3H42L

Crystal structure of pcsk9 in complex with fab from ldlr competitive antibody
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
ESVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLISGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGSVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title From the Cover: A proprotein convertase subtilisin/kexin type 9 neutralizing antibody reduces serum cholesterol in mice and nonhuman primates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 47
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2009-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h42L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h42L01
3L95A 2JJSA 4LRNL 4PJHB 5BRZE 3QXVA 2PXYA 5I8CA 2QR0A 2KH2B 2DJSA 3L9RB 1A4KA 4K3DL 5D7LB 3EJJX 4LLVA 3WNNA 4P4KC 2XIDA 3LN5B 1DUYB 2VDLL 3GMOA 5J3HC 2F8VA 3Q5YA 3LEXB 3RL2A 5IHBA 1NMAH 2XWJB 5GGVH 5IB1B 4MD4B 5HHME 3DUHA 5DJDA 4NP4L 1U8LB 4MNGA 1U3HB 2DQIH 3TBYA 4QRRB 5I1IL 2CGRL 4UBDD 3C87A 5K59F 3RJQB 1DR9A 4LPCA 3HZKB 3KPLB 3U7AA 3F7VA 3LQZB 3FO0L 2PW2A 3HE7B 3VE0A 4LCIL 5CZKA 5DTFB 4C58B 2W0FA 4DN3L 3ALWA 3THML 2X4OB 4B5EA 4FQLL 3IDGB 4E42B 2CLRB 2AI0L 4EKXA 1RZJL 1FO0H 2CIKA 3QNXA 3HB3C 3A6BH 3UZEA 4DTGL 4C83B 5E8OA 5DMKB 2IQAA 4PB0H 1R5IB 1A6WL 4ZSOB 3QEUA 3ROOB 5JXAL 2B4CH 1DQML 5JOEA 1I4FB 5F96H 2DMKA 5T1KA 4OV5A 3FRPG 2XQBL 3DXAE 4GG6B 2ZOKA 2XG4A 1UGNA 5IROA 4HUXA 3SDDA 4XB7A 2F58L 4KKCC 4I18B 2YUXA 2B0SL 1I9JH 1XR9B 4ZAKC 2IBZX 1W72B 5E2WH 1A9EA 3MACL 4JB9H 4I13B 1N6VA 1N6QL 4PJ8A 4DK3A 4KMLB 4LVHC 1SYVB 2Z8RA 3L1OH 1T03L 1AY1L 4LSPH 1T89A 4RNRB 5D93B 1YY8A 3RPIB 2QHLA 4I3SH 3UEZA 3VXUD 3S35X 3MJ8B 3IGAA 1Q1JL 3PNWA 5KSAD 1A8JH 4YHIA 3MRKA 3SCMA 1DUZB 4OCYL 3BVNA 1S7WB 4OD1H 5D1XC 4H8WL 1OVZA 5D7IE 3VXOA 5C0RH 4KMTL 6FABH 5MHSD 3MRFA 2R56L 4WNQA 2Q20A 2V5TA 1ES0A 2V17H 2DYPD 5I1EL 4CADB 4R2GD 3R06A 2OK0H 1DQLL 1W8NA 4FZ8H 2H32H 2J12B 4DZBA 2YA1A 4ZUUA 2DLHA 2DQGL 3DUSB 4JVWA 5HVHC 2CDGB 1QA9A 4WW2C 4OLVH 2SEBA 4XNYL 2ZJSH 2AEQH 4Y5YB 2F74B 4U6VL 1IAIH 1I9IH 2AXGB 4ZOBA 4M43H 2VDRH 2C4XA 3WIFB 4I2XB 2NXZB 1YC7A 1R5VB 3CC5A 3MXWL 3BGMA 3SE3A 1MQ8A 1MWAL 4OZIE 3KPOA 4KDTC 2J8UF 1JNHA 2CR6A 1KJ3L 5I6XB 3PWPD 3P40A 2X4TA 4L9DA 3MA7B 3HS0B 3CFDB 5SWQB 1ZSDA 5MEPB 4YWGH 4FA8A 5IVZA 4GFTB 4MHHI 4IIQC 2JJWA 1B4RA 1I9EA 2ZUSA 5FOBB 5C0FB 4PJIB 4YBQD 1FP5A 2YK1L 4OD3L 5DDHA 3VG0H 4DUVA 1OAUL 1I1AD 2E5EA 1J86A 2A83B 4L3EE 5A1AA 5IFHH 5K9JL 2I07A 4XMLH 4CN1A 1PLGL 5EIIB 5C0BA 1AP2B 4EDWL 1UM5H 4IRJC 1I1YA 4LDEB 4FNLL 1EXUA 3VXTB 2HH0H 4L5FL 2HT3D 1D6EA 4HS8H 3DUUB 4YZFF 4BFBD 3FO9B 1JRHI 5F7YC 4JFPB 2Z31D 1XGYL 3OR6B 1I7UA 4HIEB 4NQSA 4HQQL 4N0FA 3DX9A 4HCRA 2NR6D 4D0BB 3O3EA 2GCYA 4OZHF 2IAMC 1JGUH 3DLQR 1I1FB 4B0MM 5D6CB 3IS0X 1BVLA 3V7MA 3PWJB 4WUUA 4F3FB 3N50A 5EG6C 1UH2A 2O5ZH 5T3ZE 3NIFF 2ZUYA 2CJUL 4P3DA 2MQ3A 4G5ZL 5I66B 2DL2A 3MRQB 5JIHA 3CDFA 4NNPL 4OQTH 4E41E 5D2LB 3ARGD 1NMBH 4M7KH 3M1BA 4LAQL 3L3DA 5C7XL 3IU4H 2V7NA 1MFDH 1JZ7A 2FBJL 3QNYA 1IBGL 2VR5A 5MERA 4BFGA 4EVNB 4RGND 5IR1B 3BKJH 3F5WA 2Q6WB 2WWKO 1FNEB 1F4HA 5DK3A 5T1DL 1N7MH 4WDIB 1VHPA 1H3VA 2VMFA 5EZIH 3WXWH 4G43B 4L3CB 4NCDA 5D7JD 3MRJA 5F9OH 1LEKB 2ZSWA 5I76A 3ZSSA 5HHXH 1IKNC 1KB5B 4ODSH 3X3GL 2HJLA 5DQDL 5DO2D 1D5IH 4RISH 1FZKB 4ZG1A 3LRGA 2P49B 3OG6B 4ZFFA 4KUCD 3MUHL 3TCXA 3FFCD 1U8IB 3VXUB 4UDUA 5LXGH 1H8SA 3IU3A 1NC2D 4UT7L 1DP0A 1TVHA 1MVUB 4UAOC 2X4NB 2NNAB 4TSBH 5FHBH 1A1OA 2BNUA 3EYFA 5I9QB 1JPST 3QUZA 3C60D 4N0UA 3QBTB 3VCLB 2PO6D 4KFZC 3U1SL 3PWNA 5IQ7L 4O4YH 2DYPB 1CE1H 4OIIL 4MAYD 1K8IA 4Q6IC 5JORB 3KS0J 3J8F7 2YSSA 2VDQL 5C86A 2N1KA 4YUEH 4HCRL 4LLYB 3KYNA 3WJLA 1BBJA 1ZOXA 1KELL 3WFEL 4LSQH 1KN4L 4XXCA 5H37G 5HHOD 1CFSB 5CIPA 1F90H 1AGFB 1WFUA 3AFLA 4PJ9D 5IP4A 4HIJA 5C07D 4MCZA 4MQXC 3RUGB 4KUZL 3MRLA 3TJHD 4N8VB 1RMFL 4FXKB 1H8NA 2W9DH 5J13C 4HS6B 4KVCL 3PWPB 3PQYA 2CQVA 1TJHL 4QHMB 4GJTB 4ZDHB 1T7YA 4J6RL 1K4CB 3EOTH 4PY7B 3TZVC 3FB8B 1G7PA 2VLKD 1FDLH 4CMMB 5D7KE 2OP4H 1CF8H 5D1QA 3BZDA 4XCCH 1LK3H 4MXVE 3QFDA 5GHWL 3STZA 3T77A 5AD0B 1YN7A 3SDCD 3TEUA 4KJYA 2JCCE 3NH7L 3MRPB 1KBGH 2X7LA 2NW3B 3FRUB 2GTWA 5FDWB 3VFSA 5D7IF 3VI3E 5I71C 1W0VA 4UNUA 5C0AE 3FRPA 5IW6B 1MLCB 4PTTA 3AUVA 1KG0A 5EOCH 4JDVB 1OOAA 4JO1L 4G8EB 4WI9A 2A77H 2CUIA 2ARWA 2OSLB 3UTOA 4PJHA 3LY6A 5AEAA 4XP6L 4K9EL 2OM5A 3WUWB 4N5ED 4HPOH 1RU9H 1E28B 1TTFA 2QADD 3L9RA 4LVOB 3ECBB 2FB4L 3ZE0E 3BGFC 4X7EC 3GSVB 4XBPB 5MI0B 3LN5A 4G3YL 5B3NA 1I3GL 1UKSA 2VXQL 1S7XA 3CFIC 5SX5H 4EI5D 1O7SA 1FAKT 1ORQB 3MLYH 4OZIF 1UXWB 4YC2C 4FP8L 4UIKH 3C5JB 2H2SC 2ZCKL 3AS1A 5DEGB 2XWJA 3U82B 5EO0B 3T0DA 1TZIB 1BQHB 5IB1A 4JHWL 3O11A 4MD4A 1U8LA 1KC5H 1U3HA 4QRRA 3PP3K 4OI8A 4JHBA 4P2YA 3ARGB 3ULVE 4N8VG 3HZKA 2Q86A 3MPCA 3KPLA 5L8KB 5T5FL 3LQZA 3MLZH 3LD8B 4RGNB 3FOLB 5DTFA 3H9HB 4M1GL 3A6OA 3N06B 3REVB 2X4OA 1L6ZA 4WHYG 3IDGA 4E42A 4RAUB 4PD4J 4PJBE 4ONGL 4G7VH 5D7JB 5I16A 5GRJH 5GGTH 3MCKB 4ORZC 1D5MA 4DOHE 3QQ3A 4C83A 4JZJA 2KUTA 2HFGL 5DRWB 2X05A 1ZS8B 4NSKB 5JZ7D 1R5IA 3LN9A 1A1NB 1NL0H 4ZSOA 3HNSL 3ROOA 4L3AA 2ZG2A 3CLEL 