1QOKA

Mfe-23 an anti-carcinoembryonic antigen single-chain fv antibody
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
241
structure length
226
Chain Sequence
QVKLQQSGAELVRSGTSVKLSCTASGFNIKDSYMHWLRQGPEQGLEWIGWIDPENGDTEYAPKFQGKATFTTDTSSNTAYLQLSSLTSEDTAVYYCNEGTPTGPYYFDYWGQGTTVTVSSENVLTQSPAIMSASPGEKVTITCSASSSVSYMHWFQQKPGTSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISRMEAEDAATYYCQQRSSYPLTFGAGTKLELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MFE-23 RECOMBINANT ANTIBODY FRAGMENT
publication title Crystal Structure of the Anti-Carcinoembryonic Antigen Single-Chain Fv Antibody Mfe-23 and a Model for Antigen Binding Based on Intermolecular Contacts
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 58
structure length 226
sequence length 241
ec nomenclature
pdb deposition date 1999-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qokA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qokA02
4KTEH 3CAFA 1EO8H 1W0VA 4YAQB 1NLDL 3QULB 3PDDA 5DR5L 3RWEA 3CLEH 3UO1L 4P2OC 5CLTA 1GAFH 5C09B 3I02A 5FUCC 5ELIA 4RIRB 4AEEA 2HFFA 1HOCB 1T83C 4UV4H 2AGJL 4ZXBD 3VFOB 2DIAA 5JDSA 4LKCA 1O0VA 3KXFE 1I1RA 1OQOA 3B5GA 1W8OA 1HH6A 2R2CA 3HLAA 3K74B 5CD3A 1FLRH 5K9OB 2BVTA 5HI4D 1OGAD 4NSKB 1TXKA 2XWBB 3D2UB 4AIOA 5FGBA 2YBRB 2Y7QA 5ID0B 3MNWA 2QSTA 3AS2A 4C56E 2MKWA 5TQ0H 3CFBA 2AI0H 3U7WL 2R2HA 3K2MC 3QDJB 1XCTA 4QHUB 1FO0H 3O45B 4ODHH 2FLBT 4LOUC 1QSED 4S1QH 4I77L 1CLOL 1NC4B 3T1FA 1CYGA 5J6HA 3OJVC 3CZFB 4RAUA 3EOAA 2YEZB 4L5FL 4PRHA 4BJLA 3FQRB 3O9WC 2YN3A 3P77A 4WU7A 5HYSG 2YWZA 4HPOH 3VW3L 1G9EA 1TVHB 5AAMA 1IGYB 1C5DA 1YEDB 4LSDA 3F7RA 1JF1B 3D85A 4MA7L 1DTUA 2KZ1B 4P5TD 4ZQKA 4Q6IA 1A02N 1XIWA 4HUMB 2BSTA 2BX5A 5FDWB 1N5YL 3ELAT 2JJUA 1WUNT 1IGJB 1U8IB 4HEPG 5JR1L 2GHWB 3PJSB 3SQBA 3WFBL 2GFBB 1NFDB 2IMMA 4JR9H 1FNLA 3NIFE 5C3TA 1J1XL 4W6WB 4B41A 5C0JA 3WNMA 3FFDB 4LF3B 2OR8A 4EDWL 1ZA3A 4Y7MA 1E6OL 3MLRH 4HGKC 1GSMA 4KAQL 5D7IB 1BFOA 3O3DA 4X98A 4P4RA 4Z76B 4X4YA 3MMEA 3IFOA 3QNXB 1A1NB 1BMGA 4XB8A 1F97A 5DUML 4Q9QH 2OMNA 4MJIB 2Z8WC 3L3KA 4O2CA 1I7RA 2HJKB 2VOTA 4EZMA 2IAMD 1JFQH 1A6ZA 2NY4D 3TNNA 1ZLSH 1UENA 1HXYB 1P5UA 2OCFD 2NLJA 3QJFA 3KPSD 3QI9D 4ZSOE 5F97E 4P59H 1CGSL 1IC5H 1S7VB 3IVKA 1ORSA 4PB0L 3C2AL 4UBDD 3FJTA 4DKFH 1FPTL 3ZT6A 3G6JF 4J6RH 4NFBA 2WMPA 3QEQE 4HUWB 4YXKH 4ZUSA 2FEDD 4CJ1A 2CKNA 3DTXB 5D6CB 5DC9B 4UQ3A 1R3JB 4NZRH 2PW1A 2FYYB 4OCSH 5HYSB 1LWRA 1LEKA 3GSQB 3JTSA 1FFOB 2X40A 4PP1C 1MFAL 4J4PC 3W11D 1BJ1H 4K7PX 4X7CC 3TBTB 5IEKB 1UEYA 3RJDA 4G6FD 1DDHA 4I0PC 1HSAB 4X99B 1GOFA 2V2WB 1AI1L 1RIHL 3PWLB 3QIUC 2VUOA 2Z0BA 1UCBH 1EERB 5EH1A 5JHDE 4OFKA 2DOCA 4DW2L 4XGZB 3L3DA 4JB9L 5IWLA 4FOMA 25C8H 2E7CA 4D9LH 4XC1H 1BOGB 2Z9TA 4ODXB 1LVEA 2AK4B 1FJ1B 3MNVB 5EU6B 1A9BB 5CINH 2D3VA 2Y4SA 3GJEA 4FMFA 3QCVH 1KIRA 5DD0H 4NO0A 3MV9B 5B39B 2Y36L 3HKFA 4ZDHB 3QSKB 1R6VA 1XGTA 4ELKA 4I0CC 3JV4A 3TJHC 2HKFH 2RBLA 1KXQE 4Q0XH 3QISA 4WO4B 5D96C 1QBLL 3RWHB 3ZMRA 1RUAL 2HJFB 4P99A 3RTQA 5A2KH 1B0RA 4Y2OA 1YNLL 5HHNA 3V5HA 4FXGB 1A2YA 4ONFH 2MQ3A 4GQ9L 1XF3A 1JI1A 1CE1L 4MB5A 3TO2B 5I30L 4QF1B 4HWZA 1E27B 1FIGH 3IXTB 3MLUH 4L3EB 4UINH 4KZDL 3IFLH 3WFCH 1U8OB 3BQUB 4OKDA 5C0BA 3H0TA 3O4LA 3U4BH 3QEQD 2YPVL 2EDRA 4Y8DC 3MV7B 1DBAH 4YHLL 4H8WC 5DI8B 3QNZA 1Q9WB 5EPMB 3REVB 4A2LA 2BFVH 5DJAB 4Z7WA 1ACYH 4OV5B 4OCRH 4JHAH 3O6FD 4WFEE 2UVFA 3VGEA 4UAOC 4XNYL 1OPGL 2CIKB 1SBBA 2BVUA 1QTYT 4MD0B 3QDGA 1S7SB 5FHBL 5EU4A 5BVJA 5DMYA 2XZCL 3QXUA 2A6KA 3U9UB 1I9JL 1YJDH 3MREA 1A3LH 2Y6SC 3NH7H 3LDBC 1OP3H 2I5YH 1NLBH 1ZVSB 2VQTA 4U7SA 4MAYD 5C71A 4ZUVA 2ZWLT 2VABA 4NPYB 4Y2DD 2P5WE 4P2QB 5CD5C 4RAHA 4JPWH 4J3SA 4MHHG 1A7NL 4JG1H 1P4BL 2AJUL 2FCBA 5HHMD 4R8WL 4F57H 5F7HA 4RFNC 2Q8AH 2VDMH 3SGKC 4TNWK 1HH9A 4JQXA 3WCYA 4X8JA 5DJDB 3IFNL 1H3GA 4OFYA 1IMHC 3L95A 4OQTL 4D9QE 4S1DC 1CTNA 3SDDA 3QQ3B 3ZDXF 3GDBA 4HIHB 4OZFA 1NC2B 3RI5F 4Y19E 4L29A 2GY5A 1INEH 4E0RA 1RK0B 2ZCKH 3N1QC 3WL9B 3G6JB 3J7HA 3O9WB 3OSKA 1A6VL 3QG6B 4HS6A 3N06B 3MRPA 2FHCA 3AM8A 3G9AB 3MFFA 1QZ1A 3S37X 3BESR 2DBJA 1A9EA 3RY6C 5TDPA 4QTHB 3MLXH 1PG7L 1KCLA 2VLJA 1JGEA 2XKSA 5FYJL 5B38A 1ZVYA 4GS7B 2VXUH 4FQXB 1LO3L 5DSCB 5D2NE 3SBWA 1RULH 3O11B 3MJGX 1JV5A 2BCKA 1D3CA 4PGBB 2YD9A 5IOPA 5D72H 1VKXA 4RX4D 4L4TD 1YUHA 4KDTA 3ZTJG 4TUOB 4KV5E 1UZ8B 2ZNWA 4MJ4A 4LCYB 4LRNH 3DV4A 5JHLH 3S9DB 4H8WL 5LJYH 4FZ8L 4QCIB 5C70A 3VFUB 4HG4J 3NIDE 2Y5TB 1CGXA 3BPLC 2EXWD 5TPWH 3MRLB 1QSFA 2PCPB 5FYKU 3BZEA 5INDB 4YHML 1A4JA 4HS8L 3WDIA 4EQ2A 5HHOE 1FFNB 3O2DA 5HHPA 3OB0H 3EDFA 1HKLH 1XH3A 5E0QA 1KJ3H 3SQOL 1HHGA 4JVUA 1MI5B 1YEJH 3DVIA 1S7XA 2A1WL 2JCCF 3BP5B 1K4CA 4HWEH 1V7ML 5T33H 3ZZ1A 5I0ZA 5FCUH 4YUEH 2R8SL 3AREB 3FFCD 4PJAE 3LS5H 1U58A 1T1XB 4OZIB 4HGWB 3HUJE 1A7OH 3U2SB 1CGTA 1MCRA 4ZTPL 3NIGE 4ZAKA 4PLKC 7CGTA 3SKJH 5D7LA 3WMSA 1S7UB 5TDOA 5KVGH 4AL8L 3HI5H 1JHLH 3O6MH 4OZFH 1MIEL 1VPOH 3SE4A 4RMSA 3OKOB 5I8EB 4I0PB 5I1AB 3KPMB 1T0NB 3QAZC 4CDGC 3IT8D 3QIUB 4XPBL 1T22A 2P43B 1FNAA 2IPUK 3F7PC 2DLEA 2VR5A 2Z8SA 5BW7C 1N0XL 1IC7L 2K3TA 3ARBC 5C0NC 2SEBA 1UYWH 3P0VL 2D31B 3SE3A 3HN3A 1REIA 4XCFL 5FYLE 