3H42L

Crystal structure of pcsk9 in complex with fab from ldlr competitive antibody
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
ESVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLISGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGSVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title From the Cover: A proprotein convertase subtilisin/kexin type 9 neutralizing antibody reduces serum cholesterol in mice and nonhuman primates.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2009-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h42L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h42L01
5C0EB 3MRLA 1IEAB 5ITBL 3BQUD 1M7DA 1J1XL 4NN7C 3WFBH 2DQJH 4ETQA 3SDAA 4XAWH 3MJ9A 3K4ZA 3T0XA 3W9EA 1QD0A 2NX5D 4X6CF 5KJRH 4DTGH 3BYYA 3HZMB 4OCSL 4PRNA 4EUPG 1MFBH 1DBBL 2VAJA 4PRAA 3K7UA 4O5LH 1EEYB 3KPOA 1SJXA 4ZAKA 5ALCH 4R4FL 1T04B 1C16A 4OQTA 3MSPA 5DJXB 1ZVYA 3VG9B 3C6LB 3WCYA 1QO3A 4TUKL 1NGQL 4M1CC 1U95A 3W5MA 3EOYG 4LHUB 4PJHF 3SY0A 3RVVD 4G6JL 4I1NB 5J6GB 1NC4B 2DLEA 4X6DA 2F53A 4JRWA 5ISZE 3Q5YA 3V4VL 4UNUA 5IJVB 5L88L 1QZ1A 3OAUH 4OZFA 1Q0YH 1BJ8A 4LSSL 3S5LA 4K8RD 3V79C 4LVHC 4WEUD 1GZPA 4P5TB 5D2NE 1JYVA 2B1AH 2MQ3A 3EYVB 4Y2DC 1PLGL 1FVEB 5AD0A 1I8MA 1KNOB 3MXWL 3TWCH 2YEZB 5DA4A 3WBDA 5HHQA 5HDLA 4U7KA 1ND0A 3VD3A 3BJLA 4K3EL 4NO5A 4H88L 1FYTE 4GH7B 3HC4H 4P23A 4D94A 5DXWA 1OGAD 3BE1H 3OKOA 4IRJA 3DECA 4WI2A 5DJ0A 4KMTL 3V2AR 1U8KB 2VH5L 3L5XL 2ADGA 1HNGA 4NNXA 1A7NH 2RHEA 1FJ1B 4LSQH 4AT6B 2YWZA 2CKBA 2W1NA 2WBJC 4LCCB 2BSTA 5ADPL 4ZUSA 5CSGA 5F7FA 4YJZL 2Q86A 4YIQA 2FWOA 4HK0A 3EOTH 4OZGE 2VR4A 1NFIB 1E0OB 3OKLB 5GPRA 3QDJB 5F88A 5HD8D 4Y7MA 5IW6A 1V7ML 5DO2C 5GGRA 2XWJB 4LRNH 3HG1A 5IMLB 5ITBH 3BXNA 5C6TL 5ISZD 3SE8H 5ALBL 1GL4B 5JXEC 4DW2H 1WCBA 1BFVL 5KS9F 2WWKO 4YHKH 1JFQH 3V52L 1V3KA 3HB3C 5DRNA 5HHXH 4MD0B 3DO7A 4PJCF 1FZMA 2QKIB 5GRYA 1A3RH 2FL5A 4E42A 1LK2A 1DBAL 2R0KL 2GEEA 1U8PB 4ZODA 3DRQB 3PWPE 1DL7L 4YHNA 1FO0B 1A1MA 2EC9U 1KFAH 4TUKH 1B0RA 2OS7A 4JPIA 1NGQH 1VFBA 4W6YB 5DQDH 3V0VA 3KS0H 4G6JH 1BBDH 3TBVB 1EXUA 3X11A 1C12A 5E1AA 1VGKA 5JLZB 2Q7YA 4ODWA 5J56B 3C60D 3QFDA 5JORB 5L88H 2AJZA 3F12A 1NFDF 5F6IB 5SWZA 4WNQB 2R1YA 2EYRA 3Q1SH 1OW0A 4FQPA 1X4ZA 1FFOB 4YK4C 3MTRA 5BS0B 1MCCA 2UVEA 1BVZA 3NCFB 4R3SB 5DMIL 1JUFA 4QRRE 5TDOB 3TH3T 2Z35B 4WUKL 1VCAA 1UZ6E 2P7TA 1RULH 1KJ2L 2RQ8A 4DGVH 4I3GA 4OFKA 3WNKA 2HT2D 4F9PA 2VH5H 1QQDB 3MRQA 4I4WB 4XBPB 4LLYA 5ID0B 3E3QC 4TYUA 4L3CB 1PQZA 3PXHA 1AE6H 5EZJA 2X4QB 4PJGE 4NHUA 5C92A 4H8WC 1DN0A 25C8H 4CMMB 3SKMB 4JM2A 3VFPB 3CK0H 3PWPD 3SQBA 1R3LB 4WHDA 5IVXA 4UOW0 2A1WL 4EUPA 3BZEA 1CGVA 3LRSB 1OAYH 2FBJL 4BSJA 4LSRL 4LSTH 1BD2E 3RPIA 2CK0L 3FZUC 4I0CC 2EIZA 5DYOA 2V7HA 3CLEH 2UZXB 3OXRB 5I16A 1D3CA 5I8EB 5J13C 3ULUE 4JO1L 3V5KA 3CVIL 4KU1A 2FR4A 3T4AA 1CL7L 3DV4B 1JCKA 1TZGH 4EOWL 1DBAH 4IMLA 2A38A 1ORQB 3VFNA 2XQBL 5ENWB 4N5ED 4LPUA 1BVLB 5IJKA 3BWAB 4ZPTA 2E6QA 3IXTB 1Y6MR 1F2XK 1K3IA 4NZJA 4P23D 3VXNB 2O26U 4IRJD 4MZ3A 4UT6H 1YMME 3NIDE 2G5BB 4MJIB 5C0NC 5DI8B 5IHUL 2PTVA 4QY8B 3IRZA 1V7NL 3VGFA 3VH8G 1MLCB 1UWGH 5AYQA 4YEEA 2Q3AA 2BY0A 2VDRH 3O3AB 2VITA 4YAQA 5CD5D 5CMAA 4R0LC 5TDNA 4ODTL 2V2TA 3KJ6H 1FRGH 5DMIH 4I48B 1KYOJ 4R2GB 2RAMA 2WINA 1BZ9A 1AGFB 2EIBA 1KJ2H 5A1AA 1YN7A 1CXEA 4F33A 4WI7A 3FFDB 2X4OB 1BD2D 4W68A 4O51B 5I71C 1QEWB 2HFFA 4PLJD 3W0WE 4LVOB 5GSVB 3SCMC 3QQ9C 1GH7A 3ULVE 4TUOB 4NCDA 5EOQL 3ULUD 3MGTA 2KL6A 1IGJB 2EKJA 4BH7B 5C0AB 2NW2B 4MNGB 5F70A 1G6RL 4L8SC 1P4BH 3KPPB 5HGHA 2ARJB 3R0MA 3MX0A 1KYOK 4FNLL 5HVHC 5MEOA 4OUOA 1NCDH 2FBJH 4I0PD 1G7JB 4LSRH 1YMMD 2X4NB 4DCQA 1Q1JH 1QFPA 2ADFH 4PJIA 3OXSB 5M95B 2OLDA 1D7FA 1LE9B 4N0YH 4PYHA 3FB8B 1FGNH 5F7YC 5D7KE 3V9FA 1VEPA 3L5JA 1HXYA 1E6JH 4GRLD 4JO1H 3QUYD 5GGSB 3CVIH 1S7XB 1IBGL 4JJ5A 4ERSH 4HUVB 3MYJB 4Q97A 3QIBB 5B8CA 1MRCL 1ZHBB 5GRWA 4HWZB 3EHBC 3KPLA 2X4UB 1A7OL 1RUKL 3ARYA 5I1LA 2Q1EA 1KJMA 1TJGH 1M6OB 4NHCL 4OZIB 2ZOLB 3O2VL 1G9NC 4Y88A 1I3GL 1GAFL 1CXHA 2EZ0C 4N0UB 5K33A 5I1HH 3KPRA 5T1LA 2HLFD 2L7UA 4CL7A 3H9ZA 5IHUH 3G5ZB 4S0SD 3MBED 5EC1A 3GUTB 2A9NL 4KKLC 1BJMA 4XWOC 3CFBB 1I8IB 5DZNA 3W0WD 1IRAY 4ZYKB 3ULVD 5D1ZD 2HMIC 3LCYA 3N85L 1EIBA 3HS0A 1ZS8A 2BSSB 4P2YA 4WHTA 2ATPB 4YWGL 3OX8B 2CMRL 4ODTH 3MV9A 4U1JA 1CLOL 1NQBA 3BQUB 4Z6AT 1JPFB 5DUPL 2BVQB 3BVNA 1TTGA 4NFBA 2AQ1A 3IKCA 5E94B 3RWFB 3ZT6A 2NX5B 5D9SB 4DVBA 4NP4L 5DQ9A 2EICA 4U6VL 1BVKB 1SEBA 3OJVC 1FL3A 2AXFA 5IMOB 3MFFA 8FABB 5EZOH 2D2OA 3UAJD 4WY7H 4XI5D 2JELL 4MS8D 3BDYH 3NFPB 4ODSL 4PJXE 3BW9B 1U93A 3DARA 5GGUB 1CD1B 4ODBD 5IB4B 5DC0A 4NRZA 2R1WB 5KANG 3X17A 1A9BB 4N8CL 1JHLL 4NBZB 1U3HC 3VFSB 1G6RH 2FIKA 2EDNA 4K9EH 1K2DA 5JDJA 2A6DA 2BNRE 2FLRT 4E5XA 2HG5A 2OL3A 3IXAB 4S1QL 5HYIA 2B8OT 3F62A 1NKOA 5I73C 1U8MA 5TQ0L 1ZT7A 3SDCA 3TZVA 2YK1H 4JB9L 2FHCA 4KJQD 3Q6FA 5E9DA 3LIZL 1KTLB 5JNYB 2E7CA 1OP5H 5ACMA 4HJ0C 3P77B 4ZSOA 2X6MA 1HHIA 2WUBH 3M8OH 1MRCH 1OGAB 1R5VA 1TNMA 2UWEA 4U1GB 4XC3L 1FLTX 4MXVF 5JQ6H 3IJYB 1RUKH 4XP4L 3CVHH 1NEZG 4I2XE 4UDUB 2BVEA 1FAIH 4P5MB 4PGEB 1I3GH 1K9TA 4XRCB 3VXPB 