3QIBA 5IG7B 2VKWA 1I4FA 4HWNA 3IJSB 5GRZA 5JPNB 4HUNB 3N0PB 1CIDA 5JW4Q 1OT2A 4GG6A 3SGKA 3D69B 3FFCB 4F15C 1H15A 4L4VE 4N8PA 5BQ7B 2HJKB 3KPSE 4KJPC 5SWSD 1NC2B 2C4FT 4ODHL 4R4FH 1XF2B 4X0KB 5JUEL 4I18A 1Z3GL 1XR9A 5EBLB 3TCLB 1HYSD 1W72A 3KYKL 3AY4A 3EW3B 4R97C 3MZTA 3I3DA 5ISZE 1CLYL 2APFA 3C60B 3GMQB 2PO6B 1SYVA 5CMAA 3WUWG 3TC9A 3GJEB 4O9HH 4RNRA 2W9EL 3RPIA 1UM4L 4IOSD 4MAYB 4Y5VC 2W92A 3MJ8A 1UWEH 2YEZB 2HA1A 4HJJL 4DGYL 4N0CC 3GMPB 5ECJE 3V5KB 2FJHB 3K8KA 1V05A 1DUZA 4YHMH 5E99L 2QLVB 1S7WA 4DEPB 5TE4H 3V95A 1AH1A 1RPQA 4ZFGL 5HHOB 2MSPA 4QOKE 1JMXA 3MJ6A 1NC4D 4PJ9B 4F57L 5C07B 1VKXA 2VABB 2I60H 5CCKH 3QG7H 1PFCA 3P2TA 1LO3L 1UQSB 5L88H 3DUSA 3D39A 2R1YB 2KZWA 1NBZB 3OTTA 2HKHL 5FUZH 4Y5YA 3MA9L 1NGYB 4S10A 5TJWK 3WL9B 1UYWL 3O6LL 2AXGA 2R4RL 2VLKB 1C1EH 4KHXL 2D9CA 3WIFA 4I2XA 2DLFL 1P5UA 2VDNL 1TZHB 1MCRA 2VLME 5BO1L 3SDCB 1EIBA 2EE9A 3F7RA 4PGBB 2WUCH 4UT9H 1CGYA 4YGVA 3MA7A 3VRJB 3HS0A 3CFDA 5SWQA 1XIWC 5FKAB 3GMMB 3BDXA 1YMMA 5FF6B 5FXCH 4DVRL 2L4OA 1IAII 5KANI 1OAXH 1QFPA 2CPCA 2EYRA 1NUFA 4JREC 5JDSB 1BGXL 3SHSA 1MHEB 5FOBA 5C0FA 3KPPB 4PJIA 2F53D 1F4AA 3PGFL 4KROD 5KVFH 1HHHA 1MLBB 4HIXH 2A83A 3OF6D 3MROB 3AROA 5IGXH 2Y5EA 2QADB 1W72L 35C8H 5KAQF 2BY3A 2ZG3A 2W07A 4HSQA 1ED3B 1AP2A 4OJFL 3TN0D 4PGEB 4K8RC 1IGMH 3CUPA 4JHAH 4NUGH 1F6FB 3VXTA 4M7LT 1NFDB 2XWBB 2VH5H 1OTTD 1FSKB 2VLRD 4X7SH 1IVLA 4PREB 4JFPA 3MLUH 1KGCE 3OR6A 2FGWH 4HIEA 4ZO7A 4E0RB 3T04D 1HINL 3SDAC 3Q48A 4XPTH 4KAQH 5IWLC 4P2RE 5F72S 1N5YH 5CZXC 4MXVF 3MNWA 1E6JL 1DFBL 5D6CA 4HIIA 5KVEL 3PWJA 4F3FA 3BGAA 3DX6B 1YZZA 2JCCF 3PL6C 5F7LB 4Y8AA 5I66A 4MNQD 1YYML 2MPAH 3SGEH 1K5NB 3NZHH 3MRQA 5I2IA 5TF1L 3AREB 2JE8A 3C8DA 3BAEL 3VI3F 4PTUB 4N68A 3GK8L 3TM6A 2X70A 4AG4L 2CKBH 5D2LA 3EKCA 3DGCR 4OLWL 1DZBA 2GJ6A 2YRPA 4EVNA 4RFEB 1OWWA 1P9MA 2BRRL 5LQBL 5IR1A 4WUKL 5J11C 1CD9B 1VFAB 2Q6WA 5JOPE 1FNEA 3VH8A 2WWMC 5DT1L 5ESVB 1L7IL 4JCLA 1ADQH 4G43A 2ED7A 4L3CA 5SWSB 3ZE0F 4TSCL 1LEKA 4MNGE 5IIEB 5GZOC 4NQCD 1KB5A 5D9SA 3EO9H 1FZKA 1VFOA 1HEZB 2UZXB 5DYOB 2IH1B 1IGYB 4GKSB 4S2SB 3SKNB 2P5EB 3LEVH 4KK6C 3QXDA 1U8IA 2GYSA 1I3RB 5LJYH 5ITFB 4OI7A 1MVUA 4ZO8A 3NIGF 2X4NA 3ULVF 2NNAA 5CD5D 3EDEA 4ELKB 2QSVA 3Q1SH 3P0VH 3VCLA 1BVZA 2NY5L 2NY7L 5I30H 1DQTA 2KPNA 5I73C 2DYPA 5E8NA 3TLRA 2P1YA 4PRDB 1BLNB 4NHCH 3BD5A 2MKWA 2DM7A 5JORA 4Y89A 4J3SA 3LZFL 4PJBF 3TYGH 4RWHA 4C57C 2WM0A 3ORJA 1A7PL 4AEHH 1JYWA 4FMFA 4LLYA 3FONB 4QEGA 3W0WD 4LK4A 3QXUA 4R90L 2G60H 4DZ8B 5I1GH 3O2DA 2VC2L 3RUGA 3WHXB 4X5XB 4N8VA 3T09A 2VJXA 4FXKA 3U79A 4HS6A 5L2JB 4ZTPL 3PWPA 2CO7B 4QHMA 2EE6A 3PABB 4ZDHA 4KC3B 1PG7X 1S78D 3CDCA 4PY7A 3FB8A 3MRIB 5L7XL 3VGHA 2HT4C 4CMMA 3MLPA 4DKFH 4YE4H 4LU5L 3F12A 5AD0A 4EIGB 4KXZH 4X7TA 5C0CD 4QNPE 4KROB 1QHPA 1AQKH 4HC1L 2JJSC 1OQXA 4QY8B 2NW3A 3FRUA 4LVNB 4XPAH 3WIHA 5FDWA 5TFSH 2WBKA 3C9NA 3GBNL 2I24N 4YHOH 5DWUH 4L8SB 5IW6A 3FO2B 3CZJA 1KB5L 2I9LB 1U3ZA 3H3KA 3NABL 4ODUA 1NLBL 1T3FB 4LCWD 4JDVA 1QNZL 4N90E 3TN0B 1Y18B 5T3ZH 4G8EA 4KWUA 5GGSB 4YHYB 1AFVH 4X6BB 2OSLA 3GIVA 4XT1C 4AIZB 2VLRB 4FOMA 1EO5A 4N1CA 2HFFB 3WUWA 4LLAA 1K8DB 4FFYL 3O2WL 3BD3A 3JZ7A 3ZZ1A 2BSED 1QD0A 4XBPA 3GSVA 3QUYD 4H0GA 5DC0A 5AG8A 5C3LD 3QQ9D 3VFWB 8FABB 5TQ0H 1ORQA 3PHOB 1UXWA 1YEDB 1YECH 3LKRB 3C5JA 1U8QB 2AV7A 1M05A 4EJ1C 3ZDZE 2R0KL 5DEGA 1GGBL 4MNQB 4I9WD 5EO0A 1EEQA 1TZIA 1I7TB 1BEYH 1BQHA 4K7PX 1YEJL 4KPHH 5GS1C 2BSSB 3H8NA 2H3NA 3ARGA 2BSTA 1CQYA 3CCHA 1CGSH 5GS2H 3B9VA 12E8L 4JJ5A 5C0BE 3ZTNH 5EPMB 1C08B 4LRIC 1U2CA 4JZOA 3FOLA 3H9HA 1FRGL 3VI4E 4HWBH 1HKLH 5JW4R 5IROC 5JMRA 3OHXB 5DLML 2D03L 3MCKA 2VN4A 4HKZB 3QUXC 2FX7L 4WGWB 1U91B 3ARVA 5DRWA 2P42B 2YN5A 4NSKA 5DURD 1A1NA 1RQ5A 3O3AB 5CGMA 2ILLA 1U8JB 5F9AC 5ADOH 5IMKB 2B1AL 3OBAA 4M1DH 1PBYA 5DEZA 5IG7A 2OLDA 4WUUE 3IJSA 5JPNA 1TJIL 3QWRD 4IMKA 3D69A 4GRMB 3WIHL 3FFCA 1GIGH 3DVIA 3U9PL 5BQ7A 2HJKA 1NC2A 5ETUB 2JKXA 1XF2A 4X0KA 4JPVL 2DD8H 1MJ7L 3TCLA 5EBLA 4KZDL 4U0RC 3Q6GH 4MA1B 1JGLH 2VTFA 2KDGA 2VOTA 4GS7C 1RUPH 4H88H 1BF2A 2Q7YA 1MFBL 3C60A 1SQ2N 3GMQA 1I3VA 3MXVL 4YHPB 2AEWA 2PO6A 5C09A 4AENB 5JW5B 1MIEH 5D1ZA 3VDCA 4NN5C 2HG5B 3L5XH 4P9MH 2AABH 4MAYA 2YEZA 1AO7D 1ZANH 3GMPA 1J05B 3V5KA 5ELIA 2G5RA 3U30B 3WMSA 3T2OA 3PP3H 5GRWA 4QLRA 5HHOA 2Z4QB 3W0WB 3WHE1 5EBGA 5T3XD 4Z95H 4PJ9A 5C07A 2A6KA 3SDYH 5GGSY 3SE3C 2J88L 1UQSA 3TNMB 2BVUA 3HAEH 1NGPH 2CRIA 4KDWA 2DQTL 1FL3B 4J12A 2EZ0C 4KI5C 2R1YA 1NBZA 1WQVT 3MO1B 2D4DA 4LGSB 5KOMC 2FX9H 1NGYA 1QTYT 3WL9A 2XZZA 1JPFA 4X5WB 4H5SB 4I8DA 3DX7B 4MYWB 4GOSA 2E8ZA 2VQTA 5C0JB 1IC5H 3CIQA 1TZHA 3RFZC 3AB0C 3SDCA 3HFMH 2W9LA 5C0CB 3BH9B 2R0LH 4PGBA 1EHNA 3VRJA 1EHLH 2JJTC 1TNMA 3PIQA 3MX0A 5FKAA 2IFGA 3GMMA 5FF6A 1JZ8A 3JWDC 5JDSA 1B6DA 3MCLL 2QBWA 5C6TL 1MHEA 3D25B 4IDLA 3SY0B 3KPPA 1CDBA 3MRHA 2H26B 3MGTA 2FEEI 1OP9A 1MLBA 3AS0A 3U83A 2AJSL 4ZS7H 1J7VR 3M17B 1T1YB 3U7YH 3MROA 4RQQB 1FL6B 3ULVH 3PQYE 3WSQL 4KY1H 1ZAGA 3IJYB 1VGEL 1ED3A 4NWUL 4PGEA 1UWGH 4JPKH 3SKMB 1GYAA 1B0WA 3BT2L 3VFNB 5E6ID 1NGWB 2CDFB 2EC8A 1NFDA 2XWBA 3PDOA 4NM4H 1NLDH 1G9MH 5F7EL 1BD2A 1S9WB 2EE3A 4Y2DD 