1IAIL 4CGTA 1T80A 3QXTA 1MJUL 4QT5A 5HYJE 5BJTA 5T1MB 1I1AB 3U83A 4MJ5B 4JZJB 4LSTH 2HKHH 3NCCB 3BFOA 2Z8RA 5D1ZD 3OXSB 1A6AB 1F8TH 4RMVA 3LMJH 2MMXA 4NNXB 1CL7I 2CUHA 3FT3A 3DSNA 3EKCA 2AJYL 4K3DL 1CS6A 3OPZL 1JNLH 4PD4K 4MGXA 5CMAB 2ZG2A 3FOMA 2F15A 1FORL 1RZ8B 4U1GC 5TFSL 2VC2L 4OZ4B 3O2DH 4O5LH 1KJMB 2W92A 1FH5L 4LHJB 1MNUL 2P7TA 4Y5XC 1PLGH 4PJ9D 5DJ0A 2ADFH 3NFNA 1P9MC 5F89B 3VXQA 5FK9B 2V9RA 4XH2A 3RVWD 1E4XH 1XF1A 2NW2B 4NRZA 2JB6B 5J13C 5C07D 2A83B 4UU9A 4LASL 4KWUA 4U1HA 1MAKA 2H41A 1S78C 4XCNA 5D6DA 5DJ6A 3RAJH 1LILA 3UJIH 3FRPG 5H94B 4YHIB 4PJHE 4C57C 4HGMA 4NO2A 5HGAA 4BH8A 3GJFK 1CFSB 1B0GA 5JOPE 1AGFB 3DUUB 3VFVA 2DWEA 1I9EA 4DUXA 4JDVB 4LAQL 5EOTB 4ODSL 1NCNA 3DYMA 1KJVB 1V3KA 5MEPA 1XR9A 2OK0H 5SWZB 3ZL4H 3FRUB 4NKDA 4FQJL 2CUMA 4JQIH 5C1MB 1FNSL 2RCSL 1J05B 2CLZA 5EC1A 5EBWB 1IGFL 3O2VL 4PTTA 1N6VA 1UM6L 2VIRB 3LDBB 1WZ1H 1J8HE 3SDXE 2ATKA 4LPWA 5KANI 4Y4FC 3U48A 1BPVA 4KK9D 4MWFA 3MO1A 3IJYB 2GJJA 1NL0L 3RGVD 5DVLA 1F45A 3T3ME 5I1HL 1A3QA 4ZXBC 3QZWG 2NTFB 1HYRC 4D8PB 4JFDB 2IJ0C 2VJXA 5TE7H 1CFVL 4BFGA 3X3FH 3BT2H 2HFTA 2JCCB 3QUXD 1SYSA 1TVBB 1E4WL 5FGCB 5HI4C 2VZUA 1JRHL 4OZHB 3K4DA 4H5SB 5MENB 4V1DD 3U36B 1ETZB 1PSKL 3E3QC 4AEFA 3DX9A 5E2WL 4Z77A 5DJXA 5D2LA 3JBG7 4LGSB 43C9A 1IL1A 3WSQL 2XV6B 1PZ5B 3PL6A 2NX5D 5KOVC 1MHCB 4P4KD 1JGLL 3SKMB 2A6JB 3VE0B 4QRTB 1D9KC 3LKOB 4Y5YC 2GT9A 4K7PH 2C4FT 4UQ2A 3GBLA 5J6GA 1I85A 1MUJA 1FZOA 2OJZL 3V6FB 1J7VR 2V5RA 1T03H 1T20B 4YNYA 1CDIA 2ESVB 3CZJA 4BSVA 5FA4B 5JPNB 1KN2L 4W6YB 4K94H 4AZ8A 2E7HA 2WBJD 1FP5A 3VMOA 4N90D 4XBEL 4FQ2L 4UOW1 4ETYA 5CEZE 1OAKL 3QHZL 4WUKH 4TPRL 3MJ7A 4JRXD 1KIUA 2OM5A 4ODWB 3IJHA 4MJ6A 5DRNB 4RAVB 5AD0A 2B1AH 2F74B 1CF8H 3Q3GB 3ZHLA 2I24N 4I2XA 4O58H 3KPQA 4MXWH 5DO2D 4HIEB 5IQ7H 5EIIB 3OHXB 2MPAH 4ZS7H 3DYOA 4PJFA 2Q76A 2OI9C 4NUGH 5EUOA 3EJJX 5BRZB 5DJCA 5EOQH 5HDBF 5JMRA 1DVFB 3P30H 2GTZA 2CO7B 2X4OA 3OJDA 1TZIB 2CIIB 3QFDB 4ONGL 4L4VA 5ANMB 1PYWA 4RGOH 1VDGA 1IFHL 3CDGB 4OB5H 2ZSVB 5TH2A 2G75B 2FJFB 2IAMC 1YY8B 4CU8A 3MZGB 5FM5M 5E1AB 1C1EH 5TDNA 3BE1L 2R23B 4YHZL 1CT8B 4YDIL 4FG6D 3W0WE 3ZE0E 5J57B 1WC7B 4Y8AA 3VFNA 4JVPA 4OT1H 3RDTD 4UBDC 3TJEL 3QIBC 1IC1A 3PV7A 5I19H 4XVTH 2IANB 3G04A 5E5MB 4D0CA 2MSPA 4RWYL 2PO6D 4H25A 4AM0B 2GJ6E 1BVKB 3GBML 4GMSH 4X5WA 5E2TL 4HXBL 4Z7UA 1YECL 2H32A 3W11C 3GB7A 2AEIT 4WV1A 1HHIB 5JIKA 1ZHLB 1N7MH 3RL2B 3TH4T 3UYRH 4GAYA 1P7QA 1QFHA 4OM0L 5DFTA 4JFXB 3TPUB 4IMKA 1CDUA 5ITBH 1RU9H 2JJSC 5GS3A 3KHOA 1YC8A 3AAZA 2H6PA 4PRHE 4KXZH 5LQBH 3CFCL 2X70A 5I1JH 1Q0XH 3QHFL 5DTFA 3KDMB 2HN7A 5MEQA 3VXPB 3FB6A 3H9SB 1MELA 4Y5XB 1JGUH 5FECB 2UYLB 3IDGA 2APBA 3CFIC 1PEZA 4J2XA 5GSVA 1SEBB 4H20H 4F9LC 4TOYL 2VTFA 2EXYD 5FGSA 2BERA 4QNPE 1R3HA 4I48B 5DMGD 1MCSA 2NY7L 4HW6A 3FQWA 1N4XL 3RWFA 3HZYA 5F88A 3LKQB 3NPZB 1FFPB 1FRGL 4DGYL 3TYGH 1A1OA 3S37H 3BH8A 1HHHB 3DV6A 2UWEB 5K9KB 2AQ1A 4X0KA 3IGAB 3O3EB 1X5KA 3TO4B 4CL7A 3D3VB 4N9OB 1GGTA 1U3JA 3BUYB 3WS6A 5C08A 1MQKL 3ECBA 1T2QL 4ZFZB 4O9HH 1MCCA 1MCPH 2VR9A 2YD8A 3HZVA 4OI7A 3EYFB 4LK4A 2D9QB 1GHFL 2R4RL 4BZ2H 4KH2A 4WWID 5EBLB 4LLVA 3MQIA 4LRIC 5FF6B 2WIIB 4GSDL 2R0ZL 3TA3A 3OKMB 4CU7A 3O6FC 4GJTB 1DQLL 1FCCA 1YEGH 7FABL 1ND0A 1XGUB 3MOAL 1NGYB 4ZXBB 2Q6WA 1KG0A 2W0FB 4IRZH 3ALWA 4N1HB 4S1SL 4TSAL 1WWCA 4XPAH 5DHXB 5LAXB 2GSGB 5CEYA 1IAOA 4GKOA 1RIUH 4CADA 5J1AB 4WGWB 1F6LL 1OGAB 4QEGA 4MAYC 3VXMA 5I1DA 3ISWA 5IQ9A 2ATPA 3N85L 4DZBB 3GMLB 3T8XB 4Y2DC 3ZKSD 2NY1D 5I66B 2E6PA 5J9PB 3IKCA 5I1EH 1C7TA 1BQLL 3OQ3B 1QSEB 3MRGB 5A2LH 5T1LA 2VH5L 1A7QL 4Y5VA 5KZCD 4M7KL 3GSNB 3KPLB 4XZUA 3WHE0 2JJVA 1KIPA 4L8BB 3B2UC 4GRLD 3WDHA 2DQIH 2YA0A 1BEYL 3V52H 2BNQA 4Z0XB 5C6WH 4OAWA 2R1YA 4G9DB 2F54A 5TE4H 1MJ7H 5T3XH 1R5IA 1MHPH 4BQBA 3VFPB 5GJSH 5SX4H 5D7JA 3V0VA 4LLWB 4EUPG 4XVSH 2CDEA 4QXGL 4P5TB 4N5ED 1BZ7B 1K2DA 1ZMYA 4JKKA 1KCKA 1YPZE 3O8XD 1A22B 3SKNA 4PGEA 1T6WA 4JPIA 4CNIB 3GM8A 1FYHB 4HUXB 2VQ1A 1RZ7H 2EH7L 1JGVH 3O6LL 4YDKL 1YEHH 5I8KH 3KPNB 1NSNL 5DHYA 4XPHL 4R4BA 1V7NL 1NKOA 2FWOA 1M7IB 2DJSA 4K9EH 2D9CA 3LSOB 2F53A 2EXWC 3D48R 2R2BA 3RWGB 1HEZB 3FOLB 3TBWB 1TQCC 2OR7A 1Q94A 5E2UH 1K8DB 1NMAH 1L7TL 1A7RH 5F9DC 4PR5A 4KRPD 2IAMB 2DQFA 2NY4B 4PJ7F 5LBSH 4WW2A 1X4ZA 2B1HH 3QDGE 1LK2A 3KPSB 1K4DB 3QI9B 1BVLB 1EUTA 4BUHA 3HMWH 4YDLC 3MRFA 4KKCD 1UXSA 4G6KH 5JXED 1T0MA 4HQQL 1CIUA 1T7XA 2WUBL 2I9LA 3NMEA 4S2SA 3L3HA 1WT5C 1DBBH 4OBSA 1H3TA 1KENL 5I2IB 3R0NA 4AEHL 2G9HA 3EYSH 4CKVX 3DMMA 4RZCA 4CUCA 4LVOB 3R8QA 3ESUF 2C9AA 2OQJB 2OZ4A 4EUPB 1EPFA 1QKZL 3T0DA 3AC0A 4NKIL 4OIBA 4G6FB 5KTEH 1BM3H 4P3DB 5I73C 1CXKA 4RFOH 4OKVA 1T7YA 3FCTA 4PPTA 2HVJB 5I1KL 2VN7A 5DD1H 1OTUD 1O5DT 1FYTA 1U91A 4XVJL 3I6KB 5LCVL 3RTQD 3VXRE 3PP4L 4J3WA 2EE6A 3IJSB 4R4FL 4HKJB 5HHQB 4XCEA 5ALBL 3NPSC 4GG6E 4WFFD 3KLAA 2FZ3A 5HYEA 3R0MA 5DD6B 4QHKJ 4DKAA 5GZNC 2AJXL 4G8IB 3GMMB 5C0BD 4HIXH 1OP5H 3O4LD 5HJ3A 4WWKC 1TDQA 3WIFA 2VDOH 4TUJA 4MQXD 3LVEA 3MCKA 5IESL 2F19H 6FABH 4YHPA 3WUWA 4M62L 2J2ZA 4XB7A 2J5LC 1XCQA 3BN9D 4WIQA 4ODTL 5IVNA 1GGCL 4M1CC 1I8IB 5DRXA 2VITB 4PJGB 1HWGB 4EI6A 1RHFA 4QTIH 4I5BB 5SWSE 3GI8H 4QLRA 4PBWD 4FRWA 3EOTL 