2AV7B 5EU4A 1RUML 2J8OA 3MLPA 1L6ZA 5H2BA 3LKPB 4MQ7B 4GAYB 1F8TL 2R4SL 4QXTA 4UU9B 4YWGH 3MRKB 1X9QA 4N5UA 5EBLA 5I1JL 2CMRH 1YC8A 2DI7A 4JFFA 4PLKD 5ISZB 4OM1H 3UO1L 4UTAL 1YEEL 1BAFH 3UTPD 4XNUL 2Z31D 4XC1L 3WUWB 3F7YA 1JNHB 2BNRD 2FH6A 3O6LH 5DT1H 5TFSH 5CJOL 4BH8B 3L3DA 1KB5H 4NP4H 1K6QL 4KTDH 4MJ5B 2OTUB 2XWBA 3RNKB 1DJSA 5C0BA 1HHKA 1OCWL 5IFHL 5JXAL 3W82A 2JELH 1W2KT 1JK8A 3KR3L 4PJ8C 2NQCA 3WHXB 4Z5RA 4DQOL 3KJ4C 3GMLA 3OMZA 1ZGLM 1BOGA 3UPAA 4KKBD 2FH8A 2PYEA 2EDBA 1T6VN 3C60B 1TVBB 1WCQA 4RMSA 3O6FA 4ZPVA 4O9HL 3T1WA 2N7BA 3RVTC 4NM8H 3PWVA 2DS4A 3GSOA 3I6LE 4PJBF 1IEHA 4JN1L 3GBMH 5D2LA 3ZYZA 1P4LA 4DUXA 4OZGB 3BPLC 1IM3A 5T33L 1MCJA 4FQIL 4JB9H 4TVPE 4DAGH 1NGZA 4J7RA 1YNTA 5JIKA 3MA9H 3GBLA 1DQTA 3LIZH 4HF5L 2V6HA 4WV1A 3KPTA 5LGJB 4LIQE 4KKCD 3V8OA 3KLHD 2CRMA 3KPMA 4OBSA 3UYOD 3MRLB 5JW4Q 4IS6A 3RX5A 4M6OL 3MV9D 1QR1A 1EV2E 4P46A 3OGCA 4DN3L 3H6JA 5D7SL 3W2DL 4C57C 3QEUB 5HJ3B 4ETQB 2DWEB 3HMWL 4FQCL 3EO0A 3W9EB 2V9TA 2XTJC 2ZCKL 2JIXA 3U4AA 5CP7A 2FJFA 3BP5B 2FEDD 2CRZA 1MRDL 4XWGL 5DJ6B 1RUMH 5L2JA 3H3KA 4R90H 3MGOB 2VDMH 3GI8H 2CDEA 1C16B 3RAJH 3PWPB 3GJFA 3RL1B 2DN7A 1EK3A 4XB7A 1QO3B 2R4SH 4LU5L 1U95B 4YFLF 3SY0B 3BKJH 4Z7OF 4OJFH 4YDJA 2VSDA 1C7SA 4X6DB 3QWRD 2AJUH 4LSPL 1FZOA 3P0GB 1NLDL 1J0KA 4U3XA 4OZFB 1I8KA 4ZFZA 3S5LB 4XXDA 5HYQA 1EDQA 3NCBB 1K6QH 5E8DH 3I6LD 3FN3A 3VI4E 1GZPB 3LS4H 2XXCB 4C54A 4OLXL 1S7QB 1OCWH 3DIFB 2B0SH 3IF1A 4KK5C 5AD0B 1I8MB 5JXAH 4HIHA 4TVPD 2PO6D 5E9DD 1QRNA 2MPAH 1XIWA 4JZJC 2W9DL 3QG6B 2X41A 2A9ML 1PY4A 1ND0B 4DQOH 3JUYA 4NO5B 1EX0A 1GIGL 2Z8WC 4WEBL 4LAJH 4P23B 4DVRL 3OKOB 4IRJB 4NN5C 4IHOA 4NC1C 3RWEB 5AZEL 1P2CA 1N3NA 2ADGB 3HNSL 3O11A 3D25A 4O9HH 1U8IB 5IFJA 2VYRE 1KOAA 4V2BA 3DVIA 2HN7A 2BSTB 2LAGB 1B4JL 4M4RA 2Q86B 5E8OA 4PJGB 4FFWD 1GOHA 5I66B 1FSKC 1ROWA 5J6HA 1S78D 5F88B 3UPCA 2F9BT 4X4MA 4D9QD 4HF5H 1I7UB 2DQDL 5IW6B 1B6DA 4RFOH 5IQ9B 5GISL 5K9JL 3HI5H 4JM2F 4M6OH 4JFFD 1RZFH 4NQEE 4DN3H 1EERB 1WCBB 5IM7A 1BD2B 5IVXF 3QA3A 5GJTL 2OR8A 2FSEA 5DRNB 4YC2C 4HH9A 4GRWF 4QXGH 2ZJSL 5E2TH 4Y89A 1MIML 3T65B 1G7HA 4LCWA 1MRDH 4O02H 2UY7A 3I02A 4KHXH 2WK2A 2FL5B 1TZIB 5I1CH 3ES6B 3GO1L 1LK2B 3ARRA 2EH7L 4FQJH 2V7NA 1EHXA 4JO4L 1T7YA 2BRRL 4YHNB 4HX1A 2ZG1A 5J0BA 5E5RB 4ZNEA 4G6ML 2H2PD 1PEZA 3B2UC 3BPNB 4MDIA 4HD9A 3VFUA 1CCZA 1VGKB 4I0PB 2J8UA 2CO7B 2PYED 4LSPH 4X6CE 4ODWB 5D93C 1MCNA 1YMMB 2AJZB 1G9ML 3BYTA 4DKDC 3O6FD 1FPTH 5DHVH 4TN9A 1RMFH 3C08L 4G6KL 4JM4L 1FG2A 1PKOA 1PJ9A 2H6PA 4XP5H 4GRLB 4PRDA 2BCKB 3QUYB 3WFHB 3HC3L 2XXMB 4MD4B 4LPTA 1S9WA 3MBXH 2CIIB 4Y16A 5BVPH 1QBLL 3FN0H 2WWKT 4PJHE 3DTXA 5FAAA 4PJ5A 5CEYA 1FZJA 3NIGF 3BP6A 4JKLA 3D69A 2CR3A 2VKXA 1UM4H 1G7LA 4U1HB 5FOJA 5F89B 2YPKB 1GIGH 2UUDK 1MUJA 4YUEH 2O93L 1DBJL 4Z7WA 2AJXL 2PYFA 2DBLH 3MRQB 1KPRA 3MBEB 1L7TH 4TVSa 1D5BB 4Y1AE 4YHYB 4LLYB 3W0WB 1B4JH 1UKQA 3DVNA 1X5YA 5D1ZB 1RSFA 3KYMA 3T2OA 2BSRA 5EORL 4JPKH 4NHUB 3P9WB 1JWUA 5E4EB 1KLGA 1X4XA 2DQDH 2OJEA 2X1OA 3O6ML 5SX5H 5GISH 1AXIB 2VDQL 2CUMA 4G7YL 1MCOL 1KCSL 5E8EA 1H9VA 1Y18A 3QDGA 4EUPB 4ZO7A 1SEQL 5IEKA 1Q94A 2HYMA 1WT5C 3P30L 2C3XA 3RPIB 3TIEA 4D8PA 1Y6KR 3OKMA 3SBWC 1BZ7A 2EIZB 5GJTH 5I74B 5DYOB 2B5IB 5AYUH 3HR5A 4OKDA 4BSVB 4MD5A 1BQLH 1M7IB 3TPUA 1MIMH 1CDIA 1CGWA 4PJIF 2FR4B 3GSQA 3QNXA 3T4AB 1MCFA 1QVOA 4BFIA 3BSZL 2BRRH 3VFNB 1CTOA 1SJVA 1QSVA 4ZPTB 3EGSB 5KS9E 4NWTH 4M02A 2DM4A 4GT7A 4Y5XA 5FYLE 5JOEA 1O0VA 4J12A 3RRQA 3WIIH 3AVEA 4ORZC 3R1GH 3C08H 3AM8A 5GGTH 4OSUH 1EMTL 1OAQL 3LB6C 5BMFL 4J1UA 1A5FL 4TPRL 4CNIB 1OAKL 2XY2A 3HC3H 4LSUL 3OKKA 1CI5A 5EDXA 5CMAB 4JFEE 5TF0A 3TBSA 4Z7QE 2V17L 1DUYA 3RKPA 1Z0MA 3A6BL 2XICA 3H3PL 5T1MB 5TE6H 1BZ9B 2WBJD 4HK3J 5I1GH 1KIUA 4RFEA 5JHDA 1NCBL 5A3IC 3I50H 1NC2A 1A22B 1QRKA 1BZQK 4LLUA 3WIHL 2VMFA 2OQJA 4U3HA 5EUOA 1L4IA 3QAZC 1RJYA 1J86A 2R23A 4NCC1 4TNVF 5DO2D 3GSRA 1B3JA 4QT5B 1JMXA 3MGTB 4LCWD 1KLUB 5F9WC 2H32H 1EFXD 4ONOA 2HAZA 3RZCC 3T3PE 4PGCA 4U7SA 1GPOH 3O6MH 3OR7A 2Z31B 5AZ2L 2BNRB 2FZ3A 4G7YH 5HGHB 3E3QE 1MCOH 3HB3D 2IBZX 3A67H 1SEQH 1LDPH 5F97E 4P2OA 3P30H 5D5MA 4H0GA 5I30L 5E1HB 5CWSB 3SQOH 3TNNB 3PP4H 1JRHH 3HI1A 3QZWG 3Q6GL 1HXYB 2APBA 1VFUA 4JDTL 3KPNB 3BFOA 5FYJE 1F4YL 4JJ5B 2P5WE 4UV7L 4JFED 1DLFL 2W0FA 3FJTA 5F6HI 3TZVC 5E4IA 3BEWA 3BGMA 4ONFH 4HIXL 3KPLB 4U6XB 2VZOA 5K9QI 1LQSR 2Q8AH 15C8L 3SKJL 4I2XB 4L29A 3I6GA 1JV5B 3IDNA 2MCG1 4YHMH 3P3YA 2F5AH 4ZDHA 2JB5L 1NAMA 1J5OL 5EC1B 4GG6A 4GW1B 3K0WA 4JHZA 1EGJH 3T2NL 2DQEL 3NCCB 1EMTH 1OAQH 2AJVH 3QISA 3QG7L 4UILL 1D5MA 1OAKH 1ZS8B 4JQVC 4Y5YA 2PXYB 2NZIA 4WHTB 4DEPC 1LP9A 2L4OA 3QPXH 4G3YH 5E5MA 2V17H 3MV9B 2E9BA 1OWWA 3LKNA 5DJCA 2VDPH 3F65A 3H3PH 3CZFA 1ZE3C 3BVNB 5JO5A 3WS3A 1G7QA 1JTOA 1NMCB 3QDGD 4K07A 4NKDA 3MRDB 2QHRH 3MLXL 5BV7C 1MVUA 1SEBB 3A6CL 1U36A 4RWYH 3RZWA 1EAPB 1FL3B 3MRRB 4H1LH 2FJHB 4HKBB 5E8PA 1MAMH 3QUKA 4LHJB 5J3HC 4PJEA 3TV3H 1U92B 1A7PL 5FYJD 4NPYA 2DAVA 3LQAC 4NRZB 1F58L 5DDHB 3FB6A 3FZUD 4QKXB 2V5MA 1K2DB 4Y8AA 1JPGA 3QNZA 2HG5B 5F7NC 5E7FA 2OL3B 3N0PB 4N0CC 2Z92B 4I3RH 1DQMH 3WHE0 4KDWA 4LF3B 3QIUC 4Z77A 3GHEL 