3ULUC

Structure of quaternary complex of human tlr3ecd with three fabs (form1)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
210
structure length
210
Chain Sequence
SVLTQPPSVSVAPGQTARISCSGDNIGSYYVHWYQQKPGQAPVLVIYEDSERPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCSSYDDPNFQVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Toll-like receptor 3
publication title Lateral Clustering of TLR3:dsRNA Signaling Units Revealed by TLR3ecd:3Fabs Quaternary Structure.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2011-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uluC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uluC01
1EMTL 3KJ6L 2ILLA 4D0BB 2ZOLA 3BIKA 4MLIA 1N59A 1F6AB 4IRJB 5E00B 4RGMC 5IR1A 4NN6C 4XCEB 4PGJA 4R6UA 3F12B 1G84A 3B43A 1MEXH 3WEXA 2RGSA 3HAEG 3CAFA 4PREB 1NCCL 5E5RB 4NQDB 5DURB 3J7HA 3NAAL 4M1GH 1FCGA 4MCYB 1U8QA 3X13B 3T0WA 5J1AB 4NCC2 5CSBA 2AP2A 4G5ZL 5J3HD 3O8XD 3OKDA 4Y4HC 1C5CL 2F5BH 3HI6H 4I18B 2JCCE 3F58L 4RQQB 5DK2B 3HRPA 4NQEA 1MPAH 5I17B 5EUKA 1TENA 4DQOL 1NBZA 3BPOC 1XMWA 3EOAA 4MNGE 3GMNA 1WCBB 5E08H 1QRND 3QCTL 4RGOH 4OB5L 3OX8B 4KJPD 4K9EH 1OY3B 1MJ8H 2MQCA 4UU9B 5C6TL 3SDXE 4ELMB 1IGFL 1QLRB 3KPRB 4K8RC 3H9SB 3B2VL 1OM3L 4FQXB 4MB4A 4KTEH 2IADB 5TFSL 3M8OH 4Y5VC 2GJJA 5I8CA 2X41A 3QXDA 4RAVA 1T0MB 5CWSA 1KG0A 3CDGA 4OLXH 5ELIA 2J6EA 1UM6H 3QH3A 3BP7B 2WM0A 2MCG1 4U1HB 1J0ZA 4TOYH 4M8VA 4LHUB 4F7PB 2E9IA 3LIZL 3QPQC 4DK3A 1KC5H 4UT6H 3LKOA 1P7KB 1WWCA 2V2XB 2C4FT 3HNSH 2N7AA 4UBDD 3U82B 4LHJB 3X12B 2BSSB 2B0SL 1XF4B 1YPZF 2KH2B 4JGJA 3FCTA 2HJFB 2EIZB 3O2DH 3HZYA 3IDXL 3TBVB 4ZFFB 1CFTB 1QSFB 3TJEH 1U2HA 4XXCA 1FFQA 4GFTB 1LK2B 2BVUA 4KC3B 1W8OA 3H6JA 2VLRD 1WZMA 3NCCB 1LD9A 2B8OT 3EO9H 3M17B 2XA8L 5DHVH 3WLWD 5C7XH 5GRVK 3MUGA 4G9DB 4YXKL 4J6RH 4D94A 3VRIA 3CMGA 3T0VA 2FGZA 1Q9OA 5GJTH 1L4IA 2NX5D 3FRUA 3WKMH 4ZXBB 5J12C 2FX7H 1LNUB 1T5WA 1G9NL 3B3IA 5HYJE 5CHNA 2VLLA 5FO7B 4UUJB 4R4FH 3RJQB 4N0UA 4G3YL 3Q6FB 5FO8A 4J3WA 2P24B 1JPSL 2NXYD 4H26B 1BREA 3BSZH 4NOBA 4PJCB 3GSRB 2DAVA 3W0WD 4M7KL 4HUUA 1JHTB 4JFZL 5AYUL 1UZ6F 3SDCA 2DS4A 3P0YH 5JHDA 4HFUL 4PD4K 3NZ8A 2YUZA 5SX4I 3OQ3B 1P1ZB 4GKNA 5E95B 5E8NA 5EDXA 3LCYA 3HR5B 4HPYH 5IVZA 3ZE1F 4MNQE 3FQWB 3NPSC 1CLZL 4F7TB 2J4WH 3H7BA 4JQIL 3QEGH 3ARGA 4OUUA 2Z4QB 2BNQA 2MCPH 1H5BB 3LD8C 5LKNA 5DEFB 4Y2DD 2FSEB 5IMKA 1IRAY 2WUCH 4BFIB 3RDTD 4ZTPL 4EZMA 4RGNC 4P5TB 4L4JA 5E6IB 5SWQB 5IFHH 4NBXB 3GUTA 1QKZH 4ELMF 1Y18B 5MEQA 4QOKA 3BAEL 2XG4A 2BY2A 1YEFH 1R6VA 1IC7L 4FOMA 1RK0A 2ZCKL 3BPCB 4R3SB 3SDCD 1MFEH 3MRKA 4OT1H 5JOFA 1RIHH 5SWSA 1MCPH 4NFCA 2VXTL 5C3TA 3PP3K 3BP5B 3D25B 1LEGB 5I1CL 4PRHA 2B5IC 1CFBA 3QYCA 2A38A 4Z7VB 5F3HB 4U3HA 4TUJA 2JIXA 3LH2L 3MO1A 5HDOA 4FFZH 1DQLL 4BYHA 3DYMA 3H3KA 5F1SA 2EE2A 4KZEH 4LQFL 3GIZH 1BWWA 2HJLA 3ARGD 4GRMA 4PYHA 1S9YA 3NCMA 1FFOB 3P4MA 2CQVA 1DE4B 4KZDL 5ISZB 1FG2A 4QOKD 1OB1A 2ICWA 4KJYA 4DAGL 2R1WB 2Z35B 4JFEE 3T0DA 4CVWA 1MFAL 3CVHH 5SWSD 3BZEB 5CUSL 4CL7A 3O2WL 5INDA 3BKCL 1WITA 2MMXA 5DLMH 4UOW1 4PS4H 4GMSL 1A2YA 1MIEL 3T0EE 4K71B 3HC4L 3L3JA 3T0BA 4RRPG 4ZDHA 2JIXD 2I9LA 1HOCA 4LKCB 5CJ8A 2PYEE 4OD2A 1MOEA 2GKIA 4KROD 3P4OA 1R3KA 4G7VL 3OKOB 1LE5B 1EEQA 1A6AB 2LAAA 3CLFL 2IANA 4MQXC 3P9LB 2NY2B 4IM8A 5CEXB 3HUJB 3PWPB 4GW5B 1Q9LB 4XMKH 1UENA 2ZJSL 4YDJB 3V6FB 5ITFA 1MWAL 3O6FB 3VG0L 4ZODA 2PCPA 3S34L 2Y23A 3BJ91 6CGTA 5E8EA 4U31A 4HXAH 2VYRE 3FQUA 4DCQA 4NKMA 1MH5B 4WENB 5F7EL 4AM0A 2XI9A 4FXKB 3MXWL 1OTUD 3GMMB 5T3ZE 3PJSA 5K59F 3DECA 3QDJB 2NTSP 2HTKC 4X0KB 2KZ1B 2IAND 1S7VB 1HYSD 4WTWA 2ADIA 3VXTB 3ILPB 2JJWA 3L5JA 1GGIH 3JSSA 2E6JA 5CJBA 4MXQD 1AFVL 4MX7B 5IK3A 4QTHB 3LRSB 3MRQB 3PDGA 2BRRH 2XKNA 5A16B 3VG9B 4H5SB 3U4EA 1ETZB 5IQ9A 4QTIL 1ERNA 4JG0L 5DUML 1TVDA 1TZIB 4KDWA 2EDWA 4PRAB 1E4WL 1NKOA 4L3EB 3U83A 2A6JB 3RAJH 1WIUA 1JGLL 4XPTH 3C6SB 2OZ4A 4HV8B 3WNMA 3JV5A 3V5HA 5C0CD 1C5DB 2Y6SC 4N0FA 1HHJA 1HWGB 2NNAB 4XNMB 5HPMB 4JB9L 3SKNB 2YRZA 2KQMA 2X4SA 4E0RB 4UDTA 3VFUB 1KLUB 3TZVB 5B3NA 1DTUA 1FE8L 1VPOL 3ARTA 2YMXL 1NCWL 2P8LA 1KYOK 1GYAA 1TIUA 4G9FE 4MWFA 2VKXA 3GGWB 1I9RH 3F7YB 3P77B 2WWMC 1PKQA 2VITA 5DUBB 4WHDA 1S9WB 2AV1B 3G9VA 5FGBC 1JWMA 1NSNL 1VSCA 2I24N 4M7LT 4WDIA 5ESQA 1SJEB 4TULL 2LU3A 4GW4B 1F02I 2EYSA 2VH5H 4WFFD 2DL2A 3AMLA 1MFBH 3K74B 4QHNB 3TN0B 5JZ7D 3MXVL 4HS6B 3BP6A 4AENB 4P2OA 3HZMB 1WBYB 2J12B 3WFEL 3VWKB 3G08B 1VADB 4TTDC 2HJKA 3ARFA 1W8NA 4MAYA 4QWWD 5EA0L 1UWXH 3I02A 5KVDH 2OJEB 3Q5YA 3AS3A 1FYHB 5FYKH 4NRYB 2ITCB 1MHHB 5KVMC 1PW3A 3CXHJ 5FYJD 5AZEH 3HUJF 1GC1L 4L8BA 3QDHA 5IEKB 5DRWB 3RKDC 4X5XB 4L3AA 1MQKH 5AEAA 3MLPA 3OKMA 1FNSH 1C12B 5DQ9B 3C8HA 2D7MA 2HT2D 4K3JH 4P2OD 1RZKH 1Y6KR 3T4YB 3VI4F 4D9QE 5A2FA 3U30B 4OZGA 4JY4B 3ARFD 4JO2L 4LASL 5FM5O 2VDQH 4YDKL 4MAYD 4C83A 3MLYL 4LLAA 1PFCA 3B6SA 3HFMH 3RGVC 1E6OH 5GS0C 5L2JB 2WUBH 1UJ3A 1NLBH 1S78D 3MV01 4JKPL 2DLIA 4P9MH 2BXZA 4FXGA 1WWBX 3L3DA 2G5RA 5BS0B 1J1PL 3GSOA 3BPLC 4K3EH 5AD0A 3HG1A 1HKLH 4G6JL 3CCHB 1SM3H 4KKLD 3V8OA 4E5XA 4JFFE 4LU5H 5C07B 3IFLH 5JLZA 4XHQA 1IAKA 3L7EA 4HCRA 3CPLA 4RFNB 3JWOH 