3H7BB 5E2VL 4E0RA 3CNKA 1EERB 3VRIB 1RJZA 3DROA 5DD0H 4L8CA 5KN5B 1SY6A 1YEHH 3TBSB 2UY7A 3MJ7B 2XQYG 2H8PB 4QXUL 3ARXA 1EHXA 3KJ6H 4QNPF 3V4VH 3KWWB 4JQVA 5EOQH 2AK1L 1K5NA 1S7VB 5DMGD 4PJHE 3AREA 3DURB 4M48H 4OAWB 5FOJA 4PTUA 2HAZA 1KCKA 1PKQB 4X9FA 1W0WB 5JDJA 1EA9C 1Q9WB 3RDTD 1UEMA 3DSFL 4LLQB 5DURB 5KS9B 1K6QH 2ZUQC 4RFEA 3T08A 2R69H 4HJ0D 1KLFA 3HNTL 4X4XA 3SGEI 3WLWD 4S1DC 2NXYC 5ESVA 3QXAA 4KHTL 5SWSA 4NKDB 1NAMH 3CDYA 3MBEA 4MHHG 4CNIB 2BNRD 1OCWL 4DGIH 1CTOA 4QRRE 5K93A 4IDJH 5AG9A 1WFTA 4ZPTB 1HEZA 5DYOA 4ACPA 1VADB 4NWTL 2IH1A 3C5SB 3ZDZF 3E0GA 4N8CL 5E1AB 1IGYA 4S2SA 2F15A 3SKNA 2D7TL 2P5EA 5LAXB 3OKMB 1I3RA 5ITFA 4HZAA 5GISL 1AO7B 5F6HJ 3I9GL 1JIBA 4K3DH 2Z9TA 3CLFL 3V0WH 2XY2A 3RWEB 4ELKA 2VDLH 4XXCC 3B5HA 2VWEE 4WRLA 1WIPA 5SX4H 4KRMB 4Z7VB 4ZSOE 4P2OD 3VI4F 3VD4A 3ZKND 2XOTA 4PRDA 1BLNA 4KI1A 5EU7E 1MAKA 2BDNL 4FQQB 3HMXL 4GG6E 3L3JB 4JO3L 4NP4H 3ARBD 5IVXA 4FFZL 5I1IH 2CGRH 3FONA 5DD3L 3Q3GA 2AV1A 3FO1B 3QQNA 3TIDB 4DZ8A 3STBA 1A3QA 1OW0C 3FO0H 4CKVX 5A2JH 3G5XB 1EMTL 1FZOA 3WHXA 4X5XA 4DN3H 3THMH 2XACC 4KZEL 5L2JA 4FQLH 3TBVA 3ZSTA 2AI0H 5EU6D 1RZJH 4PJ7A 2NY6D 3PABA 3O4OC 4ISVB 3RVUC 3N1PC 3MRIA 1RIVH 1A6WH 5JXAH 4PJ5D 3V0AC 1DQMH 5E6ZA 5IBUB 3O81A 1RHHB 1Q9KB 2XQBH 1FLTX 3D1MC 3EOBB 4RGMB 4QY8A 2F58H 3OF6A 3S3PA 3D39E 2B0SH 1URLA 3QIUB 4L8SA 5D72L 4ZUVB 3FO2A 5DJYB 1JZ2A 2FO1A 4NC2B 2W65B 1E4JA 1E0OB 2I9LA 1UKTA 4PRNB 3ME0A 1T3FA 1A6UH 4QXTA 1N6QH 5SV3A 3TN0A 2IADB 1Y18A 2C3VB 3OKYA 4WEMB 4I2XE 5GGSA 3S36X 1XF1A 4L1DA 5HDBE 3UBXI 4S0TD 4PRAA 4KXZI 2DDQL 4AIZA 2BHYA 3G5ZB 2VLRA 3ULUC 2A6IB 1EEYA 3ARFD 1Q1JH 2HFFA 5I75C 4Y2DB 4OCYH 3QH3A 4OZFB 5L6YH 1DVFA 1MH5A 4KMTH 2EXYC 2DI9A 2R56H 1YMME 2V6HA 4OCWL 2IGFL 4G6FD 3VFWA 8FABA 5I1EH 3PHOA 1DQLH 5E5RB 3LKRA 2YXMA 4PJIE 2PYED 4HUWB 4MNQA 1I7TA 2LU3A 4LCCC 4U6XB 4XNYH 1C5BH 1X5AA 4WIQA 4JFYB 1IKFL 2BSSA 2OXHA 2VXSL 3U4AA 2R23B 4IOFD 1G7MB 1QFWL 5JXED 4BM7A 2QKIB 4M6NL 4JZJC 5HHPA 3VD7A 1JZ4A 1OTUC 1KIUA 3RVXD 4MLIA 5JIKA 1PJ9A 3QIBC 4YDVB 1G9NL 1KJ3H 2YWZA 1I8LC 3NCMA 3CSYB 4JQIH 1MIML 5C0ND 4LKCB 3OHXA 4HKZA 5IBUG 4L4TD 1TCMA 1J11A 1U91A 1YEEH 3AY4C 4LCUB 1WICA 4M62L 4HLZH 4U3CA 3BIBX 1U8JA 2NY2C 5IK3B 2EDOA 2YK1H 2AXFB 5GRVL 2Q8AL 3TVMB 1OAUH 4FQXD 4GRMA 2X4RA 1PZ5B 1S8DB 5DJZB 3D85A 4W4NA 1FV1B 3FN0L 5ETUA 5F3BB 5K9JH 2EDDA 4YK4B 4Z6AT 5D2LE 3IKCB 1FO0B 1U8MA 4TRPL 4HMEA 3QWQB 3LKPB 4EDWH 4UB0L 2FO4B 4YHPA 1TQBC 4FNLH 4KQ3L 2GJ6E 4AENA 5JW5A 4O2EB 3CXDH 4GMSL 2VR9A 3BPOC 5TGBB 2H2PD 3LV3A 3BE1L 4L5FH 4LP5A 2C3HA 4P2OB 2HG5A 4PJHF 4YDIL 4GSDH 2XN9A 1KEMH 2E9WA 4HKXA 3RHWK 4U6TA 4HQQH 2Z35B 3ARBB 1QHOA 4XP5L 3RU8H 1FL5B 3ILQC 3W0WA 2ZUUA 5F7MC 4XVSL 5E56A 3HC3L 1GOFA 5HGBA 2A74B 2CJUH 4G5ZH 3TNMA 1M7XA 1FL3A 4NNPH 4N5UA 4EXPX 3MO1A 5EU6B 4J23A 2NY6B 4HDIA 3BJLA 4LAQH 4X5WA 4XPGH 4H5SA 5MHSE 2FBJH 1IBGH 3ZE2E 4PJ5B 1JHKL 1JNJA 4JY6B 2LAAA 4QRQB 3BH9A 5T1DH 4ZXBA 1FPTL 1FE8L 5CJXA 1IEHA 3GSOB 4MD0A 1DN0B 1WWAX 2EKSB 5E2TL 1J1PH 1QSFD 5D4QA 2GITB 3X3GH 1LO5B 1NDMA 3SO3B 5DQDH 5LKNA 5J9PB 2G2RB 1OGTB 4JFED 1L7TL 3D25A 3SY0A 3O4LD 2H26A 4NKOB 1XGPB 2FNBA 1II4E 3RUGE 3AAZB 4GG6F 3M17A 3ARFB 5DC4B 1YNKL 1NQBA 4RQQA 3PWPE 5HYJD 1FL6A 4PS4L 3IJYA 2G5BB 1DQQB 1OT1A 4JPWH 5GGVY 2BVEA 3SKMA 3T0XA 3U1SH 2BJML 5IQ7H 3JVGA 3T3PE 1NGWA 2CDFA 4OIIH 3QG6B 4ZYKA 1P4LB 3MLVL 4JVPA 2GK2A 2PYEB 3GSXB 3QYCA 4KQ4L 1D6VL 3H7BA 4QRSB 3JTTA 1JF5A 5IT2L 4HCRH 2P8MB 3I6LD 3BI9X 3MOBL 3NFPB 2DLIA 1KELH 3VRIA 1KN4H 3WFHB 5FHAH 1KULA 5KN5A 1XT5A 5C0EB 4F7TB 3MJ7A 2HKFL 4OZ4A 1U92A 2YD4A 4KUZH 1RMFH 4JZNB 5CEZD 1S7VA 4UMGA 4A6YB 3DURA 4OAWA 4KJQD 2DRUA 4UIMB 3KJ4C 1TJHH 4G9DA 1PKQA 3GSRB 4NHUB 4WY7L 1EZVY 1CT8B 3WIIL 4KGJA 1UB6B 3DVNB 4L4TB 5GJTL 4LLQA 4QGTA 3IS1X 2A9ML 5KS9A 5HDBF 4BKLB 5GHWH 1X44A 4NKIL 4JVUA 4X8XA 3NH7H 2ZWLT 3QWRA 5TDPB 1IGFL 2ADFL 1YUHB 4NKDA 4U1SB 4CNIA 2CK2A 1G7JB 2GK0B 2H9GB 5IEHB 3MRCB 4P4KD 5HJ3A 5B4MC 2XTJC 3H9SD 4K2UL 4ODWB 3R0NA 1CIUA 5J3HD 4ZPTA 1J18A 5B21A 4PJIF 3VFGL 5E1AA 1JUFB 4RGNE 3QHFL 5LAXA 3OKMA 5C08D 1X4ZA 2F5BL 1P7QD 1AO7A 4AEFA 5C9KA 1WEJL 3RHWF 5FUOL 3RX5A 3ELAT 3LKQB 5M95B 3FN3A 2GSIB 2FB4H 1KIQB 3A67L 5DJCB 4G3YH 1I3GH 4EIZC 1PKOA 1NCWL 1QRKA 3QCVL 4FRWA 1KB9K 4IHOA 5JPMB 2MFNA 3VXPB 1J0KA 4Z7VA 3EZJB 3D2UD 3LCYA 4FP8H 3QISA 4LPTA 2ZCKH 3FHAA 4X9HA 1CXKA 1IFHL 4FQQA 2R15A 1JRHL 1AGDB 4JDZA 4KTDL 5I1JH 2B2XL 5AYQA 5IHUL 3L3JA 3FFCE 1FZMB 3HB3D 3ZKXC 4WWKA 2DKSA 5CIPH 3FO1A 3TIDA 3UDWC 5T5FH 3MFFB 5B8CB 3K4DA 3G5XA 5C09E 3FKUS 2CXKA 5FV1L 4M1GH 3RVWC 2ARJA 3MRGB 4RGOL 2ATPB 2FX8L 4KKCD 1HKFA 5C1MB 1YDPB 5D2LF 4ISVA 4ZAKD 2HFGH 1QSFB 4TUOB 2NCMA 1SHMA 5HHOE 1OLLA 5I1LA 3HNSH 2W0KA 1JHTB 4JFEB 5GSVA 5E1HB 5C07E 4DCQB 1RHHA 3CK0L 5CZVL 3O4LB 5H8DA 1Q9KA 3UX9B 3EOBA 2ERJC 3M07A 2YUVA 4ODHH 3DPBA 1Z3GH 4EDXB 5HYJB 3QIUA 4UUJB 5A2LH 4ZUVA 5DJYA 1WSST 3KYKH 5D1XD 4GXVH 2W65A 1AKJB 4PRNA 2WIIB 5CILH 1TZGL 2IADA 2C3VA 3DMMB 4TVSa 5HYIA 4OLZL 1CICA 4OCRL 2W9EH 1TVBB 3ET9F 5M7QA 1UM4H 3G5ZA 4K55A 4YXHH 3BW9B 3QZWG 5I18L 4HJJH 5BRZD 2FIKB 2DWDB 4Y2DA 5E99H 1NMCB 5JW4M 4OZFA 2QQNL 