1T0MB

Conformational switch in polymorphic h-2k molecules containing an hsv peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title The structure of H-2K(b) and K(bm8) complexed to a herpes simplex virus determinant: evidence for a conformational switch that governs T cell repertoire selection and viral resistance
pubmed rcsb
source organism Mus musculus
total genus 15
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t0mB00
4KU1A 5SWQB 4OM0H 2OSLB 1CD8A 4NGHH 4M7LT 1F58L 1JNJA 5CBEB 4OIIH 1QBBA 4LRNL 5D6DC 4N1CA 4YXHL 3B5HA 4ZD3L 2LTQB 1GZQA 1KG0B 2C3VB 3DV4B 3HZVA 5FO9A 4DVBB 4J4PD 4LLAA 3WUWA 2R2EA 2J8UA 5ALBH 1WBYB 5K9QI 3K1DA 2AGJL 2F19H 1TJGL 1NGWA 2AEPH 2ADIB 4YAQA 1KJ2H 4KXZH 1LEIB 3WLBA 2EXWC 1MUJA 3ARZA 2XKNB 3CFKB 3UTSB 5DK0A 1P7HL 2CK0L 4TSCH 2A9NL 4O58H 4PJIA 4QRTB 1TZHA 1KEGL 1D5MA 2VLJB 3VXNB 1FBIH 5L2JB 4NDMB 1D5ZA 1T20A 2IBGA 3VFSB 3W9EB 4ODVL 2FH6A 5EC1A 4ZFGH 3N1MC 1LDPL 4U33A 3MYJA 2B7DT 3TLRA 3B9KB 4P59L 4LVOC 2V17L 4NZUH 4L8DB 4R3SB 2Q3AA 3BPNC 1HKLL 4JPKL 4YEFA 4YXLL 1U8MB 1HNGA 4EN3D 1LO0L 3L3GA 1B0RA 1KUMA 5IMOB 4PJEE 3FB6A 3ARTA 2UYLA 2J8UF 3X11B 4QWWC 4IOSD 1JHTB 2E7HA 5ANMA 3DX7B 3QQ9C 4W68A 2EE3A 1F6AA 3BOVA 4PJBE 1ACYL 3WFHA 5EWIL 2VISB 4JHZA 4LL9A 2B20A 3ELAT 5CZXD 5MEQA 4PJIF 3I3BA 1RZKL 3GSNL 1ES0A 2ZOKA 2BVTA 3O6FA 3ZYIA 3H42L 3Q5TA 2QADB 3PWPD 3QCUL 4P4KD 3KJ6H 3CVHB 3HLAB 4FFYL 4PJFE 5FM5O 5F7KC 3E1F1 3P2TA 3T04D 3VXPB 5DZNA 4BSJA 3HFMH 1UZ6F 3RQ3A 2OS7A 2R69H 3V4PL 4KHXH 5IMKA 1ZHNB 3ES6A 5C8JA 1RJZA 2Z92A 3MBEA 1KTDB 1H3WM 4XCCL 5ACMA 4PRPE 3I75A 3TBVB 2FHCA 4HH8A 1FVEA 5CBAB 5C0BD 4QGTA 1HK6A 2D9CA 4EIGB 2ADJB 5ICXA 1T03L 5CP3A 1UH4A 1YN6B 4N0UA 4F58H 1I4FA 4RFOH 4O2EB 1FZKB 2WMPA 5BMFH 3BEVB 5CGYC 1EXUA 1ZT7B 5J13B 3UXFA 5EZOH 3PWUB 3T4YA 4ZAKA 4D0DA 1X7QA 5JA8B 2Z31C 4KK6D 4OFPA 2V2TB 5T1KB 3BD5A 2DQGH 4NIKB 1B2WH 2WIIA 1NCWL 3T1FB 3D87B 5K9KB 1W72A 1WFUA 2GITA 3DV6A 4NPYA 4EDWH 3EJYD 4MNQA 3H3KA 5JOFB 4NQCE 1QFWM 1QBLH 3AS3A 3QXDB 2FX9H 2Y36L 3T0EE 2Z93A 3QCTL 2YD7A 4D8PA 3MUJA 2APTA 4RA0C 1NANH 4FG6C 1ORQB 4JKMA 1R3JB 4F3FB 1CXHA 3VGAB 4G7VH 2EKJA 2QSVA 3W2DH 3DBXB 2VZTA 2O93L 2IWGA 1QFWH 4IJ3B 3G6JB 4FQXA 2YC1B 2YWZA 4HC1H 4JFEE 5GRJL 3HC3H 1VB9A 1HOCA 3MJGX 3NZHH 2VIRA 3ARXA 1IGYA 3VCLB 2E6PA 2XY1A 2WBJA 1U8NA 1JTOA 4GRMA 5BS0B 4MLSA 4PS4L 2OJEA 4P2YA 5KG9A 1QLRA 4Y1AB 4YXKL 4ZFOL 4E0RA 3X12A 3VFTA 1MRDL 2X4QA 4JRYA 2Y06H 3SPVB 3WKML 1TZIA 5IB3A 3NCMA 4NQDB 3B8SA 3QUYB 2CPCA 3ECBA 3TH3T 3HR6A 5BRZA 1UM6H 1UXWA 2ICWI 4MJIE 5CJOL 3ULSA 1WFNA 1KTLA 4HV8B 4UDTA 1J05A 1N8ZA 3GSRB 1ORSB 4NHUB 3AM8C 2ZG2A 1T5WA 4QWWD 3T08A 3U9UB 3ME0A 2NY3C 2NYYC 1IT9L 1BIIA 3VFPA 3QQ9D 3L5WA 5GGSA 1DLFL 1BFOA 1BZQK 2DLHA 4HLZG 1MI5D 2BCKA 1JYVA 2E6JA 3NH7H 1T1YA 4KK5C 5CZKA 1XR8A 3MRDB 5FUOL 5HYEA 3B5TA 2V2XA 5KW9L 1V3KA 3EYFA 5J89A 4F7TA 2FGWL 1MQ8A 5F21B 1QBML 1INEL 3HMWH 4U6TA 1JWUA 1U95A 3R8BB 3O3DA 1IQWH 3WFDH 4KZDH 4KJPC 3RIFK 5C2UB 2CD0A 5KVDL 3V0AC 4JFZH 5F8RC 2X4PA 5HDBF 1BZ7B 3WNPA 2B1AL 5C7XH 4U7KA 3BKCL 3KLHC 5DFWH 1CT8A 1I7RB 2VDRH 4ISVB 2EDEA 4WHTB 3V79C 3RP1A 2Z8RA 5FB8A 5D1QB 4OFYA 5E1HB 2IH1A 4YHML 3UBXA 1QLFB 1RVFH 2ADFL 2X9XA 4IOIA 4XNXL 4Q9CA 4TNVK 1C08A 1OP5H 1G7MA 3RVTD 1K8DA 2FLBT 4YGVA 1GOGA 4DW2L 3EO0A 4NJ9H 1I8KB 3HZKA 3C5SB 4ODSH 1A6ZB 1F4XL 2D7OA 3TC9A 3ZKSD 5D9SB 5CGYD 3M8OH 3OJDB 3UZQA 3Q48A 4TQEL 3T8XA 5KN5B 15C8L 3KJ4B 4GRWH 4HD9A 1A22B 2Z31D 1YEJL 2OL3L 3FN9A 2P5EB 4XPTL 2R0WL 2LVEA 2AS5M 3MA9L 1FFRA 2J3SA 3V7AE 1XF3B 2EYSB 4PRID 5IQ7L 2NTFA 1U8PA 3MODH 5IQ9B 4KUZH 3I3DA 4LSUL 4QF1A 3ARFC 3ARSA 4JVWA 1R5IA 3ZE0E 2BRRH 5FUCE 3C09B 4BZYA 1BAFL 2MHAA 4P4RA 4HBCL 4RMSA 4IRSA 5HVHC 3FMGH 4CN1A 2Z35B 4UV7H 3TVMB 2IG2L 4FMKA 3QFJA 2VWEC 4XH2A 3LN9A 1AXSB 2O5YH 2F54E 5TF0A 2BNRA 4GRWE 3MGTB 4FG6D 1WBZB 1IGTB 5DLMH 1HQ4B 3IFOB 4M7KH 5GGUB 4ELKB 2R1XB 3MUGA 2K7PA 2E9BA 2B8OT 3S98A 4XX1G 1Q72H 1KFAH 4YFLI 2HTLD 4HPYH 5GQBA 1KN4H 4OAWB 2AJZB 3UCRA 4LCYB 3FN3A 4U1JB 4MD4A 1OD7A 5AG8A 5C9JB 3VMNA 1I7TA 1UXSA 1QSFE 4JHAL 1CDHA 1MLBA 5DK2B 1F13A 3D2UB 3WDIA 3QDJD 3S7GA 2Y25A 4GW1A 4JFHE 4XP1H 2X4SA 3G6DL 3IFNL 3PV6A 5IV2B 1X5FA 3ESVF 5C09E 3PDOB 5I8CB 5EZJA 5HHPB 2VLME 3TEUA 1MPAL 4I0PA 4FZ8L 2LQRA 4LLMA 4YPGB 1NL0H 1ZTXL 4DKFL 5L2KB 2CR6A 1B6DA 5BQ7B 4FFVD 5GSRB 1A47A 1KJMA 4X7FC 1NAMA 1FO0L 1F4AA 3LQAC 1R5WB 2BNQB 3FQXA 3I6KA 3HG1B 1LWRA 1FL5A 1MCPL 4HSQA 4QHKJ 4TULH 4LCUA 4J1UB 3UPRA 1QKZH 3JVGC 3VMOA 3HTLX 4RMWA 3IJHA 2JF1A 3GRWL 5I1EL 1BD2A 2P8MB 1VCAA 2BY2A 1GGBH 2OTWB 3PHSA 3C87A 1HYSC 3WXWH 3E8UL 3SDYL 5L8KB 4XTRC 4A2MA 4HHAB 5D2NE 2J5LB 1ZT4B 4X80H 4CADA 5F8QC 5HPMA 3P4OA 4LCWB 1RUKH 3QG7L 1NH6A 2QKIA 4K3DH 3V0WH 3S5LB 5T5FL 1NMCC 3Q5OA 3QQ3A 1HH9A 4U6YB 1CF8L 3L3HA 4XPHL 5HY9B 1IAKB 2BSRA 3LD8B 5GS0D 4WY7H 1HZHH 4JDTH 4JFFE 2XNAA 2BOCA 2IC2A 1CBVL 4MXVE 5DYOB 3FAXA 2AJ3B 3BIKA 3B83A 2XFXB 5DFTA 4YO0B 4H8WH 3JSSA 1TCRB 3S3PA 1EAPB 3JWDH 4MD0A 1J5OH 4Z7NF 3GMNA 1Q9WA 4NO0A 3SEPA 3CFDB 1WLHA 1YEFH 5BV7H 1ND0B 3RL2A 2MWCA 2E8ZA 1AKJD 1S8DB 2F9BT 5EO0A 5FYLH 