4N8VG 4DN4L 3SE4A 3RZCA 5HHVH 5I1GH 3HI5L 2VC2L 3RTQC 3GBML 4XPHH 5GZOC 5F89B 4O58H 3AAZA 4ODXA 3KPNA 4I4WA 3FQXA 4OUOA 4JHWL 4EEEA 2BZDA 3B8SA 1N26A 3AS2A 5JDSA 3T0XA 2PO6B 3WJLC 2CDGA 3TNMA 1YN7B 4WO4A 3DMMC 2IPTH 4AEHL 2MPAH 5SWZA 3QNYB 4NZTL 2NR6C 3DSFH 3AXLB 4OD1H 4YHLL 4FQLH 4HS8L 4NO2B 3GHEL 5KN5B 5B3JF 4RFEB 1S9VA 3AMKA 1UA6H 1BZ9A 4UINL 4ZOBA 3FOLB 4MDIB 4G8EB 5JW3L 1JNNL 1A3LH 4PG9A 1FLTX 2HTLD 3RZCD 1KNOB 4HJGA 3DGGB 3QWOB 1BAFL 4JKMA 1G9MH 4ZS6C 5DD1H 5DYOB 2DDQH 3GM8A 4MVBC 1DLFH 3MRLB 2V7NA 2ITDA 4NDMA 3MC0A 5HVGB 2A74B 3KYAA 4WO4D 3HNTL 4FFWC 3K1KC 1LHZA 4EIZC 4WV1B 1DUYB 5DQJA 1WICA 4OI7A 4UZGA 3CLEH 4X6CE 4MA8H 5KSBE 4QY8A 1AY1H 1L7IL 5EIVA 3H0TA 1REIA 4DZBB 1NAMA 3EFFB 3MLWH 1TQBB 3ZE0E 3VRLF 2V5SA 1FN4A 1O7SA 1HXYB 4D3CH 1N5YL 1AXTH 4HZAA 4EN3A 2ED8A 4G6MH 4NCC1 4KY1L 4HIEB 3SE3C 5HGHB 2CIIB 3KXFA 4P4KB 4LPUA 2XZAH 4RWYH 4GS7B 3O4OC 5D5ME 1IQWL 1TPXC 1T80A 2GIYA 3HKFA 3V7MA 4JKWA 1OWRM 1A7QL 5EOCL 1GPOL 3TBTB 2YA2A 1JGUL 1F6AA 4OZHB 1DBAL 2DLFH 4TUOA 4KVCL 4FP8L 4GUPA 1MRFL 4LGRB 2IBBA 2CSPA 1AQDB 3QUML 3S3PA 1RK1A 4NGHL 2JKXA 4LK4A 4PREA 5MERA 4LRIA 4MJ5B 1ZHKA 4XT1C 4YQXL 3MJGX 5I9QC 3VXUB 3DETC 5SV3A 1GIGH 1N2RA 1INEH 4CW1A 4EN3D 1J1XH 2J2ZA 3FRPA 2AI0L 4KRLB 4LLVB 3MV9E 3KXFD 3C09C 1UYWL 3QIUB 4DN3H 3C5ZD 3X17A 5I1IL 4HKJA 5SX5H 1MCWW 2QADB 3BWUC 4NT6B 1DSFL 1AIFB 4OKVB 1JI1A 1FO0L 5DK2A 5J1SC 5DMYA 3UPRB 1W72L 4MJIE 4KRNA 2Z92B 1YNLL 4DKFL 1A8JH 4EOWL 4GG6F 2ZSVA 4PBXA 1WCBA 3RVTC 3SO5A 5L2KA 3PNWA 5CIPA 1YN6A 2PTTB 4N8CH 5EOQH 3ULUD 2XFXA 3BQUC 1RPQA 3QEQE 5ETUB 5BZDB 1ONQB 3FL7A 4NHCH 4IRZL 3UBXB 3BH9B 3QJHA 3BIBX 4QXUH 3SDAA 3N1GC 3KYOA 3DX9B 1RJYB 3PHSA 4AY0A 4NQSA 3OKLA 2R0WH 2BDNL 4M43H 5FUCE 1Q9WB 1C08A 4Y5XC 1FVDB 1KCRL 2FYYA 2WLZA 5D72L 1R3IH 1OSPH 2W0FA 2CK0L 3BN9C 4GKSB 5EU6A 3V4VL 4PRNB 4OLEA 3WFCH 2YD7A 2NY0C 4ONOA 1D5ZA 3AFLA 4XP4L 3RVXC 1EUUA 2GJ6A 4YZFF 3FB8A 5L2KD 2C3WA 3OAUL 3P4NB 2FX8H 3SCMD 3QUYC 5D2NB 3SY0B 4D9RD 3CDCA 2EIZA 2NZ9D 3P4LA 3ULVF 3WD5L 3TBVA 4M61B 1T1YB 3SDAD 1QBLH 1T03L 4IRSC 1LK2A 2GYSA 1U3HA 3S36L 2EIDA 4P9HC 1QD0A 1X5YA 3HS0B 3T0EC 4O2EA 4TTGA 4M48L 4P2QB 4TRPL 4FTVE 3L7FA 3U7YH 5EU6D 2CUMA 4LSPL 2BCKA 4A6YB 3DX7B 1RU9H 1T7XA 4JG1H 5IW3A 2GJ6D 4KROB 4M7JH 3CMOH 4QRUA 4U6HB 5IFAL 3QQ9C 4NM8L 1MF2L 2VZ1A 1RVFH 1WV7T 1I3GH 5L7XL 1LNUA 2DTSA 2Q8BH 2X1PA 5F9WC 2D31A 4P2RA 4UUJA 1JF1B 1NGQH 2CUIA 4LCIH 1CT8A 4P3WA 4M6NL 5I74C 1T1XA 2YPLA 3VXQA 3ZYJA 1U3HD 43CAA 4PJCA 2EEBA 4LMQE 1PSKL 4RMTA 1CDCA 4TVPH 5HHMB 1JHTA 1L9MA 2ZG3A 3MJ7B 3BT2L 1ADQA 3MV7B 3W9EA 4L9LB 4K7PX 1NLDH 5FEBA 1I9JL 4Z7QE 1YMME 1XIWA 1KPUB 5GPRA 3UO1L 5B39B 5L0QC 1OAYL 1T7VA 1QRKA 5E99L 4EBQH 4YXHH 5C3LD 1OGTB 4WW2B 4P2RD 5DUPL 1YDPB 4LCCC 3QRGL 1F11B 5SWQA 2YPLD 3NMEA 1MRDL 3IAPA 4JREB 3F5WA 3ZKMD 3W9DB 1UGNA 3BPCA 4R3SA 3A6OA 3L9RB 3IKKA 3PDOA 3AY4A 4PFEA 3KPMB 4OIIL 5MEPA 1FH5H 1LO4H 3D25A 5GGQH 3ARBB 2VABB 4Z7VA 3SOBH 1JF5A 4OCSL 4PRPE 1A1NA 1OGAA 4MNHA 3NA9L 4YR6B 5F3HA 5C0CB 3SDYH 3U4BH 3ZDZE 4OZ4B 4W70A 1P4BL 1RMFL 1QO3B 2FL5B 1D9KB 2O61A 2QJDA 5IB3B 5FO9A 5IP4A 2FX9L 1JIBA 1S7UB 2EXYC 2UZIL 1UB5B 3E6FB 4X9GA 4YIQB 1AJ7L 4NQXB 4K94H 4UILL 2CDEA 4B53A 3NIFF 1N7ML 1URLA 2VXUL 3RUGB 4YAQB 5DMIH 3S4SG 2BOBB 3SQOL 5I30H 1T0PB 1SVZA 4LSDA 4JFDE 4Z7WA 1A6WL 5K93A 1HH6B 3C9NB 3BX7C 3GMPB 3ECBB 4PD4J 3C6LC 4FQ2H 4HQQL 3CJJA 1RZGB 3NN8A 2V2TA 1EAPB 1KJ2B 1T04A 3V8CA 3U7AA 4D0DA 1MEXL 5GIRA 1NH6A 2HA1A 3WIFB 4NHUA 1CFNB 2GHWB 4K7FA 1M71A 5T33H 2J8HA 1EXUA 1EFXA 4Q0XL 3G6JB 3VWJB 4JHBA 1PQZB 3EO0B 5ENWB 5CEXA 3BRDA 2G75B 3V95A 2H3NA 4GW5A 1Q9LA 1GZPA 2IFFH 3HE6B 2EKJA 4BZ2H 3HI6L 4YDJA 3V6FA 2DRUA 1OTSD 4IOIB 5MENE 1YY8A 3D39B 4EI5C 2D2OA 3WN5A 1I8MA 3ULVH 1EVUA 1MH5A 1ZVHA 4KK8D 1GOHA 5E08L 5DVNA 4RGOL 1MCOL 5J06A 4FXKA 3QUKA 4OLYH 2AK4B 1MJ8L 3EYFB 3GMMA 4HEME 4O2FB 4KMLB 5MEOB 4KK6D 1H3PH 3V4UH 3QDJA 1YYLH 4WWKA 1EFXD 1FP5A 1YEIH 4X0KA 3KLAB 3ZTJG 3M8OL 3G5XA 2N4IA 1I8IA 2VUYA 4X99A 4OLXL 1F5WA 2QV2A 4WW2F 1ZLWK 5A2IH 4ALAH 3NGBC 3V52H 4MX7A 4PJFB 5IV2B 3MRQA 1DLHB 5D7LD 5A16A 2F54E 1MLCB 3MCLH 1RHHA 3NBNA 3G5ZA 2X70A 4ZQKB 4UT6L 2X4PB 4ZUWB 3BXNB 3HNSL 4L3EA 2A6KB 3H42H 1YEKL 3C5JA 3EYSH 4D9LH 3C6SA 4NWTH 1C5DA 2F15A 3WS3B 5M95B 5IWLA 2NNAA 5JPNB 5EOCJ 1ZXQA 1KXTB 2NY5L 3JWDH 3QIWC 5I8KL 1EAJA 5E9DE 3TJEL 3TZVA 4NQEE 1HN1A 3FKUS 4UIMB 3JUZA 5FKAA 1RZJL 4XP9L 5DJ6B 3GFUA 2XTJD 4J8RB 4KTDH 3GGWA 3EO9L 4K3DH 5C7XL 3L5XL 5HI3C 3RUGF 3INUH 1S9WA 4J6RL 2AV1A 3RBGA 4OCXH 2R9HD 3UTPE 5JIKA 3UYOD 3VXPA 3OJDA 3LKRB 1QOKA 2ADFH 4FQQB 2UZYB 1I1AA 3CX5J 5GJTL 1U8LB 3WKML 4P48A 1P9MC 1CDUA 1K2DB 4AENA 5J0BA 1OSZB 1MAKA 3KPSA 4IHOB 4R4FL 1I3RA 4MZ2A 3HZMA 2YWYA 4B41A 2P8MB 5GZNC 4YC2B 5D2LA 3WIHA 3OJMB 3BSZL 2VN4A 2VISA 3EJYC 4QRQB 3HC0A 4LBEA 4E9LA 1ODAA 3G6JF 4BH8B 3P0YL 4DGIH 4P5KB 4NRYA 2G9HA 4G8FB 4FRWA 1B6UA 3PQYB 1S7QB 3BYYA 4K3HA 1VFMA 5DRWA 5D96B 4HPYL 3UC0L 5DC4B 2E8ZA 1I1AD 4L4TD 1RZ8B 2J4WL 4H20H 4HIXH 5IROA 1G7PA 1ES0A 1BPVA 4JPWL 1PDKA 5F1OB 2MTPA 2B5IB 1U93B 3KPSD 1F4YH 2WUCL 1A0QH 5DK0A 2XPGB 3ZE2E 3C08H 1A6TB 3T4YA 