2GUOB 4L8DB 2A74A 2PR4L 3PL6C 4OTXH 5TJWK 7FABL 5IHZA 2R29L 1F3DH 2E7MA 2PO6B 4HPYL 5ITFB 5E9DB 4P57A 5IOPB 4JCMA 3VCLA 4AEEA 4QXUH 2QTEA 1N6QL 3P4MA 1F4YH 2W0PA 4UV7H 1TCRB 3QHFH 1HHIB 5FB8B 1GRWA 1TJIH 1NGXB 3B9KA 3VH8B 4HIXH 3DVGA 3RKDD 4LK4A 1UJ3A 3C5ZA 5JHDD 3STZA 3UTSA 3LKQA 1NC2D 5FYLH 3HUJE 1LO4H 4IDLA 5FECA 4QOKA 4JG1L 3RNQA 5EU4B 3JUZA 5LAXB 2CDGA 3G6JA 1LO2L 4RAHA 3BPCA 3T2NH 3GNML 4R96B 4O4YH 3TT3L 1Z5LA 4FG6D 1P9MC 2I07B 4QXTB 4X4ZA 3AAZB 1NH6A 2GTWB 5D72L 2VDNL 3O3BA 2EDJA 4JFFB 5FGSA 1FNGA 1WC7A 4LLMA 5EC2A 2XKNB 4ACPA 4Q7DA 2APWA 3IFLH 4OGXL 4X8JB 1XF3A 1G0YR 1S5HA 2VQ1A 4QYOB 3ARBA 2NY0D 5CILL 2AI0H 4P2OD 5HHVH 4CKVX 2XWBB 3IU3A 1C08A 4HW6A 4M62L 1HHKB 3FO1A 2DQGL 4FQLL 3X12B 3HZVA 1RUQH 4R4ND 1WIOA 5A2FA 5ILTL 1JK8B 4WO4A 2B4CL 4DK6A 2DMKA 4P4KC 1NPUA 3O9WA 4OLZL 3WNOA 1D6EA 4P2QE 2N56A 2P48B 4YFDB 5GQBA 3DYMA 4XPTL 1BOGB 4HJGA 2O5ZL 4C4KO 5MERA 2PYEB 5IBLD 4JEGB 1XR9A 5DD5L 1NBYA 3O6FB 3QZWA 1GOGA 3RBGA 3VRLF 3ESVF 4P4RA 1O7VA 3MCKA 4G42B 4H8WH 4OLUH 4ODUA 4X6EB 3GSOB 5L2KA 5D2LB 5C07E 4RGOH 1P4LB 4F15C 3RWHA 4PGBA 2R29H 2PTUA 2P5EA 1YNTB 2VOTA 1A14L 2XKSA 3MRGA 4D0DA 1IZJA 4HKZB 1SJHA 2FIRT 1YYMH 4G9FE 3BZ4A 4X5LA 1I9JL 1CFNA 4L9LB 5A2KH 3L7EB 4Z0XA 5EBMA 3SPVA 4N90D 3EO1A 1QSEE 1QR1B 3PWLA 1RJZA 4HS3A 3QUXC 2EEAA 4M4PA 2MFNA 4KKLD 4XWOD 1U3JA 4K8RL 1N4XL 4J3WA 3AREC 5E2WL 4L4TE 3D2UA 2HMID 3O8XA 3L3KA 4IM8A 1A1NB 1YY8B 3VJ6A 1CGSL 2DLGA 3ARFA 3GBNH 1X3DA 5EO1A 3MJ6A 4JG1H 3ZKMD 4Y4FC 5L2JB 4GW4B 4IRSA 1AGBB 2NY4C 1WAAA 2A6JB 4TQEH 3V7AG 4MXVE 5CIPH 1IC7L 4YDJB 1JGVH 4K3DH 1ZGLA 2X4RB 4YH6A 4KTEH 4IOFD 4XNMA 4X6CB 1FZOB 3BUYA 4QCIA 1I8KB 4W4OA 3O2DL 3GMNA 2JB6B 1I1FB 4PG9A 1QLRB 4PREA 3D18B 3U36A 5C07D 4M62H 2D0GA 3IF1B 4WWKC 3PGCA 4Q9BA 5F3BA 3GMRA 5JW5A 4HIHB 5FDWB 1C5BL 2FGZA 2OMBA 2B4CH 2JJVA 4RRPG 3X3GL 1C5DA 4U6YA 1U8JA 3MR9A 3NH7L 4UOW1 2VRAA 1H3GA 3X3FL 1X5HA 4JHBA 2XZQH 1S5IH 4FQXC 5D8JH 2MTPA 2O5ZH 4C56E 3QUZD 5E6IC 1CFTA 4IHOB 2YD8A 5FOBA 1DE4B 3NABL 3MMEB 2W9LA 3A0OA 1RJLA 3C87A 2NY7H 3U1SH 3D25B 2MJWA 5IFJB 1RZKL 1GC1H 1WBXB 2HN7B 4L4TD 2C4FT 5T3XE 2DLFH 2Z9TA 3UZEA 4Z7WF 2BVOA 3MFGB 2GIYA 3RGVA 5I1AA 4M48H 3S37X 3TT1H 2Y07H 1A14H 3IJHA 1NEZB 3QUMA 1NANI 3JVGC 2YC1A 2XN9A 4HUMB 2F15A 1MWAB 2HJLA 2WBJB 1JGLH 2X4SA 4MDJA 2VLRA 5LJYH 3B3IB 1XGYL 4Z7NF 5EA0H 5EO9A 4UZGA 5MENA 1QSZA 4PJBE 3BT2L 5HPMA 1QBMH 4B5EA 3MLTA 1KN4H 3LEVH 1N4XH 3O81A 4K8RH 3U9UA 1BEYH 4U6TA 4EQ2A 2FSEB 3PP3K 4ZO6A 1K4DA 3ARBD 4HH9B 4FZ8L 1A6VL 2IFGA 2X4PA 1F97A 3CSBA 2BOBB 2WIIA 3KAAA 4LCWB 5DRXA 1T1ZA 5F7KC 2FO1A 1EFXB 1G7MA 2FATL 5ID1B 4BQ8A 3HMXL 4PY7A 3AY4A 1HDMB 4HX1B 1SVCP 3T1FB 3VWJC 2XTJE 3BGFC 2MMXA 3L3OA 3VFUB 3OB8A 5KSAC 4C56D 1UVQA 3CZJA 2J8UB 4FABH 1AD9B 1KIQA 1KTDB 4OLWL 1C8PA 3MJ9L 3MLVH 1N2RB 4ZXBC 1RVFH 5J57B 1J1OH 1FG2B 3GJEA 1J8KA 3GB7A 4BQ6A 2H6PB 1S7RB 5L2KD 1JF6A 1E27A 1UM5H 4JRYA 1E4JA 4MNHA 3GMPB 4Y5XC 3CH1A 4C83B 5ICYA 4JFEB 3RVWD 3WXWL 2A6KB 4OQTL 4Z7OE 1C5BH 2P5ED 1CDUA 1U8QB 3HFMH 4G9DA 5F1IB 5CEYB 3HAEH 3X3GH 3AM8C 3X3FH 3RTQA 1G7LB 1QACA 1LK3L 4PJ9A 3DJ9A 4KHTL 4XPAH 1MUJB 2D9CA 4YK4B 3LH2L 1MH5A 3NABH 1ZHLA 2PYFB 5DSCA 3GRWA 4ODVL 3S3SA 1CVRA 1RZKH 5DJYB 3DVNB 3D2UD 3HNTL 1SMOA 2VZSA 3KYMB 1YPZA 1IGTB 2FLBT 3ARFD 5E00B 3NOIA 4YPJA 5JQHC 2V9QA 3V6OA 4NWUL 4WVRA 4NC1E 3NZ8B 4ISVB 3OSKA 4XCEA 1TJHL 2XWTA 5A40E 4F7EA 5EIVA 4PTTA 2XTJD 4QTHA 3Q48A 1Y18B 3QDGB 4PJAE 4ZMAT 2WANA 3RUGA 5K9OB 2A6IB 4D8PB 2CKBL 1NFKA 1BIIA 1U2HA 2VZ3A 4LGPB 3OKMB 4AIOA 4LPYA 4XHJC 5CHNA 1NBZA 3HR5B 1OTTD 4JZNB 4FZ8H 1A6VH 4HIIA 4MD5B 4S1RL 1XCQA 4OUUB 3T0WA 4FFZL 1FIGH 2P5WB 3AB0B 2FATH 3NACH 5KAQF 1CFBA 2DDQL 1RZ8A 4P2RA 3QDAA 1IAMA 1L7IH 3IS1X 5I8KL 4BJLA 2GK0B 2R9HC 1S9XB 4CRPA 1KIPB 5FHBH 4FZEL 5J13B 3KLAB 3AU1B 2RBLA 3REVA 2F8XC 4XMKL 4JFOB 3MJ9H 2AXJA 1KEML 2D7MA 1QNZH 4RRPA 2YN3A 1BF2A 3MNZB 5FIEA 1QBBA 3V5DA 2ATKA 1AHWA 3OKEA 4IDJH 4MYWB 3KHQA 4MX7B 4GG6F 1DUYB 2A83B 2XN9D 2P8PA 3WYRA 2C3HA 3BIKA 5JPNA 1PX3A 4RFEB 5JHDB 2VLRD 1OSZA 1NC2B 4GBXC 3SE9L 5C09A 4ELMA 4MCZB 4LLUB 3MV8E 5FGBC 4XMPH 5EUOB 3TGXA 1R5WA 1RJYB 4LGSB 5T3XH 5FHAH 1YEHL 2NTSP 5A2LH 1FQ9C 2BHUA 2F5BH 1YJDL 3GSRB 5EFIB 3IU4L 1I9EA 3KDMA 4UT7L 5EWIL 3KPQA 1FLRL 4OD3L 5FK9A 3QB7C 2HT3C 4U0RB 4PJEF 1KXTB 1ITCA 3VI3F 5I71B 5D70L 1TJHH 2DI9A 2EDLA 2FZ3B 2ZCLL 1H8NA 1WF5A 2NY0B 1X6LA 4Z7VF 4P2OB 3S34L 1AD0A 5D5MB 2CKBH 1CFSA 5ADOL 3PGFL 4F7PA 5B21A 3IAGC 2CLRA 3ULVL 4HWBA 4KDTC 1OY3B 3GGWA 4GJTB 3SKNB 4ORGA 4P3CL 1AIFA 4XNXL 3HI1B 1IMHC 4JJHA 2IPTL 4FFZH 4JRYD 3L9RA 1T5WA 4IMKC 1IAIL 2NY6D 2W0FB 3DMMC 3D1MC 3LVEA 4HLZH 4XPHL 2YOCA 5C0CA 3RTQD 2I27N 4PJ9D 4L29B 4Y19E 1PVHA 5GS1A 3I6GB 3HUJB 4FZEH 4GKNB 3D48R 4L3AA 4EN3C 4Z95H 1IT9L 4XMKH 1GGYA 4ZDHB 4HUWB 2O61B 5JW4N 5JDSA 3MLRH 4J4PC 3LD8C 4ODXA 1B0GB 3UCRA 3FQTA 4KK9C 1YN6B 5HHME 4PD4K 2HTKC 4TSAL 5C2BH 3TO2A 1HOCB 3E0GA 1D5MB 2WM0A 3MUZ1 4UV4H 3N9GH 1JPSH 5JZ7C 1LP9B 5T3ZE 1CBVL 3FQXA 4B7IA 4NQTA 3LKNB 3MLWL 5DJCB 5GS0D 4FFYH 3MRJA 2E8ZA 1RK0A 4PJ7F 3WS3B 1HQ4A 4NO0A 2UZYB 2CIKB 4S2SA 5LWYH 3ZYIA 1ZT4A 3MRBB 4XCFL 