4C59B 4ZUSB 3NZ8B 1D9KC 4X5LA 2APXA 1HNFA 3UTZB 5CEXB 3L6FB 3ZE2F 3GO1H 1GC1L 5T3XL 3C6LD 4AY0A 4F57H 4LPXA 1YEGL 2UVFA 4FQ2L 2Y4SA 2IWGA 4KV5E 4DJMA 2EIEA 5EUKB 4HUWA 2CD0A 4PLNC 4U6XA 4JFYA 1MFEL 5HHMD 3IFNL 3MA9H 2R23A 1G7MA 5A43C 1UYWH 2HLFD 4GQ9L 1BM3L 3O6LH 4AH2B 4QT5B 3GM8A 2R4RH 1ITCA 3RKDC 3ZYOA 2QKIA 4H0IA 4KHXH 2FGZA 2VDNH 4D94A 4G6AC 4HFUH 4IEFB 1SVCP 3RUGF 4YDVA 1NFDE 4I5BB 4XH2B 4K94C 4NZUL 4ZOCA 5EH1A 4S0SD 3CSYA 1BD2E 5KSBB 2GT9B 4QHLB 2EYTA 4LKCA 4ZTOL 4DVRH 1A6TB 5EIVA 4P4KB 4LCUA 1BGXH 3MUJA 1QO3B 3T3PF 4IRJD 1P4IH 3B8SA 3H9SB 4OZGB 5IK3A 5CJQL 5D1ZC 3BH8B 3PWLB 2JB5H 3PGFH 2AXFA 1CWVA 2GJZB 5DXWA 1FQ9C 1NBYB 3TVMA 1MPAL 5C08B 1PZ5A 4Z0BL 1P7QB 4UILH 1S8DA 5DJZA 1OL0A 3UJIL 1WZ1H 4KTYA 1MRFL 1W72H 2IPTL 3IKCA 2LABA 3K3QA 3N1GC 3LKPA 2IAMD 4LIQL 4OJFH 3IDJB 5C0DA 1OAZH 4O2EA 3WS3B 5TGBA 4ETYA 3D2UB 3TNNB 5BZWB 2DQHH 3MRDB 2MMXA 4XP9L 3R4DA 3I50H 3IFOB 4G6JL 2IMMA 5ENWA 2Z35A 4YEEA 5EBMB 3ARBA 1HINH 5SWSE 4GW4B 4OBSA 1C8PA 2GI7A 4RX4D 2PTUA 5KVEH 3QI9C 5D7SH 2A74A 3PWVB 3DBXB 2YPKB 4HK0B 3W9DB 2P5EE 1T5WA 4BK4A 1RK0B 3DO7B 3DI2B 3GK8H 2OR8A 3UYOD 1WV7T 5EU6A 4AG4H 1W2KT 1DQJB 4OLWH 4ZAKB 2DTML 4EI6B 5BW7A 2BSRB 1ZK9A 7CGTA 2ZUXA 3WNPA 4KK9D 4ZFOB 5JR1L 4JG1H 3UTSD 4PJ5A 4LVHB 1QFOA 1IGIL 2IH3B 1JCKA 4U1LB 1BZQK 4JY6A 4QRQA 5FGSA 1L7IH 3WLBB 1NMAL 5DK0B 3STLB 3QJHB 3GSOA 2BY0A 4TSCH 1DN0A 5D6DC 5IVXE 2EKSA 5MP6L 2HP4A 5D1XB 4Q7DA 5F21B 5HI4C 2GITA 2DQIL 1LO5A 3UPAA 5F7UA 1QSED 5J9PA 2G2RA 1OGTA 3PV7A 5BVPH 1Q72L 4NKOA 1XGPA 4GMTL 4J7RA 5E94B 2NTSP 4KUCF 3AAZA 3EDKA 2F8XC 2DM2A 4GXUN 1JWSB 3ARFA 3MBXL 5C71A 5HVHB 5BRZB 3SKOB 1ZVHA 4PJ7E 1NFIA 1DQQA 4NO5A 1KLUB 1FO0L 2Y1VA 1BWWA 2NY7H 4X98B 4UDTA 3OKEB 3QG6A 1ZWIB 4MQXD 1P4LA 3GSXA 2B4CL 1PSKL 1UFUA 4QRSA 2X9WA 4Q58C 1A7PH 4BK5A 3LN4B 3KLHC 3QCTH 2P8MA 3NFPA 5HHMB 3WFHA 3MGOB 1DEDA 3VWKD 5C0EA 3T0EC 4F7TA 5JXEA 3TZVD 4UV4H 1I9JL 4DW2L 4IIQB 5CSBA 4LSTH 5H37H 3IDNB 4RDQF 1GZPB 3LQAC 3AMKA 4ZTPH 4A6YA 2VLRE 4UIMA 4I3SL 4QTIL 3GSRA 1S5IL 4PJGF 3MBEC 1CT8A 1SBSH 1I85A 3HE6C 1UB6A 4UOW0 5L7XH 4K7FB 5E70A 4HMDA 3DGGB 5A3ID 3KS0H 4IRJB 3S9DB 1Q8MA 2V17L 2XNAB 5TDPA 1GGCL 1T0NB 4QRPA 4UU9B 1FNHA 4FZ8L 4MNQE 1NCAL 2Z0BA 1YUHA 1S7TB 4U1SA 1T21B 3LB6C 4OLVL 1G7JA 2H9GA 5FYJE 1KB5H 5IEHA 3MRCA 3NABH 2WV3A 4IM8A 2M26A 2K7QA 2O61B 2IAMB 3QEHB 4ODWA 4AYFA 4M43L 2X89D 4KV5F 5GRVK 1BMGA 1SJVA 4NN7C 1JUFA 3QSKB 2H2SD 3MJ9A 1K2DB 3EYSL 5SV4A 3W5NA 1N0LA 4FFYH 3WNLA 2FLRT 5ID0A 3O2WH 3LRSB 3LKQA 4H8WC 2UVEA 1K3ZA 5DJCA 4LPYA 4BSWA 2P47B 4OUUA 1CQKA 1WCQA 4YWGL 2J1KA 2EC9U 4LLDA 2IMNA 1GOHA 1NFDF 2YXFA 4P5TD 2R0KH 3IAPA 3SKUD 2ITCB 3OV6A 2LAGB 3ZL4L 4F7PB 4X4ZA 4NQED 4OFVA 1G6RB 1FZMA 5HTSA 12E8H 5IFHL 4HX1B 3SGDH 3O2DH 4WI6A 3CX5K 1HHGB 4LGPB 3G6JA 3MFFA 5B8CA 4OIBA 4JY4B 3I75B 5I8OL 4DUWA 3HCVA 3UTSB 4Q74A 1FRGH 5BS0A 4P4RB 3NCEB 1XEDA 3VGAC 1R3IL 1YMHB 4A6YL 4JFZH 1FH5L 2HH0L 3DJ9A 4O5LL 2HRPH 2XN9E 4HS8L 3MUY1 1UENA 4KK8D 5DLMH 2D03H 4UAOB 2BOCB 4WHYH 4NUJA 2GFBB 1QSFA 4TUOA 3ARZA 3FB5B 3W0WE 1LNUB 4QF1B 1QSEB 1JHTA 3BZEB 2AAVA 4DCQA 3O4LA 3O45B 1BJ1J 3WIHH 1CG9A 3U9PH 4Z7UB 1I1CA 4Q6IB 4N0CD 4YLQT 4EDXA 1MJ7H 5HYJA 1GGIL 2BY2A 4UUJA 4KZDH 4KKBC 5C0AD 1DVFC 4NO3B 1AKJA 2WIIA 3FAWA 4U0QB 3ARQA 1MFBH 1NMBL 3MXVH 3WFDH 3DMMA 2EEAA 3QEGL 1MFDL 4Z18A 3BP7B 3MJ9L 1KTKE 3W5MA 5EA0L 3BW9A 1KXVC 3E6HB 3UBXB 2FIKA 2DWDA 5J13B 3FCTB 4ENEC 3U46B 4ZUSA 1N7ML 3NZ8A 3V52L 3UTZA 5CEXA 4LP4A 3TZVB 4KVNL 3L6FA 3LHPL 2P24B 4U6YB 3JXAA 4TOYL 5DRNA 4CVXB 1KIRB 1D5IL 2J88H 4YNYB 5EUKA 2DQTH 5EDXA 2D3VA 1DDHA 2V2TB 4L8BB 5IVXF 4D3CL 4NN6C 3L7EB 3P9LA 1XIWD 5I71B 4AH2A 3DETD 4QT5A 1J1XL 4G6ML 4Q9BA 4HH9B 4MXQC 3C8HA 4OIAA 4Y4HC 3O3DB 5FYLD 5CSZB 1FVCB 2PR4H 4XH2A 3H42L 4TN9A 2VXUH 1CE1L 4IBLT 5EIQA 3E2HC 4I9WE 5KSBA 2GT9A 4PJ7F 2PTTA 4QHLA 3RX8A 5KG9B 4O02L 1A6TA 5JNYB 4PLKC 3B83A 3INUL 1OARH 1AHWC 4YUEL 4P4KA 3BGFB 3OJVC 2P7TB 2NY1C 5DJ8B 2ZCLL 3MCLH 3H9SA 3T2NL 5C6TH 4H20H 3UZQA 1HH6B 4OZGA 1F90L 3BH8A 3PWLA 3RNQB 4YC2B 5E8EA 2GJZA 2XG5A 3RBGA 1NBYA 4PR5B 4ONFH 1R24B 2AJSH 3RY5A 5C08A 5TDOA 1P7QA 1UADC 2RAMA 1F3JB 2W9DL 4U2YA 3WSQH 1PKQE 4PGDA 1RZKL 2IAND 1VGEH 1CGTA 2XZCL 1U93B 4Q9QL 3EOTL 5CZXD 3UBXG 1IQWL 3IDJA 4J1UB 3WS3A 5KS9E 1FDLL 3WKML 3D2UA 4UTAH 5IMOB 4OCSL 1TLKA 5BZWA 5INCB 4XCCL 1LK3L 3MRDA 3PL6D 4MB5A 3GNMH 1OY3B 5F7EH 1K85A 3IFOA 1HWGB 4V2CB 5E2VH 3CAFA 5CINH 3ZKMC 5GJSH 25C8H 3T1FB 2PF6A 5EBMA 3B5GA 1H3UA 3QFJB 4NQEB 5JIPA 4PLJD 4M9PA 4QXUH 2OJEB 1N5AB 3U0WH 2D9QB 3FT3B 4JGMA 1MCIA 4I3RL 5EOCL 3PWVA 1ZKAA 2AK1H 3DBXA 3W9DA 5CEZL 1GGYA 4MS8C 4P49A 3DO7A 2WWMD 5AYUL 1AO7E 4ZXBC 4F15B 3GIZL 4LEOB 3O8XC 1DQJA 1RU9L 2QQKL 3UPCA 4ZAKA 3DSFH 4EI6A 5GZOD 2BSRA 4U3HA 3JV4B 4OCLC 4R97B 4ZO6A 3RIFK 1N8ZB 1LEIB 4G8GA 1UVQB 5T3XE 4BZ1L 4Z7VE 2IH3A 1MCHA 4U1LA 2VLMD 3HNTH 3NGBC 1KNOB 1AIFB 2I5YH 3MC0A 4K07A 4KK6D 4UIKL 5J1SC 4Q6YA 4Y5VB 5HYSA 3GI8L 3WLBA 5DK0A 5FECB 4KHTH 5DQ9A 3QJHA 3UTPE 2HVJB 1OCWH 1JP5A 2A0LC 4YGAB 5D1XA 5HGHB 1KC5L 1U95B 1T2JA 5FM8A 3GDBA 3JBG7 2EH7L 4R0LC 3UAJC 3JVGC 2FATL 4HMCA 4OF6A 3MLZL 