3EJJX 4R7DA 2DIAA 3RVUD 2EYRB 4BFBD 2D9QB 4JY4A 2AEQH 3UJJL 3QFJB 5J56B 4OF0A 1OAQH 1YEFL 4EDWL 4YK4B 1R3JB 5L2JA 1FQ9C 1MFEL 2A0LC 2J8UA 5D7JC 1F6LL 4KK9C 4OT1L 1RIHL 2UUDH 2FGWH 4ZSOB 1MCPL 1UQSB 2NLJB 5C0JA 1IKNC 1B0RA 1MFNA 2A77H 3H7LA 3GSXB 5FYLL 5BS0A 3IJSB 3IDGB 2JB6B 4A6YH 4PJFF 2P4AB 3CCHA 4FFZL 5DA4A 2AJUH 5C07A 4KZEL 3LVEA 4UOW0 4X9IA 3MLRH 2BMKB 3QUXC 2DKSA 3ET9F 3P30H 4F8QA 3BKMH 3RPIB 1OQOA 5JO5B 2APFA 2GJZA 1ZKAA 2RJMA 3MNWA 3RIFF 1FYTE 1A6UL 4XVUC 1L0XA 3O6LH 2G5BA 5DI8B 4OZIB 4UI2A 2PO6A 2W0KA 4FN0A 4HUMB 1MCJA 4WEBH 2XIDA 1UXSA 2JK5B 4U1KB 4LVHC 1TJHH 5HI5D 3ES6A 3CVHL 1TFHA 4ZUVB 1S9XB 1V3KA 3IS0X 5DLML 2APBA 5DEZA 2W60A 3BP4A 4M6MH 2ZUYA 4LCUA 3S6CA 5E56A 5KN5A 3WYRA 4U6YB 2H2SC 4ZFOB 2WSKA 4KKAD 1AC0A 3MZTA 1BD2B 5FUCC 5CP7A 1X5KA 2OTUA 1KNOA 5JOEA 4YFEA 3WUWA 3QWOA 4Z7NE 1V05A 3FAWA 2QSQA 2IMNA 3R8QA 1ZAGA 3GB7B 5DYOA 1WAAF 4XMKL 1A7PL 3BPNB 4PJXB 4QRPA 1FBIH 5F70A 2IQAA 4NP4H 7CGTA 5CD3B 4XNQB 3F62A 1Q38A 3O3EB 4OQ1A 3RVVD 3CXDH 4WV1A 1BVKA 3UPCA 4Y4FA 2KBGA 4JZJB 3VA2C 1TCRB 1MVUB 1ZVSB 3ZHDA 5ICZB 1U95A 1T6WA 4DW2H 3DI3B 3EFFA 3KAAA 3HCVB 5JXED 2AQ2A 1FV1B 4KAQH 1CG9A 5HHOE 1LGVA 1AGBA 5MHSE 2Z93B 2DJUA 2B4CH 3F6LA 1UCBH 2HKFH 1GGIL 1IAOB 4LIQH 5D93C 4HDIB 4WFGD 4J4PA 1NGXA 5EZLB 4QRPD 2BRRL 3W5MA 4L3CB 4Y4FD 2ICWJ 1HH9B 4HJ0D 5E1AB 5F9JB 1YQVH 3WXWH 3A6CL 4J1UA 4OZHA 4G43A 1KJ2H 4LLUB 2DIJA 3IKCB 5DFTA 1D6VH 5EU5A 2OR8A 1GC1C 3UBXI 5JW5B 4LKXB 1W0VB 2C3VB 3AVEA 4F3FB 1PG7X 3ZKXC 5HGAA 2P43B 1QACA 4Q6IA 3BGFB 5C8JB 4ODVH 5EG6C 5E7BA 5GS1C 4BQ6A 1YNKH 1IGTA 4LGSB 5CCKH 4I5BB 1I9RL 4N5EC 4I13B 4NC1E 1AIFA 4NO3B 1RJLB 4OKVA 5IB5B 4PJ7A 5BO1H 1IEAA 1CU4H 4WCYH 5C0IB 5GGSB 3RWEA 3IDYC 4NWUH 3VMNA 3TVMD 2DYPB 3R06A 4HIJB 4YBQC 2W07A 1BEYH 5JQHC 1U8HA 5ICYB 5ETUA 5KVFL 1TCMA 2P5EB 3BH9A 3OGCA 1CLYL 4RDQF 4XVTL 3ULUF 2XQBL 4NSKB 4OF5A 3CFIC 3IRZA 3VXMA 3QR2A 4WGVB 1V3MA 4H0IA 1NFDB 3ROOA 5DSCB 1MUJA 4Y19B 1P7QA 3D3VD 1KIQB 1XR8A 1CF8H 2FO1A 1WVZA 3BYTA 2FWOB 1FVDA 2Q6WB 3MOAH 2VLKA 1VFBB 2WBJA 4U1SB 2BJMH 4H0HB 5BMFH 5E70A 5FUOL 5KSAD 5HSFA 1A6ZA 3NFPA 2LVCA 5T3XD 3OB8A 1I7TB 2QQKL 1VHPA 3L6FA 5EC1A 4JDVB 3DXAE 2XXCB 4HPOH 4NJ9H 4EUPB 1FNSL 3DHMA 5IQ7H 5C1MB 3CZJA 1NMAH 1Q0YH 4JVWA 1H8OA 3UTQA 1RZKL 4H88H 3VXMD 5CJXA 5INCA 3DIFB 1Z3GH 4NQCA 4QRTA 1P7QD 4CMHB 1XF2B 1E6OL 2WUBL 3VE0B 1NLBL 4ZO8A 1NGYA 2CLVB 2VLKD 2WBJD 4P9ML 1G6RB 5DD0H 1E28A 3TO4C 4K3EL 3NIGF 4R96B 1HKLL 1SM3L 2EE9A 5H94B 4LU5L 2ATKA 3IFLL 3QQ3A 3GMOA 1JYVA 5F7MC 5CZKA 4U6HA 1H15B 1GCFA 3PWVB 2QSTA 1LEIA 3JWOL 4YNYA 4F9PA 2VAJA 3FB5A 5HHVL 4X6BB 3ZSSA 3SDXB 5I1GL 3GRWH 1IVLA 1Z9MA 4JRWA 4JANB 2BVEA 4O58L 1XR9B 4NQCD 4RISH 3QO0A 1G7IB 2HFFB 3JTSB 5E8PB 3OR6B 3VMPA 3BHBA 1QG3A 1MI5E 2MPAL 1OLLA 3MJ7A 2A73A 4ODWB 3QWQB 4L9LA 1HWHB 3DSFL 4NN7B 4OD1L 2R1YB 4FQLL 4MXWH 1RIUL 3WCYA 2IPUG 1KPUA 4GXVH 3MJ6A 3AB0C 1CICB 2P45B 2YKLH 2FJGB 1OGTA 2EIEA 2N56A 4LHUG 1JZ4A 1JNHA 1QFUH 1YDPA 1OQXA 4Y5YB 5ACZB 2FNBA 4MD5B 5FYLE 5T1KB 1A7BA 1F11A 5DD1L 5I75C 3P0VH 4I8DA 5JXAH 3VH8B 5T1MA 3TEUA 1DLFL 3WL9A 3V0WL 4LSTL 1BOYA 3NPZB 3L9RA 3MGOB 3WNKA 1NFDF 3MRMB 2C3HA 3CLEL 3ARBA 4JVPA 5C0BB 2R1XB 1AY1L 4LL9A 1FAIL 1MCRA 3MLWL 2NY4C 4AK1A 2HRLA 4G6AC 2VXQH 2V2WB 1S7UA 4D3CL 5E24E 1UB5A 4RZCB 1M7DB 1AXTL 1JRHH 1JPTH 2BNRD 1RURH 5BZWB 4G6ML 2GEEA 4JO3H 3KYMB 1CZ8L 5F96L 4S1DD 4GW1A 5J6GB 1SY6H 5F7LB 4Z18A 4YAQA 3PG2A 5KVGH 1EHXA 2DWDB 5ID0B 4ETQB 4X7SH 1CI5A 4OJFH 5DJ8A 4CMMA 2GFBB 1A4JB 4RWYL 2ZSWA 4HXBL 3BZ4B 3C9NA 4Z78A 2NW2B 3FQRB 4WUUB 3ECBA 3D0LB 5D6DC 4LP4A 5C0GA 1UB6B 1V7MH 3VXRA 3RNKA 1EAPA 1B90A 5C2UB 3JTTB 3N0PB 4WEMB 4N1EA 1YEDA 3WHXA 4RCAA 4MNQB 2VE6A 2F53A 5TH2A 4GRLC 5CEYA 4XBPB 1TVHB 2UY6A 4J3XA 3X14A 1GIGL 1RUMH 3D2UA 1J1XL 4DZ8A 1WBZB 4WI9A 2P5WA 5E5UB 2ADJB 2DLEA 2EDFA 4DN3L 4OAWA 1KLGA 4O9HL 3FB6B 3HE6A 1WQVT 3KLSA 5FDWB 4KFZC 1YC7A 2LAGB 5HGBB 4Y5VA 3OB0H 3KG5A 5HHQB 3BE1H 1U8NA 3D39A 4QHLB 3SJVD 1UM4H 1A21A 4L4TB 3I6KB 4KVNH 2GCYB 1U42A 4Y4HD 1YEEH 5TF1H 1CWVA 3KPOB 3UTZB 3BDXA 2D7TH 4N8CL 4ONGL 3TGXA 4OM1H 3QO1A 2F53D 4TNWK 3O3UN 3MRFA 4NHCL 4WFHE 1XCQA 5F71A 3R0NA 3KLAA 2VRAA 1LP9F 5EZJA 4YH6A 2R0WL 2P5WD 1WK0A 4M43L 3X3GH 3Q0HA 4P5MA 5CMAB 5F9DC 1H3XA 3QIBC 3BDYL 4K8RD 4LSQH 3T77A 3VFOB 4Z7UB 1DEDA 1RULH 1U8OB 3B9VA 3LS4H 1YC8A 4RNRA 1OSPL 3C8DA 4U6VH 1IGML 4DKAA 4NQDE 4P4RB 4X80H 4JFQB 25C8H 3QDMA 1A7RH 3MV8D 5DA0B 1ZLUH 4GAFB 4X98B 4Z76B 1MCIA 1CFQA 4U49A 3BDBA 1ZT4A 2FX8L 2DIBA 2B1AH 4I2XA 1WT5C 4PJGA 2E27H 4QGYA 3QPQD 1QBLL 4PJ8B 4UTBH 5KSUA 3MROB 4X4YB 1ZLSH 1N3NB 4CVXA 1OP5K 5GRVL 3HPLB 4BZYA 5DJ6A 2I60H 1QHOA 3KS0H 2N7BA 3DRQB 2HFEB 4X7FC 4HWEH 2X10A 3E1F1 5CS7A 2ZUQC 4JPKH 3U7YL 4ELME 3KPRE 3ZKNC 4DK6A 1CBVL 3FT3B 3H9SE 5H37H 4F37F 3MJ9H 4ZNEE 4MQ7A 3VD3A 1RU9L 3K0WA 4JG1L 4CU8A 1UWEH 3MUJA 4J3UA 4Y16B 3VXSB 1FZKB 3FZUC 3RA7H 4FQQA 1KT2A 4HULB 5JORB 4M7JL 3CMOL 1G9EA 5L88H 3IDIB 1U8LA 1KACB 4PJHF 1I3GL 5FYKE 3ZT7A 2Q8BL 1NGQL 3GRWA 4XBGB 4IHOA 1KTKE 4LCIL 3PWJB 1JWUB 1FZMB 1D5MA 5C0FA 5DZOA 3ARZA 4TVPL 3D1MC 1AD0A 3BOVA 3GJFA 4LF3B 4F9LC 1EVTC 1PX4A 