3ARGD

Ternary crystal structure of the mouse nkt tcr-cd1d-alpha-glucosylceramide(c20:2)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
241
structure length
236
Chain Sequence
AVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDAEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title A molecular basis for the exquisite CD1d-restricted antigen specificity and functional responses of natural killer T cells
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 48
structure length 236
sequence length 241
ec nomenclature
pdb deposition date 2010-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3argD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3argD02
1KJ2H 3KLSA 5ACZB 5A16B 1FBIL 2JJTA 4U3HA 1HSAA 1P1ZA 5DJ8A 4F7MB 2FX7L 5DC9B 1OGAA 3HR5B 5I75B 3ORJA 3T0ED 3SKNB 2EDTA 3C6LB 5C0AD 4QWWC 4UQ3B 4PJDB 3RUGF 2J6EH 2ZUXA 1Q0XL 1Q9OB 2BMKA 4N0CC 2V7NA 5DZLA 4AH2B 1J0HA 5ALCL 4RAVB 4OB5L 4L4VA 5TFSL 4UT9L 2AJ3B 4X5LA 4LQFL 5IQ7H 4MXWL 2DYPB 2EXWC 1CE6B 4JVPA 2IPUG 3UTZA 3VXTB 4UI2A 5C0FB 1ZOXA 4GUPA 1F3RB 3ARFC 1G9MC 1OWWA 1JPSH 1EXUA 2P49B 3QQ3B 3BT2H 2ZNWA 3QEQB 1DUYA 5HI3D 5HYQA 2EDXA 4PRAA 3QHTC 5I0DA 3I02A 2PW1B 5IFAH 3TV3H 3VD3A 4PG2A 4GRWB 3BDYL 5LKNA 4X5XB 4NZTL 4Q7DA 3L3IB 2OL3H 4XMLL 3ETBF 3VXRE 2BOCA 4N0UB 3U6RB 4MNQA 3O4LB 3U9UA 1M7IB 1NBQA 3JV0A 4R4ND 1G7JA 2APVA 1N3NA 3NFSH 1KIPA 1E4XI 4NKMA 2Y9RT 2FJGB 1U3HA 2ZCHL 3NABL 1T2QL 4P5TC 4G8IA 5BZWB 2SEBB 3N1PC 2IBZY 3QEQD 3D69B 1OHQA 1DLHA 2IAMC 3MCKA 2HT3C 4M7LT 3G6JB 3AAZB 4CMHB 1IAKB 1A9BB 3IDYB 5IB2B 3L3DB 1BD2B 1LNUB 2X4RA 3F6IA 1F90L 5MHSD 5DSCA 5CKGA 2FX9H 3O3AA 5DJAB 4P2RB 5JUEL 3D0VA 2AW2A 1JGVH 1CFTB 3O4LD 1DQLH 1TQBC 5FK9B 2Z31B 1HYRC 1PG7X 4E42B 4PREB 4U2YA 1XEDA 2MTPA 2B1HL 2QKIA 4HUXA 4XBPA 4D8PB 1OL0A 1EH9A 1Q9LA 4MD0B 4JZJB 4NQTA 3SDXA 1D3CA 