1KB5B 5JQHC 3C2SA 5LGJB 1TPXC 3ARFD 4XP5H 4JJ5A 3WIFB 4LASL 3RWHA 4TUOA 3OKLA 1YMHA 2CLRA 1OF2B 1XF4A 1MJJB 2GAZA 3U4BH 2X89A 4MA7H 1EHLL 4PD4K 1JHKH 4BFIB 3SDDC 3IS1X 4ZUWA 4DFIA 4YLQT 5TE7H 1DSFL 3EOAB 5H35A 2HT4C 2YSSB 3GIVB 3MROB 1BQSA 5FYLE 1H5BC 4Y19D 2XKSA 2HLAA 1DBML 1F4HA 1UWXK 5H2BB 5E4IA 3OKDB 4WEMB 2OX5A 4M1CD 5CEZH 3WEXB 3C6LC 3QEGL 1WUNT 5CD5C 4MD5A 2EXYD 1HQRA 5C0CE 2MKWA 1BJ1J 3SCMC 1CFTA 1CU4L 4PJ9C 4N0YH 2P5WA 3CFJA 2HFFB 1NBVL 2WINA 4P9MH 2X4TB 5GGRA 3NFPA 1FC1A 3EYUH 4XC1L 2HMIC 4Z8FH 4L4VB 3GSVA 1GPOH 1HEZA 3ARBD 3KPMA 4NZRL 3WV0A 1A1MA 1YQVL 4NO5B 5IW1A 3EDFA 3NVQA 2DQJH 5CEZE 3GSNA 1OT2A 2A83A 1U2HA 4UUJB 1XIWD 4R7DA 2CIKB 2X1PA 2Q76A 4XAKD 1RPQA 3BYTA 1SY6A 1MFEL 1PY9A 3IJSB 5GS0L 1IGML 5DJAB 5F97E 5ITFB 2AK4A 5HYJB 1HYSD 5EOTB 4O2FB 4F7PA 3H9SD 1QFHA 5FXCH 3T0VA 3W0WA 1JVKA 4XWOC 5CWSB 1DUZA 4XTRD 2HKFH 5F70A 5HJ3B 3CC5A 3MC0A 5B8CB 4XBEL 4PGEB 4RGOL 5DVMA 3MJ9H 4I3SL 4R8WH 2OCFD 4DGVL 2DD8L 4BQ9A 1N26A 1MF2L 4FQIL 5D5MA 5I1DB 2DBLL 2PXYB 3MBXL 5GRYA 3QJHB 1KOAA 3UTPD 1C5DB 2V6HA 5IHZA 4J4PA 3V0VA 3HPLB 3BAEH 3EOTL 3MV7E 5FDYA 1AI1H 3HCVB 4H20L 2ZUYA 2WW8A 2QTEA 2E7MA 3BZFB 4LHUG 2HKHH 1J10A 3U2SA 3S9DB 3PGCA 4LSPH 3RWJA 1XGYH 4LCCC 5LBSH 5IFAH 2X4OB 1BVZA 2VXQH 1A6VH 3C5ZD 5IMMA 1S9WB 4QNPE 3L3IB 4ZMAT 5F7DA 4RQQA 5FDWA 4HWEL 2W07A 2DS4A 1E6OL 3RGVC 4Y5YA 1ZANL 3QXVA 3O0RH 2AABL 2CJUH 2YBRB 1TNNA 2D31A 4YUEL 2QQNH 3KYAA 4EN3A 5D5MF 3HUJA 1MJ8H 3WS6A 2QSCL 1DBJL 1NFIB 2BX5A 4JM4H 4O2CA 4GLRI 1BF8A 3V8OA 1WT5C 5DUMH 5AYUH 3DRQA 4KPHL 2WLYA 4IS6A 2GJZA 1GOHA 5ITBH 1AQDB 1F4YL 3G5ZB 3R06B 5GISH 3ILQC 2X1XR 5I6XC 2VRAA 4M6AA 2HFGH 1P9MA 2A74B 2VLRE 1H3VA 2CDFA 2X7LA 3SGEI 3PWPA 2UWEB 4JPVL 4P4KA 4UQ2A 4LVOB 2AJVL 3ESUF 3HNVL 5CD5D 3QNYA 3BPNB 4ZS6D 4PJ9D 2GY5A 4I0KA 2BERA 1OGAE 1KYOK 5JPNA 5I8EB 2AJYH 4X6DB 1MCBA 5AWNL 5KS9B 4JN2B 5BXFA 3HUJF 1T2QH 1TVHA 2OTUB 2WAHA 4JY5L 1OOAA 5I1KH 4HZAA 5E5MB 3L3OA 3QDMD 4CDHA 2EO1A 2B39A 5C0BA 5DD5H 4P2RD 4X98A 4R26H 3T0AA 4JFOA 3KWWA 1RZJC 5E5UB 4K7PL 2VQUA 4LGSB 1MRFL 2AI0L 4WFHD 2GI7A 4NP4H 2WQ8A 4NWUL 1LEKA 4EBQH 3KYOB 2YPVL 4HZLB 1YNLH 4XWOD 3MRKB 1U58B 1Q38A 4NUJB 4HFWA 4PUBL 3KXFD 3VRLF 2IMMA 3DXAB 2NX5B 3CDFA 4F2MA 5L8JB 3BKML 5GGVH 4JCMA 2HTKD 3FO2B 1K4DA 5DD0L 2MJWA 4LFHD 5HHXH 1D3CA 6CGTA 4X6FA 1ZLVH 3BI9X 3U6RB 4HH9A 1QQDB 2MQCA 2VYRE 3BGMA 5LGHL 2IPUG 3NCCB 4PJAE 3KYNA 5HGDA 4L9LB 1E4KC 1KJ3L 3OR6B 3KGRA 3G5VA 2LAGB 3MREA 3BE1H 3DI3B 2CKBB 5D7JD 1BEYL 2UVEA 5ELIA 5EUKA 1BOGA 1JF5A 2YD1A 2YD2A 4EUPA 2YUXA 2A9MH 1UWEH 2DQTH 1F45A 1FE8H 1WITA 4U0QB 5EZLA 2OL3A 5T3ZH 2EIDA 1EVUA 3HE6B 2I07B 2F8VA 4QTHA 1VDGA 1M7XA 1ACZA 1U8JA 3QXAA 4NRZB 3D39E 3I6GB 4LPCA 1FGVL 2VXSL 1WWAX 1UYWL 2EZ0C 2GIYA 4AH2B 2YA0A 2R4SH 1J0IA 2D0HA 1G7JA 3U0PB 1F97A 4L3EE 4MGXA 3EDKA 3CZFA 4LHJB 3PWLB 1N0XH 5E2UH 3MRLA 2FJGB 3VWKB 4NUGH 2GK2A 4OCRL 5H37H 2I27N 5T3ZE 5FYKH 4WUUE 1FV1A 1KLUB 3L1OH 1GAFH 1MREL 4N8CL 1FFOB 4P23D 5DGRA 3BT2H 5MERA 1A1NA 4QRSA 5H8DA 1FPTH 5EBWB 1MFCH 4P2OC 2K1MA 1HCVA 4L8BA 1MI5A 2AAVA 3UTQA 3W81A 4GXUN 1M71B 2EH8H 1L7TH 4Y2OA 3DX8A 4FTVD 4ODTH 5FYKE 4IM8A 1RZ8B 3B9DA 3V5KB 4DN3L 4LP4A 1FFPB 4P5TC 4JRWA 1S7VA 3GGWA 4OCLC 3O3AA 5DD3L 3TBYA 5IOPB 3H8NA 3RU8H 4D0CB 2QSTA 4MNHA 1S7RB 1S7QB 5SV4A 5I17B 1FJ1B 4Y5XC 1XZ0A 5JDJA 2PR4L 1LGVA 4JVPA 1M6OA 2F5AL 4BSVB 1ZEAL 1MCKA 4LDLB 5ESAA 1FO0A 3E6HB 5J7CC 5L88L 2DLIA 1RUPH 2CIIA 3QI9D 3IDXH 2NY3B 5J0BA 4NYLB 5DQJB 2R0ZH 5I15H 1T22B 2VMFA 4JFDE 4U1MB 5F9DC 1HSBA 4ORGB 4I4WB 1MCJA 3NABH 4HPOL 5HI3C 4LARL 9CGTA 4K7PY 3GRWA 3ARRA 1EERB 1B6UA 1MIEH 5C08D 3PWVB 1JK8A 4YHLH 2CLVB 1MHHB 2YN3A 3JWOC 3CDYA 5FKPB 4M6MH 1QSEB 4V2BA 3TT1L 3FFCD 1YEEH 1J0ZA 4L3CA 3AB0C 1A7QH 3OMZA 1T4KB 3P4NB 1NCTA 4JHWL 4TN9A 3VE0B 4PRNB 1DE4A 4HUXA 3MRRA 3ZE2F 2Z31A 1S7UA 2JKXA 1YY9C 1U6AL 3NCFB 2H6PA 5IVZB 1B4JL 5F1IB 1G7QB 4DQOH 4PRIA 3D18A 3BH9A 3MFGB 3UTSE 4NOBA 3BP5B 1IL1B 1KPRA 4Z76B 3EJZC 5F9WC 4XPBL 4Z0XB 4PJCB 3GNML 4J8RA 2VLJE 3BP4B 1YECL 4H26B 3BPOC 3C6SB 2FO4B 2D0GA 2V7HB 2DTSA 4PRHD 5D7KE 1YN7A 3EFDH 1KLFA 1PZ5B 1EPFA 2NR6C 2L0DA 3O41A 4H1LG 1KELL 1Z5LA 3OHXB 5LG1A 3CX2A 5EBMB 4MLIA 1OAXH 3X3GH 3IDYB 3KYKL 5EU6D 5IKCA 5IW6B 1GZPA 4I3RL 1DQLL 1Q9KA 3ORJA 4HK0B 5JO5B 2BDNH 1FDLH 3GJFK 4RFNC 1QRND 3DURA 4QRPB 3MV01 2EZ0D 3ULVD 1GGCL 4WHDA 1PG7W 3HNTH 4OV6F 3MOAH 3U7AA 1A0QH 3VG0L 3AUVA 3RA7L 3QDJA 5IFJA 5FUZH 1WZLA 5HVHB 5FO9B 4M48L 4DZ8B 2FX7H 4MAUH 1UKQA 1N4XL 5JLZB 1VGKA 1YEIL 3MJ7A 3C8KB 4HWZA 4QXUH 4U6XA 4UT9L 1WISA 1U8LB 2YRPA 1UH2A 4M7JH 2ARWA 4JRYE 1QR1A 1NCAL 1XGPA 2VR9A 4G8GD 4WEBH 4YFEA 5E5RB 5IW3A 4PJIB 4AMKH 4D3CL 4LKCA 4ODBD 3VFMA 2H9GA 2JJSC 4PR5A 3QIWC 3TCLA 2KPNA 3F7QA 3UYRH 3QWQB 1T20B 4QEGA 5TDOB 1VSCA 4JQXC 5EFIB 3QEHA 4KRLB 3MRFB 4L5FH 1K4CA 2X10A 3IFPA 4XNYL 3UTZB 1RZJL 1ZLSL 1MFNA 5T33H 1A9BA 3IETA 2P47B 3ZTJH 4JG1H 4AM0B 3L3GB 1B0RB 4M5ZH 1MFDL 3P0GB 4NO2A 3C08H 1AR2A 3BN9D 3ZZ1A 3FQRA 3RVVC 4DGIH 2GJ6B 4ZUVA 4AEIL 2QJDA 2FSEA 4QHNB 5TFSH 3EGSB 2ICES 1QFUL 2VZSA 1X4XA 2A2QT 4F7EB 4CMHC 1F6AB 1CGSL 