEA 1ZE3C 5LGJA 5GS0D 3GSOA 3HS0B 1J11A 3NPSB 3ZKNC 3ZDXF 3AGVA 2D7TL 1YMME 3X12B 1NLBH 2AV7B 4KHTH 1OM3H 5TDOB 5FV1L 5FV2A 3G6JE 3HNVL 4UILL 4OKVA 1DN2A 1ZA6B 1A64A 1CR9H 2Z31B 4HIHB 1MCLA 1RIVH 1A8JH 5CKGA 1UACH 4HUUB 1TQCC 3BW9B 4NYLB 1BZQK 2GSGB 4XCYB 2A6JB 2H2PC 3NCBB 4HG4J 4M62L 3LKQA 3V6FB 1SYVA 1LK3H 4JM4H 4O02H 4F7PB 1FGVH 1TVDA 5E8NB 4M48L 3BIBX 5D1QB 2FWOA 2IGFL 2C9AA 4OZFA 1YA5A 4TRPL 4BM7A 1ROWA 1R3LB 3FCTB 3U4BL 5E2TH 3QA3B 3G5VB 5DJ0B 1NAMH 4DGYL 3EO0B 5IEHB 3QJHB 5IJVA 1NGYB 4HLJA 2NXYC 5LXGL 3HI6H 5DUBA 4L3EE 2JJVA 3SQBA 1OAZH 3QWQB 2D03L 5C0CB 5IV2A 3GSRA 4HF5H 1LMKA 1NH6A 2APWA 4KMLB 2H2PD 4AIZB 3ZKXB 4NQTA 3RTQB 2EE9A 3IFPA 4NGHH 1ITCA 1R5VA 4NKDA 4DGYH 2AJXL 3ZHLA 4I77H 4J3OC 2EDYA 5C0EA 1CE6A 5F9OL 1J0YA 1YEJH 5D5MA 5GS2H 1MI5D 2JJSC 1FZKB 4LRIC 3QUYC