5IVXB 2NR6C 3WV0A 1MRFH 1DN0A 1QQDA 4U6VH 4ZG1A 2R4SL 3CNKA 3CSBA 1NBVL 4OUUB 5IV2A 4FQIL 1NFIB 1EBAA 3DUSB 4F2MB 2UY7A 3QEQB 4RGNE 4LNRA 1GVIA 2O5ZH 4LLAA 1NCCH 2EIDA 1YN6B 1OSZB 4TSCL 1I8MA 2AW2A 4OFPA 3GSXA 2ORBL 3DI3B 2JE8A 4XXDA 5K9QG 3TP4A 1G7QA 3FHQA 2CMRL 3CD4A 2ZPKL 1J0KA 3MZTA 2EDOA 3P4NB 3ULVE 3RVXD 3V6ZB 1OW0C 4WU5A 3RVUC 5BV7B 4KKBC 2EE3A 4GRMA 1KT2B 4OFYD 2H2SC 5EBMB 4N0FA 5GIRB 2CXGA 1JYNA 3RWJB 5D7LE 3F8UB 2O5XL 3SDDD 1A6TA 4K7FB 4X9FA 1VSCA 2ZKHH 4YH6A 5D93C 4KV5F 3MLZH 5JNYB 1YNKL 2FGWL 2WINB 3NA9L 3ZDZE 4WJ5B 4TQEL 1GGYA 3NIDF 1KLGB 4MAYB 1KTRL 2R0KH 4Z18A 4PG9A 3SDAA 4F7CB 3HC3H 4KI5E 4P3CL 5FUOL 5IUSA 4NKMA 3RGVC 3TT1H 3TV3L 3C6LC 2XZQL 4G6JH 4NQEA 1NGQH 2VLJD 5HHMB 2VDNL 5DQDL 1U36A 4PJ7B 1T21A 3BAEL 4PJIB 3P4LA 1AHWA 5FO7A 3MLYL 3QUXC 3E6FB 1CK0L 1UWXK 1H3PH 2PR4L 3KHQA 3A6CL 4PJAF 4OCWH 1RJLB 4ZPTA 3GKWL 3GM0A 4MCZA 1TPXC 4IBLT 5EU5A 3D0VA 1CXIA 4WFHD 1KCVL 4PJDE 3NIGF 2MCG1 3IETB 4M5ZL 1QSFD 2EEAA 3RI5K 1MY7A 3PWNA 3IKKA 1KPUB 2O61A 1S9YA 3HPLA 2EC9T 1MFNA 3B5TA 5GGRA 4KY1H 4NN6C 3ETBF 1GIGH 1GZQB 4RFEB 5ADOL 4WCYL 5F9JB 5TE6L 5IHUL 4ZNEE 4OZGA 4ZS6C 1OAZH 5CBEA 3T0EA 3STBA 3TT3H 5DVNA 4L4TB 4NNYA 2BSED 3W5NA 5BXFA 5C0GB 3L6FB 1QA9A 3MRDA 4G7YL 5D7LD 5CCKL 2VLRE 4TUKH 5EU7C 4IDJH 4PRDB 3BMWA 1U92A 1WF5A 3VH8A 1Y6MR 3UAJD 1ZT4B 1AGDB 1GGIH 4NN5C 5KJRL 4HMEA 4F7PA 4S11A 2R0LL 2FJGB 5DO2C 3LEYH 3QXAB 3X12B 5BZWA 1NAKH 3FFCB 1A1MB 3C5ZA 1R24B 3MFGB 1KCUH 2UUDK 3LH2H 3L7EB 1BQUA 2R2EB 3K1DA 4X5XB 4Z0BH 4HKZB 5FM5O 2VDQL 1MWAA 1MCQA 4TULL 3L3OA 4R2GD 3GMPB 1A6PA 4OFVA 3ZKXB 1YEKH 3FT4B 2FH6A 1A7PH 2YUVA 3UDWA 4P2RE 4P5KA 3QG7L 1P7KB 4PJHF 1Q9LB 4PJBB 3IDJA 3HB3D 4FG6C 4H88L 1H3XA 5I73B 3WN5B 3N1GC 4QYOB 4UV7H 4JJHA 4ZFOL 2C4FU 5EORL 2HLAA 4U1KB 1F58H 1FL3B 3WKML 4YJZL 5I18L 2KQNA 1UA6H 4NP4L 4N0YH 3U0PB 5D5MA 3MV8A 4MXQD 5KSAA 3RNQB 1T1YA 5K9JL 3THMH 3M1BA 3NGBC 3QWRA 4WENB 1R3IH 5J3HC 3I2CL 2DM3A 5IJKA 4MQSB 4PJCA 1LO0H 1TCMA 3RX8A 4PBVC 4P57B 5D1ZB 1SJEA 4IRJB 3SDXF 4WDIA 3TEUA 4GFTB 2QQQA 1FVCB 4M7LL 1CDGA 3LZFL 3N50A 4X7TB 3JVGC 2FO4B 4LLYB 4NQCE 3S35L 3FO9B 2EDQA 5FO8A 3IU4L 1DQDL 2MHAB 3T3MF 1QNZL 3L3GB 1CN4A 1QPPA 1CXFA 1U8HB 2XZAL 1XZ0B 1CFTB 4HCRA 2BSRB 4PJ9B 3UPCA 5IW1A 1GYAA 2XACC 4U1NB 4V2CB 2ICWI 5HGBB 1JPTH 3WYRA 4TN9A 5F1OB 2EXYC 2XI9A 5DC4B 1K8IB 4X9IA 5C07B 3ZYZA 4EXKA 3WIHL 4MAUH 1QLFA 4WEMB 2DM7A 1Z3GL 1BX2A 1MWAH 1S9XA 2R69L 1KPVA 2CLVB 5CJXA 4NNPH 3WXVL 1Y18B 3WFEH 4DCQA 5LXGH 5E24E 5EIQA 4EIGB 3QPQD 1JZ7A 1SMOA 3V6OA 3NACL 1T4KB 4UI2A 1P7HL 1SQ2N 3CMGA 4JY5L 1GAFL 4L4VE 4RWHA 2BOCB 3U0WH 1Q9OB 5E00B 4I18A 4D0BB 4W81A 1BAFL 4IOIB 4UV4L 4EI5A 4CVUA 2HT2D 3NAAH 1OAQH 5D93B 5FGBC 5IK3B 5I71C 5GRYA 1KTDB 3BRFA 2XTLA 3BO8A 4PD4J 3PL6D 1A5FL 4HMCA 1FLRL 1HCVA 5GRZA 1D5ZA 4Q9RH 4FQQB 2ZOLA 2X1PA 4TTGA 3VD7A 3RGVB 2OR9H 1CD0A 3GMRB 2BDNL 4QRSA 1W72A 1MRDL 1Q0YH 5EUKA 3QUXB 4QRQB 4U0QB 1FO0L 3INUH 4S1QL 5DK2A 5JOFA 4CVZA 4V1DB 1AD9B 5CEZL 5F7YC 4QOKD 3UTPE 4JO1H 4HCRH 2BNRE 5C09A 4G8FB 2GTWB 4XNQB 1HOCA 2DJUA 4OLWH 2NX5B 3L3IA 4P4KB 4YPGA 2RFXA 4Q6IC 1XIWC 3T4YB 1S9VA 5DLMH 3JXAA 1IQDA 3MCLH 3VFOA 1EDQA 1B2WL 4NN6B 3IU3A 4L9LA 1SVZA 5BS0A 4IOFD 4GUPB 4HJGA 3ZE0F 3WJJA 3ARYA 4LU5H 2XWJB 5IMMB 2YBRA 3AY4C 2WBJB 1U2CA 3CH1B 5MERB 3NZHH 4KI1A 1AJ7H 1X4XA 1ZT7B 3EDDA 4L4VD 3QDJA 4NRXB 1BREA 4NWTH 4JRXB 4JR9L 4QHUA 4PJXA 5GZOC 3EFDH 4MX7A 3O45A 5CZXC 4N5EC 4NYLA 3P40A 3DECA 4W68A 4K71C 4UTBH 3MSPA 1I3RA 2MCPL 2DLGA 2YEZA 4Q9QL 2F8OA 2YS4A 4GW4B 5EO1B 5J11C 1A0QH 1CFNA 1N59A 4APQA 1JFQL 3HZKA 4PS4H 3PGCA 1IGYA 4WFGD 2W9EH 1FG9C 1BP3B 1W72H 4JLRB 4P59L 1UFUA 5JA8B 4JFEA 2XA8L 4I3RH 4XNMA 1FNEB 2AP2A 1B3JA 1N2RA 3EO0B 4DKFL 5I17A 4MD4A 5EIVA 5DMJB 1B6DA 1Z9MA 1H9VA 4GG8B 5ITFA 4JGJA 2C3WA 1ZHBB 1YEEH 3O2WH 2FX9H 4LL9A 4OCSL 2BC4B 3EO9L 1NFDA 4MNHA 1YJDC 3WFZA 2WW8A 1CXHA 1U8LA 4LLUB 4WGVB 4P23A 3RDTB 5JUEH 3T0XA 5CP3A 1MCBA 2BVOA 4JM4H 2HT4D 1UCBL 4Y1AA 3UTSE 1KEMH 1WICA 2PO6B 4PJ8A 3QNXA 1G7MB 1KNOA 2Y25A 4AT6B 3IS0X 5EN2B 1WEJH 2YMXH 4MJIA 3NGBB 2R0WH 2KL6A 4LBEB 1T1ZB 4AH2A 25C8L 1NAMA 2GIYA 4D9LL 1FO0B 2BVPA 4S0SD 3N9GH 1DEEB 4U7MA 3CLFL 2X4NA 3X3GL 2A6IB 3FN0L 3E1F1 1J9CT 1H0DA 1F4AA 3KPRE 1JTPA 1ZHNB 3QCVL 4PP2B 1OF2B 1U3ZA 1ERNA 1XGRA 4QHMA 3HI6H 4C4KO 1TCRB 5DURD 4NFCA 5IMLB 2HKFL 5T3XD 1T7ZA 3VWKC 4Q0XL 3STZB 5LWYH 1GZPA 5C6PB 4HV8B 3D87B 4LNVA 5FYJU 5L2KA 5C08D 3CXHK 2V2WA 4NQXB 3PWLA 4ONFL 4F7EB 2H9GB 1NDGA 2ARJB 3HC0B 1JHTA 2WIMA 2X4TA 1W0VB 1FIGL 3MLUL 3ARVA 3EW3B 3RWEB 5JTWA 4PJ5E 3MXWH 1UACL 3IFLL 3WFCL 3I02B 3U4BL 2HFFB 5GRUH 1WZLA 4X7SH 2VXQH 4Z5RA 1FJ1A 1A9BA 3HNTH 1AD0A 2CRIA 2BFVL 5F1SA 4OIAA 1ACYL 5JDSB 4LKCB 4GRWE 2IQ9L 4OCRL 4XVUD 4JHAL 5C92A 3DVFA 1FGVL 1HH6B 2PW2A 3HLAB 4K3EL 5C0DA 3ZKMC 4HUKB 1JPGA 3F7YA 5CP3H 4PLJC 3DIFA 2YD3A 5SV4A 3FN3A 3VXMD 3CXDH 2IMNA 4WO4A 1RUPH 2NY3C 4LVHB 1YJDL 1M7DA 2HJFA 3CFBB 3FT2A 3RUGE 3QIWA 3V7AE 3V5DA 1XCTB 3SCMC 1NAMH 1IEBA 2LAGB 4ZFGL 2I5YL 1NLBL 1YPZF 3HR5A 5T1LD 4JQXC 2O93L 1QFUL 2JF1A 3VGFA 3KS0H 5J6HB 1MOEA 4JPWL 4RAUB 1CICC 3EOAB 3SDDC 3EYUH 2WANA 4F57L 2BNQD 3BHBA 2Q8AL 1L6ZA 4M43H 