5F1NA 1MHPL 5DMYA 1QEWB 1S9VB 4P2QB 1CLYH 1RIVL 1LD9B 1A4JA 1F8TL 1IGIL 4HWBH 4NKMA 1SEQH 8FABB 3WN5C 3O6FB 3MNZB 4KKAD 3N85L 1ZGLB 3D3VB 2BXYA 3TBWA 1I9RL 1YEGL 5JMOC 5DEGB 5GS1C 3EO9H 5TF1H 2PYEA 3FQTB 4M1GH 3MRJB 5K59E 2WUCL 3FOMA 5TJWK 5F1OB 1WK0A 2X5PA 1AKJA 2BSED 3ZDXE 4EUPG 5JTWA 4MJ5B 3ARFA 5I66B 5TGBA 5D7LB 3VFWB 4GLRH 3BMWA 4FQCL 1FORL 4PFEA 4YHKH 3I75B 5DURB 3RBGA 3HB3C 1P84J 1SEBA 3TESA 5BS0E 2PTTA 3V4VH 2MTPA 2HA1A 4RIRB 5ICXB 1C5BH 2NR6D 1MSPA 1E6JL 3GSQA 2AK1H 1A3LL 4EI6A 4NQDE 3SGEH 4Z0BH 2BMKB 5HGHB 1V5JA 2NQCA 3LQMA 2X05A 3T4YB 4Y19A 5DEFB 4D0DB 2OR9H 2H26B 1RUQH 3VD3A 5HDQL 5F96L 3UZVB 1T0MA 3MGAA 1DCLA 4OCXL 3AVEA 3QUKB 3CFBA 5IESH 1TPXB 2YUVA 3DV6B 4FN0A 5DDHB 1J0YA 1OAKL 2EDYA 2YPKA 3HMXH 1W0VA 5IB4A 4O9HH 2VH5L 3V5DB 3SDDB 1JTTA 2Z4QB 4S2SB 3UO1H 4G5ZH 4CUCA 5IIEB 1R24B 4XPFH 4CU6A 4Z9KB 1YPZA 1SYVA 2E27H 3ARBA 3AMKA 3L5JA 3MRIB 1NBZA 5ADOH 1K85A 2IADA 12E8H 4TSBH 2D7TL 1H5BB 4OQTL 3TN0C 1XIWA 4JO4H 2Q7NA 4UV4H 1T1ZA 3N1QC 4I9WD 2VR4A 1T04A 3JVGA 1U8NB 4Z7WE 5C0GA 1NCDL 1C7SA 3C6LB 4N68A 4UNVA 4JM2C 5EOCL 1XF5B 3SCMB 3JWOL 3H9SA 5MENB 2D03L 2AKRA 1J11A 4M4PA 1HILB 3AMLA 4MJ6A 4N9GA 1X4YA 3QRFM 1UT9A 1QFOA 3L5HA 2CLZB 4EXPX 4LRIA 4TNWK 4GMTL 1NGQL 3RWIB 4JO3H 2NXZB 1RK1A 1ZHKB 1GHFH 4PGZA 1G6VK 4WNQA 2JB5H 4AG4L 2BJML 4XP9L 4S0SD 5CAYB 1N5YL 4UTBH 1MEXL 1G7LB 1UB5B 2Y72A 2ZOLA 4JAMB 2CUIA 1YPZF 2P5EE 3H6JA 3MRHB 4JDZB 3O3UN 5F9OH 1VADA 4WDIB 3O3BA 3ARPA 1TENA 1T1YB 3IGAB 1P7KB 1F58H 3S36X 3MLRL 5DQ9A 1O5DT 1Z9MA 1NDMB 2OZ4A 4OFDA 2IFFL 3A67L 4UILL 5CEXB 5CEYB 3VW3L 2NCMA 4YXHH 1I3RB 4ZD3H 4LLWA 5HGBB 3D0VB 3WJJC 1WWBX 1XR9A 3GBNH 1DQJA 4G6JH 3PJSA 3GZKA 1GCFA 4LHQB 3BKJL 1IGJA 3C5ZA 2MPAL 2AGJH 3FB8A 43CAA 1TJGH 3RKDC 5E9DD 5IMLB 3SO5A 3WIHH 5JOPE 1I3VA 4HIEB 3TO4D 4CVZB 4TVPD 4P48A 1PYWB 4QOKB 3VXRD 1KT2B 4I18C 2A9NH 1FNSL 4AK1A 1LILA 3MXWL 4LLYB 3RTQD 2IANB 4F7CB 5I0DA 1KEGH 3JV4B 4JPIA 5BCAA 1JNHA 5J12B 5DS8B 2EDNA 4AIXA 2VLLA 2RJMA 4ODVH 5E7BA 1HWHB 1LDPH 1L0QA 2E9JA 2V5SA 4LCCB 3BQUC 4MYWB 1F4WL 2ZCLL 1PY4A 1U41A 2HVJB 4KROD 1HKLH 4JPKH 4HJJL 1DN2A 3VXMB 2D3VA 4YC2B 2Z0BA 2K7QA 3BXNB 4LSSL 1FZOB 5L2KE 3G5XA 1FL6A 5DHXB 1XCTA 4DTGL 2D7PA 1Z6JT 2FL5A 5DD6B 5DJ8B 4WUKL 3TJHC 4X6EB 3MRMB 4LHUB 4N90E 5KTEL 3UAJD 3RGVB 3PP3H 1KB9J 5DJYA 2MCG1 2YD5A 4GSDH 2BNQE 2DL9A 3HG1E 5I76A 1ACYH 4P4RB 4PJ9A 4XGZB 1T7YA 4HUWA 5EWIH 3S37X 1R3IH 5L8LB 1Z9OA 3EOBB 4F33B 1IM3A 3VH8G 3N0PB 1T5XA 1MHEA 1JZ4A 1MCOL 2ZUUA 1OSPH 1I8IB 2EKSA 5I75C 1E28A 3A6CL 3BX7C 3H42H 5ISZB 3QCUH 4HS8L 5ERWA 3SE4C 3VRJB 1CDUA 4FFYH 2ATPB 2FBJL 5TH2A 3MGOA 4PJGA 5SX5K 3QDMA 4GAJL 4R4NC 4X5XA 3ETBF 4P2RA 2F53E 3SQBA 3TN0D 5I6XB 1JPFA 3V4PH 4YHPB 3GI8L 1ROWA 1CFSB 2VZUA 4HDIA 1I8MB 5JHLL 5F9JA 4KTEL 3B43A 1JZ5A 3BWAA 2DMBA 1UB6A 3OJ2C 4XCCH 4K94C 2VITA 1IGFH 4KI5D 2DQFB 1T3FB 5FK9A 5MEOA 2NW3B 2X2YA 1KCLA 1KCVL 1T03H 4Q9QH 3QT2A 2NY4D 2AQ1A 3KXFA 1JV5A 3ZDYF 1PW3A 4P46C 3W11C 1GOFA 2EH7L 4X4YA 3W0WE 1NCCH 2FDBP 1D5BA 3P9WB 4MVBD 3MRQB 2LAAA 1NAMB 5ILTL 4TVPL 4JQVC 5C0EB 4RGMC 1YMMD 2O5ZL 4OLYL 3T09A 4PJGF 1ITCA 5D7JA 4IDJL 4WTWA 3QJFB 1I1YA 5GRWA 4D9LL 2X4RB 3IJHB 3HNSL 3WHXB 1BD2B 1CD0A 1H8SA 1LVEA 3TA3C 4CAGA 1IC7H 2W60B 3L95A 2Y36H 1TVBA 3HZMA 3QCTH 4JZNA 2WP3T 4GMSL 4WWID 1Y0LB 3K4AA 3VD7A 4RGNB 4L9DA 1ZA6A 2EIBA 3GSXA 3CFEA 4XPAL 3MO1A 1BGXL 4CRPA 3TH2T 3ULUE 1A5FL 5GRJH 3O2WH 1I8LC 2VN7A 1EGJA 1HHHA 3PE9A 1Z3GL 3EBAA 3I9GL 3HS0A 4P23A 1IEAA 1NFKA 3T0DA 3DROB 4Y4HD 5JXAL 4R96B 5F6HI 4M61B 1QYGL 4YXKH 4QXGL 1BF2A 3G9VA 1MRDH 3WKMH 4MXWL 3BQUD 3BP7B 3IJYB 4NKOA 4BH7A 1PBYA 3SKNA 2XZAL 3MNVA 1TTFA 1AJ7L 1UM4L 3LEXA 3QXTA 5HYIA 3PV7A 5CJOH 2BC4A 2QR0A 1CLZL 4FTVA 4HFUH 4UU9B 5C0AD 3TJHD 4MZ3A 3P77A 1YDPA 1CDIA 1IT9H 3CSYB 3PHOB 4PY7B 4JJ5B 4O4YH 5KVMC 3LRSA 1OSZA 2GUOB 4ZO7A 1DLFH 2JJTC 2W65A 5JQ6H 4YBHA 5IM7A 3EIFA 3BSZH 5IK3B 1TIUA 5KW9H 4KZEL 5CJ8A 2N7BA 2ZJSL 5HBBA 2MOVA 2FGWH 1QBMH 1RU9L 4OGAC 3QI9A 1INEH 4RZCA 5HYJE 1QPPA 5DD1L 1BVKA 4P2OB 4WI9A 4QKXB 5H35B 3U30C 2YA2A 4ODHL 1EEYA 5A3IC 2YK1H 3DVNA 5KVDH 4CKVX 1IGCL 1JWSB 3J7HA 4XI5C 1K2DA 1OCWL 1BX2A 4RWHA 2HT2C 2B1AH 2FJFB 5C08A 4XRCB 5DJ6A 2BSSB 3QNZB 4OSUH 5K9JH 3FKUS 1IFHL 4P5TB 5C6TL 3FFCA 1GJIA 1MQKL 4MDIA 3FT4B 3V6OA 2VQ1B 3P0YL 5FM8A 2ADFH 4ZUSB 3CUPB 1A9EA 2C9AA 2G2RA 4Y5XB 4MWFB 3HPJA 3CFJB 4X7CC 3IKCA 1MY5A 2NY0C 2YOCA 3O11A 3KPLA 4DW2H 4LLQA 4Q6YA 4PP1C 5ACLA 4P46D 4UDUB 1F4XH 3W11D 3K8KA 1EO8L 4FABL 5E03A 1NMBH 4OJFL 4JFPA 5IGXL 4TQEH 1IM9B 15C8H 1K8IA 2AVGA 1TJIL 4PRHA 1CDYA 2IMNA 4OM0L 1E4KA 4Z78A 4F80A 4XPTH 2X44D 4WO4C 2R0WH 4OIIL 5TDNB 4XZUB 3FN0L 5IQ7H 4U1NA 4LSUH 3AB0B 4PLKC 1BAFH 4HBCH 1NCUA 3CCHB 3AS1A 5EU6A 1JRHI 4HWNA 4I2XA 2F19L 3X14A 2H41A 3B9VA 1XF2B 3NPZB 5KAQG 3T0ED 1QRNA 4BSWA 1FCCA 3CC5B 3LAFA 4GS7C 4MCZB 2V9RA 4P9HC 3ZTNL 1WFOA 2D9QB 4UOJA 5F9WB 4FXLA 3PHQA 2AEIT 4K3EH 4TSCL 2DKSA 3RZCC 4A6YL 4LDEB 4FQQB 5IHZB 3MJ8A 4Y5VC 3BPOB 4NQSB 3GJFA 3QPXH 4JFED 1WQVT 4ZSOB 3LOWA 2UWEE 4UAOC 3TIEB 4J6RL 4U6VH 1G1CA 4XBGA 2ATKA 4JO1L 1KXTB 4JHAH 1CDBA 