1TIUA 2EDTA 3MRFB 1E4XI 1DDHB 3QUKB 5GGVL 3LQMA 4P3DA 3IU4H 4UT7H 3EIFA 4L3EE 4RIRA 4OD3H 2EO9A 2EDQA 4LP4A 4P2RD 1ES0A 1G0XA 1I1AA 5KVMC 2GQHA 3OKDB 3T2PA 3EJYC 3DOSA 3GKWH 1NCAH 3VA2C 3TLRA 4D0CB 3ZE1F 2BP3A 2ED7A 2ZSWA 4Z77B 1LD9A 4KROC 5C07B 3LRHA 1PEWA 5C9JA 2X10A 3PGFH 3L95A 2K9UA 2A74B 1A0QH 4JVUA 5ESQB 4WI8A 3RPKA 2DIBA 5IW1A 1TMCB 1OTUC 4N9OB 4GW5A 1KIRA 2MNUA 3RWJA 3VCLB 3SJVA 3H0TA 5EOTA 3ZSTA 3JV5A 2IPTH 4KQ3L 3P4MB 3MRCA 1IAIH 1TZHA 3P11L 1QP1A 3QUZB 2I24N 3FQWA 1I9IL 4I8DA 3PABA 2R0LL 4CW1A 3S4SB 4P9ML 2C1PA 1UM6H 5CINL 2AKRA 1MJ8L 1T7ZA 1S9YA 4M43L 3STZB 1VEMA 2CUIA 3MACH 4L4TB 4GRWH 2PCPA 2ZKHL 2OR9L 3S35X 5FO7A 4HUUA 1ZXQA 4PJFE 3QI9A 2JJSA 3O45B 2PNDA 1RUPH 3IRPX 2CDGB 4WGVB 3BPCB 4BZ1H 4TSAH 3MREA 2EDWA 1HYSC 32C2B 1Z5LB 3QSKB 4GAJH 1IZKA 3U0WH 4AIZA 3L3IA 3O8XC 5DZOA 4L3ED 4GQ9L 1NGYA 4NQDA 3IDYC 1WAAF 4PS4L 1WC7B 3EYFA 5BQ7B 1JNNH 4IRSC 3MUGA 2Y5TA 2D9QB 3BD4A 1BQHG 1AQKH 1R5IB 4YDKH 5HY9A 1JZ4A 3MRPB 4UTBL 5T1KD 1S5HB 2VXUL 3ARBB 3CSGA 2JCCA 3I3DA 5BXFB 5J9PA 5FUCC 5C7XH 1E6OL 2RIKA 1CIDA 3IU3B 5D4QA 1AY1H 1JVKA 3B5TA 3HZVB 3U4BH 1WQVT 4XP6H 4PJDE 3BH9B 3AUVA 4XH2B 3VGEA 5KG9A 1D6EB 1I85A 43CAA 1XMWA 4HJGB 4C56B 4LPXA 1GGCH 5MERB 4LBEA 3CDFA 1MCDA 1BMGA 4M1GL 3ARGA 1FNEA 1UJTA 1XR9B 2AP2A 3QZWB 4CVZA 4X98A 2NY5H 1A4KB 1HSAB 4ODUB 2EDDA 5L2KB 4ZQKA 3KJ4B 4QTIL 1CGXA 3U7YL 5B4MC 5KTEH 12E8H 4WWID 2IAMA 2CJUH 2P5EB 2AEQL 1HCVA 1WWCA 2X9XA 3D0LB 4YBLB 2BOCB 3PF2A 3IDIA 4LCIL 4XZUB 1JP5A 2Z4QB 2F19L 4KQ3H 1CFNB 2B20A 1RFDH 5F1NB 4Z0XB 3X14A 2AEPH 2DJ4A 2YD2A 3EO1B 5I1IL 2GY5A 3PQYE 1I9IH 1UKSA 4HAFA 3RGVC 3BPLB 1ZEAL 1DR9A 4P9MH 2OL3L 4M7KL 1MJ8H 3TJEL 4Q58C 4K23H 2Y7QA 3KG5A 4M7JL 1BPVA 5KBNC 3UPRA 2F74A 4QHKI 3ZE2F 3VJ6B 1DQDL 2I26N 3ARFB 2IC2A 1AXTL 2GSGA 4TVPL 4NRYA 3W81A 2ICWJ 3FQUA 5BZWB 3HN3A 1F4XL 4LIQL 4X4XB 4HKJA 3O4LE 2XTJB 5J12C 1XGUA 2VLJA 1YEJH 4NIKB 3OJ2C 3WS6C 4PY8J 4MA3A 4QHLA 1I1YB 4XNMB 3DSFH 1FORH 4G7VH 1SMAA 1OQOA 4RWHA 4OB5L 2DTSA 3G5YB 2CDFA 3CXHJ 4WFED 4F37F 4PG9B 4PP2B 3U36B 4WEMB 1HH6B 4JVPA 3N1GC 3PGCB 4YDIL 3QO1A 5JW5B 5INDA 1HKFA 1ZA3A 4WIQA 1F4WH 2C1OA 1CDYA 1C5DB 1AC0A 1S7TA 3M17B 1U8JB 3MR9B 4U6YB 3SJVD 5DTFA 5GS2H 3W9DA 5EUKA 1IVLA 3G5VA 3VDCA 4N0CD 4J3TA 2AGJH 3QIUD 3JWDC 2QQKH 4NKIH 2CLZB 1JHKL 3SGKC 5DJZA 5IMMB 1BFOB 4IRZH 2F54E 3CLFH 3FCTB 3U7YH 1D9KC 4G8IB 3IFNL 1ZWIB 3CXHK 4LCUA 4OGAD 5FO9A 4JQXC 5I1AB 2BVYA 3IJHB 4EJ1C 2XN9B 4QHNA 1HZHL 1HSBA 4LCIH 5KSBA 4FQ2L 3O4LD 5IQ7H 3S96B 5IWLC 4PJAB 5HYSG 3VRLE 4MSWA 4NQDD 5DC4B 1W0WB 1QFUH 3REWA 5EO9B 4P9HC 1FSKB 2YD4A 4HIJB 3O3EA 1EFQA 2BSED 1IGMH 2YPLA 5E7BA 3H7BA 5EPMA 3KYNA 4M7JH 5FA4A 3E2HC 3CMGA 4GUPA 4MHHG 3LMJL 3N1QC 1DQDH 2OXHA 4BZYA 2WIIB 2WP3O 4O2CB 3ROLB 4M3JA 2HRPL 4DKEL 1BQHA 1INQA 2EDRA 4X4ME 5L0QB 1DLHA 5CEZE 5DEFA 2ESVA 3VWKA 4DGIL 2KZWA 5IF0A 1HINH 3L3OB 4QRUB 2OTWA 4YGVA 4XBEL 1KTRL 1MFEL 1KIQB 1UZ8A 5ICXA 1E4XL 3GIVB 4YXLL 4OB5H 5BOZG 1IQWL 1CDJA 3MRIA 3RWCA 3GMOA 4EI5C 3ARDC 4MA8L 4P4KD 5CEXB 3GB7B 5LCVH 1V3LA 1OLZA 1T5XA 1E27B 4PTUA 5HDOA 4U7MA 4JRYB 4NJ9H 2IAMD 1C1EH 3LEYH 2NY6B 3D5OF 3KLSA 5FKPA 4ESKA 3BHBA 2DD8H 3KPSA 1IQDA 1PY9A 5IIEB 1CDGA 4HHAA 3RTQB 4R8WH 1CE1L 4PJ9B 1J11A 5DD1H 3OHXB 3LHPH 2WV3A 3K1DA 3P0YL 4APQA 2FX9L 1TQBB 1H5BC 2XNAA 1JHKH 1ZHLB 3IJSB 3L5WB 4KUCF 4NOFA 2DLHA 1XGPA 5DSCB 1U8LA 4WTZG 5D1QC 5DFWH 1ADQA 1YPZB 4K3GA 1YQVH 3IFNH 3QJFB 4JFPA 1MIEL 3U7AA 4NFCA 5ACZB 3QDME 4XCEB 3UDWA 1HZHH 4D9RE 5CJQL 3OV6A 4Z7UB 3JTSA 3BKYL 2VLJD 5DMYA 3KYKL 3P9MB 4LHQB 1LO0L 4HC1A 3RUGB 1KCUH 1EJOL 1BIIB 5C6PB 1JPST 5CHNB 3MRMB 2NY4D 3DLQR 2I9TA 4HUXA 3IDGB 1T3FA 4HIIB 4EDWL 1XCQB 4F58L 4D2NA 3H9SA 2BZDA 2HRPH 4DKEH 2VXQL 2XPGA 4P2RB 3DI2B 4Z7NE 4HIEA 3I75B 2X4TA 5I9QB 5HHNB 2EC9T 4Q0XH 1NCWL 4WW2F 3M1BA 2VE6A 1RHFA 3TVMA 3CCHB 4XBEH 3VD4A 1MFEH 1YEIH 4ZUVA 1IILE 4WW2C 4WWKD 4R6UA 1HI6B 4RFNC 3VFGL 4OD1H 3DGCR 4AL8L 1PSKL 2R1XA 4HKXA 4TULH 1Q0XH 2GTZB 3AMKA 2FHBA 3GM0A 2ATKB 3VXOB 3B43A 3U48A 2XA8H 2VLME 2K7QA 2ICWA 5E6ID 4QNPE 4GQPH 3GJFH 2PW2B 1A02N 3QDMD 3RVXC 1G1YA 4TTDC 3BIKB 4G5ZH 4P59L 3RWDB 4NKMA 4D9RD 3WHE1 4JE4B 4OFIA 3WEXA 1TENA 3TH2T 3ZT5A 3GHBH 4F7MA 3UYRL 4R9HA 5EZLB 2YPLD 3LPWA 1I3VA 5HDQL 1TLKA 1KC5L 3UZQA 5EU5B 3TO4D 3TC9A 5HYSA 4P5KA 4L3EB 9CGTA 1QTYT 4MVBC 3HPJB 1ZMYA 2YD1A 5IB5A 4JDZB 3BOVA 1M05A 3FO0H 5T1KB 5F44A 3PV6A 3DX6A 3CDGB 3KYKH 1LO0H 1X5KA 2EXYD 1JGEB 1HKLL 1MHCB 1KENH 4XP1H 4GSDH 3GGWB 1KN2L 4ORGB 1SY6L 4G6AC 4LQFL 1NMAL 5DGQA 3QH3B 2ZOKB 1T7WA 3L9RB 1T5WB 5KSAD 1XZ0A 5BW7A 5DRZA 3LN9A 5CEZH 3TP4A 2RR3A 2DQCL 2QSCL 3KPSD 4DKFL 2FX7L 5HGAA 4ZXBD 2GSIA 1FFNB 3QEHA 4JDVA 3MOQA 3THMH 1NCWH 1CLYH 1K3ZA 5GS1B 4X7CC 3WFEL 4UT9H 1UB6A 1B4RA 4PJFB 4UUJA 4YO0A 2RCSL 2ORBH 4X6BB 4ODXB 3HE7A 3WFCH 4AL8H 4WUUE 4F2MA 1JZ2A 5A2JH 4MLIA 3MV7E 2BDNL 2DQIL 2L0DA 5CS7A 1A1OB 4JO3H 4Y4KA 3ZL4L 1WFNA 2J12B 2NZ9C 3UTOA 2DIJA 4G6FD 4WTZA 1CGYA 1SM3L 4M6NL 3IDMA 4RAUA 4LLWB 2H8PB 4PRPE 4KFZC 4P59H 5TPWH 1R3IH 3MRJB 4M93C 3OAZH 4TSCH 2HTLC 1HQ4B 1KG0A 2OTPA 5D7JA 1LE5B 1F13A 4ZUUA 2MCPL 4DEPB 2IH1A 2LTQB 