1BM3L 12E8L 4QY8A 4NQDA 4B7LA 2DD8L 4HKBA 4JHAL 1JP5A 5A2LH 1P2CB 3SY0B 3WO3B 4OJFH 5DJ6A 1FN4B 1RVFL 3ARBA 3LPWA 1BD2D 1SJEB 2ITDB 3VXUA 3OR7A 5A2KH 5TGBA 1AFVL 4CNIA 3I6GB 2QV2A 2VH5H 5CJOH 3MV9B 2W0KA 3MLRH 1JPST 3HMXA 1JZ5A 1CLYH 1QZ1A 4P2RD 4PV9B 4X5WA 2UWEA 3VCLB 4PJGF 5L6YH 2Z31D 1MHPH 1BF8A 1GOFA 2VAJA 3HI5H 1TCRA 1VFUA 4N9GA 4QEGA 3WCYA 3V52L 1V3KA 5GZNC 1ITBB 5K59F 3WSQH 2YA1A 4M93C 1F8TH 3ARDA 4NNYB 5DEZA 5H8DA 2NX5A 2VDKH 4MMZC 5GS1B 5DS8B 3KPSE 5MERA 2DKMA 1NCNA 4KI1A 5JHDE 2X4TB 3UJIL 1P7KB 1YY9D 3SE9H 3ARTA 2H9GB 4LCYA 4N90D 3QDMB 4I9WD 4I13B 3V5HA 4OI7A 5CLWA 3NCFB 4M00A 2EE6A 4MZ2A 2EDJA 2NY4C 1NUNB 4IDJH 4KK6C 3MV9D 4KRPB 1HIML 1U8HB 2BVYA 1DANU 4HDIA 4PJ9C 2ATKB 3EDFA 3ZT5A 1I8IB 2RCSH 4ZNEA 5I1KL 3QNXA 4OZ4A 4I5BA 3TO2B 3CMOH 4ALAL 1JYNA 1CDGA 5DTFA 5C2UB 3QI9A 4LCWB 5HGHB 2OI9B 5E5RB 2GI7A 3FCTB 4KZEL 2NCMA 2VXSL 5ENWB 2DKSA 2FBJH 2BJML 1WLHA 3QDMD 1KC5L 4HSQA 3WN5B 5JW5B 1KCVH 1XH3A 4NPYA 3MJ6A 3O3UN 1BP3B 1LO2H 1D5ZA 1URLA 5F21B 4XP1H 5GGTH 1LQSR 3O9WA 3V4UH 4AMKL 5F9JB 4AIOA 3R06B 4HFUL 3MQIA 1UQSA 2PETA 2VL4A 4KRPD 1RURL 4X6FB 3EW3B 1BMGA 3VXQB 3O45A 5JPMA 3F65A 2AJUH 3LKPB 1G1YA 2GK0A 1VFOA 4PRIE 2B0SH 3RVVD 3U79A 1G6RL 2ZSVB 1ODAA 3DXAA 2ARWA 4LU5L 5ERWA 1BFVH 4LCWD 4PP1C 3EYSH 1V05A 1MUJB 3LKOB 4YHIA 5I76B 4G80B 4G6MH 43C9A 4ODXB 1XF4A 3LKQB 5E8OB 3VD5A 1WEJH 3GMRA 4WCYL 4N9OB 1NGYA 4XNUH 1A6PA 4F37K 1XR9A 3T08A 1DSFH 3HRZA 3TBTA 1Z9OA 2RBLA 4OF5A 2F8VA 1JPGA 2NXYC 5IBUB 1B6DA 5ID1B 4A2MA 1FZKB 3BISA 3WL9A 4NWUL 3G5VB 4L8DA 1UVQB 3DRQB 3VH8G 4M6NL 3L3KB 1DQDH 1MH5A 1AXIB 1II4E 3CU7A 4L3EE 2EZ0C 1DBKH 5CD5D 3MOAL 3TYFA 4D0BA 3E8UH 1MAML 2WZPD 1KCKA 3DUSA 4ZXBB 4TN9A 3SDDB 3K2UH 4GG8B 4H1LA 1QVOB 2VLJE 1CK0L 1QKZH 3HC3H 1B0RB 2E7LA 5DFWH 4FA8A 3SKJH 2XXMB 4WW1B 2PYEA 4PLKC 4QRTA 4Z95H 5C1MB 4PJEA 1U8NB 5F7WC 