5E94A 1KJ2B 2D7TH 1QRND 2XZQL 1AGCA 1XF3B 4K9EC 5GISH 4OGAC 1JWSA 4NQXB 3I9GH 3V5HB 4JKKA 5DSCB 1F00I 4WW2A 3UYPA 4JM4L 1KLUA 1R3HB 2MNUA 2OR7A 4XCFL 5GGTL 5GRJL 4X98A 3MRMB 2G9HB 1RZIB 4PYHA 3SJVD 3DRTB 2A1WL 3OKEA 1ZWIA 1LWRA 5CEYA 3PF2A 3G9VA 2G75B 2XFXB 2YC1B 1KGCD 4JO3H 4LLUB 2UYLB 3I02B 5KAQG 2E9IA 3O6KH 5DD3H 1SY6H 3WBDA 3MGOA 5I17B 3BEWB 1XIWB 3NCBB 4YBHA 1JPGB 2D7QA 2VDML 3A0OA 2HT4D 3DYPA 4LIQE 3V6OC 4JREB 4AMKL 3RIAK 3JUYA 4D0DA 1EMTH 1WC7B 1FNSH 3QQ4B 4GAYB 1GZPA 4DVBA 3IAQA 1R3JB 5DJXB 1HHIA 4NBZB 4M1CC 4O9HL 3L3OB 4YHNB 4BZ2L 5GS0C 3RY6C 1UWEL 1OP5K 5J6HB 4U1MB 1LE5B 4FG6C 1L0YA 1QQDB 2Z91B 3DGGA 4ZFOL 4IRJA 2YD1A 4NM8H 2X10A 4X80L 1T66C 5C9JB 9CGTA 1ZA6B 1IGJA 2XNAA 2ZPKH 5D70H 1AGEB 1V3JA 4YHKL 3VMOA 2D31A 1T0NA 4UU9A 5JOPD 4L1HA 3QG7L 1S7TA 3IXAB 4AQ1B 5D72H 1NPUA 2WNGA 2YD2A 4A2MA 2R2CA 2IANB 1JL8A 3SDAB 5KBNC 2O61A 2IAMA 1PDKA 3GHEL 5AAMA 1U8HB 3QEHA 3KPRA 3GFUA 2E9JA 1TITA 1U8KA 2FL5B 1K2DA 2YR3A 3PL6B 2FEEL 3VXRD 2AJZB 1MRCL 5ICZB 3AMLA 3IVKA 3B2UC 3LRSA 4NBXB 4MVBD 2QJDA 4LHJB 2WUCL 1L0XA 4OCWH 1BHGA 4RA3A 4M5ZL 2YPLB 2IGFH 4WWKC 3KHQA 3WDJA 5HD8D 2ZSVA 4M6ML 5JTWA 5JHLL 5J11B 1BOGB 4NZRH 3L5IA 4F7PA 5GSRA 4HIXL 3S98A 1G6RA 4FTVA 5MEOB 2HJFB 1P7KB 1EFQA 1QFWH 1SEBB 4M6NH 5E7BA 4HX1A 4OB5L 3QUXD 4OKVA 1HHGA 5DVKA 3RIFF 1T5XB 3I75A 4FQPA 4U2ZA 2GSGB 3UTSA 2IQ9H 1IGML 4CJ1A 4P4RA 1FJ1A 4JHAL 1EO8L 4JRXD 3WDIA 1YMHA 4OGYH 4X7SL 1MIMH 3E6FB 4I0PC 3H6JA 3SCMD 1H8OA 2BOCA 2GFBA 1GAFH 5C0GA 3FB5A 4M62H 3NVQA 3HR5B 1LNUA 5KS9F 4QF1A 1H3GA 5AWNL 1QSEA 4WGVB 3JV6B 4XZUB 4CBPA 3BZEA 2HN7A 5I73B 1CICC 3BIKA 4HS3B 5EO1B 2Q8AH 3O45A 1QRNB 1FN4A 5DFTA 4R7DB 5CJOL 3SBWC 3NCCB 1I3UA 4Z7UA 1EUTA 3FN0H 3NZHL 4U05A 4GW5A 1BF8A 5EU6E 1LK2B 5BJTB 4NO3A 1ACYL 4F7CB 1IAOB 4OFPA 4TRPH 2CKBL 4YO0B 2HMIC 1PG7H 4Q9CA 1B9ZA 1HI6A 1O5DT 2I25N 2FRGP 3PUCA 4GMSH 1UA6L 3SJVB 3EYQD 2X4PB 4PJ5E 2EIBA 3BP7A 4YDIH 3UBXA 4FXGB 2AQ2A 5D71H 2ICWB 5J89A 1QFUL 2EZ0D 3FCTA 4KI5D 4WEBH 2EDEA 3MYZA 3QPQC 5DZOA 1UH3A 3U46A 3RP1A 3MV9D 2QTEA 1FFPA 4MJ4A 4P3CL 4JR9H 3TZVA 4XVSH 1KT2B 5EUOB 1JV5B 2P24A 1XGRA 4Z7VF 4QTHA 4FHBD 3SOBH 4Y4FA 4CVXA 2E7MA 2GQHA 1RIUH 3RIAF 4RA0C 4YNYA 2LVEA 3HR6A 4BFEA 2JB6B 4B50A 4NNYB 5F8RC 4S1RL 5FYJH 1G6RL 3FQXB 5I8CB 3L7EA 3IKKA 5EFIB 5EC2B 3BSZH 1A4KB 4OGXH 3HN3A 2ADGA 3QXWA 5C0BD 3CVHB 3O3DA 4WW1B 1MY7A 3P0VL 1TIUA 1XCTB 5CSZA 1J1OL 1FVCA 5I30L 1HILB 4AK1A 4KKLC 4HKBB 4M5YL 4GRLC 2BVPA 1FPTH 5EORH 1EJ6A 5KG9A 4XMKL 1MCPH 3TYGL 4NQDD 4V2BA 4K7PH 2ICWJ 4AEHL 3TBYB 1BBDL 2P7TA 5HHVH 5DJ8A 4MD5A 1U6AL 4PP2B 1HH6A 2Q3AA 3GSUB 2X89A 3RNQA 1EPFA 4PR5A 3VE0B 4QHKJ 4LLMB 4XBGB 2FR4B 2Q76B 1BOYA 3VXRB 1YNKH 2W0FB 2WLZA 5EZOH 1F3JA 1OHQA 4PS4H 4LSRH 5GS1B 2BP3A 1ZHKB 4PGZA 1U93A 1F97A 4TQEL 3T0VA 1TMCB 3T3ME 2BJMH 2YUWA 4PRHD 5AUMB 1J12A 3ARDA 1RZ8A 5INCA 3MLVH 5HI5D 4PG2A 1A7OL 1RJLA 3BN3B 5I1CH 2ICES 2HWZL 1G1YA 1LO4L 4QRPE 3S3JA 4OV5B 1Q9LB 5IT2H 3T1FA 1YJDC 1WFOA 2EIDA 3QFJA 4NQEA 4UBDC 3T8XB 3NCYS 5DWUL 1A5FL 2DQJL 4XHQA 1IT9L 1A9EB 3QUXB 3QO1B 3IFPB 3SE4C 1N5AA 5F88A 3FT3A 3PV6B 2VL4A 4I3GA 4RBPK 4OFYD 3RRQA 4JRXB 3MV7A 4QRTB 1YY8B 3P4NB 4S1DD 2L7JA 2NXYD 4LEOA 3WIIH 4OF3A 2M2DA 4WO4C 4U0RB 3JV4A 2A9MH 3QJFB 4GS7B 1N8ZA 1LEIA 1UVQA 4NKIH 1ES0B 1XF5B 2B20A 5TQ2L 1KNOA 4CU6A 1AIFA 4NN5B 4MB4A 1H5BC 1IGFH 4Y5VA 2ADFH 5CGTA 4P9HC 2C7UB 5FECA 5KZCD 1BEYL 3CH1B 2AQ3A 2HVJA 3VDAA 3IYLW 4KPHL 4UT6H 1U95A 4RRPA 2YHGA 2BMKB 4W81A 3KPQA 4WCYL 2W91A 3VD5A 4PPTA 5IOPB 3BP6B 2N4IA 5TDNB 3G6JE 3VFGH 1MFAH 3ZTNL 4Q9RL 1GH7A 1KJ2A 3QHFH 3JSSA 1XF3A 5BS0E 1X9QA 1RIHL 1JPSL 4LVEA 2F5BH 5KSAC 3MODH 4NQXA 3V5HA 4XP4H 5FUOH 1HKLL 3CSGA 2E6QA 3WJJA 2X4TB 3ZT6A 3A67H 3T4AB 4RWYH 1NCWH 1R3HA 3MV9B 1QSFE 1BFOB 4AEIL 4HXAL 5IVZB 3WFZA 4TULH 4RFOH 3MRMA 4R2GC 1OAQL 3ZE1E 5D1QD 3DRTA 3AB0B 2G75A 3O4LE 4JPIB 2B2XH 2XFXA 2YC1A 4LLUA 5DDHB 5BVJB 1MRDL 3I02A 2BVOB 3K8LA 4NQVB 3EHBC 1GIGL 3BOVA 4OF7A 5HYJE 5I17A 1DQDH 1XIWA 1JPGA 1SVZA 3DYOA 3RVUD 1KCSL 5HVGB 5LGJA 3Q6GL 1Q38A 1WC7A 4P59L 4H88L 3QQ4A 4GAYA 4RMTA 1BIHA 2QQLH 1R3JA 5DJXA 4RGOH 1ND0B 3L5XL 4LNRB 3VWJC 1GOGA 3L3OA 4YHNA 4P9ML 4WI5A 2AABL 5FB8B 4YEFA 1ZANL 5J6HA 4U1MA 4NQSB 5DVNA 3VFPB 4NQDB 3I6LE 5KTEH 1LE5A 1QQDA 3D0VB 5F71A 4YXKH 3FQRB 4DWHA 5C9JA 1ZA6A 3CK0H 4ZD3H 3FTGA 3OGOE 1AGEA 1OM3H 1IM3B 1I1AC 4L4JA 3ULUD 5CEZE 1NGPL 3IXAA 4NCC1 4HZLB 4UNTA 1N6UA 1Z2KA 3H3BC 2IANA 4ZS6C 2EXYD 1ZLUK 3SDAA 2X4SA 3LPGA 2MWCA 4IS6A 4R3SA 1TZGH 5IWLA 1U8HA 3V8OA 1LILA 2OQJB 1RULL 4MXWL 4OLZH 4D0CA 4PRHB 1RUML 1XZ0A 1EFXD 4OCRH 1KJ2L 3D5OF 1RAMA 2FL5A 3PL6A 2Z31C 3SDXB 2YN3A 2AJZA 1DE4A 5ICZA 3KPNB 2QQNH 1ZEAH 2FBOJ 5KSBE 2R0LL 3PDDA 2VDKH 5E4EC 3MRJB 2YPLA 5KVDL 4LOUD 1GC1H 5T3XH 2DQCH 1OTUD 3I6KB 1YEGH 4FQ2H 3H9SE 4QO1A 2HJLB 3QULB 2ZUQB 4OZGE 4TPRH 3QIBD 5DJ2B 2ZUVA 4ZFFB 4Z8FH 3HA0A 5C08E 1MCLA 1MFEH 4BH7B 3IFNH 2B1HL 2NXYB 2D7NA 5MEOA 2HJFA 1P7KA 1OP5H 1SEBA 3GKWH 3RTQC 4YDJB 3V7AE 4KY1L 5DR5L 4TTGA 1A1OB 5KW9H 3EYFB 1T5XA 4J3UA 5FYLL 4N0UB 2GSGA 2NY2D 1UWGL 4J3VA 1YQVL 2WMPA 1T83C 4JFXB 4NZUH 1V7NL 2RR3A 3P77B 4NM4L 2VDPL 