4NNYA 2ZUQB 3EYUL 3UYRH 4JR9H 1ZT4B 1A4JA 2C4FU 2DQFB 1ZLVH 2ZUUA 5HDQH 1T1XA 2WUCH 2NXZC 2JCCF 4PJDB 3NFSL 4P3DB 3O41A 1N5YH 2QQLH 1QHOA 5L8JB 4NDMA 4RMQA 1U8OA 2EXWD 3DV6A 3H9SD 4L5FL 1VPOL 4U1NA 4UBDC 5FM4A 3CFEA 5BV7B 3UTQA 5LKNA 1M71B 1P7KA 3QP3A 4BSWB 2D0FA 1BQSA 4JFZL 3QPQD 1CQYA 5C0EA 1IEAA 3SE4C 3WN5A 2J6EH 5JW3L 5SWSA 2J5LC 3OAYK 4XXCA 4JY5H 5C9JB 3L95B 2WQ8A 2D4DA 4NZUL 1IGYB 4U1SA 5IW1B 3L6FB 4XAKE 5C6WH 4R26H 2GHWB 3SJVB 3VI3E 3H0TB 3T0EA 1WUNT 5E2JA 4PRIA 3SDDC 1HQRB 4HWNA 3BESR 3MRCB 3ARPA 1FNLA 2C3VA 3QIUB 3MNVB 3T4YA 4PLOB 2QSCH 3C6LA 3PABB 4Z7VE 1ZLUH 4DOHE 4LHUA 3IYLW 1WWBX 3DBXA 5J6GA 1NC4A 2PCPB 2E7LC 3WFEH 5L7XL 4UMGA 5IJVA 4HUUB 5D7IE 4S1SL 3Q3GA 5CD3B 1W72A 3ZE0F 1U42A 4YX2L 2XZAH 2QL1A 5GIRB 1CZ8H 3DETC 4P5TA 5IROA 3UJTH 3NIFF 1R3JB 2BDNH 1V3JA 2DQIH 4OCXL 3EYVA 5IUSA 3L3IB 3ZL4H 3O4LB 1FVEA 4GBXD 4XNQA 1NGYB 1KXVC 3PGDB 4NQDB 4KUZL 3BN9D 2BY2A 3MNWB 4M6NH 3RY6A 4RCAA 4PB9H 1IC5L 5IV2A 5AWNL 3WJLC 2GITB 2HKHL 4NZRL 1U3ZA 2OJZH 5TH2B 2FBOJ 2Y36H 4X7TA 5ABDE 1FJ1A 3CFKB 4HDIA 4HS8H 2AABL 3FTGA 4CJ0A 4B7LA 3NFSH 5KG9B 1F11B 2XRAL 2H26B 1NFIA 3AMLA 2JJUA 1VPOH 4RGMC 4KGJA 5E6ZA 3RI5K 2BJMH 4PJ7E 3L3JA 5IMKB 4TRPL 3TYGL 1MFAL 5L6YL 3KGRA 4AEHH 3HR6A 3VD7A 1ZTXH 3WNNA 2AERT 4P4KB 1QKZL 1WLHA 2AV1A 2YKLL 5FM8A 5IB2A 5C71A 4RA0C 3VFRA 2GT9A 2IAMB 3DMMD 3CX5K 5LXGH 5T1DH 3U9PL 3PE9A 3V5HA 4MD0A 5FO8A 5B3JE 4MJ6B 2QKIA 4QWWC 4QHUB 4Y4KD 5HVGB 5F1SA 1AFVL 3X14B 3SDXF 2YRPA 2EECA 3HCVB 1U8PA 4MWFA 3DRQA 5HHOE 1MSPA 3KS0J 1MLBB 4HGKC 3QQ3B 5E56A 5CBEA 3ZE1E 1UACL 1FO0A 3TCLB 1AQDB 2NY3D 2OM5A 2YPVH 3LY6A 3ESUF 2DI8A 3Q5OA 4X7EC 3SE3C 3TBVA 2E9JA 3UPRB 3D0VA 1GGIH 5JORA 1ACYL 2IMNA 1N0XL 1OAUH 1IC4H 4S1SH 2GSGB 4UNTA 3F6IA 5I1KL 2Z0BA 3FQUB 3MZGB 4YX2H 2EDOA 5BRZA 5CJ5A 3QUXB 5F7MC 5L9DL 4WRLA 1FFOA 3WKMH 4HKJB 1CE6A 3NFNB 5BS0A 3N50A 2VDKH 2VLJB 5I18L 4R3SA 4QHLB 1MCPL 4OLYH 5TDOA 4LDLB 2DYPD 4NQUA 1JYNA 1SYVA 1HIML 3RBSA 3IETA 2YA0A 2NY4B 3FOLB 3UJIL 1F90L 4NZRH 2CDFB 1Q9KB 5HI4C 1NAMH 5SWSD 2AJYL 4PPTA 2EH8L 3NTCL 4M8VA 4XBPA 5ANME 3D3VA 3MJ7B 1II4E 2HKFL 1WAAE 3OB0H 1S7TB 1MHPL 3EJYD 3G04B 4QRPE 5DTFB 3QRGL 3T0ED 3IDJB 3W9DB 2E6JA 5EUKB 4PRID 1T89A 3SKUD 1Y6NR 5FUCE 1I75A 1WWWX 1ZVSB 2I9LB 3KYAA 4NN6C 3SKMA 3VFPA 3PDDA 2R69L 2NY1D 5JUEL 3TYGH 4Y5VA 4WWKB 5L6YH 2G9HB 4HJJL 3LN4A 4WFHE 1OTUD 4PUBL 4LFHG 4GS7C 3ZDYF 3TIDA 5F8QC 5IT2L 3D9AH 3OZ9L 4AK1A 1X4YA 4PV9B 4LCUB 1SJEA 5DJDB 5E6IB 2ITDB 3OXRA 3V7MA 5M94B 3MOBL 4JRXE 3S35H 3QCTL 4HG4J 3QDMB 5I8EA 2P43B 1HSBB 5KSBB 2BFVH 3DV4A 2GW5A 4HCRA 1BIHA 5MI0B 2FX8L 3C5SA 1A47A 4MCYB 5T5NF 1ORQA 3O3UN 3REWB 1KEGL 1UACH 5ENWA 4NKOB 1ACZA 4TUJA 3BWAA 2GI7A 3K4DA 1ZLWH 1AGEB 1TITA 3IXTA 5EPMB 3KYNB 1EHLL 2R2HB 4GUPB 3VXNA 4Q6IB 3TO4B 4WI6A 4MJIA 2VXSL 1N0XH 4JHWL 1H3TA 5DI8A 1RQ5A 4XCYB 3ZKXC 1IGCL 1T66C 1DFBL 1MLCA 1FG9C 4RAVB 1X7QB 2D0HA 1J7VR 2NTFA 4OI9A 5L9DH 2HJKA 4F9LA 1I7TB 3O3AA 2G60L 2MQ0A 5IF0B 4HG4K 1WIPA 3UP1A 3INUH 2VDLL 4I48A 2P24A 3LKOB 3T8XB 1AGFA 1HIMH 1Q9OA 1FFRA 3MRIB 1F90H 4YE4H 1SQ2N 3FFDA 2X4OA 1I1CA 4OQ1A 2F58L 4O51A 4PBXA 2HLAA 5KSAB 4WHCA 2X1PA 35C8H 5GSVA 5FKPB 3ILQD 4IJ3C 3KPSB 3HKFA 4OFYD 1IQDB 4L8BB 4ZXBB 1CFVL 3QRGH 4HHAB 2WP3T 1Z2KA 1N0LA 4MNGA 4LSVL 1GGBH 4X5WB 2R69H 3TFKD 4OT1L 5B4MD 2VN7A 2ARJA 2R2CA 3LSOA 1U8LB 5E0QA 2E3VA 1UENA 2LV4A 2VKWA 5EBGA 3K1KC 1ZHKA 1A2YA 5IT2H 2X4NA 3SO5A 2W0LA 4AEFA 3P73B 1CK0L 5I1EL 4KRPC 1LE9A 3IT8D 4JFPB 3FB8A 4A2LA 3UYPA 2Y9RT 5F7EH 5BRZD 4G6FB 1MCWM 3K2UL 5TE7L 1EBPA 5GGSA 1D5ZB 4Z8FL 1S7XA 3RA7H 2XY1A 5LQBH 4KXZH 1BLNB 4HUVA 3MYJA 3QIBA 4U33A 3A6OA 5LVEA 3JTSB 4XVJH 4M5YL 5DHXB 5FV2A 4GOSA 3NN8A 2X4UA 4L1HA 2FD6H 1Q9LB 4ZTPL 1M6OA 2ZOLA 2AXHA 4G8GE 1EHLH 2N7AA 1M4KA 4NRXA 2ZUVA 4W70A 2VXSH 4XB8A 4JHWH 3BMWA 3F58H 5LG1A 4JPVH 3H9SB 2ZG3A 4IOIA 3CFBA 3SOBL 5D1XC 1OAXL 5GRUH 1HHHB 3D3VD 4ZYKA 5DWUH 2XPGB 5D6CA 2BSSA 4FXKA 3WFDH 2X4TB 2ATPA 3OX8A 2J4WL 4CN4A 3VXRE 2C3GA 4XPBL 1JPFA 5I15L 2VDLH 4LMQE 2BVQA 4ZUVB 4HMEA 3NMEA 5E94A 2NX5A 5D9SA 4LPVA 3G5XB 1MHEB 4I18C 1ZHNB 1BVKA 4XNYL 3BIBX 1RAMA 3BKML 5IMOA 8FABA 5HGGS 2OZ4H 1PKQE 2ICWB 2H9GA 1KCVH 1UG9A 3HPLA 2XZCH 4F7TB 4EXPX 1I3RB 3RU8H 2JK5A 2XZZA 4PRPB 5CLWA 1XGQA 1CD1A 5IB4A 1M7XA 3IAQA 4NKMB 1JF1B 4PLNC 3WEXB 4P99A 1SVZA 4E0RB 4F7MB 1S9VB 4LL9A 4NUGL 1OTSD 4H5SB 3O2WL 4EZMA 2P1YA 1E28B 2BY3A 4JY4A 4GXVH 2NR6C 4GBXB 4FQHA 5EU6E 1P84J 1FVDA 1RZIA 5I2IB 1CF8L 4CVUA 1KTLA 1QBAA 3PWJB 3K2UH 5TE7H 5IB5B 3M45A 1V05A 4Z8FH 1KF9B 2AVGA 1UCBL 2MHAB 3P77A 3VXME 4F57H 4P2CG 2VLKE 4M5YH 1P69B 5I8OL 3U0TB 3IJYA 3LEXB 3GRWL 3W11D 3I3BA 5IB1B 4CDHA 2DTML 4UDUA 1MJUL 4PGEA 5KVFL 1TXKA 4XRCA 2QQNL 1UB5B 3GSNH 4J6RL 2AV7A 1J9CT 1RY7B 4JAMA 2P47B 1UA6L 2YN5A 3QUMH 1XZ0B 1OAXH 3ILPB 5AAWA 5DRZB 3VRJA 5GS0L 3LKPA 4EBQH 1G9MC 4MQ7A 4GAYA 3MJGX 4AMKL 3FQRA 4IIQC 1OP5K 1LO5A 4DOHB 4UU9A 3MRKA 4LCYA 5FUOH 2OR7A 4JDVB 4EI5D 4K3JL 2O5YL 5ISZA 2AJSH 4XPBH 1XF2B 2Y4SA 5I15H 5LGHL 3RIAK 5D7IB 3HE6C 4Z78B 3AC0A 3F8UB 3IKKA 3DMMB 3C6LC 5EZIL 3J7HA 4OZHE 1MJ7H 4JY6B 1QLEL 2OTUA 4MJ5A 4XNYH 5D2NA 