4LCIH 2ZSWA 1S7UA 2IC2A 4R97B 2NTFB 4WFGE 4UUJB 2JELL 2C5DC 3HAEG 4DKDC 1I1YA 4Z7UE 3KYOB 1C1EH 1IQDA 4P46A 4ZFGH 3C5ZC 4UOW1 4Y5XC 4L3CA 3W2DL 5C0BA 2NY3C 1G9ML 1MIEH 2IF7A 5CIPA 4ZXBD 4G8GA 2AJZB 3SDDD 2F54A 1JPFB 5J1SC 1CD0A 4MXQD 4DKFH 5I1HH 4JPKH 2G5BA 1BFSA 3ULSA 4KKAC 4YX2L 3PQYB 1YC8A 3LRGA 4MA7H 3IFNL 1PEWA 4MQSB 5LQBL 1OM3L 5HI4D 3A6CL 4QF1B 5EU6E 2P43B 1FO0H 1MRDL 1NC4A 3P0GB 1T1XA 4GAGH 4HGMA 2XZAL 3GSOA 3WFCL 3JXAA 1UXWB 3BP5B 3MPCA 3OKOA 3AMKA 3UO1L 4FQ1H 1KCUH 5DHVB 3O3BB 3U2SA 2X4SB 1TENA 4DN4H 3RFZC 1WBXA 4RWYL 4LSTL 3LHPH 3E0GA 1XGQA 3E6HA 3O2WH 1A6AA 4EI5A 4NBXB 3OR6B 1HHIB 3BP4B 2A6KA 1JK8A 3O6FB 1G7IB 3PQYD 3O6KH 3BEVB 3GO1H 2CKBL 5INCB 4IJ3B 2A6IB 2XFXA 4S0SD 3QEHB 4GQ9L 2HMIC 1S3KH 4MJIB 1AGEB 4HKJA 4LK4A 3VFMB 4HIJB 1T0NB 2EH8H 4OM1L 2N7AA 3QO0B 3MLTB 4X9IA 4ODBD 3PGCA 4B53A 3DIFB 4F15C 2EDFA 2AXHA 2WBJB 4Q9RL 4YHMH 5F1NA 4BYHA 1EHXA 3GJFH 3PP4H 3O8XA 3L3OB 1ED3A 1FJ1B 5B8CA 1Y18B 4HULB 4DTGL 3AU1A 1EMTH 4OD2B 4JREC 3O6FD 3SKUD 5KSUA 2P24A 4PB9L 3GSWB 2WAHA 4QHUB 4IIQC 1I75A 3CK0H 1BBJB 1EEYB 5HHOE 3BZ4A 1LE9A 3ZE0E 4L5FH 4ESKA 1MEXL 4MJID 2FIKB 5HYIA 4DVRH 2AK1L 1MRCH 1JV5B 1Z3GH 4KAQH 2FJHA 2VB5A 4MAUH 4G6JL 3O6ML 1AIFA 3CVHH 5BVJB 1F4YL 5J1AB 4M1GH 1HH9B 2GIYA 4OFIA 3IJYA 3K3QA 2WBJD 5GISH 4QXUH 3BE1L 2W9EL 1M71A 2Q7YA 1F4HA 4HPOL 4ZOCA 1UJ3A 5IB3A 5C9JB 4QTIH 3UXFA 2V17H 1EO5A 2D7QA 4NO0B 4QRRA 1QBMH 4OKDA 5CCKL 4BFGA 1UC6A 1RFDH 2Z8RA 5J12C 3L3JA 1KULA 2ZCKH 5FO9A 2XWBB 1F3JB 5GGRB 2ZG3A 4D9RE 5F1IB 5MEQA 5CILH 5IW6A 3GM0A 5JIIA 2OK0L 3V4PL 5IBUG 4JFZH 4ENEC 3MOQA 1TPXC 1FLRH 2Y07L 5DT1H 1MI5E 5GGSB 2E6JA 5ELIA 3DX9A 3SJVB 1RZKL 4OZFB 1UWXH 5LBSH 1QSEE 1G7QA 3QUXB 1JBJA 4XP4H 5GRXG 5FV1L 2FO4B 4J3OC 4FTVE 4NO0D 3WIHA 3AS0A 4P2OC 1B0GA 3TWCH 1S7QB 1MHEA 3MOBL 4X4ME 5IMMB 5HHPB 3DVGB 5DHYB 3P4MA 1FNGB 