3KPQA 3OXSB 4NZUL 4G8GA 4RFEB 2UY7A 2JCCA 5DJCA 1GGUA 4AYFA 1PG7H 2GTZA 1JWMB 3IFNH 4X6CB 2PNDA 1N3NB 4HAGA 3IU3A 4RFNB 1CFNA 4RRPA 5DRWB 3UP1A 5KS9E 4R0LB 4YDJA 4QHLB 1MPAH 5F7DB 2ZSVB 4FZ8H 3P73A 1NEZA 4G80B 3V7MA 1AGEB 2OMBA 4RQQB 4XMKH 1NCNA 3OGCB 1SYSA 1MI5E 1FO0H 1RQ5A 3BMVA 4U1KB 3ULVF 4W6XB 3VRIB 3AREB 4NN6C 3MRNA 4MCYA 4U1HB 2D31B 4APQC 3VXUB 5EC2A 4ENED 4K94L 1F2QA 2BNUA 3ZE2E 4WU7A 4F8QA 1IZKA 3LVEA 2BHYA 1S9YB 5EU3A 3GRWH 5I1EH 4OQTA 3GB7A 3BD3A 4U1LA 1QPXA 2R56L 3E8UH 1UJ3C 4IEFB 3SDYH 1S7WB 3HFML 2HFEA 5IJVA 3UROR 1P69B 2JCCF 4N0FA 3QIWB 5HI5C 2NX5E 3NN8B 4PTTB 3KS0H 4JANB 4HG4J 3QG7H 4NCC1 3SKMB 4K8RC 4RMUA 3LKNA 5F7EL 4HKXA 4WHYH 1CF8H 5FIEA 1FQ9C 4XPHH 1ADQL 2P7TA 3CDGB 3FONB 1BBJA 1CBVH 4PRBB 2NY0D 5F3BA 4I48A 4RFOL 3P9LB 4H5SA 1VERA 4CVWA 5FO8B 3NPSC 3MLZL 3O45B 3OXRA 3NACL 4D0BA 1BMGA 4ZG1A 4CMHB 4OGYL 3KPRB 3QO0A 4MA1C 5JNYB 2E7LC 2PO6D 1UZ8A 4Y4FC 1AXIB 1RJYB 4OZ4B 3QEQB 4DAGL 4RDQF 2DI8A 1WAAE 3QAZC 5EZIH 1K9TA 3WJLC 1R3LB 2QHRL 3RVWD 5JZ7D 1DQDL 4Y89A 1AFVL 3P40A 3H9ZA 4PLKD 1U92B 2QHLA 1U8OA 5INCA 1CE6B 1HHGB 2K3TA 5ADPH 3QULA 5GS1B 5DJZA 3NIFF 4LEOA 5I1GL 4GG8B 2W59A 1EHLH 3GEWB 4QTIH 5DWUH 1EJ6A 2F54D 4F2MB 1DSFH 1N6UA 5ENWB 3ZDZF 3WNLA 1K4DB 1L9NA 2EIZA 2VXVL 3F8UB 1CZ8L 4ZPVA 3IDJB 3BZ4B 1G7PB 1SJHB 1DBMH 2PCPA 4GG6B 2NY6C 3LY6A 2XY2A 2DI9A 3DUUB 3QEGH 4Y4KC 3TBSB 4EUPB 4XCNA 5BOPA 1ZA3A 4XXDA 5C0IA 4XCYA 4IOFD 2NZ9D 1CU4H 3EDDA 3PIQB 1CVRA 3MV9B 4ALAL 1UM6L 2R39A 1T21B 4O02L 1NBVH 3NCBB 2G75A 1FLRL 1X5IA 4XC1H 2A77H 4LOUC 1QTYT 5DEZA 5C09D 1T7ZA 3IDMA 2VLMD 4NZRH 5CJXA 1CGVA 2CO6B 1YQVH 4KMLB 3OSKA 3WL9B 3OAUH 3BVNA 3LRGA 4APQD 3DX9A 4LPUA 1BBDL 4Z6AT 4BH8B 3TIDA 1MFEH 3REVB 1QSEE 1KPVB 1IGMH 1FZJB 1PQZB 4K3JL 3WFDL 1EZVY 2A6DB 32C2B 4LNRA 5TE4L 1WFTA 1INQB 4N8VA 1I1FB 3IVKB 5J6GA 5D93B 4OF3A 2H1PH 3R0MA 1D6EA 1QVOA 1UVQA 1JNNH 4NRYA 4XBEH 1XF1A 2F5BH 4I3SH 4NWTH 3MA7A 2G60L 4R97B 3WN5A 4PJCE 4K8RD 1MF2H 4FQIH 4JM2B 4Y2DC 4K2UL 1NC2B 5BVJB 1U91B 2GTWB 3CH1A 2DWDB 2H32A 3SO3C 1CK0L 5JW3L 1LHZA 2QSQA 5F88B 3LKSB 4H20H 1P4LB 3N1GC 4KTYA 5E9DA 5FA4B 5EULV 2H8PB 2Q8BH 3DECA 3TO4A 1W0YT 2RAMA 3M8OL 3VXRA 3VXTB 5FM5M 4X4ZA 5IBUG 1R3HB 3R1GL 1NDGB 3RTQA 1KULA 4R2GC 3OAYK 1U3HC 1J87A 3ARGD 3RWDB 2BVOB 5DZLA 4QRPE 2JIXD 2IALA 1P2CA 2BXZA 3EW3B 1IAMA 3JV6B 1WIOA 5EIVA 1JK8B 3MODL 2B0SL 4TTGA 5CGTA 4HWEH 4KH2A 1E6OH 1ZANH 3DOSA 1AH1A 4OZHB 4JFXB 3LN5B 2VWEE 5GGQL 3IF1A 3AXLB 4LGRB 3MRRB 5DK3A 2VL5A 1FSKB 4U6HB 1BPVA 1I7ZB 1F11A 1DBJH 1I9JL 3VFRA 3UPAA 1ZLUH 1UWXH 1JMZA 4PRIB 5CKAA 4KRPD 2AXGB 5J9PB 4KPHH 1KPRB 3NA9L 3PWJA 4PGBA 4H25B 4OLEA 1F4YH 5FYLD 3LQAH 2BVPA 4OV5B 1NQBA 2R0KH 2FATL 4TYUA 1IKNC 3LSOA 4ZPTB 3DMMC 3O41B 2AJVH 2HJLA 2VAAA 4Y4KD 3HNVH 1FFNA 1CICC 1P7QD 4R4BA 4XX1E 4G8IA 5C0CD 2GSIB 5IKCB 3LS4L 3TN0A 1GZPB 3QDGB 4NN5B 4A6YB 1YPZE 3D69A 4LOUD 5C0FA 2GJ6E 3U0TA 3S4SA 5AWNH 2XA8H 3GSOA 1J86A 3MFFA 3R8QA 2C3HA 4NQVA 4ETQA 2APFA 4Q2ZA 3D9AL 4JY5H 4LCIH 4CW1B 4P2QE 5IFJB 2YN5A 4K8RL 2ARJB 2HRLA 4K55A 5CEZD 1RY7B 1HE7A 3FO1B 5D7IB 5I75B 3SDXA 2RBLA 3D3VE 2DQDL 4NJAH 4UQ3A 4K7PH 1MRFH 4NWUH 1FNGB 2W0KA 3OR7A 1S3KL 2NY7H 4NKDB 4YZFF 5JW5B 1CQYA 2YPVH 4OCYL 2C7UB 5FO7B 1WZ1L 3AY4C 4X80L 1KPUB 4RWYL 1YMMA 1RUKL 3MLTB 4PUBH 1M7DB 2OMNA 4K3DL 4OLZH 3GI9H 1F3JB 3VH8B 3HAEA 2ZCHL 5D7LE 1S9KC 5DD0H 4KJYB 4ZYKB 4E42A 4Y16C 1A6AB 4JFYA 4Z77B 4XNMA 4CGTA 4DZBA 4RBPK 2HG5B 5A2JH 5HYSA 3WJJA 2QQLL 4RISH 2NY2B 1HZHL 3KDMB 4E41B 3PWNA 4JDTL 3W39B 1OTSC 1B0GA 1J1OH 3MV7D 1CXLA 4KI5F 2ICEA 5HD8C 3MMEA 1AC0A 5AD0A 2A6JA 2R1WB 1H15A 3I02A 5DI8B 3PABA 3JBG7 3MR9B 3SDXF 4I18A 4HX1A 5F7UA 2EEDA 3RVUC 1U3HD 4RGMB 4HKJA 3TNMB 1FGVH 4F7MB 2VXSH 1UYWH 1GYAA 2Y6SC 3DTXB 4KDTC 3GMOB 3TWCL 1E27B 4Y4HA 2M2DA 1JHLH 1L9MA 4W6YB 3TA3B 3H7BB 3BJ91 3BFOA 1Y18A 1KJ2A 1PJ9A 4MX7B 5CZVL 3KPOA 3U46B 4ODUA 2VDPL 1JN6A 1BQHG 4OCRH 3SKOA 2FJHB 4KQ3L 1XGUB 1DBKH 2PYEB 4M4RA 1INDH 1MREH 4AZ8A 2X70A 2ZG1A 1PAMA 4PJEA 4Z95L 5TE7L 5C0AA 2FECI 2DAVA 4OD2A 3EYVA 3U1SL 3KPSB 2YPLB 4HIHB 5FEBA 1LE5B 3KPPA 1BWWA 4PJBA 3IXAA 1EVTC 3B6SB 5CHNB 2NY1C 3G04A 2XWTB 5T5NG 4ZUUB 5CEZL 3VFGL 2VLRD 3QH3A 3DMMD 5DRZA 4DN3H 5B38G 3GK8L 3DHJA 1YUHA 2YZ8A 5MENE 3VXQA 2YMXL 2I9TB 5DD3H 4Q58C 4C59B 6FABL 4N0YL 4FQLH 4EI6B 1IC5H 4XWGH 1PD6A 3K74B 1OD9A 5EG6C 4PJFA 3T2PA 2PR4H 4OB5L 3DIFA 2F5AH 4ZXBC 4Z8FL 1ZEAH 1S9XA 1S7XB 4WVRA 2C3GA 1OGAD 1CXKA 5GZOC 2G5BB 4KUCD 1T0MB 3WNOA 3SDAC 1CYGA 1M05A 4LNVA 4PLJD 4KDVA 3WUZA 3FOLA 1KENH 4QYOB 4G9FB 1DLHB 4ODWA 4PJEF 4A2LA 2A6IB 3HC4H 5DMKB 2GSGA 4PRPA 4HXAL 4LARH 1W0VB 3LEYL 5I1AA 3UYOD 3TF7C 2COQA 3PGDA 1QSVA 5CSZA 1OTUD 2GCYA 1NFDB 3QUZD 1DUYB 2BVEA 1T89C 2VXTH 4P46A 2KUTA 4PJBF 5EBLB 3TT1H 2J2ZA 1NLBL 5SWZD 3PL6C 4YHNA 3SGDH 1KC5L 1ZXQA 1BZ9A 1JGEB 2XT1B 4JHWH 4JKPL 5KSVA 4JQVA 4Q74A 3CX5J 3KXFE 2HKFL 5EIIA 4FRWA 2W0LA 4M02A 4QXTB 2ED8A 5F7MC 1ZT1B 1T1ZB 4YNYB 1MOEA 1X5HA 4PJFF 3QWOB 4QOKE 4YHOL 4X7SH 3MSPA 5DO2C 3CSPA 3E6FA 5HTSA 1C16A 4FXKB 3G5YA 1ADQA 2IANE 3GNMH 3DYOA 5EO9B 2Z91B 3BAEL 3TBTB 2CMRL 4HCRL 