2VKWA 3PIQA 5IUSA 3PQYA 1NLDL 2WLYA 4P46C 4ZTOH 2KUTA 2VWEE 1QSFE 2C9AA 3HE7B 4U7KA 4F7EA 1J87A 1HILA 3UTTB 1IC5H 4PUBH 2HFGH 1RZ8A 2ZKHH 4EBQL 4EUPH 4C58B 1A3RH 2Z91A 1JRHI 4JQVC 2ZUTA 1U93A 4KDTC 3I9GH 5D70H 2AV7B 3MBXH 4X8JB 3UJTL 3MODH 3QDGB 1HXMB 3NCJH 1OD7A 1ED3B 1CGYA 2UWEA 3HZKB 4KPHL 2IC2A 4XP5H 4ZOAA 5KOMC 2O26U 3PF2A 1MCEA 1CGUA 4KQ3H 2I5YH 2M1KA 1G6RH 1JPST 2BK8A 1LO4L 4RGND 5GGQL 3GSXA 3SOBL 5E8DL 1G7HA 3DV6B 2XACC 2X05A 5HD8C 4JFPB 1MELA 1RZ7H 1DEEA 4TYUA 4PJIA 1JGDA 3U2SB 1PY4A 4LPYA 4CADA 4K94L 5FGCB 1MNUH 3D0VA 4K9EC 3KJ4C 3RY5A 2ZG1A 4NC1C 5K59E 2MNUA 2YXFA 3FO2B 1XGYH 5EC2B 5DMIL 2MSPA 2X4QB 2A9MH 1JTPA 5TDOB 2OR9H 4OZIA 2X4UA 2JK5A 1CDHA 4ODHH 3D6GA 3ZYIA 2WBWB 5KANI 2VZUA 3QAZC 3TVMB 4U1JB 4ODSH 1AGDB 1SQ2N 1T3FA 4J7RA 4M02A 1KB9K 1WFNA 1TMCB 2UYLB 5HDQH 3U0WH 5LQBH 2AEPH 2VO5A 1N6QH 3EFDH 5T33L 1AXSA 4KI5F 1BD2A 5FM5M 1CDJA 1PG7H 3FO9B 1DVFC 5JR1H 3D3VB 3W39A 3LMJL 3MTRA 5E94A 3BUTA 4I3GA 2E9WA 1U8KB 2XZQH 4DUXA 2IFFL 4PJXA 1RUAL 3TA3B 1NUNB 5CD3A 4XNQA 5HVHC 2P7TB 1ZANH 2BVQA 4XGZA 3FB7B 3ULVL 4ORZC 3U46B 4MA1B 1TCRA 1MVUA 1ZVSA 4L8DB 4WFEE 3L5IA 4QHKJ 1G0YR 5ISZE 1BP3B 3STLB 1UKQA 4OCRH 5EORH 5IHZB 5J9PB 1H3PL 3HCVA 4AL8H 5E2UH 1WBXA 4H0GA 1YEIL 4PP1D 1TQCB 2FIKB 1T66D 5A3IC 4MDJA 2DM7A 1IAOA 3EW3B 4JE4B 4ALAL 4HDIA 5BXFA 4DJMA 1DBJH 3IDMB 1AC6A 3MMEA 1X5GA 3PL6C 4YHOH 4ZS7L 1JWSB 3IJHB 2IF7A 3LEVH 3QXTA 4QRSA 1PGRB 4F33B 2IAMC 1HH9A 1JMZA 4QF1B 2OL3A 3H42L 3FHAA 3REVA 2DMKA 3EYSL 3Q3GB 4D9LL 4YX2H 4LLUA 2HMIC 3L95A 2W59A 3HUJE 3WNLA 4NWTL 3PWPE 5J11B 3DVIA 1R3HB 5FKPB 4LKXA 5IW1A 3LKSB 3JWDL 4XB7A 5EUOF 2DQGL 1G7MB 4YO0A 5FGBA 1RJZA 3S35L 2D7QA 4WI6A 5C8JA 1NGZB 2KL6A 5GRJL 2H9GB 5IF0B 3B9KB 5LG1A 2Y6SD 4RFOH 2DJ4A 3HA0A 1BOGB 4KTDL 4OLVH 3VI4E 4I5BA 1VENA 3O9WC 4WVRA 3RBSA 43C9B 2B1HH 4YDVB 4JM4H 2ESVD 4ZFGH 5B38B 3HI1B 4HX1B 3U1SH 5C0IA 1QNZL 2AJZB 4OCXL 5JTWA 3RWGA 1OCWL 2ADFL 4JY5L 4JFXB 3QJFB 1GGYA 1RHFA 2DYPA 1NFIB 4GQ9H 2WAHA 1D7FA 2R0ZL 3MRIA 5KSBB 1W0YT 4P23B 3MRGB 2WWMD 2GTZA 2BC4B 1U8PB 4FXLA 3DTXB 4GQPH 1RUPH 4JY6A 4M3JA 4B50A 4FQIH 2DMBA 3RX7A 4Z0XA 2G60H 2DBLH 4PJEA 5DSCA 3MLSH 4PJ5B 5TE4H 2PTVA 3A67H 1JPFA 1KIQA 4UTAH 4HWNA 2Q6WA 3TBYB 1V7NH 1K5NB 5HGGS 4TTDD 4KJQC 3GJFK 4GSDH 4WUKL 1T22B 5TQ2H 5IM7A 1ROWA 3MYZA 3RGVA 2YRPA 2OMNA 1GAFL 3QPXH 4H20L 4HIXL 3QI9C 1XGUB 4TNWF 2HRPH 2I27N 3JV6A 3QUZB 4HIHB 3OKEB 4MA3A 2BNRB 2J5LC 2LTQC 3SDDB 3ALWA 5B3JE 3DNKA 3E8UH 2LV4A 1A0QL 3T3MF 4HUXB 3C08L 4ZAKC 3RKDD 1J8HB 1NCTA 1W2KT 2FJFA 3BUYB 3DIFA 2AEQL 5CP3A 3HMWH 1PG7W 2ARJA 2QLVB 3QFDB 1OAQL 4TVSa 1XF2A 3NIDF 1K6QH 2NYYD 1FC1A 3GBLA 2IPKA 4AZ8A 2FGWL 3S5LA 3RTQA 3ZKQD 1GGTA 1HQRB 4KRPC 1HHKA 4J3SA 2A77L 4O02H 2JCCA 1T0NB 1TETL 2HLAA 5E03A 4HFWB 4A6YL 1T7WA 4LLYA 2WIIA 1AR1C 4X7EC 3RGVD 3WJLA 5GS0D 3VFGH 2VDOH 3MLRL 4TVPE 4E41B 1QR1B 2HT3C 1J05B 4N9GA 3P30L 1DQJB 3MRPB 3SDXA 3BKML 3CFCL 3QEQB 2A9NL 4JANA 1C7SA 2QQNL 1ZLVH 4R7NA 2X4TB 5CKAA 3VRLE 1XR9A 1WIOA 3CFBA 3TIEB 1EMTH 3O6LL 1G7IA 1T1ZA 5E8PA 3HPJB 1UKTA 2D4DA 4D2NA 3EO1B 4WEBL 4LNVA 3R4DA 5E8OB 3UBXG 3RTQD 2C1PA 1A22B 5GZOD 3FFDA 1IEBB 3QEUB 1U58B 3TCLA 4X4XB 2XT1B 4OGAC 2M2DA 5GS2D 1P84J 1J0HA 3OR7B 3NAAH 1R5WA 1VDGA 3DMMD 4QCIB 3BEWA 3ARVA 4RMUA 2FJGA 2AJVH 3C87A 1NJ9B 4IRJC 2NR6D 3BKYH 2RAMA 1NC4B 3WNOA 1C5CH 1RZIB 5ACZA 1U6AL 4U6XA 4XNZB 1XCTA 2MHAA 3PWNB 1OAUL 1ZEAH 2MFNA 1BFSA 4LRIC 3QISA 1QSED 3BEVB 5IVXB 1FBIL 3U79A 4NP4L 3MGOA 3C8KA 3CXDL 3QCTH 4OB5H 5EO0A 3MRBB 3P40A 4ZS6D 4I0PB 2X40A 2EIBA 4WU5A 1KCKA 5FGSA 3SE3A 5C0BA 1J5OH 3F7RA 1FNHA 4MVBD 4NQUA 5EH1A 3B2VH 1OM3H 2Y1VA 2WNGA 4I18C 4DW2L 4E42B 3MBEB 4FFWD 5LJYH 2XWTB 4CNIA 1NCBL 3D18B 2AKRB 4KAQL 2V2WA 3VD9A 3D85B 4V2BA 4RZCA 3PV6B 1F4HA 2P8PB 4LSSH 5HYJA 2B4CL 1ORQB 1Z0NA 4S1SH 1XGTB 5BZWA 3KYMA 1UCBL 3MSPA 3T1FB 5J6GA 4LIQL 1Y0LB 1HINH 3CD4A 4V1DB 3ZSTA 3DVNA 3GDBA 4FQXC 4Q9RH 1X5LA 3VU2A 5FDYA 3EYOB 3OPZL 1XH3B 1FVEB 4HHAA 1F00I 4HKZA 4JLRA 4L8SB 4WUUA 2A1WL 1XEDA 3DUSA 4MJ6B 4GG8B 3N9GH 5E5MA 3WXWL 3RNQA 4U7SA 3IDXH 3ARXA 1KJ2L 5FCSH 1J8KA 2JB5L 2WBKA 1D6VL 2DI8A 5EO1B 3MNVA 2E6PA 1JCKA 4MNQA 3UTSD 4Y4KD 2DB8A 3ARDB 3EAKA 1QVOB 3GSNA 4YZFE 1TVHA 5HYJD 4ODVL 3F7PC 3P9WB 2XA8H 4LDEB 5B39G 1BM3H 1YNKL 4L4VD 3ULVE 4IIQB 2ADJA 1FNFA 1UKSA 3BQUA 1RZKC 2CIKA 4PJDB 2R2HA 3S88H 2VWEC 3FB6A 2VB5A 4AIZB 3DETD 3ORJA 5FYJU 5FDWA 5BO1L 1CU4L 4WCYL 4NN5B 4QHLA 2V5MA 1G9NH 3I6KA 4NWUL 5F1NB 2VNCA 2GCYA 5J13C 4Y5XA 4HWBA 4G3YH 3EZJB 1XGPB 1BEYL 2VLRE 4QLRA 2HP4A 1D5XB 3TYGL 2CDFB 2NXZB 4JFZH 5IB4B 1QEWA 3RVTD 1KCLA 4HFUH 4ZXBC 5EU3B 3HAEA 3JWOC 4O2CB 1CD1B 3KYKL 3LDBB 4OZHE 1CF8L 5C0EA 1EK3A 1NGPH 3IDJA 2CXKA 3TO2B 4LOUC 5A2KH 4Z7UA 2BSTA 1X5HA 1KBGH 2EC8A 1BX2B 1F8TH 3MRRA 1OHQA 4JFDB 4JFEA 3D9AL 2KQNA 2OTPA 3VXUE 4MAUH 5IVXF 4YHIA 1FFPA 3T0EA 3W0WE 4ZUSB 3O81A 5TDNB 1KEGH 4HPOL 4ZTPH 3S36X 5IQ7L 4NKOB 1YEHL 2PYEA 4NO0A 3BN9D 1PYWA 1NMAL 1K4CB 1Q0YL 1U8JB 4XMPH 4H88L 2W0LA 2NY1B 1IC7H 2CRMA 4U1IB 3LPFA 1H0DA 2F19L 2XNAB 4HC1H 3MROA 4X4YA 3RVXD 1Z3GL 4IMKC 3SBWC 5BRZD 4OF8A 2YUVA 3HPLA 1H5BC 3QUYD 