4AQ1B 1UWEH 3OXSB 4OZIA 5JNYA 3QUYB 1HZHL 3NA4A 1T83A 2GK2A 5HYJA 2IPUK 1Z0MA 2OTWB 2E27H 3SCMC 3NA9L 1B9ZA 3RWHA 2HT4C 3SJVD 4Y4HC 5F9OL 3BKMH 2GEEA 1N5AA 3QUXD 4JLRB 3MRNA 5HTSA 1Z0NA 3OXRA 1HXMA 2VSDA 1A6WH 3K4DA 4FOMA 4XMKH 1IEBA 2YD9A 3DBXA 3HE7B 4O9HL 3EZ8A 2BNQA 1C5DB 2R1WB 5HI5D 4PUBH 1MRFL 4YLQT 4YQXL 1G7MB 1KN4L 1W72H 3THMH 1U2CA 1VPOL 4LKXB 4GW4A 3TN0B 7FABH 3QUYD 5EC1B 1X7QB 3HCVB 4XMPH 4RDQG 3NZHL 2JB5H 1A6TB 5ISZB 4YK4C 5I2IA 1GZQA 3MRMA 3GMOA 2FD6H 1HN1A 1H3TA 3RWFA 3B3IA 1CF8L 4LSUH 4JM2A 3UYRL 1AQKH 4XP9H 4MQ7B 4KJQD 4CRPA 3FB6B 3HE7D 1JNHB 3CLEL 5FFLA 4WO4A 2FWOB 1VHPA 3H9YA 4BJLA 2XPGA 5HGGS 3GMLA 2HH0L 1XR8B 3VD4A 1ZAGA 4YDKH 4OKVA 3BP7B 4HW6A 3HLAB 1OAYH 3LMJL 2D03H 1HHJA 3SKOB 5IVXF 4QTHB 4IS6B 3T1WA 3GIVA 7CGTA 5ISZD 1FNLA 3TT3L 2FH8A 3VMPA 3KNBA 3TLRA 1NCUA 1R3IL 4E0RB 4GG6B 4PJ7E 5I16B 1AHWB 4XX1G 1AY1L 1A3LH 3EHBD 1KLGB 3B4NA 3PABA 2LVCA 2DOCA 2GJ6D 4PGEA 1A2YA 1MQKL 1WBYA 4JHWH 4AL8L 3HRPA 3C8KB 4RFNC 1QNZL 1U8MB 4Q2ZB 2Z8SA 3O2VH 5T3ZL 3MNVA 3NH7H 4RDQF 5ALBL 1WTGT 2WM0A 1Z9LA 1N4XH 3P73B 4GKNB 4PY7B 1CE1H 1GC1H 1RZGB 1KEGL 1V7NH 3QQ9C 5DUBB 2C1OA 2X4UA 1KJ3L 1CDHA 2HLAA 3MROA 1KBGH 2ICES 5ACZA 5A16A 3P4NB 1TVDA 1QRKA 4F7MA 3HR5A 4Z9KB 5DXWA 4B7IA 5HHNB 2VC2H 3SKNA 3C6LA 4RMSA 1GPOL 2AP2A 4K9EL 4UQ3A 1OVZA 4PJDA 4HJJH 4YJZL 5GRZA 1Q9OA 4U1SB 3PWUB 4AH2A 1MLCB 3SEPA 4RAVA 4OSUL 3UBXB 2AJ3A 2FRGP 1N5YH 4NNXB 4IM8A 1JTTA 3TVMC 4A6YH 1KELH 4JRXB 2DYPA 2H32B 4NHCH 1CE6A 3VXTA 3QAZB 3VRLE 1NCAH 3CMGA 3DROB 4OT1L 4LSPL 5C0FA 3EDJA 1CFSB 3QQ3A 3CAFA 3QEQA 3UZVB 4YFLF 4PP2B 5I15L 1N0XH 2COQA 3NPZB 2PW1A 4JAMB 4QCIB 3PP3K 3UX9B 4X5XA 5HGAB 4HH8A 3L3IA 4N0UA 3U6RA 4FFVD 4AY0A 5D5MF 3O4LA 5T3XL 4FFYL 4HS8L 3MRKB 5C07B 1M7IA 4TSCL 2P8PB 1Z9MA 3B8SA 4PJHF 1RZJH 3VFPB 5I73B 5C0GB 1I8KB 4JRXD 1UYWH 3B5GA 2FJGA 1G9NC 2VISA 