1TETL 4NQCA 1OTSD 1QOKA 4X5WB 1X5XA 3F5WA 3T0EA 2HKHL 2Q86B 4B41A 3SHSA 5HD8D 3CMGA 1SJEB 2AP2A 1KELH 1ZLVK 1P84K 5IFAL 3VXME 1IMHC 3BPCB 4L8SA 4U2ZA 1HHKA 2ZOLB 1A6VL 1RJCA 3Q1SL 4I3RH 1I8LA 1DQLH 4X7TA 3RVUD 4JFEA 4TVSa 3QA3A 4WO4B 2VDNL 3D39D 4G6FD 1GGCH 2EEAA 4LPVA 3O9WD 3U83A 4Z7UB 3BUYA 1HXMA 5GRVK 4BQ6A 3RAJL 2CJUL 4L3ED 4YE4L 2QQNL 1UG9A 4OIBA 3TV3H 1MJ8L 2AEQL 2X9WA 4N0CC 1C12B 1ED3B 2EC9T 4JM4L 4X9GA 5T3ZD 5ISZE 5D1XD 4WUUD 4EQ2A 2O5XL 1LP9A 1EJOL 1AGBA 1NCAH 2QADC 4PRAA 3OKMA 3RZCB 5DMJB 1HHJA 4QGYA 3ZKND 1KJVB 3V5HB 1OPGL 4X99A 5JHDB 1N2RB 1VKXB 1CN4A 4TTDD 2EYRA 5IWLA 2JJTA 4MDJB 3BEWA 4ZOEA 1F3DJ 3UYPA 4L8CA 1G6RB 2BOBA 4M43L 1MVUA 3E0GA 4UAOB 1P1ZA 3L3JA 1A6UL 1IKFL 2IPTH 4UIKH 1S7SB 5SWSB 3UEZA 5C0ND 2BVQA 2ZUQC 4F9LC 1RZJH 1RIHH 1ZLSH 4BK5A 2NMSA 3V9FA 2ADGB 3KLAA 4TUKL 3FT2B 2UZXB 2G9HB 4HUNB 5CP7A 4CVXB 2YEZA 4JGJA 4KMTH 1KIRA 1JF1B 3RDTA 5ABDE 4S1DC 2FEDC 3SDAD 2VDML 3WNMA 1LP9F 4LSRH 5DD5L 4R26L 2Y5TA 4JFDD 1RIVH 5GXBB 4FXGB 3FFCE 5FOJA 4LVNB 4KKBD 3L7FB 1T5XB 4PBXA 5JPMA 3WIIL 3B5GA 3RL1B 2DB8A 4OFVA 3JV5A 5DJ2A 3FQNA 1N7ML 3RWCB 1HDMA 3N9GL 1M7IB 1OAQH 2PO6A 3MZTA 1YEGH 3WE6A 4WU5A 2WUCH 1IAII 1LNUA 2HRPL 4R90H 3VXSB 1VEOA 4QCIB 1U8QA 5DO2D 5BOZG 4HS3B 3OF6D 2NLJA 4DVRL 4DFHA 3EOYG 3UTSD 4AT6B 1UB6B 3P4MB 1UCBH 4FQCH 1FORH 1J7VR 4PV9A 4YR6A 1HH6A 1WC7B 4OGXH 4DK3A 5E1AB 3VXOA 2VLJD 3L6FB 4RNRA 3NCJL 2FH8A 4ODXB 4OF0A 3GJFH 3VFOB 2F54A 2GK0B 3D6GA 3QFDA 4EZMA 3NPSB 2X09A 2A9ML 2IAMC 1FE8L 1E6JH 4P3WA 3B9KD 1A3LH 1D5BB 4MA1B 1DEEA 4YWGL 5GRVL 3W82A 4Z7QE 1KN2L 4Y5VA 4BUGA 4YIQB 5JUEL 3ZKXB 1QRNE 4L4TB 3IDGA 1GL4B 4LVEA 1G0YR 4LLDA 1CFQA 1IAOA 5HDQH 5F96H 35C8L 4GKZA 2R4SL 4OCXH 4GW4B 3AGVA 3ILPB 2BZDA 3MLXH 1N0XL 4OCMC 5F7NC 4EKXA 5ESQB 3WO4B 1Z9SA 4NUGL 1OAKH 4HXBL 1MCQA 2XOTA 4ZDHA 2VH5H 3FO9A 4ZO6A 1LO4H 4N0CD 3AC0A 4JZNB 4PJHB 5IEKA 3ZE0F 4NM8H 5IVXB 4NT6A 5C09A 3F12B 5EDXA 4GKSB 2QADD 2JB6A 2R29L 5C07E 1W0WB 5B39G 4OZGB 1AGFA 5FGRA 1OVZA 1FNEA 3S88H 2XXCB 3DYMA 2D7TH 4GRWF 2XACC 4HIJA 5E8PA 4KKLC 2R23A 4APQA 4P5KA 2NY6B 4PJ7B 5TQ0L 4HJGA 3V52L 1NUFA 1RHHB 1NCDH 2H2SD 2W0FB 3H0TA 4N1EA 4XCFL 3LDBC 3B9AA 4Y8AA 3JWOH 1UJ3A 3QQ4B 2D03H 3LV3A 4UOW1 4LKXB 5IR1A 5D7SL 1PKOA 1MHCB 1UCTA 2ZNXA 5D2NA 1A2YA 1NGQH 5MEPB 2XPGB 3IDXL 4S1DD 1CQKA 1TLKA 2R0ZL 4LF3B 3SGKC 2FEDD 3RX5A 4AG4H 2BJMH 4XP9H 1N5YH 1MEXH 1OM3H 4R7NB 4RCAA 2Y9RT 2W65B 5LAXB 1YYML 5T1KD 3TPUB 4YHLL 3RX8A 3X13B 3IT8D 3GMPB 3OKOA 4M6ML 3L3KB 4BFGA 3IDNB 1TQCC 5GSVA 3MLRH 2V7NB 3RWFB 4EXKA 2IFFH 3A67H 5ESVA 1A7QL 3VW3H 2AQ2A 2A73B 1ONQA 3MACL 3MRCB 2E7LA 3HR5A 3PDGA 3TVMC 3ARGA 4MSWB 3BKJH 4O00A 2MPAH 1KCKA 4HKBA 4J2XA 2JIXA 4GAYB 3VFVB 1R3KB 5L9DL 1IQDB 4J23A 1H8OA 4Y2DB 5TDPB 1FVDB 2PKDA 4FQHB 3AS2A 1QO3B 1QRKA 3C60C 5C0JB 3EZJB 4ZSOE 3LS5H 3QEUA 1SMAA 1AGCA 3C9NA 1JF6A 3CU7A 4H1LH 3EFDL 3NOIA 1K6QH 3G08B 1UKSA 5BS0D 4HS6B 3P9MA 3D25A 2I24N 2FB4H 1K5NB 5BW7C 3T3PE 3X3GL 2ZCLH 4IMLA 4R2GB 4MXVF 4X6CE 1MCDA 4HJJH 4WJ5B 3EYOB 5I19L 4NQDD 3NFNA 1YY8A 3QUYD 1DL7L 2BDNL 3CVHL 1FDLL 2EE9A 1LO5A 2X9YA 5CJBA 5FF6B 4LSSH 2ZUXA 2ZSWA 3CLEL 4WUKH 1CD1B 4XAWL 5GGTL 3LKRB 3QCVL 2MCPH 1OB1B 5JORB 5BZWB 4Y4KA 1H3XA 1P7QA 1D9KB 2FX7L 4MAUL 1Y6MR 3VXUE 5C0CA 5IBUB 3ARUA 3IKKA 2X4UA 1CG9B 4W4OC 4QXUL 5ETUA 4AIZA 5DUPL 3M17B 3X14B 2D7QA 1FAKT 4ZQKB 5A16A 1FZMA 3EUUA 3RNKB 1CFVL 5HGAB 4HS8H 2OJZL 3MUZ1 4HMEA 4KJWC 4XVTL 5IHLB 2FBJH 1OW0C 4KI1A 3RHWK 2Y7QA 2XWJA 1F00I 1JPST 4KKLD 3F7VB 5IB5A 3QNXA 2DTMH 3S6CA 5DMIH 3I3EA 4L29A 2IFGA 2P45B 4KTEH 2FWOA 5D1QD 1CICB 2P42B 4KWUA 2NNAA 4JRXB 5T33L 4WWKB 2H3NB 2J4WL 3BW9A 4JG1L 4XBPA 5C2BL 2Q7YA 3KR3H 5DRXA 3QZWA 1DJSA 3GMRA 3KHQA 4UOW0 5D96B 1OLZA 4NN7C 3VGHA 2P8PA 2ITCB 4GQ9L 4NHCL 5M7QA 3KPRE 2ZUTA 4MNGB 1SYSB 5ILTH 4TVPH 5E99H 1EV2E 4ZFZA 5J6HA 3WFEL 4MCYB 5DJDB 3MV7A 5D1ZD 1FN4B 2P5ED 4JZOA 4MA3B 5IEHA 4OLYH 3NIGE 3CFIC 4WFGE 2BNUB 5E6IB 5I74C 5CMAA 4D9LH 3HNSH 2ENSA 4NRXB 1KSRA 4Q6IC 5T1MB 4PGCA 5ICZB 2CDGB 1LE9A 4EDXA 2LU3A 1XGQB 2RIKA 3MJ9A 3SDCC 2F8OA 2DWEA 3EO9L 1U3HA 3OKKB 2DYPB 4MQXC 4N5EC 2HJKA 3TVMD 3HE7C 4XXCC 3RPIB 1SMOA 4NM4L 4TVPE 4GMSH 5FGCB 3QRGL 2FR4B 1NGZB 2X42A 1U8HB 3GMQB 3B3IB 4Y16B 4HUVB 2AW2A 3FTGA 3OX8B 3O2VL 4K3GA 3X3FL 1I9IL 1TTGA 2R1YB 5FKAA 4XMPL 1XGRA 3ULUC 3ARYA 4GG6E 5C92A 1A7OH 5IROA 3ISWA 3I9GH 2IH3A 5INDB 5HHMB 1NJ9B 4QT5B 4QRUB 4W6WB 4WFFE 5I16A 1TXKA 2ICCA 1QYGH 4QXGH 2OI9C 1N5AA 3GSUA 4Z0BL 4V1DB 4UIMA 3D2UD 3MV9E 4MXWH 3CAFA 2XZAH 2G5RA 3NCYP 4G6AD 2NW2A 2ICWA 3P30L 3SBWA 1IE5A 3MYZA 3VFUB 1UZ8B 4S1QL 1GIGL 4ONOA 1A6TB 3LKPB 3VA6A 1CLZH 4HUKB 2VLRA 3SE3C 5IESL 5L2KD 3DMMA 3U9PL 4AL8L 2YA1A 4AEFA 1J12A 4N90D 1L4IA 4QNPF 3OGOE 1U8OB 3ROLB 2BNQD 3K81A 3FQUA 4WI7A 1A21A 4YZFE 3HG1D 5SX5H 4DCQA 2R2BA 3GMMA 4QRRB 1BVLA 4MMXC 2PYFB 1ZLWK 3B2UC 4KZEH 3ROOA 3UO1L 4F9PA 2ZJSH 1OGAA 4OZFA 4XPFL 5DTFB 1VACA 2GHWB 3EFFA 4GT7A 4YJZL 3BO8B 3BH8B 4YBLC 5DD1H 2C1OA 4P5MB 3D0LB 1HXYA 3M1BB 4TSBL 1GXEA 4ODHH 4OT1L 3SOBL 1H3UA 5FA3A 1PKQB 1IGCH 3P11L 5E4EC 5F44A 1OCWH 1BQHB 4WTZG 2OQJB 