2CR3A 1KELH 3IRPX 1NGWB 1Z9LA 3V6BR 5I1JL 2HFEA 1G9MC 3LH2H 1K4DA 5DD0L 4P5TC 5E6IC 1YMHB 2VLJB 4X7TA 3RWHB 4JFED 5I66B 4IRSD 4LQFH 1INDH 5CGMA 5D9SB 3RL2B 1F58H 4OQTL 3O11B 4Z5RB 1AO7D 1EBPA 4NPYA 3IDIA 1E4KC 2EDHA 1QZ1A 2PYED 4NO0D 2OK0H 1GHFL 3PWLB 2ERJB 4XBGA 5GGVH 4DAGH 1KTDA 3PWJA 1FZMA 1A7OH 1KPRA 5CUSH 2P49B 3Q5TA 4QXTB 3QQ9D 4GMSH 3U0TA 3T65B 1LQSR 5JNYA 3NIFE 1ZGLP 5DJ0A 5D2NE 5CD5D 4Z6AT 3TNNA 4PLJD 4PJDF 3VD7A 1HEZB 2BHUA 4MXWL 1X6LA 5F97E 4WHYH 4X9FA 4JHAH 2ADGB 4XWOC 4WJ5A 2J1KA 2OYPA 2EZ0C 3VGBA 1RUKH 4K71C 1QFUL 1MCBA 4P2QE 5T3ZD 1F4WL 4Q2ZB 2H1PL 2DM3A 1Q94B 3QCVL 5E9DB 3P0VL 5JXAL 1HXMA 3MJ8A 1ED3A 3S34H 1W72B 1MCHA 5D1QB 2L7UA 1R24B 3HZKA 4KRMB 5ICXB 2HFTA 4FQ1H 5C0NC 5C92A 4UDUA 1J0KA 4MB3A 2RR3A 2VDRH 3I50H 4G9FA 4NRZA 4KGJA 2NY2C 3NZHH 1S3KL 4ETYA 2YUWA 3MXWH 1EUTA 1P69B 1HYRC 1SJHA 3O6FC 5FUZH 4FG6D 5HHME 2I07A 2VL5B 2VAAB 1PLGH 2VXQL 1AFVH 1JPTL 5C2BH 3MV7E 1B0GB 4WHCA 2VL4A 4JO3L 5F6HI 2R2CA 1QFWH 1SY6L 5GRZA 5KVGL 4QTIH 2Q20A 3H9HA 5DUMH 5IVNA 4X7SL 5FECA 4GRLB 2ESVB 2EXYD 1NBVH 4JZOB 3HHRB 1JK8B 2D0HA 2X9YA 4G9FD 4JHZA 3HC3H 2X9WA 3K2MC 1B4JH 3VFVA 1CLCA 1V7ML 1AGEB 1F4AA 3C5SB 4MQSB 2V7HA 1AGDA 4U1JA 3ULUL 4YHZL 3VG9C 2DBJA 2UYLA 5DDHA 1KCUL 4PR5A 4ZFOL 4XNYH 4FFVD 3VFRB 5FAAA 4EI5A 3C6LD 3O41A 4KKCC 5IJVA 1RUML 1M7IA 5FA3B 5GS3A 3KPPB 1I4FB 3ETBF 5C0CE 3AGVA 1EBAA 5KW9H 1U8KA 3RKPA 3FT4B 4MCZB 3TA3A 5LCVL 3W81A 4JCLA 4EDXB 2EYTB 3BE1L 2Y07H 1UM4L 1TJIH 4PGEB 2GY7B 4NKDA 4D8PA 5F3BB 3U46A 4L29B 3O4LD 1YEEL 3GMQA 5TF1L 4L8DA 4LIQE 3RUGE 3GK8H 1YUHB 3AREC 4DEPB 2ED7A 4JFFA 4OM1L 3S3SA 2CXGA 3DBXB 5J9PA 4DUVA 3LEXB 2WIMA 2X1WL 3RWDB 2AJYL 4EI5D 1FIGH 2NY6C 4F2MB 3IGAA 4FS0A 2FIKA 1P4IL 3CC5B 5BQ7A 3TN0C 1RQ5A 2DLTA 4D9QD 5LGJA 3X3GL 1CQYA 5TDPA 2BFVH 2JTDA 1X4YA 3QB7C 4LSQL 1FYTB 1NUDA 2FJHA 3FFCB 3VWKC 2EDEA 3QIWA 2RFXA 2YZ1A 3IB4A 4RMRA 3VXOB 3C2AH 4QNPF 5HHNB 1JWSA 3KR3H 4HG4J 4MSWA 1T1WB 4U6VL 3UDWC 4NNXB 4P2CG 3G6JE 1D6EA 1XZ0A 35C8H 25C8L 4PV9A 1A7RL 4RAUB 5M7QA 4G8IB 3VJ6A 4JFFD 1BZ7B 3OG6B 1R3HA 5FKPA 1QQDA 3LV3B 3GO1L 4TNVK 3IETB 4BSWB 3NTCL 2DWEB 4UTBL 1ZLSL 1IEHA 4RDQG 3IF1A 5IROC 3D39E 2H9GA 2FEEL 1P9MA 2VSCA 2EO9A 2NY7L 3QEHB 4Y88A 4HWEL 4H25A 3QIWD 1JYXA 3I84A 3U30C 2AK4E 3BO8B 2O5XL 4JPKL 5D7IB 4X9HA 1EEZB 1MHEA 5FCUL 3MJ9L 5L9DH 4FNLH 3HI1A 3VFMA 1UWEL 3RA7L 1VFUA 1IL1A 1F3RB 4X6CA 2CO6B 5KSBA 1NEZB 1K85A 4FQHA 3MACH 1KB5B 1ZHBB 5HI3D 4OLWH 2BC4A 2ICEA 4RA0C 1I1FB 2QHRH 3SGJC 2ZUSA 4PJFE 5EB9A 2Y5EA 1YNTB 3CGTA 5KANG 1DP0A 3RVWD 4HKXB 4HUWB 1EH9A 5JHLL 2UV3A 2R29L 2M26A 3G6AA 3TPUB 5DJDA 3IDNB 2AVGA 4RFNC 3ABZA 3O0RH 4RMWA 4K94C 5AAMA 3DI2B 1NCDH 3TBYA 3CFKB 5J3HC 1J18A 2CKBA 3JBG7 4ZTOL 1R3LA 5D5MA 3ZDXE 2PO6C 4XP1H 5K33A 1A5FH 5ADPH 3EJYD 4XMLH 2YD6A 1IC5L 5D7JA 1SMAA 2HFGL 4PUBL 4S2SA 2ZKHL 3T08A 1UXWA 3MRDB 4NUGH 4JEGB 4HIHA 3OKEA 4XB8A 3CZFA 3FN9A 2C4FU 1QFWI 3BMWA 4HH8A 5D70L 3MBXL 3L5WB 3MODL 3BUYA 1MWAA 3NCJL 3S37X 4HKBA 4X9BA 1ZWIA 2CKNA 1MVFA 4OZFB 1H3VA 2D4FA 4G6FD 3MLZH 5GRUH 2E7HA 3MV9A 1N64H 5C0AB 4KQ3L 2OTWB 1G6RL 1VACB 4AT6A 1WAAE 2FCBA 5GSVA 4NNYB 4HFWA 4MJIA 4BUHA 1HHHB 1RZ7L 1HSAB 2X4NA 3MA7B 3UTSB 2A0LD 1IAIM 4WV1C 1NDGA 5D7JD 1XF3A 4KK9D 5ID1B 4PLOB 5JW4Q 1VEMA 5H37G 3ULVC 1LO5A 4K3GA 4OD3L 5D1XB 1JZ3A 1DN0B 1X6NA 4BH7B 1TVBA 3CXHK 3QEQA 4HLZH 1C5BH 2X4TA 1LILA 1IQWH 1TQBC 1X7QB 1XGYL 2V5YA 1AKJB 1LEKB 3TIEA 3ZO0A 2OR9L 1A7QH 3QUXD 1CFSB 4JPIB 3I3EA 1JGUH 1DL7L 5E8OA 2L7JA 3O45B 4ODHL 1DBAH 3FT2A 1L7TH 4KVCH 4FP8H 1AGCA 2OP4H 1E4XL 2GI7A 1BF8A 5CFHA 5TE7L 2VXSH 1MLBB 4P4KC 3LSOB 2D0FA 4Q6YA 4Y1AD 4NGHH 2A6IB 2H8PB 4MJID 4UNTA 3HZVA 4GS7C 3OR7A 5D7IF 1TTFA 3QFJE 2PW1B 3CFEB 3U0WL 4QCIA 5HDQL 3DUHA 3JV4A 2AEPL 5LQBL 1N6QL 1T20B 2AI0H 2ENYA 3EFDL 2Y7QB 1BLNA 4XCNB 2XQYG 4ZSOE 1NC4A 5C9KA 5DRZA 1Z9SA 1PG7L 5I1IH 5I8EA 1RZIA 1DSFH 2R4SH 4IBLT 9CGTA 1AGFB 1W72H 3JWDC 4N8VA 4WY7H 4EUPG 3QBTB 1GZQB 4JRYB 4PTTB 1EPFA 2DTMH 5HYSB 2JLLA 3FMGH 3ZKSD 4OLUL 3QIUC 4FTVA 4LLQA 1PKOA 4R2GD 4O4YL 2QADC 4APQD 5K9OB 2BHZA 2GITB 2VIRB 1IZJA 4OCRL 3MBEA 4PIRF 5KZCD 2YBRB 2XWTA 3VRJA 2BDNH 4AL8L 2GSIA 2AKRA 1J88A 5JIPA 3D85A 3WO3B 2DQTL 2P8PA 1U91A 2R2BA 1FVCA 4JM2B 5D72H 1MIMH 2XXMB 4U33A 4LLMA 1NC2D 2CK0H 3N06B 1Y0LA 4C56B 4NO5B 1JTTA 5F44A 3V79C 1P5UA 3V5KB 4YHOL 2HVJB 2P48B 3HRZA 5GGUA 4L8SA 5GS1A 4FTVD 3M45A 1YJDH 1AO7B 4YX2L 4LCWB 1YMMA 1G7LA 3BVNB 1AP2B 1IGJA 1BQHB 2DQHH 4YGVB 5FIEA 3EGSB 4PJXE 2X42A 3RWIA 3ARDA 4JQXA 4RSVA 5BVJA 3RY6C 1QVOA 2D7OA 3VFWB 5B21A 4B7LA 1PBYA 1MCKA 2VJXA 5F7UA 5D2NC 1NPUA 3QXUA 2FECI 1EGJH 4LSPH 4RFOL 3T2NH 4OLVL 2HKHH 3LN4B 3C60D 4YHNB 1KJMB 2AS5M 3V5DB 3RZWA 4JM4L 2PW2B 5C0DB 1B88A 5IFAH 5LWYH 4NM8H 2ZUXA 3LHPH 4GBXB 5L7XH 3VH8G 1IM3B 2VXVH 2CGRH 4RAHA 4GQ9L 1IFHH 4PRPA 1YMMD 1MCCA 5JW4R 1JZ8A 2VQ1A 5C09B 5GHWH 1RZFH 3BWAB 5DF0A 1PSKH 4ODUB 4PGBB 5I15L 3WIHL 4NRXB 4KROC 1A14H 5IB4A 2ZWLT 1S7WA 4YBQD 2G60L 4Z77B 3MLSL 2VMFA 1CD1A 3T0AA 2Y4SA 4NQVA 2VDKH 1J1OH 1V7NL 4WI8A 2R8SH 3UO1H 2KDGA 4MD0A 5FA4B 3WE6B 1C8PA 4JFDA 3QG6A 2NMSA 3U36B 1X4ZA 5TQ2L 4HW6A 4OCLC 3PXJA 