4TNWF 4XPFL 2ICEA 3BKMH 2VR9A 3ZKND 4Y4KB 2FB4L 5EU6D 2AQ2A 3WKNA 4GAGL 1UEMA 5E70A 5EBWB 4I0KA 4MMZC 4KI5F 3IDMB 3WHXA 3B9EA 3DXAE 3HZYA 3VXMD 1FYTA 3RWGA 2VLKD 4KI5C 5GHWL 4OGZA 3MRNB 1A6WL 4EQ3A 4M00A 5CCKL 2IH1B 5IK3A 3KYOB 2D7NA 3IAPA 1A4JB 2VN4A 1QLFA 4AIXA 2A0LD 2ICES 1NUDA 1YQ2A 1T1XB 3EZ8A 3BDBA 4XX1E 3C8KA 3O41B 4OZGA 3IDUA 4CMHC 3JWDH 1U8OB 4OGYL 4YZFE 1G9EA 3UTQB 2IFFL 5LGJA 3HMXA 4LCCC 1P7KB 3L7FB 1DBML 2DYPB 1Q38A 3MXVH 4WI4A 4OCRH 4RDQF 1OAZL 1YECL 1WV7T 1J8HE 4EVNB 3RIFK 1RZJH 5I8OH 3FMGL 1I9RL 3WN5B 2X1XR 2OP4H 5AG8A 5SWSB 5C2UB 3QEUA 1Y0LB 5HJ3A 2DWEA 2DTMH 4U1SB 3VXSE 1NJ9B 5KVFH 1UWEL 3BP5A 4MNQE 5JOFB 1MQ8A 5SX4I 3T0EB 4P9HH 4PRIB 5DJ6A 4M7LL 2YA1A 3UBXB 1UA6H 2C3VB 3MGOA 2YUZA 4K7PL 5E03A 2IBBA 2ZSVB 3OKNB 3RL1A 2NY1B 3PWPA 3T4YB 4HULB 2GYSA 4OF3A 4LFHD 1MHHB 3DXAD 3C8DA 1WFUA 2H2SC 3DBXB 4Q9RH 3E6FB 2O5YH 2HWZL 5F3HA 3MLYH 1KT2B 4ZO8A 5LGHH 4YHIA 1HXMB 3ULSB 1OB1A 3Q3GB 4HWBL 1W72B 3TBWB 3LQZA 4U1KA 1WFOA 3WV0A 2BHYA 1QLEH 4HQQH 1JPTL 4XPFH 2AS5M 1N8ZB 3F5WB 1S7QA 5DLML 1OSPH 3DIFA 5DVLA 1S7WA 1T6WA 1T1WB 3TN0A 2FB4H 2YS4A 1QFWI 2R4RL 4XNQB 3UEZA 5F6IC 2DJUA 4B50A 3GDBA 4QRRA 3QG6A 4KJPC 3SDYL 1C5CH 5IV2B 3SGDH 1N5AA 3FT3A 3O3DA 1QA9B 4MQXD 3RWEA 5CCKH 1YEFL 2ZG2A 4ONGL 4X7TB 1OT2A 1IKFH 1G7PB 1YEKL 4M1DL 5F7DB 1RK1A 1U8IA 1OM3H 3BKCH 4MVBD 3IDYB 4HDIB 3FTGB 3VXSD 3V95A 4MNQD 4NUJA 3WNMA 4PJGA 4LVNB 5I66A 4I3SL 1T83C 1X6NA 3KVQA 4OGYH 1FZKB 1MAJA 4O58H 5EG6C 1I7UA 3L3JB 1V8HA 2IFFH 2OK0L 5IQ9A 1K85A 1N6UA 2AQ3A 4J3VA 2DKSA 4ZFOB 1ORSB 5DJ2A 4G6AD 5D7LE 1I9RH 2AV1B 4Y4HA 4WCYL 2ZUXA 2KH2B 1J1XH 1BD2A 5IB2B 1FDLL 3QXAA 3ETBF 1NLBL 3V0WL 3NCJL 3VFRB 3S97C 2GT9B 4X9IA 1P1ZB 1ETZB 4XVUC 1UWEH 4JRXB 2JJWA 3V5HB 5FO8B 3T65A 3UJJL 4C59B 4OCSH 4KGLA 2EKSB 1DBBH 2UY6A 1OGTB 1F00I 2E27L 1LHZA 4M7LH 1TZIA 5BV7L 5HYEA 3RP1A 3ES6A 5KVGL 2E7LA 4R4FH 4MWFB 4WFGE 4U49A 5F9OL 5CBEB 5CAYB 3E8UL 1DEDA 4YBQC 2GY7B 1CICC 1FYTD 5AAMA 3CVHA 4I0PA 1CR9L 3D0VB 3V4VH 1YMMA 4UI2A 1J0IA 1DQJB 5SWQA 2NZ9D 4GKZA 4LSSH 4WHYH 3GFUA 1OOAA 3KXFE 3UC0L 5BRZB 4J8RA 4GRLA 2AK4E 4O2EA 2BCKA 3QUYA 3WFHA 4JQIL 4MD4A 1CE6B 2CIIA 4LRIA 4NSKA 1PLGH 3MXWH 5J06A 1BREA 3VDAA 4W4NA 4POYA 3IGAA 1DTUA 1VACB 3VFMA 1SYVB 4U1HA 4K3EH 5F89A 4PBVC 2YPKA 2DMBA 4H88H 3IETB 1KACB 3ZE0E 5SV3A 5D7LD 4HZLB 4KMTH 3L5XH 1KB5A 4KC3B 3VFOA 5J12B 3GSWA 3MZTA 1DQLL 3MBEA 2X70B 4M1DH 2BVTA 1LILA 4R2GC 1D5BA 1T20B 1MAKA 3W0WA 3UTTE 3D3VB 5ADPH 1CQKA 5D1ZA 4HT1L 4ODHL 4JO2L 2YZ8A 1S8DB 4CU6A 1WWAX 4LAQL 4RMWA 1L9MA 3FFCE 1KELL 3QIWA 4TOYL 4I9WE 5IESL 2IPKB 1V7MH 1ZVHA 5EU3B 2V2XA 3AS2A 4LVOC 4Y5VB 2VABB 3T0VA 1PDKA 3BZFA 3LN4B 1E4KA 1DSFL 3GI9L 5C6TH 3TIDB 2IH3B 3JWOL 5ALBH 4Q2ZA 1QYGL 1BFVH 3SDDD 4ZFFA 1RIUL 4MA1C 2PN5A 1FBIL 3MODL 4LNRA 3V52H 1MFCL 1SJEB 4PRHE 4KVNL 3KXFD 4BSVA 1M7IA 4DZBB 4A6YB 3UJJH 4LEOB 1R0AL 4YR6A 2VL5A 2ICWI 3TN0D 3C5SB 3O0RL 2W59A 2R0KH 1DL7H 1A7BA 4QRRD 5FEBA 1A6TA 5SX5K 4TUJB 3CPLB 3EGSA 4G80B 1AR1C 4G8GB 3HLAB 2VWEC 4PY8I 5CZXD 5GRJL 2V2WA 4XVTL 3WD5L 4MAYA 4YQXL 2I60L 4OZIF 1QSFE 4J3OC 1MCLA 4OF6A 3OPZL 3UTTD 3UC0H 2Q87A 2NTFB 2QV2A 3SDXE 4CNIA 1DBKL 2HJKB 4JQIH 1S3KL 4TSBL 4PFEA 4WI3A 3FFCD 2BVPA 2EO1A 1YY9D 1FFQA 5GZOC 2BNQE 4OF7A 5IB3B 2P24B 5T1MA 4WUKH 3V4PL 4MHHI 4H26A 2GJ6E 1Q9OB 2B4CC 4PP1C 4UINL 3NPZB 2VR5A 3EOAA 5AUMB 1CXLA 4Y4HD 4M5ZL 1IEBB 4JGUA 1OP3K 4M9OA 1MY5A 3BQUC 1PKQB 2HLAB 3U7WL 3NBNA 2DQTL 3ZDXE 4QT5A 4JO2H 4KK6D 1RIVL 1KLUA 3U2SB 1GC1C 3V6FB 2FCBA 4EI5B 2J88L 3ARDB 2G2RA 3CFCL 4FMFA 1MCSA 2ENSA 4NT6A 1IL1B 3SO3C 2Z31A 4G43B 3RDTA 1FCCA 1PG7L 2BNRA 3LSOB 2A1WH 1QPXA 3OG4B 3EOBB 5FKAB 4RBPH 3JWOH 1ZHKB 1A2YB 1JWMB 4QWWD 2CK0H 5HHPB 4LDEB 2MWCA 3QQNA 1RIUH 5CWSA 5EU6B 5DEGB 3L5HA 1VADA 4O2FA 3TNNA 1I8LC 1H5BB 4GMSL 5DUBB 3BD5A 5I8CA 4K8RC 3KPNA 1R0AH 1A6PA 1H3XA 1CL7H 3VXMB 5DMGD 2VLKB 4LLAA 3ZHDA 3O0RH 4EOWH 3QFJE 3FL7A 5CJXA 2BNQD 3NN8B 4U6XA 2XQBH 3ZDYE 3WIFA 5C0IB 3PJSB 4I2XA 2GJZB 3SKOB 1O7SA 2YD7A 1JV5A 2IANE 3P0VL 4XVTH 4NRXB 3MA7A 1YYLL 1WTLA 1QFWL 4HBCL 1V7NH 4IOIB 4GW1A 4PG2A 1HEZB 2ZNWA 2COQA 5D6CB 4WW1B 3VMOA 3JTTB 2PXYA 4FXKB 3JV4B 3NCYP 3EDEA 2MKLC 3QIWD 1NSNL 1FE8L 4R97B 4H20L 5HI4D 4YXKL 1TDQA 4G8EB 3V4PH 4MAUL 4AH2B 4HBQA 4LKXB 1FH5L 4JFDE 3MRDA 3O6KL 4OZHB 1FL6B 1ZSDA 3IDXL 5F7UA 1EAPA 2EEBA 4M5ZH 3MRRA 2FJHA 1YNLL 2FO4A 4HKBA 2H9GB 3ZT7A 3U7WH 3HPLB 1H3PL 4IOSD 2DQTH 1U92A 5D7KD 5EOQH 1RIVH 4RFNB 3DXAB 2JK5B 1RZKC 3HNVL 1CDHA 1XGQB 2IMMA 1UCTA 3UBXI 5DDHA 5ETUA 3VRIB 3QWRA 3QFJD 2X42A 4PIRF 1IE5A 1AO7E 5GGRY 2ZUTA 1V3MA 1HH9A 4FNLH 4EDXB 5IEHA 2Z92A 4RMRA 2M2DA 4LF3A 4XTRC 3K8LA 5SX4H 4MAYD 2GUOA 2IG2L 4HZAA 3TH4T 5DGRA 4JY4B 4L8DA 1T21B 4ZUTA 3C60C 4FQHB 2PO6A 4PGZA 1FVDB 1RZIB 5CFHA 5ITFA 1VFAB 4YHPA 5IOPA 1MRFL 2CUHA 4GMSH 4JREC 1T4KB 3QHTC 4NFDA 1IBGH 3OKYA 1TCRA 1MREL 4MQSB 4NJAL 4X8XA 5FB8A 2Q7NA 1NGXA 3VH8A 3HRZB 1JNLL 1Z9LA 1UKTA 1A7OH 1T66D 5F9AC 1BBJA 3QXWA 4NHCH 2EYTA 3O2VH 1KBGL 3D87B 3VXSB 1ADQL 1GAFH 3P0VH 2JJTC 2KDGA 4MNQB 2HVJB 1YYLH 4UB0L 5C08E 3QYCA 4HBCH 4JAMB 5LAXA 3RHWF 2A9NH 3ZTJG 4KRMB 4RMTA 