2WQ8A 3TJEL 5KZCB 5F9JB 3UTTB 3S37L 1QFWI 4YFEA 1BBJB 4MGXA 4F7EB 4PV9A 3HR5A 4RZCB 3JV6A 4NBYB 1AJ7L 4HS3A 4MCZB 3BQUC 1QRNA 1MPAH 4XNXH 3T2QA 4R7DA 3KJ6L 3MRLB 3V4VL 4Z0BH 1FZJB 3RA7H 3UJIH 4YZFE 1Q0XL 3DHJA 5DVLA 3D39D 1F8TL 2DMBA 4BH8B 2IPTH 4N0RA 1CBVH 1LK2A 3IETB 5GIRB 5E6YA 2X4QB 4F7CA 4CMHC 1ZE3C 4LIQH 4YO0A 3ILQD 3BPLC 1BVKB 3VXQB 4WI2A 4J8RA 3SJVA 4G8GE 4WU5A 3E8UL 2X4PA 5EC1B 2YRLA 4X9IA 2C1OB 3QFDB 4XP9H 3U4EB 4FXGA 4KMQA 1EVTC 4G6JH 2ICWA 3SE9H 4F9PA 4OZFH 3LS4L 3WS6C 3O4OB 1W0VB 2C3XA 3OKNA 1YMMD 1G9EA 1KT2A 4HKJB 5EUOA 3BKCL 3MFGB 4Z76B 3R1GL 1UM6H 4X6DB 4X4MA 2GJJA 2R0ZL 3S36H 2CUMA 2JB6A 5DJ6B 5IW1A 4LPWA 1OAYL 4NNYA 3FQXA 2JELH 2EDQA 2ZCHH 5EFIA 5EC2A 4XVTL 2DTMH 3V0WL 5F7HA 1BQLL 3G6JF 3CVHA 5JR1H 1VEMA 4WW1A 1HZHL 1S7XB 1IGIH 1XCTA 1OTSD 1HILA 4Z78B 2P43B 4HKBA 4N1EA 4FFWC 3TO4A 3E3QC 5AZEH 5I75B 1CLCA 3KPMB 3S5LB 2K9UA 5MP6H 3O11B 2FIRT 3KR3H 3RKPA 4GAJH 2WINB 3F8UB 1FVEA 3ZE1F 4KJWC 5HGGS 4PP2A 2Q86B 3GSUA 1Q72H 1EFXB 4GMTH 2XA3A 3MCG1 3O9WC 4LLMA 2A6DB 2OJZH 4XBGA 2FR4A 2Q76A 1JGEB 3MBXH 4N5EC 3TO2A 3VXRA 3HPJB 4KH2A 3BYTA 4LCCB 5GS1A 3KLSA 4CW1A 4J3TA 3H0TB 1ZHKA 4LHQB 5I16B 3V79C 1D5MB 3QQ3B 3P4MB 2ZNWA 4EI5C 4JZJB 5AUMA 2GJ6D 4XC1L 1CDUA 1RIVL 4LRIA 3T2PA 3HI5L 2W60B 3QIBB 1PW3A 2DKMA 1CE6A 1PSKH 1CU4L 1I1RA 1Q9LA 3RWCB 1H15B 3O41A 3T8XA 2AP2A 1YC8A 2E7CA 1KTLB 1LP9A 3QUXA 4WV1C 4DW2H 3QO1A 3BHBB 1FGVH 3IFPA 5DS8A 5DHXB 3PV6A 3KPTA 3KPRE 1A6UL 3UYRH 2NY2B 5ADPL 1AR1C 1INEL 5CMAB 4JRXA 1ZVSB 4V1DD 4QRTA 3IB4A 3P4NA 3ARRA 4BJLA 4XWOD 1E6OL 4QTIH 4WFFE 2J2ZA 1MCDA 1S5IH 1XGTA 1KTDB 4HBQA 2WZPD 2LU4A 3MZGB 1A7NL 2HT2C 3IDIB 2QHRH 4HXBL 5L6YL 2BVYA 2LFGA 4P57B 3F65A 3QJFA 2PYFB 3PG2A 5B4MD 2XTJD 1EAJA 1TQBB 3BZ4A 1XF5A 5EWIH 2V9QA 2Q1EA 3HI1B 5HGAB 3BPOB 1ZHLA 1VKXB 1GGCH 3P0GB 3WN5A 3HMWL 3GHBH 2OS7A 4PP1C 1NCAH 4JQXC 4RAHA 5F7WC 5KSBF 2C7UA 4APQC 3D39B 4J3OC 3CH1A 3FB7B 1SJEB 1C5BL 4NKMB 1EH9A 4FTVE 1BX2B 4HT1L 2BMKA 2Z92B 5HVWA 1M71A 5IOPA 3BP6A 4OZGF 3CXHK 5TDNA 1N4XH 3UTSE 1SYSB 3EYSH 1WBXB 1VFMA 4D8PB 1ITBB 3H7LA 2XRAL 2H1PH 3VG9C 3GUTB 4YGVB 1Z6JT 1A9BA 3T4AA 2EKJA 4JQIL 4RAVB 3MV9A 5GGRA 1UKQA 3AM8C 1BFOA 1YMMB 3CGTA 1Z9OA 1YEEL 2EYRB 4N1HB 1QSEE 4GW1B 4PJDB 4RBPH 3UJJH 4JPIA 3RVWD 4YR6A 3ZL4H 5FM5M 5BVJA 1HHHB 3MRNA 2BVOA 3OX8A 4Z7UE 5I1KH 1EAPB 3CZFB 4NQVA 2JJTA 4OD2B 4QHNA 1A6PA 1ERNA 4JHZA 1Y6KR 2DLTA 4XBEH 3OZ9L 2YMXH 1FORL 5I8OH 1QBAA 2RCSL 3CUPB 2YPVL 3CXDL 5IF0B 1R3IH 4A6YH 1FH5H 1XCQA 2MOVA 4O5LH 1H9VA 3ARSA 1ND0A 4LNRA 5J12C 4KKNA 5FB8A 4GSDL 1KEML 3VFPA 4NQDA 1U8NB 5JLZB 2OR9L 1GHFL 4ETQB 1A0QL 3LEYH 5E4IA 3RU8L 3D0VA 3FQRA 1S9VA 1DBBL 1A1MB 1OGAD 1B0RB 2QQQA 3DO3A 1A6AB 3MNWB 5F6HI 4HIIB 4Y4KA 3ZHKA 1MJ8L 1IM3A 2Q8BH 5LCVH 3O0RL 4XI5C 5I2IB 1GGIH 4P3WA 4O58H 2N56A 1DBAL 4HZLA 4Z9KB 2X70B 2BZDA 4W4OC 2VISB 3FZUD 3BRFA 2OQJA 3HUJB 3QEGH 2BY1A 4PRHA 4XPGL 2IFFH 2X09A 2GJ6B 2FHBA 1A7QH 3ISWA 1UJTA 4X99B 3MJ9H 3C2AL 4JKPL 2OZ4A 5EA0H 2IBZY 4OFIA 3OKLB 2FEDC 4OLYL 1PX4A 3SDXA 3C8KB 3QEQA 3KPNA 4WW2F 5DEFB 2EO1A 3VH8B 3KJ4B 1YNTB 2F9BT 3AGVA 1PVHA 2GY5A 2UV3A 1QUNA 4XNZC 3V52H 4AQOA 3T65B 1MCOH 2DWEB 4KVNH 3RKDD 1U9KA 3GB7B 3LHPH 3QAZC 5IBLC 1J1PL 3B43A 5FAAA 3I6KA 5D9SB 1SMAA 2V5RA 4TOYH 3FJTA 4G6AD 3DRQB 1CL7L 3QULA 4OFYA 1PYWB 4OLUL 1JFQL 5F9DC 5DJ2A 4V1DB 4MDIB 4BH7A 3QXDB 4D3CH 3EUUA 2Y6SC 3P9MB 2CDEB 1EJOL 1D5ZB 4E9LA 1J1XH 4G6MH 4YDJA 4LDLB 3JWDL 1X5JA 1IL1B 5D8JL 4GKOA 5JIIA 2XTJB 1JTTA 4JPWL 1KN2L 5HDLA 5C09D 4W68A 4JFXA 5D1ZD 3GSQA 3H42H 1OB1B 5E8NB 4JCMA 3P77A 4G42B 2BOBB 4O02H 5EO9B 5CUSL 5F9JA 3INUH 3QFJE 4NQEE 3UTTA 2Y7QB 3LKNB 4F7EA 1ZLUH 5FHAL 2WLYA 2ZCLH 3RVTC 3T2NH 4RZCA 5TH2B 4QXGH 1KTRL 4R7NB 1HXMA 3FHQA 4WTZG 1FZJA 1OLZA 3MV7E 1MCBA 1T0PB 4BH8A 1RZKH 3IETA 5IMLB 5GIRA 1V3LA 2X4QA 3CFJA 4OCXH 3ZKXB 2XZCH 3OKOB 4Q9QH 1IQWH 1BVKA 1NGZA 4L9LA 3VXQA 1CDJA 3MV8B 1WIUA 4ONOA 3UP1A 2VAJA 1MAMH 1UJ3C 3WKMH 1OW0A 1W8OA 4OCSH 5EC1A 4KRLB 3VH8G 2C1OA 4Y4FC 4YH6A 4IJ3C 3F12B 4HLJA 2YUZA 4JN2B 3BMWA 3U4EA 3BUYA 4X7TB 1P53A 1R0AL 1VEOA 1E4XH 1J8HD 1DL7L 3C9NB 4MZ3A 5DMIH 4H1LB 4ODVH 4HKJA 1SEQH 4ODUB 5D96C 4I3RH 4Z76A 2AJYL 1WT5C 2NZIA 5HDQL 2ADIA 4U49A 4X6DA 5CEZH 5HY9B 1DLFL 2X6MA 5ACLA 5DJ6A 5AYUH 3GIVB 2ERJB 3GIZH 2UWEB 4TVPE 4ZNCD 4LSVL 1H3PL 2QQKH 3GBML 1PEWA 3O6FC 1LQSR 3IDYC 3WO3B 1FFOB 4C54A 2GEEA 3ROLB 1G1CA 4BZ1H 2P48B 4C4KT 1OGAB 4Z78A 4U1IB 2R29H 1E4KC 4W6WB 5K9OB 2AV7B 1M05B 5FYKD 3GI8H 4OLEA 3RGVA 4ZNEA 1BD2D 2MKLC 3KPMA 3S5LA 5I1JL 1VGKB 2R2HA 2VL5A 2Y36L 3UMTA 3EGSA 1U41A 3OSKA 2WINA 3PGDB 4S1SL 1D9KB 2H3NB 1QLEL 2BSTB 3NIGE 4D9RE 3CCHB 2EH7H 1OSPL 4AJ0A 2LQRA 2FATH 4JJ5B 1EFXA 3ARDC 5FYLE 2Q3ZA 2XZQH 2A6DA 4JZOB 4PG2C 3DNKA 1JGEA 1KIPB 5I1HL 4Z7UF 3HPJA 1K9TA 3ARED 4OQ1A 4LCCA 2CIIB 4HG4J 3T1WA 4JM4H 3VXMB 1FFRA 2VDOL 3QUYC 4XRCB 1BREA 4MA3B 3H0TA 3T0ED 4XCFH 2F5AL 3P4MA 3LSOA 2A1WH 5IBTL 2W60A 5ICYB 4HULB 3QP3A 4H1LG 2R2BB 1I8LA 4K71C 1SJXA 3HI6H 4Y16C 3RWCA 5F93C 2KBGA 4MWFB 2MQCA 3MBED 4OKDA 1KTLA 2IANE 2VDMH 3TBWB 1QLFB 3BHBA 4GXVL 4AMKH 2V5YA 3FB6A 5CILL 2XXCB 5K33A 2Q7YB 1JBJA 