5DI8A 3P77B 1MJJA 2F54D 3WHXB 4WU7B 1LP9A 2X4RA 1D6EA 4WW1A 2OTPA 1C5DB 5D7JD 5IMOA 4NUJB 1LO4H 2NY1B 2BY0A 1FYTE 1G6VK 1LD9A 4ZQKB 2CIKA 2RB8A 4P48A 4Q6IB 4LQ1A 3UX9B 2BSTB 4MD0A 4M8VA 2R1XA 3U4EA 1S7SA 3OX8B 1B6UA 3SBWC 2DQEH 5KZCB 2R9HD 4ZUUA 1F11B 2PYED 4Q6YA 1EHLH 1F3JA 2EDEA 4YBLB 1GXEA 3MLXL 2XNAA 4GRLB 4MZ2A 3PIQA 5C0JB 4JPKH 3D9AL 3VFWA 2VXUL 5F3HB 2F53D 2ITCB 3OR7B 5E08H 1RULL 3K4ZA 4X98B 2IG2H 4P4RB 2AABH 2X7LB 5HY9A 4HULB 4X4YB 3MMEB 1QR4A 5B4MC 5HVGB 4RBPK 2APWA 5D72L 5DS8A 1QFWH 3IFOB 2BVEA 2EE9A 3N1MC 3L3KB 1I7RB 4RGNC 2C1OA 1A6ZB 3O8XB 5I9QC 5TPWL 3C60A 4K71B 3NFPA 2NLJB 1YYLH 3MRBB 2J3SA 3VCLA 3SY0A 5IJVA 2E6JA 3IVKB 1DE4A 4TVSa 1HDMA 4HLJA 4JY6A 2DKUA 5ENWA 3ULVC 4J3OC 1TJIH 1OD7A 3ULUH 1CDYA 4K8RH 4ZUSB 3B5HA 1YEJL 2VSDA 4HWEL 4ZAKC 5AZ2L 4G7VH 4UQ3B 4GG6F 5D1XC 3DMMD 2OL3H 3JTSB 4L8DA 3LS5L 1JK8A 1A7OL 4KUZH 1T1WA 4XNZB 1AQKL 4KRPB 1G7LB 1IGTA 2A9NH 3SKJL 2ZCLH 5HVFB 5DC0A 3VXSE 1SEQL 1NEUA 3HI5L 3VRLE 1JHLL 4YHYB 3NCJL 3O6ML 1FYTD 1VPOL 3L3DB 3SE3C 2Y5TA 4LCWA 1RZKH 1WCQA 1C5CH 2AXHA 4HBCL 4TRPH 1NCWH 4X4XA 4CN1A 1W2KT 3GJEB 3BKJH 4JHWL 1G7HA 3CDYA 1UYWL 1KIRB 5CP7A 4NQEE 1XGTB 4WI2A 4ELKB 3TNMA 2EC9U 1DL7H 3SDCA 1XGQA 1EAPA 1KFAH 4QWWC 3AREA 4L8SB 4LSTL 2HKHL 1T1XA 5DF0A 1F8TL 2X05A 3LMJL 4TTDC 2GCYA 3UBXI 3RTQB 3N1PC 5E2VH 1B0RB 1IKNA 4U3CA 3ULVF 1UH3A 4MXQC 3V5HB 2E9WA 2FJHB 4GMTH 3PWJA 2UZYB 4LEXH 1JNLL 3WNOA 4OZFG 4HWZB 3H7LA 5AUMA 5KS9A 1WFTA 5ALCL 4KJWD 4O5LL 1MFBH 3QPXH 5C0BB 3H0TB 5I8EA 3O4LB 5D6DC 5F1IA 1T0NA 3ZDZF 1PLGL 2ADFL 2N1KA 3KYKH 3CC5A 4BQ8A 2V5MA 4ODBD 3QNZB 1E4XL 3Q6FA 4Z7WB 4OZGE 4WI4A 4D9RE 1PKQA 4GKZB 3T0EE 1YQVL 4FTVA 3ULVL 2ZUVA 3RAJL 3PGFH 1MFEL 3HMXA 4LLQA 1FE8H 5EO0B 4LCCA 3K8MA 5CKAA 2EZ0C 1BBDH 1G7JA 4JZJA 5DEZA 5BVJB 1DEDA 3JWDH 3VMNA 3HI1A 4KROC 3K0WA 4KVNH 4BZYA 1NMBL 1TITA 3MREB 2FSEA 3BUTA 4BH7B 2OK0L 1H3WM 4PJDF 1FFQA 3B8YA 1Q8MA 4JQIL 3RZCC 5HPOA 3BGMA 1QFOA 3SDAD 4DEPB 3ESVF 4NQED 1T89C 3I50L 4YC2C 4CVWA 3ARFC 1TQBC 1HH9B 5IHZA 4X8JB 1S5IH 1KCRL 1NKRA 2EDTA 5CS7A 3L95B 3X13A 3R8BB 4DGIH 3SDDB 3NABH 4OZFB 2HT2C 5IHLB 1R5WA 4L29B 4E0RB 1ZE3C 2IPTH 5H94A 4YHIA 1NCUA 3X3FL 3M07A 1BWWA 3MRPB 2ICWB 2C3GA 4YX2L 4G80A 5F7EH 1RUMH 2DIBA 3HS0A 4FFZH 2V9QA 3TBVA 2CGRL 1QSVA 5ESVA 3PWUA 3RPKA 4GT7A 3MBXH 1JHKH 3MRRA 3CH8A 2FX7H 5SWZA 1I85C 2VLJB 1JGEB 3W2DH 1LO5A 3ARDC 4ISVB 3FQNA 1YMHA 5B8CA 1AO7A 3SGJA 5GGUA 1JV5B 4MD5A 5IFJA 4X6FA 5IOPB 2XTJD 1ORQA 2W1NA 1YUHB 1QBBA 3U7YH 4K7PL 5JW4M 2CRZA 5IVZA 2M8XA 1IBGH 3DV4B 3JZ7A 4OJFH 2DLIA 3VXUB 4FNLL 3HRZA 1QSFB 4DAGL 3BZEB 4KTYA 1L7IH 1A4JB 1EO5A 4K94L 3DGCR 4RQQA 2MNUA 2VRAA 3K8LA 5HHPB 1D6VH 5CZVH 1XH3B 1LEGA 5FYKH 4WUKL 4FQLH 4IOFC 2HT3C 4GBXA 3IXAA 1HHGB 5I9QB 1JYXA 1RUKL 3L1OL 1S7XB 1K4CB 1Q72H 2B1AL 2BY2A 4X4ME 2HFEB 3C5ZD 1ZHKA 2IBZX 1U58B 4C58B 4O58L 4LIQE 4YWGL 5CSBA 1JZ4A 5IQ7L 2APFA 2MPAL 4NUGL 5D7LB 1UM4H 5EOQL 1EJOH 5TDOB 5M94B 2OSLA 4QHLB 4RSVA 5CUSL 1YMMA 3WXWH 1U3HC 1BD2A 2XKUA 1T5XA 3V6FA 3PP3H 5DRWA 3FTGA 5HGHA 3E0GA 4Z7VA 2ESVA 2GKIA 2FD6H 1EFQA 2V7NB 4RGOL 1T22B 1BZQK 5CIPA 2DMBA 4KDVA 5K59E 4M1GH 2J8UB 1CBVH 4OF7A 1YDPA 2SEBB 1L0XA 3EHBD 2I9TA 3MV8D 1K5NB 5KSAD 4ODWA 4ELMA 4PREB 5DRNA 4DGVL 4QT5B 1Z0MA 4RAVA 3V8CA 5BJTB 5I75B 4D0DB 5EZLA 4WV1C 1YEFH 5I19L 4R2GB 4XVTL 1OWWA 4PY8J 4L4JA 1JWMA 3FT3B 3QZWA 4MA3A 2IBBA 3UC0H 2QQKH 4GMSL 5BRZA 1MCIA 4YLQT 5C0RH 5IF0B 4BZ1L 3FOMB 3LEVH 4JGMA 5HVWA 3QFDA 3FKUS 3GK8H 4HUVA 3LN4A 2P7TB 1MVFA 2CH8A 5E7BA 3QXVA 1OT1A 5DJ0B 5C09E 1I3GH 3NFNB 3VXQB 5ITBL 4IRSA 1Q9KA 4XH2B 4R26H 3ARWA 5E1AA 1MF2H 1MSPA 5JQ6L 4NRZB 5I1JL 5EWIH 1Q0XL 4UU9B 2UY6A 5FCSH 5DJ6B 4XCNB 1AC0A 1JGUL 4XAWH 4GAFB 5EOCJ 2IFGA 4NO2B 5HGAB 1BLNA 4BH8B 5FDYA 3E2HC 2MQCA 4H20L 3UZVB 1B0GB 2YXFA 5E6IC 4KGLA 3VFVB 2DWEB 4JPVH 4Q9CA 3AXLA 1BVKA 2YRPA 4UDTA 1I75A 5MEPB 1XR9B 1V05A 2JKXA 4FFYH 3QDJE 4KKAC 5CIPH 2NQCA 4OM1H 3S37L 2VE6A 4EI5D 2CLZB 2OP4L 5FOBA 4PTTB 2W9DH 1FLTX 4C59B 1G0DA 3MR9A 2ATKB 3WHE1 3TA3C 3WLWD 1ZTXH 4NOFA 4O2FB 3K46A 5FB8A 4MWFB 4MMXC 3LB6C 3MO1B 3BISA 3KDMA 5E8DL 4R0LA 4BZ2L 4M5YH 1U8NB 4JJ5A 3ROOA 3I6LE 2P42B 5GS1A 2A9MH 2ITDA 4XVUC 3HC4H 1V3JA 4U6XA 4HAGA 3SE9H 1ZANH 3HE6C 1QP1A 3B43A 1SYSB 4U7KA 2UZIH 4XP1H 4I48A 3VFMA 3BX7C 1QO3A 3OG4B 4OCYH 4F15C 3KR3L 2DJ4A 4Z77B 4IJ3C 5DJXB 1FFPA 5D2LB 4IRZL 2YA2A 43C9B 1NFDE 4XPAL 4XBGA 1P2CB 3PL6B 5L9DH 4U1JA 4DN4L 2WAHA 2UWEA 1RIUL 3DURB 1FG2A 5I6XB 4Y5VC 3DLQR 4UQ2B 5BS0D 5J6GB 1MUJB 4Y1AE 1FZOB 3BUYA 2V2TA 2PKDA 3B83A 4MJIE 2E27H 4E41A 1DLFL 4OCNC 4YNYB 3HNSH 5I1EL 4BSVB 3CFDA 4LPVA 5D7KD 3QO1A 5D1QA 1UJ3A 1JIBA 3S6CA 1EEQA 3BWAB 1FZMA 1A6UH 2XN9A 4QOKB 4DK6A 3UTOA 3MJ7B 1LK3H 2YXMA 1XGUA 4MJ6B 4L3AA 1NGYA 5AD0B 1N6QH 4PIRF 1U8PA 2AKRA 5TE4L 1MJ7L 4W6XB 1MHPL 4I2XB 4R96A 5GJSL 3CSPA 2UV3A 3IYLW 3KPQB 5LAXA 2GSGA 3C5JA 2XQYK 1IJ9A 3HZMA 4PJFB 5DD3H 1FGNH 2AXGA 5EUOB 5J1AA 5DJCB 3NFSH 4APQD 4KHTL 2QKIA 1J88A 4YXLH 5ACMA 1HWHB 2GTZB 3OJDB 3TM6A 5I66A 1YEHL 1T3FA 4JFED 5I8KL 1JYWA 1T7VA 2J4WH 1X5GA 4GW5A 3WFHA 4OIIH 1WLHA 3GRWA 5T5FH 4J8RA 3GSNA 3KPLA 3P9WB 4R4ND 1C12A 2AK4E 4WW2C 5EU6E 3IDUA 