3SDAC 3VRJB 4R96A 3N85H 2I07A 1Z6JT 2EC8A 3U4EB 2C7UA 3FQRB 1LO5B 3AAZA 2GTWA 4LCYB 3C09C 4HC1L 1CLOH 1NSNH 2WWMD 1FE8H 2XKNA 5EOCJ 3WJJC 1T2QL 4QHKJ 4NQCE 5DUPH 4ZAKC 3RDTD 4H25B 3FO9A 5IKCB 3VW3L 4MAUH 3DROB 4X8JA 1WZLA 4X6DF 1FH5H 4QYOA 4V1DE 1KCLA 3IDXH 4XVSL 1OPGL 4U6VH 5D2NB 5GGTA 2ICEB 3T77A 1YNLH 4XT1C 4Z9KB 3X12A 1GYAA 3K3QA 3SHSA 4ODSH 2XG4A 2NY2C 2P45B 2F8OA 3HNVH 3HZYB 1KCRL 3RJDA 1FYTB 1WK0A 3RWGB 1FGVL 4N8CH 1JHLH 2WIMA 3C6SB 1KJ2B 2YSSA 1A6AA 1X5IA 1NGPL 1NGWB 4N1EA 5IK3B 1UZ6F 1MCIA 2AJ3B 4EIGB 1K8IB 3TA3A 1QLFB 1G6VK 5HVFB 1F6AB 4G42A 4M7LT 4S1QH 4X6EA 4JFYA 1VEOA 2I5YL 3C8KB 5TQ0H 4P23C 2IG2H 5IFAL 1NL0L 4M93B 4IRJC 1LWRA 2P8MB 5C08D 1EZVX 2VXVL 3EYOA 5C0DB 4D9LL 4LASL 4LGRB 4HKZA 4GMTL 3T04D 1CYGA 4PJGF 1RV6X 3ZLQC 2PXYD 4L9LA 1KULA 3L7EA 4MJ2A 5D7LB 1A3LL 2B7DT 4XC3H 4NQCD 3KNBB 1MI5E 4XP4H 4HWEL 2HP4A 1DANT 4XBGA 1RI8A 4V1DD 4ZOEA 1A1NA 1YY8A 3LRGA 2IJ0C 4Z0BL 3WMSA 4GW4A 5DK3A 1AGBA 5J11C 2A6JA 4ZS7L 4MJ4A 2IBZY 2ITCA 1F8TH 2VDOL 5I1JH 1N59A 3DX8A 2X4RA 5J1SC 1NBQA 1RIHL 5F3HB 4X6CA 3UO1H 1YEEH 2O5XL 4UTAH 1A7QL 1T2QH 5E95B 4XNUH 4YHIB 3SDDB 4XC1H 5CJ8A 3H42L 2R0WL 1OB1B 4HFUL 3VW3H 1J10A 5CJOH 8CGTA 3LQZB 4U1KB 3KXFB 2JB6A 3OL2A 4XVSH 5JIHA 2QJDA 1ZT1A 3BPNC 1I1FA 3NIDF 1QLRA 3D18A 2R0ZL 1AXSB 2K1MA 3NA4A 5IFHH 1S7WB 1FCGA 3TN0B 3T3MF 4PJHA 5FDWA 3UROR 2X9YA 3KR3H 2ZWLT 1OD9A 4QRRB 1ZKAA 3WL9B 1OW0C 1KCRH 1YJDC 1N5AB 3FT3B 3O3DB 3VA6A 3OJDA 5B3NA 5EN2A 3E6HA 1DE4A 4D3CL 4Y2DA 2NR6D 5IP4A 1HHGA 3MMEA 1RK1B 2GCYB 2B2XL 5JR1L 3P40A 1WBXA 5FXCH 3UTTB 4KQ4L 3H9YA 4R4BB 2BHZA 5ECJE 1DEEA 2UYLB 4FTVE 4JN1H 4NUJB 5IFAH 3EYQD 4UDTA 3MCLL 5JMOC 5T33H 4KI5E 4E41E 4EKXA 3FFCB 2LU3A 4FQIH 2HLFC 4F9PC 4RISL 5I19L 5GGQL 4YHOL 1NEZA 5CJBA 3ULVF 4OBRA 3KWWB 1GHFL 1MFDL 4X4YB 1MWAA 1AGDB 2WBJA 4CVXB 5D1ZC 4YXHL 1G6RB 1LNUA 1EBAA 3EUUA 5DJ2B 4M03A 3B3IA 1JTPA 4Y4HB 5D7SH 5E24E 4QXWA 3W2DH 3QXAB 2QR0A 4LMQI 4G8FA 4JM2C 5E4EC 4MXWL 4RGMB 3NCMA 1A7RL 3HMWH 4L4VE 4FQCH 1TVHA 4XPGL 2ZCKH 1EEQA 3EAKA 2DM3A 2BOBA 3ROOB 4A2MA 1QPPA 1EFXA 4XWGH 2X2YA 4AYFA 4YDLC 1BX2B 4NYLA 5ID1A 5JXEA 3VXUE 3QDJE 3UAJC 4XI5C 2IALB 5I74C 1HDMA 3HE6D 3U46B 2HT4D 2W9EL 4LU5H 3T1FA 2VDOH 3CVHB 4KPHL 1AD9A 4HUKB 1NLDH 1KTDA 5SWQB 4P0DA 2R0WH 1N2RA 5I0ZA 4XHQA 4GKZB 3TA3D 2YD3A 5IJKC 1S7RA 4EXKA 3BIAX 4J8RB 3SDXB 4O2EB 4FTVD 4OLXH 4NSKB 3MJ8B 1X5XA 1MF2L 3GMPA 4ZD3L 4C83A 1T0MB 4JFEA 1MVFA 2A6KA 3ZTNL 4KAQL 1U8QA 1INDL 3S98A 5F1IA 2BNQB 1JWSB 2W9DH 3IGAB 4EI6A 2A9MH 4GG8B 3VFMB 1OF2A 1J1PL 3FAXA 3WNLA 4WEBH 4DVRH 4NQED 5AZEH 1KSRA 1W72L 1KB5B 4KH2A 5C3TA 3VFOB 5ESAB 4FMKA 3GSWB 3HNSH 1VKXB 4CADB 3C5JB 2R2EB 4ENED 4L4VD 4ZO9A 5JR1H 1DVFD 5DJYA 4X7SL 4RX4D 4OD2A 3STLB 2JTDA 1IGTA 1SY6A 3C9NA 5E00A 4UQ2A 1Z9SA 2NY5C 4HAGA 1XGTB 3PHSA 3QIWB 4K3HA 5DJ8B 3VXUD 3I9GL 3NZ8A 4YHOH 4ISVA 1MCHA 3DX9A 2V2XB 5K9JH 5EO0A 5LGKA 3BZFB 2WQRA 1EEZA 3QULA 2M1KA 4RGNC 4Q2ZB 4JHAL 4M61B 5K9OA 2A6IA 2H45A 2QEJA 4PLKC 4ZFFB 2IGFL 4NZTL 1A7RH 4LNRB 4PGDA 4NN6B 4XPGH 4XMLL 2YZ1A 3S36L 4JZNA 1T0NB 1NDGB 2GKIA 2ZJSH 4M1CD 3ARTA 4OUUA 3V6ZB 2H2SD 4YR6B 3WXVL 4KTYA 2FEEI 2P5WA 2VL5B 4GS7B 2BXYA 3KHOA 5IBTL 3GO1H 1IFHL 2Q20A 2EH7H 1A6UL 3QFJB 3C8HA 4JO4H 3TM6A 1MEXL 1J0HA 1A6TB 4ZFOL 3J8F7 4CUCA 2BC4B 4G6MH 2GK0A 1S9XA 5CSBA 1KIPA 2HVKB 2V2WB 3KLAA 3AU1A 1RU9L 4MAYB 1OP3H 4Y2DD 5B8CC 4JFOA 4YLQT 3P9LB 4OI7A 1G9MH 4PJCE 4XP9L 4U2YA 5FYKL 4Y1AD 4G6KH 3MNZA 4JM4H 3S4SG 4IBLT 4QGYA 3WDHA 1MFNA 3QR2A 4LKCB 2VC2L 1QBLH 4MX7A 3FT4B 2BVPB 3V4UL 3ZTNH 1FO0L 1INDH 3DYPA 2A83A 4Y0GA 4M6ML 4PG2C 2ADIB 3NZHL 4H26B 4NOBA 4KKCC 1NFDE 3BZDA 4MCZA 4ZFGL 3OR6A 3EOAB 1X5JA 1DBJH 4R0LA 5F9JA 3WNPA 2AJXH 4EEEA 3RHWK 2OX5A 1AJ7L 3B83A 4LLDB 4KZDL 5C86A 4FXLA 4FP8L 5EFIA 3FHAA 4PJXB 4N68A 1NMCC 5D96C 2Z91B 3CFIC 5EORH 5J1AA 1EHNA 2X7LB 2G2RB 4NQXB 5JXED 1A21A 4X0KB 4NT6B 3D39E 5TE4L 1EO8L 3K80A 3RDTB 1RZGB 2VDQH 3U82B 3SCMA 1KCSH 4QF1A 3VFTB 1IAOA 3K81A 1F3JB 4XGZA 3PG2A 1T7XA 4K94L 5FYLD 4ZTOL 2JKXA 4NO3B 4WU7B 2FRGP 3QCVL 4KZEL 3TBTB 3SKNA 1VADB 1BWWA 4O2FB 4XMLH 4L8SA 3PNWA 5MEPB 3C2AL 3DUSB 4NO2B 5I8CB 4B53A 1CICD 3NA9L 2HH0L 5C0AE 3SDCC 4HEME 3BSZH 4CBPA 1PGRB 3WIFB 1ULVA 5CZVL 3GSUB 2UWEF 4GKNA 3HUJA 2JF1A 4AY0A 2VZ1A 1A9EA 2VISA 1RU9H 3STBA 4HUWA 2O61A 3MA7B 3I85A 5DVMA 1B0GA 5C08B 4XP9H 2DL2A 1T80A 1YN6A 5FYKH 1HCFX 5HGDB 4A6YL 5BMFH 1A5FH 3IFOA 1HOCA 4TPRH 1LEKA 5DD6B 4HCRL 4TTGA 3NGBB 4LSUH 1OD7A 1A8JH 1FN4A 2VWEE 5DEZA 4JPWL 5JPMB 4FFWC 3V4UH 1FO0H 3CUPB 1S78C 3A6BH 4K71C 3D39D 5IG7B 4NQCB 1U41A 1BQUA 1NCBH 1RJCA 2DQJL 3NZHH 3RGHA 3ECBB 4OZIE 4XAWL 4V1DB 1ZSDB 2CIKA 4ZFGH 3WIHH 5KJRL 5DHVB 4DWHA 3LKSB 2D4FA 4N0UE 2FO4B 3MRBA 1KGCE 3DHMA 3MRFA 1AJ7H 4KZDH 4O5LL 2W92A 1DDHA 2RFXB 3VI4F 5HYJE 5ALCL 1XR8B 5KSUA 1BJ1J 2P5WD 3BUTA 5ETUB 3BPOB 3X13B 3AXLB 4KRLB 3OKDA 3BH8B 4FOMA 3R06B 6CGTA 1UH3A 5AZ2H 3OAUL 1UWXH 1Q0YL 3F6LA 4D0CA 1HH9B 5IEHB 4F3FA 2H2PC 3MUJA 4YFEA 2Q3ZA 5C07A 5I30H 4K94H 4ZTOH 2B1AL 5F8RC 4ZUTB 1S7SB 5ESQA 4KZEH 1U3HA 1WICA 3O6FC 4YHPB 3LKRB 1F4HA 4MB4A 3Q6GH 5D2LF 4AJ0A 4JLRA 4G9FA 4JDTH 1K8DB 