2F53D 3L3DA 5C0DA 5E8NA 2IQAA 3QUZA 5HYQB 5C6TH 1E4XI 3V6FB 4I77L 5IHUL 4Q9BA 1AHWA 5SWZA 3BP6B 5IFHL 3P0YH 3JZ7A 1RZ7L 2EIEA 5C0IB 2ZCKH 4M93C 3S35X 3VWJC 3MNWA 2W9DH 4HG4K 1T0NA 3QIUD 4MXQD 7FABL 3EDEA 4ZXBB 3RJQB 4M8QA 3DUSB 4OD3L 1UM5L 4JO3L 1KLGA 4K9EC 5EUOB 1PX3A 3BKYL 1EO8H 4FABH 3V4UL 4LSVL 1SBSL 1L6XA 5B38B 4M1DL 5IGXH 5KZCB 1T83A 3SN6N 4KUCF 1C1EL 3WS3A 5JDSB 3FRPG 1TJIH 5K93A 3VD4A 4BJLA 4PJAA 3PQYB 1J8HE 3LKOA 4AQOA 3FN0H 1ZHBA 5BZDA 1I85C 3RY5A 2KKQA 5M94B 4OZHE 3PL6B 2GYSA 4HGWB 1F5WA 3FQWA 3GBNL 4QHUA 4G6JL 3ARDC 1FYTB 2E8YA 1CWVA 1I75A 4G8EB 4NQEB 4MQXD 2PW2A 5KSBA 1RFDL 4RAUB 5GIRB 1Q9OB 3T4AB 1XCQA 5JXEC 1UVQB 2PW1B 3WIHL 1AGDB 4OD1H 3D39A 3EHBC 4OF7A 4WV1C 3ZTNH 1MCNA 4K23H 4X4ME 3STZA 3HC0A 2FRGP 4QRQB 3O9WA 3V6ZA 2I5YL 5E94B 3BHBB 4A6YH 4KMQA 1CGYA 3IXTA 2FZ3A 2I9LA 4L3EA 4PV8A 3VFNA 4GKNB 4GBXB 2I25N 1BQLL 2AV7A 2VL4A 4K7FB 3SY0A 4PP2B 1EFXB 3W9DA 3ULUD 2XZZA 3RWGB 3F7YB 1OGTA 2ZP0T 2FGZA 4JGUA 5I8OH 5D1XA 4WUUA 2XN9B 4J6RH 1DN0A 4JO1H 4JY4A 1G1YA 3MXVH 4PJAF 3GHBH 4WW1A 2XZCL 4M7LL 1H0DB 1OAUL 3QDGE 5I71B 5T1LB 4NC0B 2HVKA 2V5TA 5GPRA 4LMQI 5C0AE 1HSAA 2EE6A 4DN4H 1RK0A 4HIXL 4L4VD 2JE8A 4HW6A 3FHQA 4H0HB 5KSBF 5LJYH 1ZVHA 5MP6L 4Z7VB 2HJFA 4GSDL 4PG9A 5HDLA 3BZEB 3RUGE 3VI3E 1WCBB 3O8XC 1R3IL 3LKQA 3UC0L 5I2IA 5D7IE 5DR5H 3H9HA 4LBEB 5H94B 1ETZA 4K94H 4YFLF 1OSPL 2Q87A 3VG9B 1EZVX 4NQXA 2AV1B 1DQTA 4JLRB 4QO1A 5FM4A 4ONHA 3SDAA 1QHPA 3DRTA 2QQKH 5HYJD 2KDGA 2R56H 1UACL 1RZGA 1DVFD 4X6BA 4ZOCA 3JTSA 3LB6D 1GH7A 4JFDA 4HQQL 1T1WA 1L6ZA 5SWQA 2OSLA 3INUH 3RVXC 5CBEA 2XTLA 3BDBA 3IFLH 3VDBA 3V95A 1T89A 1AIFB 5ECJE 1TDQA 5F7EH 2PXYD 2ZUQB 1RULL 2C3VA 1KG0A 2IPKB 2YD9A 3DV4A 5E70A 4DVBA 4E41E 1IGFL 4KQ4L 1BQUA 3KPTA 4NNXB 4R4BB 4NFDA 1KB5L 4G8IB 1ZV5A 4L9LC 1ADQH 1WBYA 1KIPB 4P3DB 2OR8A 1XH3B 2P46B 1FYHB 2V2WB 4Q9QL 4L1DA 2ADIA 1Q1JH 4LPYA 2VZ3A 1LEIA 5BVPL 2YKLL 3BUTA 3G9AB 3QDHA 1NCCL 4NSKB 1IBGL 3O4LB 3OF6A 3CFKA 3MLZH 4E5XB 3NACH 3UTSA 1EFQA 1HI6A 4JFQA 4QRTA 3HE6C 4OGYH 1BHGA 2CDEB 2CH8A 1DBAL 2VLJA 3QHFL 2KZ1B 5D2LB 3O6LL 3UPCA 3VXNA 5L2JA 4DAGH 5CIPB 3VFSA 3W9EA 4CNIB 2R0LL 3SDXB 3ULUL 5I1CL 5HDOA 4UQ3B 2QHRH 2Q8AL 3TNNB 1DQDH 1AFVH 3B9KA 1IC7L 3SGJC 4L8DA 4R3SA 1JYXA 3QUML 4U1SB 5EN2B 4G8FB 4GAFB 1CCZA 3VWKC 4PGDB 4KV5F 1U8MA 2IBZX 5I1GH 3O4OB 4DUWA 5IMOA 2EXWD 3DX6B 5F7YC 5F1SA 1ZSDB 3X11A 4YGAB 3KPSE 3SQOL 2YPLE 1JHTA 2VXVH 3DX7A 3UZEA 1CZ8H 3O2WL 2XWBB 3LH2L 2VISA 1OQXA 2JELH 3H3BC 5J56B 4K71B 1RZIB 5ID0B 2AXJA 2IAMB 1BJ1H 2ICEB 4G42B 4IIQC 4POYA 2FYYB 3CVHA 1KXVC 5KSUB 3HLAA 2HYMA 3VXPA 4ALAH 4RMRA 1DTUA 2HN7B 1JTPA 5GGTA 1X44A 4O02H 1FLRH 1LP9E 1RUML 4UNUA 3U7YL 3Q3GB 1ZHNA 4HFUL 3THML 3DO7B 1N59B 2YD6A 5IT2L 5DHVH 1DDHB 4G9FE 1KTDA 5E95B 2VDQL 4O4YL 3T3ME 1M4KA 4EVNB 5FYJL 3MRPB 2DQHL 3UTTB 5JQ6L 1KJ2B 2B5IC 2V9QA 3BSZL 3TBVA 1EEZB 2CUHA 1I1AA 1BBDH 1NFDE 2XXMB 4JY6B 1YN6A 4O2EA 3CK0L 1FZKA 2BSTB 4D9RE 4K3JH 3BEVA 5TE4H 1ZT7A 3P3YA 2JK5B 3MRBB 1TJHL 1AP2B 3L9RB 4MAYB 5D70L 2YK1L 4K9EL 1UWGL 2GQHA 4NKQB 2V2TA 5T1KA 5B22A 4OSUL 3KG5A 5K9JL 2G60H 3DXAD 2NX5D 3T1FA 5K9KA 3LDBB 4PJ5B 4KVCH 4K2UH 1I3GL 3RI5K 3EKCA 5B39B 5JOFA 1CK0H 5JW3H 4FQJH 4BUHA 1OP3H 1ORQA 1S9XB 3OKNB 1R3JA 1JGLL 4F3FA 1EUUA 1NMBL 1EAJA 3WUWG 4HWBA 1G84A 1WVZA 2FNBA 3QUXC 4P9HH 4YQXL 1CL7I 3R1GH 2A1WH 3IDYC 2VZVA 3HE6D 2YC1A 2EDLA 4GW5B 4D94A 3TO2A 1VFAB 4PRPB 3VCLA 1L0XA 3HI1B 4GRLB 5FECB 3VDCA 3D85B 1TQCB 3FL7A 3FT3B 5BJTB 5CSZB 5BS0A 1MCWM 4Z7UE 2B0SH 4FP8L 1G6RH 2CO7B 4U1IB 3RNQB 4JPWL 5GGQH 4JREC 4NQDA 3VWKD 3QUYA 5KSVB 4ELMB 3CIQA 4I5BB 2C1PB 4HV8A 3GSRA 1I9JH 5DFVC 4HAFA 1R6VA 3IAQA 1KBGL 4PY8J 4Z7OE 3RIAK 3U9UA 4LQFL 4K3EL 4KVNL 2WZPD 5DJ0A 4LLVB 5JHDE 3TYFB 3NA9H 5AAWA 5K59F 4XC3L 3C60B 2AERT 3QPXL 2H2PC 3N1PC 5HI4C 2W91A 3ZDXF 3MRDA 4NQCB 1VESA 4U6VL 3PXJA 3F5WB 1F90L 3OTTA 2FATH 1ZHLB 5SWSE 4F37K 5E7FA 5EU4B 4M5YL 3CXHJ 1U42A 1PG7L 4UINL 4F15C 4OI9A 3LS4H 2FX8H 4WFEE 1RSFA 2YS4A 5I1LB 1NAKL 3BPLB 4XNQB 1I7RA 3DI2B 3HMXA 3AROA 4WHTA 4XMKL 2NY3D 3U4EB 4Z7WA 5D1QA 1EBAA 2NYYD 3FFDB 1QLFA 3D9AH 4NKIH 4C54A 4K8RH 1YJDC 2APWA 4KK5D 2VO5A 4B50A 1B3JA 1DQQA 2NXYC 3MRGB 5E08L 4HUUB 2DQDH 5LVEA 2R8SL 3O6FC 1I8KA 4MJIB 1MY7A 3C5SA 1FVCB 1A6ZA 1QSED 5CFHA 5IB1B 1S3KH 5SV3A 5D9SA 4KK8C 4NFCA 4KJPD 1QACA 3OJDA 3TYGL 4OCYH 2CKBL 5HHQB 1EHAA 5KN5A 1WZ1H 3LQZB 1JGDB 1ZOXA 4RWYH 5D1ZA 2P5EA 4L4JA 4U4BA 2ZZUT 3KLHD 1VHPA 1XF3A 2EYSA 3T0XA 3S3JA 4HMCA 4QLRA 4FS0A 5IQ9A 3MBEC 3HI5L 2ZCHH 4P57A 3SE8H 3I50L 2QQLH 4PB9L 2D4FA 3FB5A 2Z35A 4Z7WF 5ID1B 3TVMA 2WBKA 3OAYH 3UJJL 5CP7B 4GAGL 3WYRA 1ULVA 1AXSA 2AXFB 4LIQL 3MGTA 1U2CA 1WBZA 4NN7B 3MLYH 3MCKB 3RDTB 3IFOA 4G9DB 5GGUA 4ELKA 2R1XA 3F6IA 5FCSH 4EI5B 5KJRL 1KEMH 2P48B 1J0JA 4L4TE 3S96A 1N64H 4ZOAA 4ZAKC 4OAWA 4HT1H 2AJZA 4LCYA 1RD6A 2X40A 5C9JA 1NC4B 4QRPD 3TWCH 5EZIL 4KKCC 1TFHA 5I74B 5AEAA 5E56A 5DRNB 5D72L 1CXEA 4Q6IB 5DK2A 5CLWA 5BW7A 2EO9A 2OLDA 3D2UA 1A7BA 1T7XA 5CZVH 1MLCB 3SDCB 5ADPL 3WIHA 1U8KB 2AJSL 2VDPH 1JI2A 3HE7B 3UTOA 4PJHE 5IV2A 5HHOB 3LPWA 2VABB 4KQ3H 1CGXA 