5C09B 4XAWL 5D1ZB 3BN9C 5DZNA 4BELD 1ZVSA 4MA8L 3HPLB 5J57B 1IC1A 2P5ED 3V6BR 1EBAA 5DA0B 4YXHL 4BZ2H 2CLZB 1FFNA 4XMPL 3KLDA 1KTDA 3LB6D 5A2KH 3IDIA 3VGFA 1MHCB 2EYSB 4P57A 2YPLE 2PYFA 5A40E 4X80H 4PLOB 5ACMA 4M6OH 3HI1A 3GO1L 5ID1B 5HGAA 5CJ8A 1BQHG 2A6KB 4YHKH 3ULUL 1HK6A 4HEPG 1ZLSL 4P23C 4JO4H 1GPOL 5A16B 1XGQB 1NDGB 4HUUA 3FB7A 1SJEA 4NKMA 3WJJC 3F7PC 1BX2A 2QSCL 1LEGA 5C8JB 4AEEA 4PJGB 3GHEH 1UEYA 2Z92A 5C0IB 1F4WL 1JPFB 3V6ZB 3QI9B 1X5LA 1SYSA 7FABL 5M94B 4HFUL 5CLTA 1WBXA 4IMLA 4XWGL 1MRCH 4D8PA 2OMBA 1S9KC 1WVZA 1AI1L 3GUTA 1BFTA 2IJ0C 5T5NG 1J8HB 4GG8B 3MLXL 4M5ZH 4RAVA 3PIQB 1H3TA 4LEXL 4JM2C 4NDMA 3EYVB 5IB4B 1MCJA 4GW1A 4PJDA 4M6MH 2F19L 1P4IL 4PUBH 1MHHB 5JHLH 3MRHB 3MGTB 1QRNE 2JB5L 2JK5B 5L0QC 4FS0A 5BXFB 2Z8VC 1MCEA 1BFSA 3KXFD 1EAPA 2IALB 3CZFA 4QCIA 3MNVB 4OD2A 4UILL 4J4PC 5TE7L 1WZ1L 3RWHB 4OB5H 4U3XA 3O2VH 1BECA 5CP3A 5F97E 3SJVE 3TFKC 1EO8H 1OAZL 5IF0A 4F58H 3OAZK 3PDOB 4LBEB 4M00A 2DQHL 5DQJB 3N1FC 1AGBB 3I50L 1BD2B 2UUDH 3L3HA 4KKBD 1U8NA 2ITDA 1DVFD 1F3DJ 5JLZA 4ETQA 1RJZB 3DROB 4L8CB 4ZODA 5AWNH 1AXTH 3O3UN 3S7GA 4G9FD 5EUOE 4F7MB 1A1MA 1J0ZA 1B0RA 2AS5M 1A6AA 4RDQG 1CGUA 2AKRB 1ULVA 2J7LA 1FC1A 3CPLA 1VPOL 3C6SA 5CJOH 3V4PH 4X4ME 5D7SL 1OSZA 1QPPA 5BV7C 4ENED 4MJIA 4Y5XC 4YHLL 5GZNC 1X5IA 3X14B 1S7RB 1ACYH 2E6PA 4JO2L 4ZUWA 3RVVC 2VITB 5FYJD 4WTZA 3S35L 4NJ9L 2VB5A 2O5YH 2VISA 3T0EB 3HUJA 3BJ91 5E6IC 4ONHA 1UA6H 4X99A 4P2CG 4HGMA 3FT4B 3WO4C 4JG1L 3K0WA 3OKLA 2D0GA 1QFUH 3C8KA 2VSDA 4X4XB 5DEFA 4C4KO 2ATKA 4MAUL 1YNTA 2OI9C 1CXFA 4FFVC 2VXVH 3VD9A 3QXAB 2CSPA 2BFVL 3MBEB 4P3CH 5E2JA 3T65A 2DWEA 1QEWB 5TE6H 3GB7A 3HE6B 5CLWA 5C3TA 1BJ1H 1PGRB 4Y4HD 3DRQA 5L8JB 1PYWA 5F7FA 4JFFD 5DMGC 5BVPL 4V1DA 4LQFH 4MDIA 4S1RH 4WHDA 3VXRE 4D9QD 1G6RH 3P9MA 2CDEA 3D85D 3RDTC 1D5ZA 3K2MC 4PLKD 3UC0L 3ESVF 1IL1A 2NY1D 1KCLA 4JRYD 4URTB 2P46B 4XVUC 4HJ0C 1J1OH 1HYRC 2W0PA 3QIWC 1OB1A 4NN7B 4M5YH 4PJFB 1AXSB 5IM7B 4KTEL 4G42A 1EX0A 2LVCA 2EDRA 2XN9D 3EJZC 5L2KA 3QDJD 2BOBA 2DQEL 4D9LL 4XMKH 1IMHC 2RB8A 4OM1L 4MMXC 3IFLH 5EO9A 1P6AB 3QCTL 5IVXB 1GVIA 2Y7QA 3QT2A 3LKNA 3BPNC 5DA4A 1BBDH 2APTA 4JFHD 3Q3GB 1U6AH 2AV1B 1LP9E 5TH2A 2VZ3A 4UV4L 1YEIL 4R7NA 3IDUA 4W6XB 4LSTL 4LHUD 1FZOB 3ULSB 1KV3A 5FUCC 4JRXE 3LRHA 5I74C 3ES6B 1CTNA 4F9PC 32C2B 3ZKMD 3TBVB 4DN4H 3RWIA 5IMLA 1A7BA 1DSFL 4PJ7B 3OKOA 1ZHNA 4GO6B 4TQEH 1SBSL 3UDWA 3CH8A 1BZ9B 3MV8A 4E5XB 5I15L 3P9WB 1F4XH 1MWAB 2E9BA 1A7OH 2WBWB 3X12B 4JN2A 2HWZH 3CFEA 4QHUB 4MS8D 1LO4H 4NFCA 3VGAB 5FO8B 5ALBL 3ETBF 4F8QA 1IAIM 4ZXBD 5JA8B 6CGTA 3KXFB 1HHKB 1A7RL 3O8XD 3AS2A 1A5FH 2DQJH 1IT9H 1EUUA 4H1LA 3V8CA 4TNVK 5FIEA 1CGVA 3EBAA 3NCJL 3RPKA 4QXTB 3MSPA 4TUKH 1IEBA 2C5DC 2PTVA 2OL3B 5HY9A 4U6HA 4PRAB 1S7SB 1NJ9B 2VZ1A 4F9LA 2UWEA 1EEYB 2AJXL 3TO4C 4OF5A 4KI5E 3G6DL 4NC0B 3P3YA 1I9RL 4TSAH 3QH3B 5EU5B 3L3IB 1E4XI 1DVFB 2A0LD 5FDYA 1MH5B 4FQCL 1KENH 3MV9E 1FFOA 3U4BH 4NZJA 3ROLA 2GAZB 4R6UA 4G9FB 1OGAA 3CFKB 3UAJD 1R3KB 5TQ2H 4U1IA 4PJCB 5K9OA 3BRDA 4OGAD 1KPRB 4U1HB 3WEXB 1VGKA 1MCNA 3SO3C 4EN3C 3AVEA 3PGDA 1D9KA 1YA5A 5FKPB 3X3FL 1HH9B 3UCRA 4L29B 4WCYH 5H94B 5HHPB 1NEUA 1CLOL 3O2DL 5DF0A 4Q9RH 4NZTL 4JY5L 1RIHH 1JPSH 2QL1A 1KIPA 1INQB 5DD1L 5LGHL 1X5GA 4I1NB 5IJKC 2C1PB 1N59B 2CIIA 4JFZL 5CGYC 5SWZA 2HRPL 2X9XA 3VXMA 4NN6B 4XRCA 4MA3A 4NQDE 5J4MA 4AEIH 4GQPH 4HXAH 2XPGB 3ZMRA 1ZVYA 1OAQH 1BJMA 4XCEB 4Y4HB 5ANMB 1ZMYA 4JFFB 4MQTB 5ICYA 3BWAB 1F2XK 4CAGA 1QVOB 4M1CD 1MRDH 1WAAA 2R2BA 5F9WC 3E2HB 2X4RB 5GS0D 4MWFA 5JW4N 3D85B 3EFDH 4M93C 1KCSH 3V6FB 4FG6D 1J0HA 3TBWA 4WEUD 3K2UL 1AHWB 1QLFA 5EUOF 1RHFA 3S97C 3U2SB 1U8MB 4POUB 4P59H 2NY1B 2APBA 4JRYB 4PRHE 1T66D 3WFDL 1HHJB 4OTXL 1UCTA 3ZLQC 3LV3B 3HPLA 3WN5C 1L4IA 3Q0HA 3SDXE 2VQ1B 2VAAA 2CLZA 2XN9B 3QEQE 4HKXB 3QDJB 2M8XA 1NCBH 2WBJC 3JWOC 3ZDYE 2I27N 2RHEA 4ELMB 1MHCA 2EYSA 3ALXA 2N7AA 5ACZB 1J10A 43C9A 5ID1A 1F11A 3TIEB 1TTGA 1FG2B 3IXTB 5HGBB 4FQXC 4LHUB 1RUAL 3SPVB 5A16A 1XGQA 4POZC 1NDGA 3B2UD 3UTPD 8CGTA 1F6AB 5C8JA 3S4SB 1J5OL 4HDIB 4PJGA 5IHZB 3CX2A 2AGJL 4HK3N 4WWKD 5C0IA 4WFHE 4MXWH 3CJJA 1RULH 1S7UB 1RUMH 3BZFB 3V6ZA 1KJ2H 3QI9A 3SGJA 4N0UE 1YEFL 5J1AB 3SKJH 4TVPH 2PR4L 3X11A 1HOCB 3NBNA 2VXUL 2NY0C 3LMJL 3TV3L 4ZXBB 4OF8A 1J8HA 3O8XB 4GG8A 1C5DB 3RZCC 1WBZB 3BISA 5KVDH 4ODTH 3UTTE 2Z93B 2IF7A 4MD0B 1UZ8B 4YX2H 1WCBB 1OARL 2EE2A 3EYVA 3NAAL 5IB4A 4TNVF 1NDMB 5IESL 3BESR 4JDTH 4UI2A 3MLSH 4XCYB 4H20L 3GEWB 5I1AA 1MHHA 4K94L 2JK5A 3NGBB 4F80A 2OYPA 5BXFA 4ONFL 2B1HH 2E7LC 2IALA 5D2NC 4I0PD 3MNVA 2Y72A 1UG9A 3QIUD 3RWHA 1CFVL 5D6DA 5DR5H 3C5ZA 1LP9F 1YY9C 1DBML 5FYLH 3H3PH 1YQVH 3BKYL 3M8OL 4K7PY 3HG1D 4R0LB 1CICD 1FIEA 1V7NH 4Y4KC 1RFDH 3L7FA 4LBEA 4UTAL 4HHAB 4ZYKB 2VDPH 5DQJA 3EZ8A 3B3IB 1AGBA 2ENYA 3GNML 4YPGB 3TJEH 4WJ5B 2R9HD 4U31A 3JTTB 3N9GL 3S37H 5CINL 5GJSL 25C8L 1PY4A 3PP4L 5DUMH 5EBWB 2HMID 1BQSA 4K8RH 4LHUG 3PDGA 5AAWA 4WI8A 4OZ4B 4F7MA 1U92B 3GSWB 4ODBD 5D5MB 2MCPL 1AJ7H 2AKRA 4ODXB 3U0WL 3ARWA 4YDLC 3RWFB 2LV4A 4X6DE 1BJ8A 2H45A 3S4SG 1KSRA 1I8IB 1Q0XH 1F8TH 4P5KB 5GRUL 1IM9D 4NOBA 3I3BA 3QPQD 4L8DB 1S7RA 3X14A 4G9DB 1U0QA 