1CDCA 1AR1D 4PV8A 5BO1L 4HGWA 3MV11 1XF5A 1DLFH 3QUZA 1QSEA 3HC4L 5C0ND 3BE1L 1ZGLP 3S4SA 3WO4C 1BBJB 4CGTA 15C8H 4WV1C 3SKJH 2W91A 3HHRB 4LSQL 2EYTB 5CZVH 4L4TA 2ERJC 4L9LC 3GIZL 1U8NB 2JB5H 3B4NA 5DK2B 3EOTL 3O45A 4P46C 1KGCD 1J18A 1J5OH 2BK8A 5J4MA 2DQEH 32C2A 5HYJD 3CC5A 5C1MB 3QG7H 4UILH 1KJVB 4HCRH 3CGTA 2C7UB 3TNMB 4PP1D 4LRNL 1YC7A 3MO1A 4JPWH 4Z76B 1H15B 1OGAE 5BQ7A 3SE8L 4DW2L 1R5IA 3BRDA 3FO9B 1LEGA 1S7UA 3MRPA 4YHKL 3QQ9D 3SCMD 5F71A 5GJSL 1JFQL 3DX7B 1U58B 2D31B 5BXFA 3P4OA 3MLXH 4IIQB 5HHXL 3A6CH 3QEQE 3T77B 3TYFA 5AG9A 1A3RL 3ISWA 2LQRA 3BP4B 3BH9A 4XH2A 4KV5F 3HE6B 1A7PH 1EPFA 3VGAC 1KFAL 5DQDL 5E2VL 1GOFA 3WLBA 1F58H 3R4DA 1BBDL 4C56A 2XA3A 2YSSB 1A6AB 1UQSB 4DZ8A 4KK8C 1XIWC 3TA3B 1A4KA 1HSAA 4FQ1L 4PJ8A 4JFYB 4X6FA 1XCTA 3Q1SL 4FTVB 3GHEH 2FEEL 1T2XA 7FABH 2PR4H 4E41B 3FOMA 4GRMB 3EYOB 4HPYH 1FC2D 4PR5A 2H32B 1GJIA 3EHBD 5C0FB 4GFTB 5DRWA 4QRQA 3D0LA 2BOCA 1ODAA 1WZKA 2BNUB 4XZUA 2Z4QA 1N6QH 5BO1H 5F1NA 1RULL 3GM8A 2EZ0D 1I7ZB 4NQEB 2VAAB 4MLSA 4CMHB 4PJBA 4DGVL 4L8CB 1TCMA 4L4VB 1DVFB 4XBGB 1F4AA 3GIZH 2CSPA 3ZZ1A 4NQSA 3QQ4B 1AE6L 3QEQD 1QFWM 4NC2B 1T2JA 5BZWA 2G75A 25C8L 3W39A 4C58B 4JFHE 3VXUB 1LO2H 4NN7B 3GNMH 4F8TA 4X4XA 3TT3H 2ITCB 4RZCB 3CK0L 1EHAA 4P2QD 5GZNC 3PWNA 1DUZB 4X7DC 5D72H 2VDNH 1ZAGA 1U3YA 1VA9A 1N59B 4KMQA 3DX8B 1I1YA 2NXYC 2EDHA 1OAYL 3FN9A 3DVFA 4LSTL 3QBTB 2VL4A 4OGXH 3F7VB 3G5YA 2WLZA 5GJSH 5CILH 1FFPA 2J8UF 3CLEL 1ZT1B 4PP2A 2OCFD 1NCUA 1HH6A 3G9AB 4ZOCA 4OV5B 2FJGB 2PUQT 2DQGH 4FQLH 1H3UA 4E9LA 1LVEA 3E1F1 4PJHB 1TZGL 1U3HD 5ILTH 4OLZH 3M17A 4GO6B 3P4NA 4G9FD 1UYWL 5E2VH 4XPTH 4Z7QF 4LVHB 2EDFA 5DC9B 4XTRD 1QSED 4Y16C 3OJDB 5EN2B 1OVZA 3E6HB 4X6DE 5DHYA 2F53E 3R8BB 4Y2DB 4UT6L 2W65B 2CLZA 1EAJA 5DD5H 1HHGB 4X9FA 5IMMA 1BFOA 4Y1AB 4FQ1H 4JZJA 4H1LB 2C3WA 1GZQA 2Z93A 1UWGL 1DEEB 2IWGA 4HJ0D 2Z8SA 2XTLA 3FCTA 2W0KA 1V5JA 3BGAA 4G8IA 4UDTB 1ZWIA 2V9RA 2VDRL 3WLWC 5C8JA 4JFHD 3ORJA 4WU5B 4Q6YA 3JZ7A 1HHJA 3KJ6L 1FRGL 2Y25A 1I9JH 3S96A 2XACC 1R24B 1LNUB 4PJAA 3GKZA 1YZZA 3T3PF 1W0WA 1YDPA 4HIJA 1VSCA 2QR0B 2LVEA 4G8FB 2V5YA 1JZ7A 1TVHB 3SDAD 5IGXL 4WTWA 5E2WH 4TNVK 5CSZB 3PHQB 3SGEI 4QGTA 5HPOA 4D0BB 1CGSH 2ARJQ 1QOKA 5DUML 5FM5O 5JA9A 4N8VB 4O2CA 3ROLA 5FGCE 2LU7A 4NYLB 1UC6A 1KPUA 2W38A 4ZAKD 3PWUB 1B9ZA 1YA5A 1P4BL 1FYHB 4ALAL 3PDGA 1WZMA 1IC7H 5KS9B 1HN1A 4QRUA 3HG1E 5MEQB 1BF8A 3AB0C 2F53D 1NCDL 5BCAA 4LDOB 3GIVA 1Q1JL 2ADFL 4PJCB 1FHGA 3O2DH 4N0YL 5ACLA 4PJ8D 5CEXA 1XH3B 4RMVA 2NY2D 5T3XD 1FGNL 1CICB 1E6JL 3GMQB 1X5LA 3ALXA 1MELA 1OHQA 4ERSL 1PYWB 1UXSB 2Y72A 4YPGA 2D7OA 3NH7H 4EI6B 5IIEA 2DJSA 1CD0A 1UYWH 3RVTD 1OF2B 1TJGL 3OHXA 2IPUK 1NFDB 3K8KA 1P53A 3MV8A 3QXUA 3H8NA 2VZTA 5I1HL 3IJSA 3L5WA 4LLVB 2IPUG 43C9B 3RKDC 5CBAA 1LMKA 5SWZE 3B6SA 1KB9J 1MCEA 3T3ME 5EUOF 4OD2B 4GXUN 3C9NB 4UQ2B 2R15A 5H35B 2E6PA 3QJFA 5ACZA 1Z9MA 1X5FA 3D39B 3DX9B 1WTGT 4FG6C 3K4AA 4Z7UA 5EO0B 3P9MA 3QULB 1EEZB 3HG1D 3B8SA 1XGYH 3MLZL 5I6XC 2BXZA 4FHBD 2YA2A 3IS0X 4U0RC 2Z8RA 3BT2H 4HLJA 2VQTA 4PGDB 3MRMA 4UAOC 5EZOL 4WY7L 3B8YA 5IGXH 2UV3A 3U0PB 4NC0B 3IDGA 5D5MF 3BDYL 2GK2A 2R56L 5DUMH 2NY0C 1LGVA 4P2OC 1KB9K 4YNYB 4BM7A 1CG9B 1SYSA 1WT5A 3HMXH 3ARUA 4R4NC 4MA1B 3SBWA 5JIPA 3I75A 4K9EL 4ALAH 5HHNA 4Y19A 5IVXE 2E8YA 4LARL 3CCHA 3RX8A 1U8HA 4F7CA 1FVCB 4GRWE 4OLWH 4KK5D 3VMPA 1HI6A 4HWUA 1GXEA 5IBLC 3QNYA 1KTKE 3DO3A 2C4XA 2YK1L 3HUJF 5SWZD 3ULUL 2GTZA 3VXOA 3FKUS 2QLVB 2W60A 2LE9A 3WXWH 5HBBA 4OQTH 5GXBB 1N6VA 2WUBL 2PW2A 3M8OL 5CIPB 2CQVA 5JQ6L 1LP9F 4JFXA 1LK3H 3RWDA 4ZOAA 1G84A 4KHTH 3CVHL 1EUUA 4Y5YC 3GSVA 1FAIL 1LEIB 3LH2H 3OR6B 4OZFH 2CRYA 1VENA 4R0LB 5F9JB 5EZLA 4HV8B 5CGYC 4ODVH 4F8QA 5EU5A 3DURB 5IVZA 3HNTH 5EB9A 5HYJB 4M7ZC 2P8LB 4RNRB 3U6RA 3TBYB 3NIGE 4OIAA 4L3EA 3S7GA 5ESVB 5J1AB 4NWUH 3ZKMC 2H41A 3HPJA 3GJFK 4JM2D 4OM1L 1BAFL 5H8DA 4JDZA 5EIIB 2CD0A 5B39G 5T1KA 2ZNXA 3O6LL 4QF1B 5DT1L 3SCMB 1IAOB 5TFSL 3CDGA 2C9AA 1KB5L 3MLZH 4WGWB 4XGZB 1YEDA 1DANU 4KTDL 4PD4J 4QRTA 4AQ1B 4IOFC 1JGEA 1MHCA 5GRZA 1ERNA 3RZCA 3G08B 4L8SB 3SO3B 3PNWB 1KV3A 3QH3A 4S1RH 2V5SA 2KQNA 2R56H 2ADJB 2ZOKA 3B2UD 4OZ4B 5HVHB 5K59F 3BEVB 4CN1A 1ED3A 3RWIB 4RGNE 2DDQH 3VGBA 3MROA 5EULV 5I17A 2DBJA 3UTPE 3QXVA 1FFNA 4U4BA 4LOUC 4RMUA 5I8KH 3TESA 4NM8L 4LARH 1A9EB 3K46A 2QHLA 2VISB 3MV8D 3QUZC 3GBML 4PJFA 4X6BA 1KEMH 3B9KC 4PJIE 4OCWL 5IHLB 1UJ3C 2DL9A 3GK8L 4DAGL 3ULUH 3BJ91 1GCFA 3C5ZC 3MA9L 2B39A 2R2BA 1LEKB 3IFOB 2HA1A 1A1OA 1FN4B 4PBWD 3G6JF 3OTTA 4FRWA 4PYGA 5BVJA 1ZK9A 4LLWA 2H8PA 2GAZA 5JMRA 1IC1A 2RJMA 1LE5A 3SE9H 4QRSA 4JQVA 3JWNC 3QWOB 5BOPA 5DQJB 4KJYB 4QHMB 3NPSC 3QEQB 5FV1L 3KPRE 4BUHA 5I75C 2DQFA 1YEHH 4R90L 3EDFA 4PJDA 1YJDH 2VDML 1R3KA 2VXTL 5H94B 4B0MM 3GI8L 4UQ3B 5KSUB 3RAJL 4P2QB 3K74B 3ARBC 5EWIH 1JRHI 1K4CB 3LZFL 3HAEB 3HZKB 1WBYB 1FLRH 2ILLA 1NCTA 3BKJL 4OJFL 4RGND 3MV9E 3L3HB 1M71A 3RVUC 5D70H 7CGTA 2AJUL 4BSWA 4U31A 4WO4C 2ZCLH 3O9WC 2X40A 4Y19D 3OAZK 5JIIA 5CKGA 4F3FB 3DUHA 5E8DL 2PF6A 3S34H 1R3HB 5K9KB 3RY5A 5ADOH 3LS4L 1TQCC 2R8SL 1IGYA 5IBUG 2B0SL 3ULVH 5HHMD 1U3HB 1ZLVK 3TF7C 3L6FA 4P3CH 1MQKL 4XNXH