1U95B 5D70L 1WAAE 2JJSA 5BZWA 2SEBA 3D69A 4K71C 2R56L 5CJQH 1MFNA 1F58H 3CFCH 3G6JA 1MREH 3AAZA 3IRZA 4YHNB 2CH8A 1IAKA 1A9BA 3L5WB 5IB2A 3DHJA 1BD2A 1LNUA 3L3DA 3R8QA 2GY5A 3DO7B 2LV4A 4WUUB 5DJAA 4IMKA 2BVUA 4P2RA 4JG1H 4XPHL 2B2XH 1CFTA 3QDGB 3NIDE 5FK9A 5C07D 2Z31A 5E5MB 3S96B 4NJAH 4U1GC 3ZLQC 4PREA 2R2EB 1AR2A 1CVSC 2QLVB 2VQ1B 1EVUA 3MLVL 1WVZA 5KOVC 4KVCL 3RAJH 4D8PA 4MD0A 4JZJA 5EO0B 3VDCA 1DBMH 1AR1C 4KDTA 4XCNB 1CGYA 2VLRB 2F15A 4JY4B 4F7TB 3SY0A 1P2CA 4PRPB 5IBTH 1OTSD 1FN4A 5D2NC 5KJRL 1SJEA 3EYUH 2ITDA 3LS4H 3UBXI 5D7IE 4A2LA 2VDQH 3I6GA 1FE8H 4UZGA 3MV9A 3I2CL 4RWHA 4PV9A 3QHFL 4Q9CA 4F58H 1UB6B 2E6QA 3VCLA 4XTRC 3QDGD 3AREB 3ARFB 2DWDB 1A4JB 1WTLA 2PTTB 2VITB 2FJFB 3HUJE 3PNWB 5DD0L 4Z7OF 4J2XA 3MC0A 3BD3A 3H0TB 4TOYL 1SY6L 2JF1A 4NNYA 3ZDZF 4Z76B 3WHXB 5DS8A 4TSBL 5GS1A 5JLZB 1ADQA 1CTNA 4QWWD 4WI3A 4OGYL 1A7PH 5H37G 4F8QA 2X4TA 1P7KA 2VLRD 2H9GA 1NJ9A 3S7GA 3MREB 5BRZB 2KZ1B 3QDMA 2DIJA 1QBLL 4LSDA 5KSBE 4HAFA 2NW3B 2EDNA 4S1QL 5FCSH 3DV4B 5MP6H 1U8HA 2EXWD 3X3GH 4R26L 4TQEH 3ARED 1P6FA 2VXTL 4J3SA 3CXHJ 4R90L 3ARFD 1VFAB 2ATKA 4LDLB 4P5TB 4MCYB 1JF5A 4K7FB 4NO3B 3OKDB 6FABH 4LP4A 2IAMB 1I8IA 2A9ML 3OL2A 4L8BB 4PJIE 4S0TD 3TO2A 5A43C 5JOEA 5F97E 5HDOA 4LCWA 5HGHA 4O58H 2CKBB 4FQQB 3FCTA 3DUHA 2ESVE 3QP3A 1NMAH 5ENWA 4ZFOA 2E9BA 2ZUVA 3RDTC 1T7YA 3NCYS 4OLXH 5BRZD 3WN5A 5JW5A 4JGJA 1BQUA 5JW3L 4MAYC 1YEJH 3HKFA 1BZQK 2D3VA 1TQBB 1H3XA 5F9JA 1YMHB 1NBYB 4HV8B 3R06A 2DRUA 4JM4L 4Y89A 4X6FA 5D1ZB 5IFHH 1RZ7L 1BIHA 2DJ4A 3KAAA 3VXQA 4P5TD 1LEIB 1IGCL 5C2BL 1KJMB 3S35L 3H3KA 3SO5A 3JV5A 5KS9F 4H8WH 3MRFB 5ETUB 2JIXB 2IAMD 3LKPA 3MLSL 3WFDL 2EC9T 5E0QA 3RL1B 4Y2OA 2ZSVA 4FABH 3U7AA 1RD6A 3FJTA 2NY7H 3LKOA 1MUJA 4M6ML 5I76A 4PRBB 2IBGA 3UBXG 4G80A 5KW9H 3UTPE 1F6LL 3ZHDA 5D6DC 4RGOL 4RMUA 4ODXA 4FQHB 3LKQA 5E8OA 3RWGB 