5IVXE 4DOHE 4QTIL 5DWUL 5I8CA 5HHPA 1AC6A 5DFVD 4YPGA 2VLKB 4Z95H 5L2KA 4OZGE 1NKOA 5HSFA 5BQ7A 3U1SH 5A40E 5GSRA 1Y6KR 1BWMA 4H0IA 4PLOB 2FIKB 3A0OA 3Q2CA 4LMQE 4PV9B 1R5WA 2BNQA 4PJ8A 1I7UB 4GUPB 3HG1A 1I1RA 4W4OA 4PJ7E 1IEBB 1ZLUK 1RURL 4JZJB 4J1UA 1L7IH 5GS2H 5IF0B 3QUMB 2WBJC 4LSQH 5EU7E 1AD9B 3VFGH 3F7RA 1ODAA 4PTUB 2OI9B 3FZUC 5CJ5A 3MCG1 1LK3L 4NC1C 3GK8H 2ZNWA 2OTWA 4BZ2H 2YMXH 2JJVA 2P1YA 3N1FC 5D8JL 6FABH 4HHAA 3L7EB 1ZT4A 4OB5H 1A3RL 2A77L 2IJ0C 4NCC2 3EO1B 2EDQA 2F53A 2CRMA 5FV1L 1S7TB 2NXZC 1QA9B 3TZVA 1GSMA 1C5CL 2Y07L 2GJ6D 2XA3A 2WBWB 4OQ1A 2ZPKL 1MCSA 1QSFB 3EJJX 3OAUL 4U6YA 5DMGC 5HY9A 1IAKA 1S5IH 4HIIB 3U36B 3QIUA 4HXAH 3LEYH 4P2QD 1DBBL 2VC2L 4IHOB 5DYOA 3CZJA 3V8CA 4YBLB 2XFXA 3ZTJG 4YO0A 2DQCL 3ABZA 3D3VD 3UBXG 3AS0A 1NLBH 4PJDB 3REWB 5FHBL 4ONFL 1MAJA 1OWWA 1KC5H 1TCRA 5DC9B 2B4CC 1EAPA 1A64A 4IRJB 4JKPH 1V3LA 4RBPH 2ZG3A 2H1PL 5E4EB 2FLRT 3CPLB 1JNNL 3J8F7 5IVOA 2R23B 1QSZA 2F5BL 1KCRL 3CFDA 4NWTL 3B2VL 4JCLA 1ND0A 3MCLH 4YHOH 3RBSA 4FQPA 5L0QB 2OZ4L 2DL2A 4UT7L 5CCKL 1KB5A 5LGJA 4ZUTA 3WFCL 3PUCA 5D7LD 3VWJB 4M93B 1MWAB 3WIFA 3L5IA 2CMRH 3GM0A 3Q6FB 4HCRH 4XHJC 1TETH 4X4XB 5DURD 5IR1B 5IG7B 1OF2A 5J12C 1MJJA 4XXCA 2DDQL 2Q8BL 4FQ2L 4KTDH 3SKJH 4M3JA 2BHZA 2ITDB 2FBOJ 3EOAA 2ED9A 4I1NB 1MNUH 4NBYB 3IU4L 5J8OA 2YSSA 3GIVA 2J12B 2V5RA 3MROA 3Q1SH 4R9HA 4YC2C 1F2XK 4XP6L 2VDNH 4POZC 3OKDA 3OKOB 4JFFB 5GSVB 3WEXA 4PREB 5DC0A 1JFQL 4NO3B 3RAJH 4FQ1H 3ARDB 4YE4H 3BRGC 4IRSC 1A6PA 1SVCP 2J88L 2C3XA 2HFFA 2AEQH 1JGUH 3QO1B 3GSWB 4MHHG 2BP3A 3SDDD 2R4RL 4WV1B 4L4VA 2O5XH 4KAQL 1EJOH 3EZ8A 4OLUH 1OTTC 2DLTA 2X1OA 1T1XA 5ICYB 3E2HC 4OZFH 2HT4D 3KYMB 2C4FU 4NO5A 1OPGH 2M26A 3LPFA 3SJVB 4UUJA 4ZFOA 3LQAL 4RX4D 4M43H 2CIKA 1L0YA 3C9NB 1MCLA 1UC6A 2R0KL 3IJSA 1G9NC 5L6YH 1ZWIB 1A6UH 1YJDL 5DUBB 1E4JA 3ULUF 5DJAA 5CD3B 1UH3A 1IKFH 3C6LD 3FB7B 3FZUD 4KK9C 5ITFA 3QIBB 4JRXE 5LCVH 5HYJA 4OF6A 5EOTA 3HZYB 4O2FA 3SCMD 1G7HB 1DVFA 2XQYG 5MEND 1A02N 5IJKA 4TUKH 1FRGL 5CWSA 3FAWA 2LU7A 5HJ3A 3NA4A 5B8CA 3AU1B 3QPQC 2XRAL 2HMID 2WUBH 4PGEA 2XA8L 2NXZD 4I0PC 1NSNL 4MNGE 5I1DA 5D6CB 2PXYA 3QJHA 1KYOJ 4LCIL 1C5DA 2VDMH 3O8XB 3HPLA 2R9HC 1P7QB 3HCVA 3VJ6B 4U05A 2RFXB 3GUTB 4NJAL 1NGYB 5SWZE 3NZ8A 3RY4A 3WIIH 3H3PH 1AE6L 4C56E 1GGIL 2NY7L 3OKEB 1YA5A 1B90A 4HEME 5F89B 1N7MH 1FAIL 1AO7B 1KGCE 4CMMA 3N9GH 2X4OA 2WWMC 2Y7QB 4X8JB 4Y0GA 1H3GA 4PIRF 1S9WA 4C83B 1JRHL 3L3IA 2VUYA 4OLVL 4OLZL 1D5XB 2HRPH 3GI9L 4RGNC 4YDIL 5D6DA 2ENYA 1I85A 5HVGB 1BOYA 4DVRH 2J8HA 4QOKD 1A4KB 5KBNC 1RUAL 2FWOB 2YBRA 3HRPA 4RISL 2IAND 4WI3A 3TM6A 1J1OL 1JZ6A 2UZYB 2V5MA 5HHME 4DKEL 1EMTH 3NCJH 2YD3A 1NFIA 2PN5A 1U8IB 2F15A 4Z5RA 3GMRB 4V1DE 3WKNA 2W38A 4JDVB 4YWGH 5KSBE 1KN2H 1AQDA 3LN4B 5JUEH 3G5ZA 4JKLA 1MCWW 3R06A 3VXMD 4TUJB 5DSCB 5E8EB 5T1DL 2A74A 1UQSB 3O2DH 35C8H 1JHLL 5IEHB 2XICA 3UDWC 2UWEA 4LHUD 4YHZL 3RGVD 1LK2B 1FGNL 3RWEA 4H0GA 2UZIL 1AD0B 1JZ2A 4HXBH 4QRRE 1NBYB 1ERNA 1DBKL 4WW2B 1INDL 3QG6B 5I8EA 3HRZB 5C3LD 3KPNB 4LEXL 4X6DA 4G43B 5KS9A 5ISZD 2GKIA 2R29H 4QHMB 1D5IH 1MCCA 2OTUA 3MV11 1ZVSB 2VB5A 1PKQE 4XCEB 5E5MA 3IYLW 1NANI 3K8MA 3ILQD 1OARL 4CJ1A 1XGRB 4RA3A 5JIPA 1MH5B 2A6KB 2DIJA 5TQ0H 4NNYB 1JUFB 1MFBL 2RQ8A 4IIQB 3V52H 4YHIB 2YUWA 4XCFH 1QFWI 2EDXA 2CKNA 3KYOA 4ZNCD 4YDVB 4FQLL 1IC5L 3ZLQC 4XWGL 4OZIE 4HZLA 1FL3B 1HHIB 3JV0A 2UWEF 5F3HB 3ZHDA 5D7SH 3MRKA 1R5VB 2P4AB 1T2JA 4NUJA 1NGXB 2B4CL 3DXAA 3ZO0A 2NX5A 5FYJU 5DXWA 2F74B 3FO2A 1II4E 5HHVH 1KENL 4BZ1L 5AAMA 5IB2B 1HNFA 3GDBA 2B5IB 2R9HD 3HC4L 3T65B 3U6RA 5KS9F 1QQDA 1RZKC 5FAAA 4JGMA 4OTXL 4L9LA 4PJXB 1YYMH 3PQYE 3OR6A 3C5JB 2R2BB 3GMMB 4JJHA 4KV5E 4XNUL 3PF2A 1FH5L 2XYCA 2VXTL 4D2NA 2DRUA 2CKBA 2X4NB 3MV8B 3VGBA 1BD2D 2FCBA 4K07A 3DVGB 1FYTE 3MACH 3FCTB 2Q6WB 4NQEE 2I07A 2GFBB 4TOYL 3FO0L 2F58L 2YHGA 2ESVB 4NRZA 3I6GA 3OQ3B 5L9DH 4X7SL 3L3DB 4WI6A 2GT9B 1SJVA 4RGND 1WAAA 1YEDB 5DJXB 3U0PA 5KVEL 1OQOA 1Y6NR 3RIFF 4J4PC 2FJGA 3NBNA 2R2HB 3VWKA 4GJTB 1T0NB 5C0RL 1Z0MA 1O7VA 1KLUA 4GXUM 2XN9E 5KSAB 1KIQB 3ZE1E 2D2OA 1FFOA 4QY8B 2IPUK 2Q3ZA 4JEGB 5EBWA 3QUXB 3BDYL 4JB9H 2DQEL 4BKLB 4TNVF 5I19H 1CD9B 3NIDE 4MA8H 3WS3B 1DL7H 1REIA 2Z8SA 4R4FL 3CVHH 3WDJA 3VI4E 1M71A 4R0LC 3CLEH 2E5EA 2WWKO 4XAWH 5GGTH 1RZ8A 4S1SL 4Z7VE 3QCVH 3V5KA 1R0AL 1UGNA 4NQUA 1FFPA 3ZHLA 4PYGA 4Y5YC 3NAAH 1GZQB 5IOPA 3HZVB 3WUWB 4JREB 3AREC 2R2EB 1WAAF 4QHUB 2J8UB 4D0CA 5I30L 1EO5A 1S7RA 1S7QA 3TV3L 5I17A 1FJ1A 4EN3C 5DUPH 1NGWB 4BSVA 1JJUA 4YAQB 2DBJA 3WS6C 2ORBL 3E6HA 3AM8A 1A7PH 2DJ4A 3WLBB 1MUJB 1CFVH 3TJEL 5B3JE 4NYLA 2OJZH 3RRQA 4GKOA 4P2OD 5DK0B 5DQJA 4XVTH 1T22A 5C07D 5LQBL 4U1MA 2FZ3B 1TZHB 1MCFA 1D5MB 4ORGA 4I4WA 4UNTA 2CRIA 1YZZA 3W9DB 1D5ZB 5CZXC 1NAML 3PWVA 2AQ3A 3G6AA 2CLVA 1P9MC 1MHHA 5FKPA 5EC1B 2IPTL 1QSEA 4UIKL 5TE6H 3MLPA 4P5TD 3MYJB 2VOTA 1J8KA 3RIAF 4P4KC 3Q6GL 4GH7B 1RIHL 3K80A 1MVFA 1T4KA 3VE0A 4F15B 3L5XL 4PRNA 2J4WH 5IVNA 4KMTL 5C2BH 3V2AR 5IVZA 3FB6B 2XTJB 1G7QA 4KC3B 2UYLB 5F1IA 7CGTA 1S78C 1U3ZA 2DM2A 4N1HB 3BP5A 1IL1A 4GQ9H 4NHCH 4Z0XA 5ANMB 4PJCA 1QLEL 2YZ1A 1IM9D 1WICA 