2VITA 4RMVA 1Q9OA 4LCYA 2LE9A 3T0EA 4XNUH 5F6IC 4P2QD 2HRLA 3E8UH 4HGWB 5E08L 1RV6X 3FT4A 2CK0H 1NGQH 2HTLC 4MQ7B 1D5XB 3LS4H 3ULUE 2XICA 2NY4C 4KI5F 1CR9L 3ZDXE 2I5YL 4ZNEE 2RJMA 1Z9MA 1CFQB 1FNFA 1YPZB 1QEWA 3HE6A 3K4ZA 3BKCH 1MY5A 1DBKH 5HJ3B 3VXNB 5GPRA 3N85L 3EJYC 3R1GH 1P84J 2R0ZH 4MJ6B 3OAZH 1OAYH 3TVMD 4GRLD 4B53A 5HGDA 2P4AB 3CVIL 4XVTH 3QUKB 2PUQT 3FQNB 3DWTA 2NX5A 3OQ3B 5F1IB 2B8OT 3BD4A 5ILTL 2J8HA 1BQLH 5CBAB 4JEGB 3S34L 1HZHH 1WK0A 4IHOB 2ZUTA 2RQ8A 2KKQA 3U36B 2BCKB 1BQUA 4PJXB 4PJFA 1AXSA 5IM7A 5CD3B 1BIIA 4DKAA 3HZMB 5FYKL 1G0XA 1RURL 4P48A 4P99A 3PWUB 4JDZB 5KVGH 2J3SA 1N3NB 2K3TA 3O6KL 2WWKT 1SY6L 4I77L 2VUYA 1IJ9A 4WWKB 1JNNL 4CVZA 4L9LC 1N26A 4AL8L 3DX8B 4JLRB 5HI3C 3QR2A 2CXGA 5IFAL 1FNSL 3ULSA 3JTSB 3WUZA 3ES6A 2DJ4A 2ARJB 32C2A 4M7LH 5F7DB 4OCNC 1JGDB 4Y8DC 4M03A 4G7YL 3VFRB 4BZYA 1DTUA 5HSFA 4LL9A 2R0WH 1U3YA 1BZ9A 4XC1H 3GJFB 2X2YA 1CLZL 4E5XA 2BVQB 5I1LB 4ZMAT 2FH8A 3HI5H 5IQ9B 1MWAA 5GSVB 4NM8L 3X12A 3SDXF 3LQAL 4QHUA 1G84A 1CU4H 1E4WH 2ZPKL 5D70L 5FO8A 3EAKA 3ZDYF 3KXFA 1HHKA 4GBXC 4I0PB 4WO4D 1MCFA 1YN6B 1I7ZA 5E2UL 3VRLE 5ADPH 1INEH 3HG1B 2OL3A 2UZIH 1CICB 5HHNB 4EQ2A 1S7SA 1E6OH 1NJ9A 2CH8A 4ESKA 3RGVC 1A7NH 5FCUL 4DGVH 1U3JA 4HXBH 5C2BL 3PE9A 3L3IA 4QWWC 5EU5A 4AT6A 4I4WB 4FMKA 4PJAA 4X6EB 1DLHB 2WUBL 3CVHH 1FNGB 2YS4A 2GAZA 3N1MC 4G9FA 3CFKA 4KK5D 1KCVH 4BQ9A 1R3KA 5BMFL 4PJDE 3HMWH 5T33L 4PJCA 1JVKA 4WWID 4CDHA 2X41A 1GGUA 3QNZA 1KPRA 4U1HA 2DS4A 3WEXA 1IM9B 4NZRL 5DHVB 1HCFX 4HT1H 1KF9B 1T20B 5FKPA 3D3VD 1HH9A 2FHFA 4XXDA 4L29A 5H94A 4P2QB 2V9RA 3EDJA 5FGCB 4X9GA 1INQA 3NFNB 2IQ9L 1MI5D 1KPVB 2C1PA 1N59A 2XRAH 4OGYL 5J06A 2XYCA 1IRAY 2ZP0T 3EHBD 4NQTA 5LVEA 4YQXL 1G7IA 1A3RH 2EYTB 2R8SL 3C6LC 2XPGA 5JA9A 1GAFL 1YNLH 1C5CH 5KSVB 3VW3L 4XCEA 4Y4HA 5ANMA 1P5VA 5JW3L 4JFFA 2LTQC 3BWAA 4G80B 1QVOA 5FO9B 4QRPD 3VWJD 1VCAA 3JV5A 4GRLB 1NH6A 2XWTA 2HLFC 4MJIE 5C92A 3VU2A 1MFNA 1B2WL 2V7HB 3V6FA 3PGCB 4NFDA 1AHWA 3OZ9H 3BPCB 3U2SA 1FORH 4JRYA 1PG7L 3HUJE 2RCSH 1HHJA 2YPVH 5C0DB 2VNCA 1FCGA 2OL3L 4I0CC 4X6DF 3WD5L 3T0WA 3GGWB 3RWGB 4OZFG 2YWYA 3W9EB 2VQ1A 3QDJA 5D71L 5ENWB 3P4OB 1IC7L 4WEBL 1M7DA 2OR9H 5FFLA 2AEPL 1GHFH 4ZS6D 1A0QH 4ELMA 3JUZA 3MYJB 4W70A 1DBBH 2PN5A 5ACZA 4JR9L 4UNVA 1KYOJ 2DIAA 3VFVB 3EO1A 3TIEA 2B5IC 3CSPA 5CAYB 1FG2A 3IXTA 1MJ8H 4LHUA 3SOBL 2Y25A 3SPVA 3ULUF 4X9BA 1RIUL 3O0RH 3ZDXF 4V1DE 3JWOH 4IRSA 4XNMB 3LKSB 1T5WB 2FHCA 3DARA 1DBAH 2ESVD 3K1KC 1F6AA 5FYJL 3S4SA 5IHZA 4MB3A 5F3HB 5HPMB 3BSZL 4MJ2A 1S7UA 1QSVA 3BZFA 3CFCL 4OGXL 2Z8SA 1JTPA 2XTJE 1QOKA 3C2AH 4JKPH 5J1AA 4MLSA 5BS0D 2KZ1B 4OLYH 3MRBB 2ZOLA 4GH7B 1HOCA 3MREB 5L2KE 3WNOA 4BUGA 5GXBB 3O8XA 4P46C 4CGTA 1C5DA 1WBZA 5EORL 3K74B 3KHOA 3T0BA 2Z93A 2PCPB 4WO4B 1MCPL 3RTQD 1UZ8A 4UTBL 4K7PL 2W38A 1P6FA 1WCBA 4LDOB 1NCCL 3V2AR 1CL7H 1VDGA 3GSNB 1TDQA 5HHVL 1V3KA 4OLUH 2X1OA 4XCYA 1JFQH 4F2MB 3QRGL 1EGJA 5DFVC 4R96B 3EYOB 1H5BB 3J7HA 1B6UA 1R5WB 1TJGL 1EJOH 5EZOL 4BQ6A 1FG9C 3TT3H 1IILE 4ZPVA 3JWDH 5E24E 3QDGA 4NT6B 4LSRL 1NFIB 4NO5B 1AKJD 3MR9A 4S11A 5D8JH 4KK9C 2J4WH 1MELA 1KN2H 3DMMD 3MV8E 1XMWA 4R0LA 3OJ2C 3V0VB 4UDTB 2AK4D 3U0PB 1HQ4A 4HBCL 3T4YB 3BQUD 4HHAA 3BYYA 4JN1L 1QBBA 3B3IA 1WLHA 5KSAB 5IVNA 4YPGA 5I1CL 4WJ5A 1JYVA 3IJHB 3I85A 5CUSH 1NUDA 1XR8A 2D2OA 1U8OA 1CS6A 5EBWA 2C3GA 3D3VB 1OF2B 3GSWA 1A4JB 1TQCC 2DL9A 4R2GB 1WZLA 5D5MA 4C56D 4PJEA 4ODXA 3RWFA 3UJTH 2ZNXA 5ICXB 4PRPD 4WFEE 1I8IA 1MI5B 1Y0LA 4P5KA 3VGGA 2UWEE 4L8DA 3IRZA 4R9HA 5E9DD 1IARB 3WHE0 4GAFB 4NRZA 2DF3A 3VRLF 1F13A 4JAMB 4K3JH 3V6OA 2ORBL 4HGWA 2OZ4H 3C09C 1OGAE 4AIOA 2I9TA 1G0DA 4MQ7A 1D5XA 1R0AH 1FIGH 4QRPB 4MMZC 3VWJB 2BHUA 1CFQA 4QGYA 1YPZA 3VWKC 1DL7H 3RY6A 3WXVL 5T1LD 3QWOA 3H2WA 1G0YR 4P0DA 3VXNA 4UT6L 4PJDF 2AJYH 5HDQH 1BAFL 1DLFH 4J3XA 1LDSA 4BUHA 1EGJL 4MJ6A 1FLRL 1MFAL 3GZKA 1P69B 4KKAC 1I1AB 1XF4B 4FFWD 2VLJD 3MODL 4LSVH 1H3PH 5ID0B 3GBMH 5H35B 3QUKA 5SWZE 2VO5A 4WTXA 1F4YL 4XP4L 3FQNA 4S1QL 3VXME 2VZUA 2JLLA 5F1IA 3D9AH 5A3IC 4CRPA 4Z7QE 4RWYL 4BSWB 5CBAA 4KJWD 5EU3B 4OUUB 1BPVA 4HG4K 4TULL 4RFOL 2FJFB 1P4BH 4LQ1A 4LLDB 4PD4K 3U36A 2BCKA 4PJXA 2P44B 2Y06L 3O9WD 5CD3A 2HTKC 2VYRE 3HZMA 2Z31B 1WAAE 5D7LA 3PWUA 4XNQB 1QKZL 4M7JH 2Y36H 2ESVB 4S1SH 1N3NA 1DUYA 2FWOB 1QLEH 3JV0A 5E4EB 1DQDL 1OSPH 2YD3A 1U36A 3DX8A 4JLRA 3LEXA 4WU7B 3V9FA 4XPFL 3G6JB 3HLAB 3PJSB 1JYXA 5J6GB 3HCVB 1B4JH 3JTSA 5BS0B 5I1HH 2EEBA 3WNKA 3OMZA 2QQLL 5F7DA 5KVMC 1JGDA 1S9XB 2VDOH 3VFRA 4RFNC 2ADJB 2F5AH 2GIYA 3RTQB 4NUJB 5KTEL 3HUJF 3GJFA 3HE7A 5I8KL 2BVQA 4P5TC 4G8GD 4YXKL 5IBTH 1F42A 5IQ9A 5DMJB 1AR1D 2X1WL 4BQCA 1KB9J 4ZD3L 2HFEB 1OM3L 2CLRA 4F9LC 1CG9B 3KVQA 1VA9A 5GS0L 4PRID 4I0PA 2HT2D 1HWHB 4HUVB 3B8YA 1YN6A 5DMKA 2NYYC 1MNUL 3WFBL 4KRPC 4PJGE 4B41A 5HYQB 1ODAA 4HPYH 1GZQB 3VFOB 1A6VH 4XAWH 3HG1A 2AK4B 4MA8H 5HHNA 1F45A 1EDQA 5ITBL 3BQUB 4PP1D 2ICWI 3SBWA 4KK8C 4XMPH 5IB5B 4APQD 1PZUB 1ZEAL 3K7UA 1OAKL 3MLWL 4I4WA 1J8HE 4X6EA 4CMHB 1DLHA 4WFGD 5FGBC 2VDKL 1FNGA 2FECI 1RZGB 3CMGA 3BPLB 3FT2B 4QHKI 2DIJA 5GS3A 1B0GB 4DUXA 4C56B 2DQCL 4FQ1L 3KG5A 1OWRM 4XHJC 1FFQA 4F33B 3F6LA <