5EFIA 5TDNB 1DBJH 1N3NA 4XP4H 4LSPH 5E2UL 2FLRT 3MV9E 1NMAL 3VFNB 1A7RL 4CMMA 2PUQT 1I7ZA 4P23D 2ZCHH 2O5YH 2DTSA 4TVPH 4OF5A 5LBSL 4Y1AD 3ZYJA 3G04B 4D0CB 5CHNA 2I25N 4H25B 4PJ8D 2DLTA 2DD8L 1KGCE 1Y0LA 1TNNA 4MJID 3WE6B 2YD5A 3VFGH 4X5WB 3MXVL 4DQOL 4G6KL 4Z7UB 1RZFH 3GB7B 5C2BH 2J6EA 4CNIA 4UIKH 1EVTC 2NY0D 1J0JA 1P1ZB 3BKYL 3VD3A 4GAYB 3EYSL 4XP5H 4L3EE 2JELH 5IW3A 5HYFA 2BMKA 5EC2A 4DKEH 1FQ9C 1E6JH 1OAYH 3I6GA 4KRLB 4R7DA 1M7IA 4CDHA 2AJ3A 1CWVA 4OLEA 2YR3A 2EO9A 3MV7E 1T5WA 2H6PB 3AAZB 4C54A 2VZ3A 2FBOJ 2H1PH 5EZIH 3RZWA 5KTEL 1BM3L 2X70B 3KAAA 5JW3H 3RWGA 4RFOL 1RAMA 3UBXG 5DTFB 1PDKA 3TBWA 5MEQB 4NGHH 1ITCA 1KC5H 3FB6B 4GRWF 4ODVH 1K8DA 3RKDD 3MRHA 3IDGB 4R97C 5L2KD 4HJ0C 4KJPD 4OGYH 3ZKND 2IBGA 5GSVB 2X9WA 1S9WA 1RZGA 3IDYB 4EIZC 4R3SA 5M95B 4NQDA 4WW2F 3BP6A 1J1OH 3FQWB 4JFPA 3P9MA 3HZYB 2ENSA 5F88B 5DXWA 1D5BA 3RUGF 4POZC 4HIXL 1JF6A 5SWQA 1XGYL 3JWOC 1A1OB 2VKWA 2W38A 2VDOL 5ADPH 3A67H 2FO1A 2F19L 5DURB 3MODH 6FABL 1YY9D 5F7MC 1BF8A 5GS0C 4P2QE 3PQYA 3ZKQD 4EUPA 3VXOB 5TGBA 3BD3A 1VFBB 5C08B 5I1IH 1MCEA 4P3DA 4R6UA 5ERWA 3GI8L 3RWCA 4XNXL 4JZOA 4KJYA 3TN0C 3JV5A 1KGCD 2YOCA 3DSFH 1MRFL 1PX3A 3TWCH 4LLVB 3I6KA 4ZO7A 4QHNA 3ZLQC 1MCOH 3UPRA 3QIWD 5K33A 1ND0B 3G6JE 2J6EH 5AWNH 1YEIH 5DK3A 3ULUD 4K8RD 1HQRA 5A16B 2O5ZL 2A74A 4U2ZA 1MCLA 2E7LC 5D8JL 1KG0B 3H9YA 1TVDA 5F8RC 3AS1A 3GMMA 2JIXD 4JFHE 3RP1A 4NWUH 5D7SH 2OZ4L 3TCLA 4IS6A 2C5DC 5TJWK 1OSPH 4KK6D 4XWGH 5HYIA 2OYPA 4CADB 3C09B 3LS4H 1VACA 3VXMB 5I1DB 5IQ9B 2ATPB 4F15B 3SE8L 1KOAA 3TYFA 1QOKA 3UXFA 4PV9A 3MLZL 2MOVA 4U6TA 2L7UA 2AJSH 3GSOB 2B5IB 3PDOA 1UC6A 3GJFA 5T1LB 2R0KL 3VI3E 2BXYA 1AHWC 3WNKA 3GO1H 1KLFA 2NY2C 2W0KA 4XZUB 4XX1G 1KIPB 3CK0L 3DUSA 3TT1L 3B9EA 1NH6A 4G6JL 4R90H 4U0RB 5HHVH 2BNQB 4OAWB 5BOPA 2D03L 2DQHL 1MI5E 2F54B 2Y23A 4HG4K 3PGDA 3MLVL 4LSVH 5D7JB 1H3PL 3V0VB 2W60A 2CDEB 3ES6A 4OCWL 4OZIE 5A3ID 3JWOL 2EO1A 4OD1L 1K2DB 3WFDH 1IILE 3T3PE 3EDJA 3SKNB 4PGEB 3C60D 3RWJA 4JPIB 4MNGA 2VQ1B 3FB5A 3VRLF 1G9NH 4K23L 4DVBA 2PYEB 5BZDA 4MDIA 2XTJC 1CXLA 3T0EC 4FFWD 4R4BB 5F72S 5HD8D 2FWOB 3K7UA 4M3JA 1KLGA 2DQDH 3A6BH 5FKAA 2CRMA 2YRZA 2VO5A 3G5XB 2YZ1A 3O6KL 2F53B 2EEDA 2BOBA 3DRTA 2R2BB 1H3VA 4JFHD 1J12A 4UILH 3OB0K 4PYGA 4X80H 1Q94B 3OWEA 3SO3C 2B4CC 3IB4A 1JJUA 2P48B 4JZNB 1PAMA 4PR5B 5L0QC 1B4RA 3WUWG 1X5AA 5JZ7D 3OR6A 4PJIA 5I16B 4YHOH 2DQFB 4WW2B 2OS7A 1PY9A 2E6QA 3IDNA 4TUKL 1I1FB 1LK2B 3MC0A 5A40E 4IDJL 1UXSB 3C5ZC 1T0MB 1GGIL 4JO3L 2I9LB 1OCWH 3S34L 3GJFH 4S2SB 4LCWD 3GHBH 3L3HB 4IM8A 5CGYC 2VLKA 3LEYL 2VISB 5CFHA 2RAMA 2HAZA 4KTDH 5IT2L 3UTQA 3DMMB 5C0FA 4RZCB 4ZTOH 2M2DA 3OKDA 1NAKL 2CLRA 3QEUA 3S96B 1C8PA 5SX5K 3GNMH 5F6HJ 3UDWC 1KCUL 3BSZL 5B3JE 2Z91A 4JFFA 1QHOA 4Z0BL 3SDCD 4OKVB 1I8LA 3ARED 3FCTB 5C0CD 1CL7H 4OZGF 3AS0A 2CR3A 1U91B 4FFVD 5E6YA 3SKUD 3EHBC 5C0GA 2VLLB 5F9WB 3CFJB 2VWEC 1SHMA 2FL5A 3PWPA 4G9FA 4UV7L 4P5MA 1A64A 5IEHB 1QLRA 3BPCA 3FHAA 1F58L 2YUXA 4KVCH 4R97B 4U49A 3VGAC 1UA6L 4F9PA 5HJ3B 4HKBA 3WIFB 5JLZA 5CJ5A 5SWZE 4TUJB 1CD1A 3THML 4QXUL 4YHPB 3WUWB 4HHAB 3B9VA 1LO0L 3X12A 1AO7E 1XCQB 3MLSH 2FR4A 4LARH 3FFCA 5HI5C 1G0XA 4Y4HC 1F4YH 5DRXB 3MACH 4FTVD 2X4PA 4M48H 4EI6B 3V4VL 1NMCC 3MX0A 3JV6A 2Z31D 2QSQA 4XWOD 2V5YA 4YBQC 4J3XA 3BPNB 2VYRE 4LCIH 1Y6KR 3DWTA 3QO0A 1DN0B 4HC1A 4YGVA 2B4CL 3ILPB 5E6ZA 5IV2B 3EJZD 4YXHL 15C8H 1P7KA 3LN5B 4JFDE 4PJBA 1KN4H 5FYKD 3NCBB 3WN5A 1J5OL 1WJ3A 2JCCE 4YFLF 1VGEH 4H0HB 2LVCA 4PRNB 4XCYA 4AG4L 5BVPH 2X1WL 5GGTA 1JPTL 5FGCE 5ABDE 4OZHE 3U46A 3GSXB 5CJXC 1F3DH 5MENE 2X42A 1G7QB 4P46A 3MRCA 3RNQA 1DQJA 5CJ8A 1FZKB 5D5MF 4MAUL 3SGDI 4WU5B 2DRUA 4GRMB 1DBML 3WD5H 4N0FB 4IRJA 3WFEL 1A6TB 1Z2KA 2IWGA 5LXGL 5KVDL 2FRGP 3AGVA 1WISA 3T2NL 3HRPA 1FVCA 1F2QA 3BRGC 4ZO8A 4YR6A 4LLYA 5L2JB 2C1PA 3VGBA 3LHPL 3U0WL 4LDOB 2ESVE 3WLWC 4PG9B 3SDAB 3VH8G 1VB9A 3WO4C 1JNNH 3NAAL 1BZ9A 1H5BA 4NKMB 3SHSA 1IQWH 4DVRH 4NQEB 4AJ0A 4F8TA 5BO1H 3RA7H 3DOSA 3HA0A 4U1NA 5HGBA 4L8CB 2QQNL 1AO7D 1T21B 3EYOA 1QFPA 5FO7B 1T66C 4Q9RL 2QADD 3CX5K 2OR9L 1PG7X 4ZPTB 3MJ8A 4MCZB 1Z5LB 1S5HA 5EU5B 2E5EA 5E9DA 3D0VB 3NN8A 3VWJB 2CLVA 1Q0YL 5BRZE 3RWDA 3PWNB 3INUL 4HC1H 2O61B 3HPLB 1VERA 4Q74A 5GGRB 3UEZA 1RMFL 5ILTH 1EVUA 4HCRL 4GBXD 2G60H 5ANME 2BOCA 3BEWB 1Q9OA 4F7TA 3BZFB 4HF5H 5DD5L 5GGTH 5KG9A 3MBED 3DUHA 4KKLC 2J1KA 1DP0A 5DLML 5JW5B 5IKCB 2XTJB 4LIQL 4GLRI 2NY6D 3S98A 4NNYB 3EYQD 1JNJA 2CK0H 4KK8C 1WFOA 5BXFB 1VCAA 3MRDB 3WDJA 4LU5L 4U3XA 5TF1H 4PLOB 1EH9A 1CU4L 1YMMD 3GMRA 1P4LA 3I9GH 2IANE 1U92B 1FSKB 3VH8B 4YHNA 1BD2D 1NUGA 5L0QB 1AJ7L 4NWTL 4LHQB 4IOSD 3EFDL 4KMTL 4O02H 1RHHA 4APQC 1MLBA 3CJJA 3RHWF 2YSSA 3C5ZB 1KSRA 1LHZA 2VDLH 4H0IA 4IIQA 1NGWB 2P24A 3D18A 4JO2L 5DMIH 3EO1A 5E4IA 2NX5A 4NM8H 5GRJH 4PRAB 4WTWA 5JXAL 5IB5A 3T4YA 2GUOA 1A0QL 1NLDH 1MWAB 3FZUD 3L3OB 4XMLH 3B9DA 4KGJA 3V79C 32C2A 3KJ4B 2R56H 2C3VB 1Z9LA 2LTQB 4OGZA 1W72L 3H9SE 4P5KB 3QT2A 2AGJH 4I3RL 5GGSY 1HNFA 2HLAB 4P2OA 3C6SB 3CH1A 4R7NB 3GSRA 2CJUH 1QBML 1IT9L 4NM4L 3O2WL 5D5MB 3MV8B 1T83A 4PJ8C 3NCYP 5KSAB 2PXYA 2CRYA 3VFRA 2C3HA 4IRSD 3MOQA 1C16A 4PJCB 2OTWA 4KUCF 2JLLA 3D0LA 2UWEE 3JUYA 