4LSRL 5CLTA 4F37F 5I1HH 5D2LE 2J7LA 3WFHB 5L7XL 4H26A 5HI3D 2FO4A 3FRUA 2V7HA 3WFEH 5KOMC 2NXYB 3TH4T 5EOCJ 5MEQB 5I0ZA 2DM3A 5FV2A 1ES0B 2ZOKB 2YR3A 1PZ5A 3F6LA 3LZFL 1AY1L 3OHXA 2YRLA 1VA9A 4AENA 5EBMA 3BGAA 1OAQL 5IW6A 4TPRL 1YY9D 4KK6C 2CGRH 4HK0A 2VDKH 5JO5A 1RAMA 4NM4H 3DJ9A 4R90L 3K0WA 1T1WB 3QRGH 4YK4C 5IMKB 4QRPA 5AUMA 1KF9B 3ES6B 3VGGA 3CFCL 1RJZB 5C8JB 2EDFA 2Z92B 3MBEB 3PXHA 3EJZD 1X5GA 3G6JE 3K1KC 2OP4H 4P99A 1UCBL 3EJYC 3P0VL 4BQ8A 3O2VH 3X3FH 1I9IH 1YNTA 2LU4A 3VA2C 4M6OH 4OGXL 4XMPH 2A0LC 4DZ8A 5C9KA 1FVEB 4XP4L 5JLZA 3S36L 4MJ2A 4PJCF 3C8KA 4U1GB 4Y1AE 1U8LA 4N0UB 1I4FB 1CDJA 1EXUB 3BJLA 1X3DA 4JHBA 1HI6B 4JFQB 4J3TA 1HN1A 1X5LA 4ZAKB 5DA0B 1X7QB 3P30H 4DEPC 1PDKA 4LSTL 4S1QH 1GIGH 2HH0L 2Y1VA 1CGTA 2MKLC 1CLCA 5TDOA 2BVUA 2M1KA 2WIIB 5EFIA 1W72B 3U9PH 2GITB 4AL8H 4NPYB 5I18H 3MLXL 1O0VA 3MRFA 4MNQB 3UTTE 4ONGL 3UTZA 3VD9A 2ZUWA 3T2NL 3ARED 1G0XA 1LO4L 1JNLL 2Z93B 3GIZL 3VXUD 4AM0A 4D8PB 4NM8L 5K33A 1BLNA 4UTAL 1UFUA 4LQ1A 2GJ6A 4XNZB 4QHNA 3S88L 3EGSA 3C2AH 5E2VH 4OBSA 4F7EA 4FQXB 4OT1H 2JTDA 3SOBH 2OTPA 1HOCB 1QEWA 3DARA 3P11H 5D93C 2VIRB 1S9VA 4P2QA 1IGYB 1LD9A 3QIWD 2WBJB 1NGPL 4GRMB 4PJ5E 4R97C 8FABA 3MNZA 1ZGLA 3D3VA 2OJEB 5KG9B 1I9EA 1QLRB 4I77H 5IHUH 1DFBL 5JA9A 3X12B 4E0RB 3VFTB 2DQIH 2X4QB 5IFHH 4JRYB 1C8PA 1RZ7H 1TZIB 3S37L 5MI0B 1SY6L 4NZJA 5IB3B 1TMCB 5ACZA 3ECBB 5DEGA 5DF0A 5F1KC 5BRZB 3ZYZA 2B2XL 1UXWB 2D4DA 7FABH 3ULSB 1KTLB 2EE2A 1U36A 3FQTA 4OD3H 1J05B 1SVZA 3MRJA 1N8ZB 4UDTB 1UM5H 3WCYA 1S78D 3EYSL 3RVVD 1T5WB 3BKYH 3V4UH 1QBAA 4LSVH 4MJ5A 1SBSH 5I66A 2EDWA 1BIIB 4M1DH 5D7LA 3VFWA 1OM3L 3P4LA 3VFPB 3L5WB 4ZODA 1C1EH 3KPRD 5GGSB 1BFOB 2BCKB 3RVTC 1XR8B 1NCBL 2V2XB 3QEQD 3DGCR 1I1AB 3EYFB 4WHYG 4RIRA 4F7TB 2E6QA 3A6BL 2CRYA 2ZKHH 2X1WL 4WFGD 1JWUB 1U95B 3O3DB 2BMKA 5HGHA 3NGBC 4ELME 5TQ2L 3WSQH 5DEFA 2X4PB 1FSKC 1RFDH 2L7JA 2H26A 1J18A 3CDCA 5GRXG 1CT8B 5B3NA 2EDTA 2I5YH 3QUKA 5FB8B 4I8DA 4BFEA 2IH1B 3UBXB 2FECL 1MCRA 1URLA 4IOIB 5DDHA 1C08B 1BQLH 1G7MB 3LS5L 2A0LD 3HB3D 1V3JA 1K8DB 1K6QL 3V5DA 4YGVB 3SDDA 5E0QA 2Z4QA 3EO0B 4S2SA 3HZKB 4XVSL 5IIEA 1R24A 2FB4L 1P4BL 3LCYA 4WFFD 4ZTOL 3MRIA 1V05A 3WLWC 4WENB 5E8DH 3MLWL 2XZCH 4M7LH 3T8XB 3SE9H 1JCKA 1OAUH 1H5BA 3MV9D 2QBWA 2HTLC 4Y8DC 1LQSR 4NN5C 5DHYA 4RX4A 3BISA 3TO2B 5IP4A 1ZLWH 4HIXH 1KXQE 4WTXA 5CSGA 2NTFB 2EDBA 1U8PB 2MCPL 3LHPL 4WGWB 3I84A 3C6LA 4QF1B 5MP6H 1R5IB 4Q9RL 3JWNC 1XF5A 3SCMA 2MHAB 5GRZA 5MENA 1EBPA 4IRSB 5D71L 3H7LA 3TP4A 1QUNA 1HILA 3KLSA 4X0KA 3UC0H 3QFJB 3JTTA 4KDWA 4XH2B 2CLZA 4N9OB 2BNRB 2DMKA 5GGRY 5JMRA 1NPUA 3RWIA 4PG2C 4JR9L 1JL8A 4URTB 2VZ1A 1ZHKA 3QR2A 3E2HB 4FFVC 3MUGB 5DJ0B 2NZIA 3HI6L 5KVFH 5FYKU 2V5YA 1UACH 3CXDL 1G7LA 1UB5A 4JAMA 3AAZA 4LCWE 5EORL 3MRHA 4JDZA 4WDIA 2DTML 4HQQH 1OWRM 5CUSL 5DMIL 3IGAA 4MD4B 5ALCL 1JYWA 1P7KA 1WWCA 4JO2L 1I7TB 1NDMA 1UXSB 2DLFL 1MLBB 5CEXA 4JM2D 5CEYA 1NC2D 1I3RA 1RULH 1MJ7H 5HGBA 3D0VA 4GW1B 4KQ4H 4NFBA 2X4SB 2NY2C 4OLWH 1KB5H 1P6AB 3PV6B 5T3XH 3KR3L 5CSBA 5LKNA 5IMLA 5EZJB 4RSVA 1T7WA 4I0PB 4LLMB 5BVPH 2YKLH 4HIEA 1TCMA 4CVZA 1IBGH 1PYWA 4QOKA 4NOFA 1KT2A 1KJMB 4Z7WB 4EOWH 5EPMA 1G7IA 5E99L 2XKUA 2C26A 4LLYA 4F7CA 2IANA 3FQXB 1DANT 3I6KB 3JV4A 1DBAH 5GS0C 3QHFH 1FL5B 3O6LH 2KBGA 5DS8A 4LCUB 1DQQB 1T7VA 2DMCA 3UPRB 3DETC 4WI5A 1MFAH 2R0LH 3ULUH 5I1CH 5T3XE 2Q8AH 1J8HD 4LCCA 4ZO8A 2OM5A 3O81A 3QUMH 2HVJA 4TRPL 5HHOE 3MLUL 5C6WH 3VXMA 5D4QA 4CADB 3RKDD 5D1ZB 2VLKE 5HPMB 3BXNA 3P4OB 1JZ8A 1FZOA 5C6PB 2QKIB 5DD6A 5DJ8A 3WNKA 4X6EA 3MRMA 4LHUA 3SQOH 3RGVA 4ACPA 4XMLH 1LMKA 3QQ3B 4L3AA 4ORZC 2D7NA 4P57B 1HH9B 3L3HB 3VD5A 2BSRB 4XGZA 3LH2H 1A7OL 1XMWA 3FB5B 5EOQL 2JJUA 3CVIH 2XNAB 2BOCB 3EOBA 4F33A 5J1TC 3WMSA 1WT5A 1I8IA 3BIKB 1OP9A 5ISZA 4M00A 2ERJC 4LDOB 5E6YA 1BFVL 3QXUA 2MMXA 3VRJA 3WLWD 4M3KB 4FZEL 2ATPA 2UUDK 5E8OA 4MD0B 4NZDA 3S96B 2CXKA 3GMNB 4L4VE 4M7ZC 3QDGD 1Q9WB 4NO0B 4YHPA 1EEQA 1RUMH 1CFSA 3U7YH 1KCSL 1BFTA 3THMH 3CXHK 5IT2H 3OZ9H 4M1CC 3RL2B 1I8MA 1A7NL 5F71A 5EO0B 2VDQH 2A38A 2EXYC 4KFZC 3RWHB 1OHQA 5FYJH 1WSST 2DQHH 4TUOB 2DQFA 1T3FA 3OKLB 1YMHB 2NW3A 2CLRB 4LLUA 1XF4B 2GAZB 1A1OA 4OCWL 1MWAH 3BD4A 4PJDE 3CK0H 3R0NA 4ZUWB 2DQUH 5J3HC 3ARBC 3MRQA 1TJHH 5D70H 1QP1A 2XZQH 4K9EH 1MRCL 4R4ND 1UWGH 3TFKC 5C0EA 4Y88A 1QR4A 4PJ8B 1XIWC 2HLAB 2BY3A 3JUZA 5FYJE 5LWYL 4C4KO 5EU5A 3QJFA 5KANG 5FGBC 4UZGA 1IAIL 2W1NA 2X4RA 3WHXA 1WTLA 1I3GH 4MD5B 5C70A 1HQRB 2ZCKL 4DUXA 2W9DL 2W60A 1CFTB 4GOSA 3RJDA 2P5WB 2NY2D 4E41D 3GBML 5HYFA 2WINB 1FIGH 5GGRB 3NFPB 2VDOH 1Y0LA 2F53B 4LRIC 5I9QB 4XT1C 1JGLH 1BJ8A 2VERN 3GSVB 3TZVB 4B5EA 1HEZB 5EH1A 3KPMB 4LPTA 1NUNB 4LAQL 1A1MB 5IW1B 4YQXH 1MELA 3GO1L 3GSNB 2A83B 2C4XA 4R7DB 3HN3A 3QIUB 4AQ1B 1NMAL 2Q76B 3DROA 3DETD 4FP8H 1D6VL 4R96A 4WI4A 1LO2L 4M61A 2RCSL 4PBVC 1IILE 2AK4B 3TA3D 5BO1L 3T2QA 4F7PB 3BP7A 3IJYA 3W0WB 4JPWH 1DUZB 4NQTA 4V2CB 4PRDA 1WCQA 4B0MM 3C5ZC 1BECA 1CI5A 5LXGL 1RIUL 4OD1L 2PYED 1VGEL 4K23L 4P2CG 4UU9A 1KBGH 4I13B 3UDWA 4LQFH 4KVNH 4FNLL 5D5MB 3KPSD 3CSYA 2YPLD 3PHOA 4ZUTB 3SJVE 3V0VB 4PY7A 4XC3H 2GUOA 4ETYA