2CJUH 4JFOB 2X9XA 5DUPH 3MFGB 4PRPD 1T7ZA 3QRGH 3QPXL 2HRPL 3TO4A 1MRDH 1K4CA 3E8UL 1VKXB 4NFBA 4U1IA 5IHUH 1DDHB 2ZOKA 2PXYB 4GAJL 5ALCH 4G8GD 1DQML 1IGYA 1LE9A 1E27A 3HMWL 1YPZB 4LLWB 4HUVB 4WW2C 3HN3A 4OCSH 3LAFA 2ZG2A 5H2BA 4JM2F 1YMHA 2VLJA 1I8KA 4P49A 3K2UH 4JREC 1P4BH 1RMFH 4O02L 2P5EE 2DF3A 3KS0J 1IMHC 1BBDH 1EIBA 3VFSB 2Z31B 4L8CA 5D9SA 2R2EA 5T1LD 1NFDE 2QQLH 1ZV5A 3VGFA 2VDOL 3ZTNL 4Y19E 1KB5H 4M7LL 3TO4D 5HHPB 5DS8A 3PWLA 3WS6C 4URTB 1IZKA 3CSPA 1D9KC 4U1LB 4IDLA 1CVSC 4GKOA 3STZB 3T2PA 4HQQH 4XPBH 2WW8A 2B4CC 1TZHA 1PY9A 3DUUB 3CSYB 2DQFA 3QUMA 2YR3A 4QRRB 3EOBB 3GBNL 2F54A 4GMTH 1HEZA 5MEND 5DTFA 1KPVA 4Q0XH 3PHQB 2H6PA 4HWUA 3FTGA 2ADGA 3GSUA 2AJVL 1SYVA 5TPWH 1T5XB 2EXWC 3BKYL 2EDYA 3IXAB 4ZFZB 1FFNA 4Q2ZA 3HTLX 2VUOA 1FO0A 5E9DA 1ZEAL 3T4AA 1W72A 3O3AB 5D1QA 3EOTH 4XP6H 4OZFH 1OAZH 3KHQA 3GNML 3MUZ1 3GMRB 4IS6B 7FABH 3WV0A 3RU8H 2P1YA 3ILQC 3VWJC 2YPKB 1HHGB 2H32B 4YUEH 5D1ZB 4F80A 1MCOH 1MCDA 4U1MB 3HB3C 2F54D 1J5OL 2HLFC 3F7VB 1NBYB 4X6DB 4ZO7A 5CEZH 3DYOA 1M6OB 3HE6C 1LO2H 4WU7A 1MREL 4NFDA 3FOMB 3ALXA 4ZUUA 5D7KD 1R5VA 2ZUVA 4ZUTB 3N1QC 2VAAA 5D6DA 2XG5A 1I7ZB 2AGJL 2X4OB 4LSSL 4S1SL 4OGXH 1XF5B 4I48B 1B0GA 2HT2C 4XCCL 1GL4B 3DROB 4NZRH 5JIHA 4NQED 2VDLH 1DFBH 1BBJB 1D5BB 1HINL 2R0LL 2NY4D 4WI7A 2JE8A 2HG5A 4GRLA 5E6YA 4Q9RL 1LP9E 5I71B 3KNBA 2YD8A 3NCBB 3GMLA 3P3YA 4HS3A 1LK3H 1YEKH 2AXGB 5HYIA 2PF6A 4BQ8A 4RWHA 3RWFB 3N9GL 1WZ1H 3N50A 4H8WH 2V9TA 2AQ3A 2NY5H 3SEPA 5KG9B 2DQCH 5I8KH 3SHSA 3WKNA 2HN7B 1S7SB 1RZJH 5I1LB 5I1HH 4XP9H 3VFRA 2YSSA 1NDMB 4FMKA 4YBLB 2IJ0C 1UZ8B 1EEYB 3C2SA 2FR4B 4JR9L 5J13B 3WIIH 1GGUA 1BM3L 1I4FA 3L5XH 5C0BE 2JJSA 1MAML 1SHMA 5EOTA 4R4NC 5CJQL 5EWIH 3D69B 4R4BB 3S88L 5TGBB 5DHYB 3GHBH 4PB0H 4YPGA 1CYGA 3SGEH 2FHFA 5JA8B 3PGDB 3S4SA 4EDXA 2QR0B 3KYNA 4PP2B 1JN6A 3CK0L 5F3BA 3QIBA 4XCYA 5GGSY 2XTJE 4PJAB 3V6OE 3BW9B 1KOAA 5EO9B 1YUHA 2O93L 3KPTA 2OJZL 4ZMAT 3RWDA 4HF5H 3VD5A 5ESAA 4BM7A 2SEBB 1GXEA 5AG8A 3K4ZA 3CC5A 3L3HA 4WUUE 4PJHE 3WFHA 1Q9KA 5EPMB 1FGNL 1WT5A 1NGPL 5J6HA 1FYTA 3UC0H 1KBGL 3LKPB 3QULA 1F8TL 3RX8A 4YC2C 4CRPA 3VXOA 4XH2A 4POYA 5JOPD 2DQEH 1T1WA 3UJIL 4ODTH 4JPWH 4LEOB 5BJTA 4HZLB 1U8IB 4MAUL 4U0RB 1YEGH 3LN5A 4NC2B 4MQTB 3QIBD 4W81A 1KEGL 2MJWA 1PZ5B 3HLAB 3MRHB 1BZ7A 3UJJH 3LQZA 1OW0C 4TSCL 4XMPL 2AEWA 2Y5TB 1KXVC 4PRIB 3RHWK 5D96C 4X6DF 4EDWH 4WTZG 4HC1L 3ZMRA 5D8JH 2GAZB 5JHDD 1T2JA 5DRXB 4L4TE 4JDTH 1A1OB 2VN7A 3S37H 5FYLH 2EKSA 1WC7B 4I0KA 3BZFB 4LFHD 5ABDE 1KELL 1VEPA 3AU1B 4PPTA 1YECH 1P5VA 3QWRA 3VI3F 4K2UH 4O51A 3MYJA 3BO8A 2VLMD 1INDL 1NFKA 4LARL 2BNQD 3IFOB 4YK4C 1BVLA 4PRBA 3KPQB 4WIQA 1F58L 2FO4A 2AJ3B 3VDBA 4AEFA 1ZVYA 4X5WB 4F9LA 4HGWA 5DJ2B 4XRCA 3ZKND 3DX8B 2COQA 1GSMA 1A6UH 1I1FA 3K8MA 4Z7UE 5EBMB 4G80B 4P46A 2OK0L 5GGVL 2CMRL 4FZ8H 3GSQB 1A9EB 4BSVB 2V5TA 3FZUD 3LKNB 2C7UB 1A7OL 4HUWA 4ISVA 5HHOA 4PRHD 32C2B 3LN9A 4JQVA 3MFFB 1BGXH 4OI9A 4PV8B 5F1IB 5F72S 1B3JA 4KDTA 4A2MA 3T8XA 2D9CA 1HDMA 1MHCB 1C1EH 1P2CB 2R23B 4R2GB 3RFZC 3OXRB 4JJ5A 4APQB 5IBLC 1QLFB 2NTFB 5TQ0L 5EFIB 3FAXA 3G04B 1T89A 2DKMA 4JHAL 2YD3A 5C08B 2HT4C 4UQ3B 5I19L 5C71A 4L9DA 1RUKL 4JRXB 3MRDA 1MCFA 3DVGB 1UVQA 4P46D 2XKUA 1FJ1B 2IH3A 1A7PH 4PTUB 1G0DA 4HAFA 4PJAF 3MGTA 2IWGA 4F57H 5HHOD 1ZS8A 3MR9A 5MHSD 4KI5E 3MRNA 2UZXB 3VXSE 4OZFA 5IMOB 4FQ1L 3OKNA 3CX5K 3FO1B 3RL1A 2VDRL 3I50L 2HYMA 2I9TB 3NZHL 1VACA 5EN2B 1T83C 4NNYA 3B83A 3GI8L 2ARJQ 1KIPA 3BPNC 4X6FB 4X8XA 1ZA6B 4XC3L 4PRDA 1HHHA 2YD1A 1CGTA 3VCLB 4G42B 3JVGA 5FUZL 1G7JA 2C3GA 5ID1A 1ZT7B 1XGRB 2XN9B 3WMSA 2P47B 5DD6A 1PLGL 2K7PA 4JZJC 5B38G 4MXVF 3I6GA 1JTOA 1DN2A 5CBAB 1J0IA 5EIIB 5C2BL 2YXMA 4NZDA 5HD8D 4F7MA 1QFWL 3C60B 1X7QA 1SJVA 1AKJA 1LEKA 5F7WC 1IQDB 3SGEI 2BNUB 2H45A 1CFSA 4HH9A 3UTTE 1H9VA 1NBVL 3FQNB 3VFNB 2F8VA 3A6CH 2IALB 3K80A 1TJGH 5LVEA 1N0XH 4K23H 1DVFA 3HC3L 2K7QA 3VFTA 2X1XR 3WFZA 4LNRA 1B4JL 3O2DA 1ACYL 1A1MA 4LDOB 1JPGA 5H35B 1UWGH 4WFGE 3QDGE 1KN4H 1BVZA 1HNGA 3VMOA 1Z6JT 4YDLB 3G6DH 3DXAA 5GGTH 1T20A 4XNYL 5AUMA 3U9UB 3N1PC 4WHYG 4NIKB 4OCNC 4NJAH 5DHVA 3QA3B 2GT9B 5EBLA 1IAMA 3AREB 4JPVL 1S5IH 3L1OH 3GSWA 3H3PH 1YEJH 5KW9L 1T21B 2K1MA 4PJBB 1KIRB 3BGFC 2NY6B 2XWJB 5DEGB 5CSZB 1ORSA 4PTTA 1BFTA 2H32H 1F45A 3I75B 1DVFD 2Y07L 4YEEA 1TJIL 1P4LB 5FGCE 1R5IB 4QYOA 5KVFH 2VDPH 1IBGH 5E2JA 5SV4A 1CLYH 4XVTH 3TT3H 5K9OA 1T2QH 1F3JB 2IFGA 3GK8L 1JUFA 2XQBH 3PL6A 4MJ4A 3RRQA 3O3DB 3DXAD 2YBRA 1FIGL 2IAMA 2NY3B 2O5YH 1ND0A 4FHBD 1NKRA 5FUOH 1WLHA 2BFVL 1CGWA 3VW3H 3PWUB 5D6CB 4HGMA 2QQKH 4GXUN 3UAJC 1EO7A 3CSBA 2HVJA 1FDLH 3C2AL 4PJ9B 3RWCA 3KR3L 4K07A 5IB2B 3U7WH 1MI5A 4LAQH 5A3ID 4OFVA 5T1LB 35C8L 1DUZB 1XGQB 3S35X 1C16A 4OV5B 1Z0MA 3S97C 4ZYKB 3GKWL 3D3VE 1I7UB 1A6PA 2F5AL 5EZIH 2LU7A 3O9WA 3VXNB 1S7RA 2QKIB 2AXFA 3O6KH 1CE1H 4RBPH 4M9OA 5HY9A 1MY7A 4HUNB 2IAMD 5F7KC 4DGVH 1L6XA 4HWZB 5I2IB 5I16A 2HMID 3NFNA 2APWA 3T3ME 1Y6NR 4R0LB 4ELKA 1KJMA 4NUJB 4HK3N 5HDBE 2Q76A 1I8LC 3BI9X 1MI5D 4XZUA 3NIDE 4CMHC 5L9DL 4FNLL 5DMGC 3D87B 1S8DB 1RJCA 3O9WD 4OF7A 1JV5A 4O00A 4ENEC 5KS9F 3MACL 5K9KA 4KV5F 4OLWL 3O8XB 5C09A 2QHRL 