4B7IA 5C6TH 3U7WH 1SJEB 1OGTA 4HX1A 4JM4L 1EXUA 4X6CB 1KEML 3D3VE 3S88L 1PEWA 3P11L 1QPXA 4JO4H 5EO1A 2R0WL 2CSPA 3BVNA 5DZNA 1V8HA 2V5SA 4LDEB 5IGXH 1BHGA 3MA9L 1F6AA 4DWHA 1MVUA 2XN9E 4NZUL 1DR9A 5CSGA 1DSFH 5IW1B 3V4UL 2YPLA 4M6MH 4KJPC 4XHQA 3ZKNC 3HI6L 4MVBD 3QNYB 5DMKA 5CILL 1CI5A 4MA7H 2E9JA 3BW9A 2P49B 1UJTA 2BC4A 2LAAA 3PHQA 5IFHL 3TIEA 5LWYL 4LLUA 3D25B 5I1CL 5CBAA 2MWCA 1NFDF 2ADGA 1BX2B 4XMPL 4X8XA 5H8DA 1S9XB 5JR1H 1KPVB 1CZ8L 1OGAE 3Q5TA 8FABA 3WBDA 3LD8B 3T0VA 1N0LA 3E3QE 1J1XH 1G7MA 4CVXA 1YY9C 4AT6A 5KVFH 3ZHKA 5FEBA 4EDWH 1NCTA 1T1ZA 3K3QA 3FL7A 3MXWL 3RU8H 4N0RA 1EO7A 4KAQH 4I18B 4PRIA 4UTAL 4PLNC 5GRUL 1IEHA 1QSEE 4EI5B 5ID1A 1IGIH 5DUMH 4WO4C 1ZHNA 1SMAA 3BO8B 3DETD 5LGKA 4OCXL 3ARGA 2Z93A 2ZOLB 1CGSH 5LGHH 4XP6H 3ULSA 1YZZA 3T65A 4TVPD 3C2AH 3CXDL 3HHRB 3I85A 1RUPL 3L5JA 1FPTH 4HV8A 1W72B 5FM4A 1ZS8A 1JZ5A 4E41D 4NQXA 1GCFA 5EUKB 2DL2A 4FHBD 4KK6C 3HC0A 4P2CG 2YD2A 4M7JH 2YKLL 5D1QD 5DK2B 5JOFB 4CVZB 3OBAA 2XN9D 2D7OA 3B4NA 3EYUL 1AI1H 1RIHH 4HUNB 4MXVE 1RV6X 3MRKA 5IW6A 3NOIA 2NTSP 3L3IB 4B50A 4YPGB 2RFXB 2DN7A 4M43L 3EJYC 1S9VB 3LCYA 4MNQA 2AERT 1IQDB 4JB9H 1RZKC 2P47B 2AV7A 3IU3B 3QA3A 4L9LB 5BS0B 4HJGB 4LGRB 3TGXA 4KMLB 2AXJA 4LFHG 4Q9BA 2F8VA 1MQ8A 5T3ZH 1DLHB 4NQVA 1OY3B 2EDBA 3KPSE 4NC0B 4NQTA 4P2YA 3DXAA 1EHLL 2P8PB 4PJXB 1UH4A 3ZDYE 4MX7B 1HZHL 1U0QA 4QY8A 4NYLB 1H8OA 4M02A 3C60C 2OXGA 1JBJA 3TPKA 1I3RB 1IAIM 4GQ9H 3PQYE 1QFWL 1UEMA 4I0KA 2EDFA 2Y07L 5I30H 4KRNA 3WHXA 4HJJH 1CFNB 1N59B 4APQB 3HZKB 4NO5A 1HILA 3GMOB 4KZDH 3PGCB 4NUJA 4GAJH 1INQA 4TNVF 4NJAL 4YHLH 4JFEB 4XNMB 4NHCH 3U30B 1U8QA 5C9KA 1N2RB 5I17B 1TJIL 4MD4B 3OX8A 4GS7C 4FQXC 2IGFL 3ULUL 4K8RL 4XCCL 5JZ7C 1ULVA 5DUBA 3MTRA 1DJSA 5ITFB 5KSUA 1CFQB 4LSQH 4XNYH 1F11A 4U31A 3BN3B 4Z9KB 3JWDC 4MNHB 4GRLA 1IEAA 1U8LB 5SV3A 2XZCH 3CPLA 4P23B 1I9JH 5F3HA 2DKSA 4KUZL 1AR1D 2ITCA 3OR7A 2BVOB 2A9NL 2X7LA 2ZCLL 3CSYA 4S10A 4Y1AB 1AIFA 4PJ8B 1KNOB 4EEEA 4BA8A 1CFBA 4PJGE 1AXSA 5DFVD 3MGAA 4AH2B 4NBXB 3DO7A 1IAKA 4RDQG 3O8XA 1NAMB 2B0SL 3MOBH 1C7SA 2BVPB 1RZKL 5IVXE 2NY0B 1C5CL 4TRPL 3MRBA 2X4NB 4NQDD 1BQHA 4NBYB 1NCWL 3AU1A 3AREC 1H0DB 3NZ8A 3U1SL 2ED8A 1CCZA 5CGTA 1XGRB 4QHMB 2EKJA 4OTXL 5ESAA 5T5NG 4W4OA 4C4KT 4XC3L 1G0YR 1KFAL 5I8OL 3PQYD 3G5ZB 1A6VH 3SGKA 1GZPB 5L2KB 5E2VL 2GITB 1G7LA 1WWAX 3CFEA 5I74C 1HSBB 4LEXL 1NDGB 1UWXH 1JHTB 1EZVY 1PG7H 4XI5D 4QRPA 4J3TA 2X4TB 1EEUA 2DYPA 2GSIA 2IALA 1VEOA 3ARXA 4NT6A 5JXEA 1LO3H 4F3FA 1MFBL 3QPXL 1J1PH 3RY6A 2NY5C 2P1YA 4XWOC 4LCCC 5CLWA 3FN9A 4Z5RB 1I1AC 4HXAH 3UTTA 3VI3F 4CRPA 1BJ1J 4JZJC 1AD0B 1NANI 2Q8BL 4ONOA 2PW2B 5C0DB 4Z8FL 1JPGB 3EJZC 1DQQA 1WIUA 2LFGA 5HHME 1FE8L 4YHMH 4HS8H 3F7YB 4PJ7E 3DIFB 4PJIE 4L8SA 3JWDL 3UYPA 1M7DB 2FIKB 3FMGH 3F58H 3FT2B 1UVQA 2N7BA 4OZIF 1V7MH 1UCTA 4LP4A 3QIWB 3V5DB 2FJHA 1IEBB 4OSUL 2WK2A 3T3PF 4G6ML 4Y0GA 3HR5B 2PYFA 5KSBA 1DFBL 3ARUA 4YQXH 2Y5EA 2OL3B 1MFCH 2H8PA 2JIXB 2Y06H 4LSRL 1NFKA 4OV6F 3BHBB 4AL8H 3TBYA 1MJJB 2WWKT 1LP9B 2X4RB 1D6EB 4WW1B 1S5IL 4OLVH 4JFOA 1EX0A 4YDVA 4GKZA 3KLSA 4DGIL 5IMOB 3NABL 1FVEB 1WIPA 3ARSA 4L4TE 1PVHA 2IPTL 3P0YL 1LD9B 5EO0A 5EU3B 5GSRA 2HA1A 3U4EB 2R1XB 2HTKD 2BSSA 5HYQA 3T2QA 5B8CC 2ZUQB 4FFZL 3SGJC 4F37F 4ZUUB 4OGAD 4I3SH 1MJUH 4M7ZC 3VMPA 1F3JB 3MBXL 1JHKL 2Y1VA 4BH7A 2XNAB 1X5FA 4RISH 3W2DL 3PIQB 3VFWB 3ARBA 4BSWA 4WI9A 2P8MA 5ICYA 4X9GA 5HY9B 2DIJA 4U6HA 4OFIA 2AJYH 3FFCE 5DS8B 1JE6A 4K3DH 3NCFB 2C7UA 3U7YL 1P53A 5LGJB 1EUUA 3HMXL 2DQGL 4XPFH 2NY5L 3R4DA 4FA8A 5B3JF 5AZEL 2PTTA 4JRWA 2C1OB 4JRYA 2VC2H 3C60B 1FH5H 3NFPB 5IP4A 1HHJA 3MRJA 3VCLB 3SY0B 5IJVB 5IM7A 1FDLH 1DE4B 1HQ4A 4HK0A 4WUUA 1HDMB 4KQ4H 5ENWB 4JY6B 3OKLA 2ICWA 4FQ1L 1NPUA 4PJBE 2NMSA 2WZPD 2VLKD 1Q72L 1EHAA 5C9JA 2GJZA 4PRPA 1D5MB 4L8DB 5DDHB 4GXUN 1JK8B 1OB1A 4ISVA 4BQ9A 4YDJA 4EBQL 1T1WB 1KBGH 4JFFD 4M3KB 3KYMA 1IGTB 5IR1A 4LAQH 1UKQA 4ODSH 1UM4L 1EJOL 1NDMA 4M6OL 35C8H 4FQJH 1QRKA 3VRIA 5K93A 3G5YB 4KQ3L 2RCSH 3VXUA 3RVTC 5ACZA 3QRGL 1FZJA 3BZ4A 5E94A 2V7HA 4K2UH 4LCWB 1IGFH 2VNCA 3PWPD 5EA0L 4L1DA 4G9FD 4OD2B 3FO2A 4M1GL 2HH0H 4Z78A 1ROWA 4X4XB 3B9AA 1KUMA 2LU3A 3BGAA 1G7HB 1VFMA 2DI7A 3FQUB 4X5LA 4KZEH 5CP7B 1VFAB 1NL0H 4O2EB 3TNMB 2BY1A 2H2PD 4YZFE 4EQ3A 5I1HH 1ZT1A 3ZT7A 3SDCB 3BMVA 1XGQB 2HFEA 1EAPB 4OZHF 4Y4FA 4WHYG 1DVFC 5C0CB 1YEFL 4UT6L 2HFGL 5C07E 2GCYB 2AEWA 3M8OH 2BHUA 5I0DA 1NQBA 3K81A 3UC0L 1FAKT 2JB5L 4K7PY 3PWJB 3D39A 5C0RL 4IRSC 5ESQA 4QHLA 5E2WH 5EOCL 3DJ9A 3UP1A 5AUMB 1JZ3A 5KS9B 3WSQH 3MJ9A 4UIMA 3VG0H 4YIQA 1JGLH 5F1IB 1LMKA 2V7NA 5I74B 1F6FB 3CC5B 2IFFL 2J8UA 2P8LA 5GS2H 4JREB 3Q6FB 4R26L 1N5AA 5DQ9B 1MF2L 1OTSC 1PKQB 5EWIL 5F6IB 1K5NA 4P46D 4FTVB 4PREA 3Q6GL 2R29H 1KN2H 4LLQB 1PG7W 4MS8D 2Z31B 4LCCB 3IDIA 4D0DA 2OBGA 5DJYA 1G7JB 1QRNA 2IQAA 43CAA 4JE4B 3H8NA 4FQ2H 1CG9A 4IRJD 1OAKH 3HI1B 2DS4A 5EBGA 4MVBC 2Y9RT 3VFTA 5GRXG 1NGXA 2FSEB 2K7QA 3O41A 2AEPH 5IF0A 3G6AB 1U8KA 2N7AA 3BGMB 4OM1L 4HT1L 2COQA 4G42B 3E6HB 1A14L 2DQTH 4V1DE 1ZVHA 2W9DL 1U9KA 3A0OA 3ILQC 4PJEA 4F80A 1PZUB 4W4NA 1P4IL 5GS1C 5IHZB 2WUCL 2NX5E 4JFQA 1ZTXL 3X13B 5FFLA 4LEOB 1G6RA 1FVDB 1R5WB 2D4DA 4M5YL 1BF2A 3AB0B 4M9PA 1HCFX 5E9DD 3WIIH 2DDQL 5E99H 3SE9L 1ZANL 4G80B 3DETC 3BE1H 3LPFA 3KXFA 4YHZH 1JPFA 2UZIL 4M93C 4UB0H 3HS0B 4YDIH 4XP1L 1S7TA 1X5XA 3TBVB 1PQZA 3VDCA 4IDLA 3MJ9H 5ESVB 3PWUB 3TO4C 4M6AA 4OI8A 4OCYL 1E28A 3MRRB 4N90E 3TJEH 5C7XH 5FOJA 5F1NA 1JVKA 3R1GL 1LO5B 2UVEA 3CFKA 4JRXE 2KPNA 1YMHB 2DWDB 3FQNB 4M1DH 4C56A 4RWYH 5B8CB 1AO7B 1CLZH 5GGUB 2QADB 1MAMH 5EU7E 4MD5B 5IFJB 3GBMH 4X6FB 3BDBA 3F7VA 3MGOA 4M7ZB 4ENED 1ORQB 4HXBH 5D1QC 1YECH 1UJ3C 1EEYA 3QIBA 1DUZB 1GGUA 5IVZB 3MLWH 3LKSA 3MNZA 4FQCH 1AH1A 1P6FA 4QXWA 4G6AD 4MJ2A 1CVRA 4O2FA 4U6YA 3HRZB 4OGXL 4JFZL 3SGEI 1YYMH 1RJYA 5GXBB 4RQQB 1J0IA 1VFUA 1U8NA 4JN2A 4DFHA 4JN1L 1L0YA 3QUKB 2I07A 1LEGB 3HTLX 4GBXB 3IXAB 3HPJA 1LK3L 3QHFH 1NUFA 2ZOKA 3MBEB 3BWUC 2YD1A 4NN7B 2JJSA 4N0CD 1ZHKB 2YD6A 2BRRH 2NY6B 4TOYH 1RZIA 4WI3A 1P2CA 3S36X 1K6QL 3DHJA 2KUTA 3QCUL 2AAVA 1D5IL 3DURA 4XBPA 3NFSL 2HJLB 1TTGA 2OSLB 2RHEA 2UWEF 4FXKA 5AYUH 3X11A 5F44A 5J4MA 4KJQD 1YMMB 1G6RH 5FHAH 2X9YA 5J12C 1BD2B 1T5XB 5IVOA 3ROLA 5DRWB 1I9IH 3FTGB 3H3PH 5HGHB 2ZUXA 4Z7VB 3H9HA 1LDSA 2ADIA 1VEPA 3CX5J 5F1KC 1LO2H 4J7RA 1QYGH 5CIPB 1NCAL 4P2OD 5T5FL 2YZ8A 3ARRA 1UT9A 1YDPB 3BWAA 4QOKA 1T2QH 2I9TB 5F9OL 1DBJL 5L8JB 1FV1B 4XP4L 4LSPL 2PXYD 2CK2A 4ELMB 1M05A 3KPOA 4P5TC 3T04D 2R4RH 4ZSOA 1I8KA 3RHWK 3W82A 1AGBA 5EZLB 3WLBA 4YGAB 2O5YL 5CEXA 4GSDH 2PF6A 2R0ZH 1IC4H 3ME0A 2JJTA 3BGFB 7FABH 2Q3ZA 1DQMH 4GXVL 1JWMB 4N0UA 3CCHA 3QZWB 4TSBL 4MA3B 3VFGL 2AEQH 2DBLH 1X4YA 3SKOB 4LRIA 5C2BL 4ONHB 3PF2A 4UIKL 1AR1C 2A0LD 5KAQG 1ED3A 4WI8A 1P5VA 2JELL 1SVCP 4HUVB 4LOUD 3LN4B 5A1AA 3FQXB 3H42L 1E6JL 2IF7A 2YPLD 3N85H 4IRSB 8CGTA 1Q9KB 5JHDA 2NY4C 5HDQH 4CW1A 5IROC 4XNUH 3QI9C 4ODVL 1BQLH 2VH5H 5ETUA 1A7QH 5FAAA 1BLNB 2W07A 4QGYA 5T3ZD 4DZ8A 2FEDC 1HI6B 2BXZA 3AXLB 2FEEL 2EDDA 1J1OL 4G8EA 2BVQA 4UDTB 4Z7NE 3WE6A 4LLDA 4LVOC 1AE6L 1DUYB 2RGSA 1KCSL 2B2XH 5IG7A 4PRID 4KK5D 1G9MH 3V5KB 1P1ZA 2M1KA 3GRWL 2VE6B 1TLKA 3BIKB 4PB9H 3A67L 5FOBB 3GSNL 1TIUA 2JJWA 4XXCA 3MR9B 2VAJA 2CDFA 2WNGA 2YK1H 4MXVF 3ARGD 3MRNA 5I1IL 2EH7H 2CDGA 5FB8B 1NSNH 4ZOAA 4H1LG 3NCEB 4DOHB 1V7NH 4R0LB 4GKSA 3TWCL 5E8NA 4JJ5B 3ROOB 2OTUA 4JCLA 1D5XA 1IGCL 5GS1B 2ITDB 3NCMA 1ZSDA 2YUZA 5E8PA 4U6XB 2NZ9D 1KB5A 3LAFA 5AWNL 1RD6A 2VSCA 1YEIL 3CVHA 3VFMB 3CVIL 2E9BA 4EVNB 3DGGA 5D71L 1OM3H 1QO3B 2N56A 4HH8A 3VD5A 1VA9A 1OD9A 3QXDB 2DM2A 4XBGB 3ZDYF 2W65B 4M93B 4U1JB 2EDWA 4XWGL 4PP1D 1FG2B 4MNQD 3LS4L 2E8ZA 3DVNA 4HQQH 1XR8A 2WUBH 3F65A 1LE9A 4QRRA 4HKXA 4XMKH 3VXOA 5GRJL 2V2TB 1VFBA 4HMDA 4XRCB 3QBTB 1KENH 1LE5B 5E70A 2P5WA 4E41B 1NBYA 3CFDB 3K1KC 3AUVA 4HWNA 3QO1B 5D1QB 1UJ3B 1X6NA 3GO1L 1FZMB 1C08A 2XN9B 4NKIH 1A3RH 4WI6A 1SY6A 3DXAD 4M8QA 3W9EA 4EOWH 4HK3N 1KTLA 4R90L 4PY7A 2ARWA 5HHVL 5I1KH 5A16A 2VL4A 4Y19A 3T0BA 1RVFL 1U8PB 2AKRB 1OLZA 5BV7C 5KW9H 1L9NA 1WZKA 3OJMB 2QSVA 1GOHA 4R96B 4N68A 3UBXA 3TJHD 4X9BA 3O4OB 3C5JB 1JN6A 2HLFD 2EYTA 3OTTA 4HLZH 4XPTL 1CGVA 4X7DC 3HZMB 2AXGB 1MCDA 3WFDL 1B88A 2GQHA 2QKIB 4LDLB 3G5VA 2AJXH 1OWRM 1R3LA 5D70L 1G9NL 5GISL 1T3FB 5D2NA 3ARZA 4PJGF 3GSOA 1KB5H 4GW5B 4ODTH 2NZIA 3CVHH 3WFHB 3DX8A 5L88L 3L3JA 3ET9F 5IVXF 4J8RB 3VFSA 4WWKA 1C12B 5J12B 1X5ZA 5F3BA 2D2OA 5EFIB 2NYYD 1N3NB 4UILL 2XOTA 3EOTH 2FB4H 2IPUG 2WSKA 1UWEH 4CMMB 3TF7C 1I7ZB 3DYPA 2R4SH 5HHOA 3HE7A 1NBVH 5GGQH 1OTTD 4YHOL 3MRQA 4ETQB 2ZUWA 5CHNB 2R15A 2JTDA 1Y0LB 1IKFH 2YC1B 4PV8B 3SPVA 4KU1A 4TSCH 5HPMA 4UZGA 2W0PA 1OCWL 5D9SA 4PJAA 1ZKAA 3GHBL 2Y6SD 4TNVK 3LQAH 2QR0B 5IHBA 3LRSB 3HUJA 5DQJA 2ZPKH 4WTXA 5LVEA 4KTDL 2PYEA 5KSBE 2BMKB 4WFFE 1SY6H 4ZTOL 5EC2B 4WHCA 4UT7H 4FXLA 3CGTA 1AP2B 3I6GB 5C0BE 4R7DB 3GNML 3O4LE 1HN1A 2AJ3B 5CD5D 3L7FA 1T5WB 4PUBH 1MHEA 4URTB 3G5XA 2V17H 4MA1B 2FGWH 1Q1JL 1FL5A 4Z7WE 1IM9A 1CL7L 1OW0A 4TQEH 3HCVB 3PV6A 4JZNA 3MRHB 4UMGA 4MB4A 3SDYL 3VU2A 5I16A 1TZHA 2EIZA 5BV7L 5C0EA 1S9WB 4A6YA 2K9UA 5AEAA 1RZGB 1T04A 4PJIF 3TV3H 2H2PC 1I1FA 4R3SB 4QRPD 3GIZL 4NQDB 1E4KA 3BP6B 3QWOA 2DYPD 4FZEH 2VDNH 5DQDH 2VUYA 1U93A 3P9MB 4JFPB 4MHHI 3FO0L 1AXTL 4UT9L 1D5BB 5CJQL 5HHXH 3HAEG 1CDHA 4U1IA 5SWQB 2PR4H 4FP8H 1CR9L 2VISA 3T2PA 1YA5A 2XPGB 3UTTD 1ONQA 2ZJSH 2QTEA 3MLSL 3PQYB 3ZKXC 1F4YL 3S96A 1MREL 4M5ZH 3MACL 4M48L 3VGDA 5TGBB 3C5SA 4Q7DA 3S5LA 3OKNB 4ZFOA 1CDBA 4RGMB 5ERWB 3WN5C 3RWCB 4ZUTB 2BVYA 4JZOB 4KJYB 4JRYE 5GJTH 4LCIL 1A47A 4M61A 1Y6NR 1RIVH 4QHNB 2GAZA 3B6SA 5IHUH 1UB6A 4F58L 2IH1A 2VLLA 3UPRB 3CFJA 3AVEA 1HINL 1ZLWH 2A6DA 1VGEL 1HQRB 5IEHA 4AIZA 2A74B 3QCTL 5IB1A 1Z9OA 4PJHA 4EDXA 1KXTB 5D1ZC 4IRJC 2R1WA 5I76A 5CCKH 5I1GH 3TCLB 5F93C 4IS6B 2VLJE 1QLEH 3RWIA 1JWUA 2OXHA 1RSFA 4HHAA 5DJ8A 1VACB 5AAWA 4CMHC 4OLZL 3WD5L 1EEZA 3LKRA 1X5YA 5F7WC 5AG9A 2H3NA 3TYFB 3S36H 4OLYH 1H5BC 4QXTA 4PV9B 1JF5A 4JDZA 4PJ9C 3PDOB 4A6YH 3VXUE 3GJFB 1VGKA 4WFHE 5FYLH 3SDXA 2ZG3A 5GGVY 3RVWC 3RKPA 1QSFE 5IB3A 1XF4B 5IMKA 2FHBA 3ILPA 1JNNL 4FABL 3TVMA 3LN5A 4I4WA 1IQWL 5DJ2A 4F33A 4DVRL 5BO1L 2VDQH 3NCYS 3ARBD 4PJBF 4A2MA 3S4SA 4PRNA 1V3LA 3KNBA 5IB2B 5KANG 2WLYA 2A77H 3PGDB 2W60B 3ES6B 3GBNL 3U82B 1FZKA 5FO9A 4JKPH 4PY8I 5ICXA 2W9LA 4YHKL 3WKMH 4JRYD 1OAUH 4RNRA 1LDPH 5I18H 3GIVA 