3QQ4B 4U6TA 4GG6B 3V0VA 1HSBA 3CVHA 1SYSA 4IMLB 4EQ3A 1DR9A 2ZOLB 3BIKB 4Z77A 1N59B 1BFVH 3MOBH 3O0RL 3DJ9A 2Z8VC 3QI9A 1QRNB 4DFHA 2FECL 4EVNB 3WEXB 3HG1D 1RIUH 1NCDL 5DGQA 4WW1B 4ZAKA 1VGEH 5HGDA 2H26A 1ZSDA 3WE6A 1KGCD 4HIIA 2WINB 3BZDA 3HMXL 4XP1L 3DV4A 1WEJH 5DJZB 1A5FL 3QSKB 5ADPL 1X9QA 1U8QB 1VA9A 1VCAA 4PJBF 4M8QB 4JFOA 4M5YL 4XMLL 1F4XH 4DVBB 2VZTA 2IBGA 5IFJA 5IT2H 3K3QA 5GISH 4WNQA 2YUXA 3E2HB 3OKDB 4KK8C 4NN7C 4NUGL 5HPOA 3PUCA 1VKXA 3CFJA 3DURB 3V0WH 4ONHA 5F9OH 3U48A 4LSTH 5EUKB 4KK6C 2R69H 4PGCA 3CFDA 1NBZB 1CICC 3EOAB 1IM9A 1NMBH 1YPZA 3GMNB 5SWZD 3CU1A 3MLXH 3T1WA 3VFPB 3L3KA 3MLZL 5GRUL 3AM8A 1N64L 1ZE3C 1VERA 1OTTC 4Y5YC 5FHAL 3VDAA 4ZAKD 3DPBA 1FAIH 1G6VK 1FPTH 4KK5C 3ULSB 1FRGH 5I8CB 3QXDB 2X7LA 1JFQH 1NAKH 5MI0B 1KG0B 1IKFH 4PJ5E 1OP3K 5DJAB 1CZ8H 5F96H 3NABH 4KRPD 5C9JB 3RHWF 3QH3B 2VLRB 4JFHD 3V7AG 5BW7A 3U0PA 1UT9A 5CBEA 1M4KA 4LSUH 3GI9H 5FK9B 1C5BL 4HXBH 3LKOB 1FCCA 2AW2A 3SE8H 2VDMH 4D0BA 2HT3D 3RI5K 3MLTB 1KFAH 3MOQA 2WV3A 2NX5B 4IRJA 5E00A 3R8BB 4XCEA 1L7TL 3H9YA 2OP4L 3FCTB 3F12A 3H2WA 3NOIA 4GLRH 2VXSL 3V6OC 3HZYB 3CSYA 2BNRE 1F97A 2GQHA 3LPGA 4N1CA 2B2XH 1J8HE 1QFWM 2NXYB 4NQDA 3E0GA 3RIAK 1N0LA 4MCYA 3V4PH 3W0WB 3X13A 5E7FA 2YD2A 5J1AA 4YFDB 4OGAD 4O9HH 3MUGB 1CIDA 2R4SL 4I18A 5FGRA 4RQQA 2XY1A 3KVQA 4DTGL 5I17A 1WJ3A 2E9JA 3O3AA 4WY7L 4ODBD 3VRIB 4IRJD 4S1RH 2YPKA 4E41E 2DTML 1CR9L 1HHGA 1T5WB 2HH0L 3OX8A 3B3IB 4Y2DB 3FMGL 1C7TA 4ONGH 5CGTA 4UU9A 4N0UB 4ELMA 1QLRA 1HZHL 3KPRA 3RDTB 4U7MA 3H9SA 3BISA 1WWAX 4ZNEA 4FQXA 3UYRH 5DURD 5E6ZA 2IADA 3FOMA 4HUUB 4MA7L 1B2WH 5D4QA 3SDCB 1T0MA 4ERSH 3BDYH 3BP7A 1XF5A 2YHGA 4M93B 1TITA 3NZ8B 4FFYH 4U1HA 1MIML 5I1DB 1ZMYA 4GKNB 5E8NB 4LHUA 4F7PA 1BBJA 1D5BA 5IVZB 3RVUC 5DHXB 1IGMH 5JIIA 1P7KA 2V2XA 2RCSH 3ARGB 1GGBH 4OUUB 3X12A 2BSSA 3N85H 1BQUA 1XF4A 2PETA 4X5LA 1LO0H 2Q86B 3QQNA 2CLZB 4HLZG 5IMKB 2MWCA 1YJDL 3KPRD 2HJFA 3H9SD 4R26H 5KG9A 4ZFFA 2R15A 1CFTA 1QSFA 4FQXD 5MEQB 4QOKB 2DQHL 2C26A 2FD6H 1N6VA 2HN7A 1FNEB 5IVXE 5I1LA 3DX6B 2IBZY 4WWID 4WTXA 5JOFB 5SWSB 1UC6A 5FYKD 4GKZB 1UZ8A 2B39A 3U4AA 1MY5A 3V2AR 3M17A 4LP5A 3RY4A 1CBVH 1UACH 4LHUD 1EGJL 2JIXB 4G9DA 3T2NL 2HVKB 2HKHL 3D69A 1I3VA 3W11C 4PJ8C 3MRCB 1IC4L 2HJLB 4GRMB 1HCVA 2Y9RT 5JA9A 3QNZB 1JBJA 5LWYL 5F7NC 2YPVL 2IEPA 3LHPL 4ZXBA 5DO2C 4PP2A 4CDGC 2VXVL 3P4MB 5IBTL 2CGRL 3ZL4H 5FO7A 3O6MH 1IFHL 1QSFD 2BY1A 1FG2B 3Q6FA 5EO9A 2EICA 1OB1B 1WTGT 2ICWB 2VZVA 4KJYB 2P24A 5GHWL 4FABH 1JHLL 4ZOEA 4V1DE 1RZFL 1CDBA 3IJYB 4H26A 3LS5H 4KI5C 3BRFA 3GSRA 4Y16C 5INDB 4PLNC 1A14L 2IGFH 5GGVY 1A2YB 5DJXB 3L3JB 2ZNWA 4XAWH 3S9DB 3EYVB 3NFSH 2VDKL 1P1ZA 3T3PE 2BOCB 3HR5A 3D5OF 1J1OL 3LKPA 2R8SL 4Q9CA 2PR4L 5KTEL 3FQWA 4F7TA 3SBWA 4IMKA 4ZXBD 4EXPX 1R0AL 2Q7YB 2Z4QA 4G7YH 2AEIT 1H5BA 2CJUL 2IANB 5DEFA 2FSEA 1F2QA 4HMDA 4BFIA 4LOUD 1TZGH 4XVSL 3STBA 3UJTH 3DO3A 2WP3T 4P5TA 5E6IA 4OFPA 3PP3H 3MRHA 4PJDE 4LCYB 5DVMA 1Y18A 5DD5L 1FGVH 1I9IH 3HE7C 4KPHH 2PCPB 5IHUL 5ALCL 5E8EB 1V3LA 5JXEC 2OI9B 3V7AE 4DCQB 3FQUB 3SGKC 1MQ8A 3BP5A 4C59B 1RAMA 1LEGA 1E4KA 1A1OA 1CFVH 4AM0B 5E8DH 4GLRI 3AU1A 1W0WB 4LDLB 1XIWD 1CCZA 3PJSB 2NCMA 2CRZA 3K2UL 4X4ME 5FM4A 1BBDL 3ARUA 3QXAB 3P0GB 2ADIB 2QQLL 2YS4A 1FFOA 2Y25A 5IB1B 4P5TD 1KB5L 1DE4A 3K4AA 3DX8A 5ISZA 3PGCB 4G80A 3OZ9L 2R1WA 1FG9C 4G6KH 2Z35A 5IQ9B 1G0XA 3IS1X 4J12A 3BZEA 5ITBH 4XPBL 1OGAD 5DGRA 1VESA 4Z7NF 3BFOA 3NH7L 3V5HB 5F1IA 4N0FB 5ACMA 1QBAA 4LKCA 1QFHA 4UDTB 3OXRA 1FNLA 1ZGLB 4GMTL 3CH8A 2DL9A 2NTFA 3CDFA 4ZPVB 1QPXA 5EFIA 2Z8SA 3OKOA 1FL5B 2NZIA 1LE5A 2L0DA 2VQTA 1A6AA 5DWUH 1BIIB 3P9MB 2P8LB 3UZEA 3P9LA 2RB8A 4I77H 3TVMC 3LMJH 5TPWL 5ISZD 3HUJA 3OSKA 2BXYA 3PWPA 1MJUL 1PKQB 3M1BB 3IFNH 2VLJE 4PTUA 2VITB 4LPWA 1QTYT 3LQMA 1RUAH 1OP9A 4XNUH 4N0RA 3O6FA 4XWOD 4WDIB 2EZ0D 3EOTL 4XP6L 1OAZL 7FABL 3LEYL 4LGPB 3RU8L 1JGEB 4LPVA 5T1DH 4YUEL 2I9TA 1LWRA 3BP6B 5EN2A 4P2OB 2BVTA 5ECJE 2BP3A 3FONB 4X6FA 5ILTH 5KSAC 5CEZL 1LO2L 3TA3C 2HJKB 3ARFB 3H9ZA 4OF6A 3LQAH 3VCLA 4MAYB 4ZOCA 3WBDA 1E4JA 1S7VA 1XGRA 2NY2D 4POUB 2J6EH 3VXTA 1G7QB 2DI9A 3ILPA 1DJSA 1G9NC 3PWPD 3WUZA 5B4MC 4MA1C 5IW6B 5CBAA 4OGXL 1CD0A 5F7DB 4QTHA 3LRSA 4NZRL 3O6FD 1UWXK 2AK1L 2VDLL 4H5SA 4ZS7H 1EX0A 1ETZA 3WHE1 4GAYB 1NEZG 2IPUK 1DFBL 1HIML 5I1EL 3I2CL 1KN2L 1TZIA 2BNUA 1TQCC 4PRAA 2IALA 2MQ0A 1LK3L 4PY8I 2A6JA 1N4XL 3L5HA 4HV8A 4ACPA 1WZ1L 4H8WL 4XNMA 5HPMA 3SKNA 2FB4H 2DQCL 2DQGH 3QDJD 4E0RA 4WWKD 3VFUA 1KLUA 4QNPE 3S35H 3B9EA 4C83B 3B6SB 1QR4A 5L6YL 5GRJH 5LAXB 1EA9C 2ARWA 4PG2A 3FO0H 5I1HL 4UAOB 4CJ0A 2XRAH 3U9UA 2DMCA 3L3DB 3GSOB 3F7YA 1U9KA 3P77A 3WIIL 1ZTXL 5J11C 4IDJH 3AREA 5DUBA 5AD0B 4XPGL 1VFAB 5EWIL 5E1HB 5JLZB 3GHBL 1QNZH 4PB0L 4POZD 1OCWH 4UB0H 1IAKB 3L7EB 5IGXH 3CPLB 4L3ED 4JY5H 2XWJA 4KKCD 2X4RB 1SJEA 4GW4A 2R0ZH 2JJTC 3I75A 4BFEA 5I0ZA 3RZCB 3B9KC 4QHNA 3TN0A 4HS6A 1P4LA 1R5IA 4OZFG 3AAZB 4ODXB 1ZOXA 3KPNB 3TZVD 3FQXB 1WBYA 3VWKA 3G08A 1VADA 4KKBC 4J3VA 5JDSB 2XKSA 3TNMB 1CLOL 4HF5L 2ESVE 4WO4B 3UDWA 3WSQH 2OJEA 1A3QA 1MFCH 1UH4A 3CSGA 5SWZB 2ITCA 1MHHA 4P23C 4HT1L 5IEKA 5D6CA 2ENSA 4WUKH 1BZ9B 2IQ9L 4PJ9A 