2DF3A 4X6BA 4MNGB 4I9WD 3VXNA 1ZGLM 3ARTA 3FB5B 2IC2A 2VLME 3OAUH 3ALXA 4HC1L 5K9JH 1CLYH 2X44D 4DVBB 4MDIB 5T1KA 3C08H 3BP4B 5BZDB 3I2CH 4WUUD 1EZVX 3GHEL 5L2JA 2G60L 5FKAB 4F37K 3BDYH 3QUYA 4G6AC 4HF5L 2KZWA 3K2UL 5F7FA 5GGTL 2J8UE 4FS0A 4KK9C 5GS2D 2BOBB 3DRTB 3GMNB 4PRPD 4YK4B 4HSQA 5GGSA 5L7XH 4M7LH 5AG8A 4YE4H 2EH8L 4LPXA 1K3IA 4ORGA 1I1YA 3LEXA 2YPKB 5DWUH 4NDMA 3OR6B 1DQDH 2HG5A 4YZFF 4BFBD 1QNZH 1MJ8L 4ORZC 3NTCL 3IDNB 4P9HH 3MUHL 3JVGA 4O4YH 3I9GL 1Z5LA 3QQNA 4M00A 3VXUD 1UQSA 2HRPL 3VWJA 5J06A 1HHKA 1WZMA 5CJOL 2VLKB 4P4KC 5GHWH 3E8UH 4HBQA 3CUPA 4J3VA 3UTQB 5C0FB 3X14A 1Z3GH 4KJQC 1IAII 3OKDB 3PP3K 2CLRB 4ACPA 3QEUB 2R69H 4ZYKB 2VDLL 1RK1A 3BEWA 4WTZG 4MA8L 2IPKB 3BZFA 5DMIL 3OXRA 3LN9A 4NM8L 2Z91B 5DGRA 1BJMA 4PGCA 4JFFB 2VL5A 2C4XA 3QFJD 2QBWA 3NACH 5JW5A 4Y4FD 5IKCA 4XMLL 2WBJC 4JY5H 5EZJB 2R56L 12E8L 1RURH 4DKDC 1BAFH 3ZT5A 1ZA6B 3IDXH 4PG2A 2PXYC 1JPSH 4Y89A 3KWWA 3D39D 5MHSD 5EB9A 2FL5B 1T0PB 2VLMD 1EMTH 3PWPB 4G9FB 4P5MB 4K07A 3W0WA 1QLRB 3BPCB 1ZLVK 1ES0B 1A5FH 2CJUL 1RI8A 4P9ML 4H26B 4HKBB 5JLZB 1UWGH 2X89A 1CD1B 3N0PB 4GAGH 5EDXA 2GJ6A 4KRMB 1ZGLA 2BDNH 1MRDH 2FR4B 2WP3O 5EZOH 5C6TL 2GY7B 3MUY1 1JMZA 1FAIH 2A0LC 2X4PB 2ZNXA 1NGWA 3QUZA 1RUQL 1D9KD 3JV6B 4PRAA 3CMOL 4JO4L 4GW1A 1GC1H 5CEZH 1QRND 4DN3L 2VXTL 1WFUA 3QO0B 4L1HA 1XEDA 2Z4QA 4AMKL 4YGVB 2C3VA 3F12A 5IFAH 5IGXL 1VADB 4IHOB 4YBHA 5CWSB 1X3DA 1RFDH 1DSFL 1B2WH 4I13B 5C2UB 4KHXH 4M6ML 4XCYB 3RDTC 3KPTA 3C6SA 1INDH 1FNGA 3FAWA 4R7NA 3U46B 1M6OB 1YC7A 3L5WA 1J0ZA 5F96H 4LKXA 2PO6C 2L0DA 1OL0A 4JKLA 1MPAL 4P46B 1U8MB 3MRCB 1DQJB 2HTLD 3ZE2F 4D3CL 1JNHA 2ED7A 5D2LE 5IIEA 3GUTA 1Z0NA 1JUFA 3QYCA 1CE6A 3F5WB 5FKPA 3OKKA 3KPPA 4KK5C 3V0WH 4X6CA 5DEGB 3VRJA 1NGPH 5KVFL 1DCLA 2DB8A 2HP4A 4M03A 2RR3A 1NUDA 3AY4A 4YR6B 4CMHB 1JRHI 3RU8L 2C1PB 3BZDA 2FGZA 2XY1A 1LQSR 3KXFD 3ARGC 3UJJH 5B39G 3LV3A 1BFVH 2MCPH 2ZP0T 1R0AH 1IGIL 1BZ9B 1H5BB 3QQ9D 4NJ9L 3V7MA 4QOKE 2BY3A 4G5ZH 2Q7YB 5F21B 2NNAA 5INCA 4C56D 3TH2T 4OD3H 3QNYA 3EYOB 2NZ9C 4O51B 5LGHL 4XP6L 4L3CA 2XA8H 5DMGC 5FV2A 4I2XE 2D0HA 3FONA 3MJ8B 3QIBD 3D25A 1SYVA 4G43B 1S5HB 4N0UE 3FO1A 5E9DB 1IM3B 3NN8B 3DPBA 2H26B 4KPHH 2XIDA 4PJFE 5GRVL 4WHTA 5EUOE 3EO9H 4UDUA 3RWDB 4G3YH 2DM4A 4KTEL 4M7JL 5E4EC 1EO8L 1AGCA 3CLEL 3IAGC 4F7TB 1LEIA 3BXNA 2JK5A 1XF2A 5KG9B 2GK2A 2QHRH 1IE5A 1KPRA 2XT1B 4LVHC 2BJMH 1CLCA 2RIKA 2VZTA 2Y72A 3CLFH 3X3GH 3FN0H 1GJIA 1TTUA 5T3ZL 1KIQA 3REWB 4Y16A 1P4LB 4WFGE 3SOBH 2VR4A 4YHNB 5TQ0L 3IDMA 2AI0L 6CGTA 2HLFC 4Z7UE 1HK6A 3EDEA 4ODHL 1RHHB 2Z92B 3NA4A 1MLBB 2YSSB 3U79A 2D7TH 1YPZA 5D4QA 1BIIA 1SJHA 4IIQB 2P24B 3D18B 2NY1C 3AROA 5DZOA 3EO1B 1EK3A 5IB5B 3VWKA 4K55A 3WNPA 3S7GA 2GUOB 4HJJL 1T2XA 4HPOL 3MUGA 4JAMA 2FEEI 1UACH 4B0MM 5CJBA 32C2B 1MCHA 2XG4A 5F8QC 4GAJL 2NYYC 4AQOA 4YBLC 4XTRD 5C86A 4NHCL 4GRLC 4J23A 3PNWB 1DLHA 2IQ9H 1KELH 4P2OB 5T1DH 3V0AC 1FGVH 4K3EH 1OTTC 4X83A 3GSRB 1ZEAH 4LSQL 4Z7NF 2P8PA 2PXYB 3VFRB 1C16B 1AGEA 5JHDD 2OTWB 3O8XC 3D0LB 3MLRL 2WBKA 5DHVA 3OL2A 1OGTB 4HX1B 3L9RA 5T3XE 1EXUB 5IB4A 3V2AR 3U0TA 4ALAH 4ZFGH 1J0HA 2CKBA 2B8OT 2X10A 1D7FA 4QRRE 1QFUH 1FC2D 5C08E 3SO5A 3BVNB 2XRAH 3GMOA 1PW3A 3RJQB 3MOBL 1ZLSL 5H35A 2D7MA 3SCMA 4UUJA 4U1LA 4W4OC 4LPUA 1BJ8A 1IC5L 1HXMB 1F6AB 1MVUB 5E8OB 3FQTA 2YPLB 3UJTH 4J6RL 4LCUA 4XNZC 4KRPC 4YXKL 1CICA 3B2UD 3VXRA 5DMKB 5LKNA 1CFQA 3BW9B 3OF6D 4NZRL 2EKSA 3PHQB 4YHYC 3TIEB 4JKMA 3S97C 5CBAB 5IWLC 4KKCC 2ADGB 4Z7OE 5JXEC 4GG6A 1EV2E 1R5VB 2LABA 1UXWA 4JVWA 4BSJA 8FABB 3DX6A 3VXME 4CVXB 2E9IA 3DVGB 4QRUA 3D9AH 2VXSH 1TJGH 1IRAY 3QJHA 1W0YT 4ODUA 1FBIH 3EYVA 3RIAF 4PRIB 5HXMA 4XC1L 3U6RB 1J1PL 4WFED 5ID1B 4Y88A 4HXAL 5SWSA 2NCMA 4L8SC 5CINL 5C8JA 2AV1B 1OTUC 3BRDA 3T08A 1WGOA 5DD0L 3MYJA 1ZGLP 3RTQC 3ARGB 2BNQE 2BRQA 4ZD3H 2Z93B 5JIPA 4JM2A 3ULSB 2F54E 5DHVH 3T65B 4HDIA 4WI7A 3BKCH 3G5ZA 3RBSA 4Q2ZA 2GEEA 1KACB 2YWYA 4QRRD 2CKBH 3FMGL 1JTOA 2ZG1A 3EFFA 2GITA 3F58L 1ZS8B 5AZ2H 2P5WD 4EN3A 1G7PA 4ZUWA 5DRZA 3FAXA 1HSBA 4MQXC 4HFWA 2DQJH 3BN9C 2FDBP 4UINL 4YQXL 1AQKH 2PYEE 1MFCL 2Y06L 3BYTA 4KC3B 2EYSB 4D9QD 1DBAL 1SEQH 3MRKB 5D1XA 5IW6B 5F6HI 4Y19D 2DLFH 3NCJH 3OGOE 4MNQB 5E4EB 2BZDA 2F53E 4OLVL 2AK1H 2AV7B 3QA3B 5SX5H 4JY4A 2F5BH 3M17A 5IBTH 4HBCH 4CBPA 5JMOC 2VERN 3ORJA 4JHWH 5F7DB 2C26A 4NQVB 3H7BA 4DEPC 2KQMA 2FIKA 3U9PH 1A3LL 4I3SL 1TETH 3NH7L 5J1TC 3DXAB 1LNUA 4UNTA 4XX1E 1BECA 4RISL 3RVXC 3W39A 2X1OA 4QY8B 1BQHG 5GZND 4BM7A 1QUNA 4WWKD 2OL3A 3U7AA 2K1MA 4JG1L 4PJDA 2JIXA 5KSBF 3WS3A 3HNVH 4N9GA 1U6AH 1QR1A 2VDML 4LPTA 4NRYA 4XPFL 4X6EA 5D96B 4M1CD 4U4BA 5HHOD 3HE7D 3AM8C 5ALCH 4NO5B 1HILB 3KVQA 4J3UA 4Z7WF 1QEWB 1FVEA 1INQB 1QG3A 3G9VA 4ZNEA 3PDGA 9CGTA 1INEL 2NR6D 1FDLL 3BD4A 5EU3A 1QVOA 1U8QB 2ZCKL 3LPGA 4KQ4L 2J8OA 3KS0J 1MFDH 3S3SA 5DUBB 2VZVA 5ISZA 1YQVH 3GKZA 3ULVH 5KSUB 2DICA 1MFEH 4XHJD 3SJVA 2XICA 3TBSA 4KDTC 2VLRA 1IEAB 1KEGH 1N8ZA 3QEHA 3CPLB 3KYNA 4HS3A 1NMBH 1KBGL 5CSZA 4EJ1C 4UAOB 3CSYB 4LPYA 5DK0A 1AIFB 1IM9D 3VD9A 3RVUD 35C8L 4KKBD 1HKFA 5LGJA 2H2SD 1AXSB 1AKJA 4LRNL 4LHUA 5JHLL 2G5BA 3DO7B 1F4HA 1IAKB 2ADJB 2X4SA 4K2UL 1WAAA 3ZSTA 5FYLD 1ZLUK 3I50H