4X5XA 4PG9B 1GAFH 2DQEL 3TN0D 4F58H 4ODTL 1C12A 5DQ9A 4IJ3B 5J8OA 4CBPA 1YEGL 3U9PL 1BQSA 5E4EB 3VWKD 4C57C 1DANU 1MSPA 1AE6L 2V7NB 2ITDB 4NDMB 1AHWB 3ZT6A 3QHTC 1HI6B 4DKEL 5DQJB 5D8JL 3G5VB 4HWZA 3EBAA 2W9EL 3QUZC 2EE3A 3NCYS 4JDTL 4QY8B 3S37L 3SDDC 1TETH 4R0LA 3FJTA 4S1DC 3TFKC 3SGJA 1YECL 4K2UL 3K8KA 1NAMB 4HSQA 2NQCA 4HGKC 3BN3B 4UNVA 3QXWA 3L3GB 1FN4B 2XZCH 2D03H 5BV7B 1JI2A 5LXGH 5EULV 3B9DA 3FHQA 1INQB 3T04D 3I3BA 4UMGA 4EN3B 4LPTA 4QXGH 3CFCH 2BVYA 4OCWL 1S8DA 2A9NH 3KXFB 2QQNH 3WXVL 5F89A 3C5ZB 3H8NA 5KVEL 3FFCE 5K9JH 2WP3O 1EO8H 3QQ4A 4J3TA 5HYSG 4OZGF 4FZ8L 4GG6A 3ESVF 1YN7A 4IMLA 5IESL 3BKJH 4ZD3H 3AUVA 5IIEB 5BS0D 1OL0A 3QG7H 3QNYA 4TUOB 2DQJH 4AQOA 4GUPB 1TTGA 1QRNA 3AXLA 1BGXL 4QEGA 4EVNA 4NO2A 5IG7B 3JUYA 5KAQF 1RK1B 4RFEA 4WW1A 4OGYH 5C07D 3TYFB 1C1EL 2Q1EA 1JYWA 2ED9A 3G9AB 1MFDL 5MERB 2WINA 2J7LA 1ZHKB 2VOTA 4S0SD 4AG4H 3MX0A 3FOLA 5DJZA 4MDIA 4G8EA 1N2RB 2W9LA 4V2CB 4CW1B 3VGAB 4M8QA 3DGGA 3MCKB 4DVBA 1U6AH 1RD6A 4AEIL 4EKXA 4HKJB 1OAUH 1J11A 3B9AA 3CIQA 2WWKT 5EU7E 4PYGA 3MRLA 2PO6D 3DURA 2H41A 5D7IE 2A74A 4F57L 3QXVA 4HEPG 4X6EB 3Q48A 1DUYA 4XCFH 2ZSVB 1RIVH 4CU7A 1BQHG 4UNUA 5SX5K 3LKQB 3VFPA 3IAGC 5L2KB 3MZGB 4B5EA 3PNWB 3SCMB 5CIPB 1YN6B 4UT9L 2XFXB 4YWGH 4XNZC 1JZ2A 4NZUH 2ZPKL 2N1KA 1OP3H 5TF0A 5CZVL 4DZBA 4XAKE 3IVKB 3QJHB 3SDAB 1OT1A 1NCBH 3KYOB 2WMPA 4MLSA 4C4KT 1HXYA 5FFLA 4NQSB 3ULSA 3OKLB 1QSEE 12E8H 1VB9A 4NOFA 5DJAA 1C08B 4I0PC 1FHGA 4HIEA 4HBCH 4RA3A 5HGHA 5C9JA 2FYYB 1X5ZA 2CIIA 2VLRA 4P4KA 3VGDA 2W0FB 1GJIA 5EU6B 1EHLH 3MBEC 4JGMA 5FK9A 3OPZH 3TWCL 1D5ZB 2A1WH 2GJ6B 3FB8B 3ULVD 3TBTA 3MLTA 2NX5A 2OZ4H 5C0RH 1TJGL 1N0XL 4Z7OF 5I76B 3TC9A 2JB5H 4F15B 3WLBB 4K23L 1AQDA 1NMCB 5DMKB 4P57B 3UCRA 1UWGL 1KN4L 2WK2A 3EDDA 5D7SH 4MJ5A 1U3HB 3VXUA 2XV6B 5HHXL 1ZK9A 2ORBH 3G6DL 4L8SC 4O2EB 5GGTL 3W0WA 1OOAA 4W68A 4LLVA 5JMRA 4M1CC 4P4KD 5C0AE 4EXKA 4DWHA 4J4PD 4NKIL 3QIUA 3L7FB 4K55A 4WHTB 5TJWK 5FYJH 4NJAL 4Z8FL 4NT6A 3BGMB 2BCKB 5ALBH 1QUNA 4YFLF 4YPJA 3UPRA 1S5IL 2R0KL 3L1OL 1B4RA 2FRGP 3ARDC 3H3PL 2EDRA 1YEJL 2Z92A 4JQXC 5CEZE 4WI2A 4QRUB 3UTSE 2PYFB 1I7RB 1L0QA 2GW5A 3AC0A 4BQCA 2ZCHL 4YDIH 3OAZK 4FQJH 4IIQC 2D31B 4P2RB 2PTTA 4Y2DA 3TYGH 1Z9OA 3R0MA 1CT8B 3RDTA 3S8WA 5BZDA 4L4VE 1ONQA 2VR9A 2VDPL 1JMXA 1IBGL 3UBXA 2W65B 1T1XB 3LB6C 2YPLB 1I1RA 1T2QL 1TNMA 5D71H 3TT3L 3VXQB 43CAB 3BJLA 3VXUD 1NUGA 3DX9A 3R1GH 4PLKD 1RJYA 2LE9A 3MLVH 5HI4C 4NN5C 5DC0A 2R4RH 3KYKH 3QIUD 1Q9WA 3W9EB 1CGSH 1S7TB 2QADD 2O5YL 4U1NB 5I1DA 4I1NB 4X4ZA 4BZ1H 4GKSA 4MZ3A 3D9AH 1XIWB 3VW3L 4XVJL 2NXZC 1K8DB 4PRNA 3V9FA 2FIRT 1P84K 3RY6A 3OWEA 2FH6A 1D5IH 1FDLL 3UEZA 1AQKL 3P4NA 3U7WL 4LAQL 2Q86A 1HNFA 2CLZA 5D2NA 3LDBC 3SY0A 4WI5A 1N6UA 1Q0XH 1YEHH 4OV6F 2OQJB 1KEML 2ICWI 4M61A 1T1YA 5EZIL 2F19H 4KMQA 15C8H 3F5WB 5DFVC 3O6KL 4JKKA 4B0MM 1CE1L 1FNEA 4YHYB 3DX6A 3PDOB 3TP4A 4JRYE 3HS0A 5MEPB 4DGVL 4GKZA 5I1JH 4P2QA 4Y2OA 4N8PA 1A1NB 1OGAB 4GRWB 4MNHB 4KUZH 2HVKA 2NY1C 4A6YA 3DX7A 1EERB 3MRCA 1RY7B 3SE9H 4HCRH 2O61B 4OQTH 5L8KB 5FO9B 1CL7H 3QNZA 2EC9U 3SKMB 3TH2T 5BRZE 5GRXG 2CDEB 2X1OA 1FZJB 2EH7L 1GHFH 1JF1A 3ZZ1A 3M07A 4Z9KB 2VTFA 4C56E 3DLQR 1E6JL 4I9WD 1J0JA 5EBWB 5HBBA 3IJYA 3TH3T 3SO3B 2DKUA 4Z7WB 4U3CA 1DBKL 4P2QD 5HVFB 1FLRL 5I73B 3MPCA 3MV7A 3I6LE 1BFVL 5DJXA 3NN8B 1AO7E 1JE6A 1PD6A 2CUHA 3MOBL 1T04B 2V2TB 4D0DB 2ERJC 4U0QB 3EYVA 3UZQA 4LCWE 5GIRB 2CKBL 2BOCA 4NHUB 3EDJA 1QPPA 1VGEL 1NQBA 4K7FB 2AXJA 4DOHB 5B39A 1M71B 1LP9B 4OSUH 1EXUB 1EFXB 2Q7YA 1WEJL 4XI5D 5J89A 1I9EA 4WW2A 4P2YA 3WDIA 2GSGB 1F4XL 1F4WH 2H1PH 3QCVH 5IT2L 2H3NB 5GISL 4LCYA 1GZPB 4XHJC 5HHMD 5D7LB 5F9OL 3W9DA 2R69L 4PJCF 1OAXH 1YY8B 3KPMA 3J8F7 3WN5B 4M9PA 1NMBL 1I8MB 4PP1C 3MV7D 4HJJH 5DXWA 1S3KH 1T66C 3MLXL 2VABA 3QUKB 4YR6A 5C0CA 1W0WA 3WS6A 1NAMH 1SEQH 4NKQB 5C09E 3LZFH 4FQPA 4OZ4A 2FL5A 4WWKB 1QO3A 3IAQA 5D1QC 1D9KA 5BV7H 5IB3A 3QXAA 1FPTL 5DC9B 2GK0B 1FRGL 3E6FA 3G5XB 4ONFH 4YIQA 1I8IB 4X99B 1BMGA 1JFQL 1NAKL 1VGKB 3IT8D 4NQXA 1IKFL 5IB1A 4NBZB 2XTJB 3NABL 2UVFA 4S0TD 3SPVB 4AMKL 2EE6A 3RUGA 1WUNT 2BOBA 3PGCA 5GSRB 4JN2B 2Y06L 2WWKO 1RHHB 3G5ZB 3GI9L 4LSUL 2X70B 1HH6A 3GMPA 3PE9A 4PJHB 3SE8L 2E5EA 2MKLC 2VDML 3ARBD 2R56L 4MJ2A 4YHML 3C5JB 1KFAL 4LVEA 3U6RB 1RZGA 4H1LB 3VGGA 4R90H 1KJ2A 2ZP0T 1A9BB 3ULUH 4S1QH 4YHZH 4Z7VF 4NM4H 2BSRB 4GRWF 3WIFA 4TPRH 1CFNA 1D9KD 4UV7H 2CO7B 2EDTA 1KCUH 1ZGLA 1AD9B 2B2XL 2YWZA 4ZPVA 4AIXA 5FKAB 1FL5A 3DHJA 3G6JA 1YPZE 4D0CB 4C4KO 4DVRH 3VWJA 3F7QA 1PQZA 3V4PL 1BIIA 3EO0A 3P9MA 5HJ3B 1YJDC 5ENWA 2G75A 3WO4B 4BK5A 3M1BA 4OIAA 2EDQA 1EHNA 2FHCA 5LCVH 5IHLB 2YOCA 4PGZA 4IOIA 1LDPH 4EIGB 5GRYA 3VXPB 3OJDB 3W2DL 1I1AB 3JZ7A 4Z7WF 1J12A 2EXWD 3VXRD 4S1RL 1JGEA 5CIPH 3W82A 4NBYB 2QEJA 3REWB 2JJSC 3EYFA 3KPSB 2AK4A 1H3TA 1I3RB 4O2FA 1KTRL 4OF3A 1ZLWH 5MEOA 3FONA 2AJYH 5D2LB 3UYRL 3D2UD 4I3SL 1P4IH 2VISB 3ILQD 3VWJD 3HC0B 2FHBA 4LBEB 4XC1L 1B2WL 1G7QA 3V6ZB 3OF6A 4ERSL 3HB3D 2G9HB 2HLFD 5IW6A 5F7DA 3HE6D 4PJFA 4QRRE 4FFYL 3SN6N 2ICES 3CDYA 3PGFH 5IV2A 2F8XC 4DEPC 1DLHA 1JF6A 3ARQA 3O4LE 1FSKB 1MLCA 4GAYA 2AJSH 1CD9B 3D39D 4ZQKA 2X4PA