5BVPH 5D71H 1WZKA 5TE7H 3DOSA 4JR9H 3W81A 3EJYD 4EBQH 4LHUB 5D1ZD 3B2VH 1YY8B 4M93B 3ZYZA 1PSKH 4YPGB 2CK0L 1W8OA 1NPUA 5ID1A 4UV7H 2JIXD 4K7PY 4MWFB 1FZKA 1OD7A 5FUZL 4LARH 3G5VA 1NFDF 5DGQA 1UVQA 1ZT4B 4MQXD 3DRQA 2NY4B 3L3KA 5DLMH 4K3EL 1UCBL 2R69H 1I1CA 3BX7C 1H3PH 3PDOB 3WJLC 4PJ9B 5C6PB 1J88A 1NCWH 3QB7C 3N9GH 5FM4A 4ZXBA 4LHUD 3ABZA 3GM8A 1IJ9A 3SDDA 2GYSA 5GZND 4GG8A 3QDAA 1QVOA 4HUNB 1B0RA 4P23C 3RNQB 2YR3A 3D87B 4WW1A 1OAZH 2Z91B 4XXCC 2GSIB 1ZT1B 1U8NA 1YNTB 3IETB 3K2MC 4XC1H 4G42B 2NTFA 4W4OC 1H0DB 4J3WA 4UUJA 5DVOA 2R4SL 2NY4D 4XB7A 4KK6D 1IT9L 1OGAE 3S34L 2DJUA 1MCOL 3MX0A 3KYOA 2Y4SA 2IANB 4PJ9D 4XBEL 1YEKL 3NCJH 3QIUD 5EPMB 5C08B 2HRPH 2XZCL 1ZGLB 4KZDH 2AJZA 2Q20A 2QQLH 1JPFA 4ETYA 3FQNB 4XI5C 3P2TA 4L4VE 1FFRA 1FAIL 1UZ8B 2EO1A 1JNLL 3PQYA 4NUJB 1MY7A 2CRIA 3DI3B 3Q0HA 2HG5B 4D9LL 5A2FA 1A3QA 4QF1A 3N1FC 3DYMA 1NDGB 3NIFE 1KB5H 1BREA 2AJSL 2CDFB 4YFDB 1UXWA 3BP5A 4FP8H 5DD5H 1CGSH 1B6UA 1R6VA 3QG7H 5K9QI 5DHVA 3O3BA 1LK3H 2X4SA 4FFZL 2IAND 1BGXL 5ITBL 4FQLH 5C08D 3KS0J 2NZIA 1B0WA 1HNFA 25C8L 4YBLC 3M8OL 5F7KC 3ZTJG 1RIVH 4MNQE 3OR6A 1HHIA 3BP4A 4P57B 1QHPA 3KPLB 3O6FA 3U0WL 3L5XL 1G7IA 1FCCA 4PP1D 1MPAL 2P4AB 3BEVA 2VE6B 2Q3AA 5INCA 3BKJL 2LFGA 4AQOA 2A6IA 3QEHA 1KTLB 1BLNB 1IGIH 3MJ9H 3BH9B 3FFCD 1CLCA 4MJIA 5ID0B 2YRPA 1AGEA 4U6VH 1MQ8A 1IGTB 2PCPB 1JGLL 3S97C 2O5XL 3VFMA 1MAJA 4HIJA 3ZL4L 2FL5B 5FDYA 1T0NA 5KN5B 3QO0A 4GAJL 1AC6A 3RNKB 3MLTA 3GSNL 4Q0XH 3DIFA 2WBJA 1W0WB 3TNMB 3EYQC 1SYVB 4HLZH 3L3OA 5SWSB 5EZOL 1CWVA 1FJ1A 1YEGH 4GS7C 1Y18A 2W9LA 3MA7B 2W1NA 4K55A 2OYPA 5TF1H 1U6AL 4OD2A 2YUXA 3TBWB 2W07A 4XVTH 2F5BH 3R1GH 4RGNE 2VR9A 4PJAB 3GSWA 5L7XL 1JZ8A 3L7EB 4QHUA 1BFTA 5K9JH 1BBJA 1EEYA 2EZ0D 1VGKB 2FIKA 2OP4H 3SDXE 3C5ZB 1JV5A 2VWEC 4Y5XB 1FC2D 5DMJB 2XWTB 3RIFF 1CDCA 4Z7WB 1KXQE 3RU8L 4DN3L 4GKZB 5JHLL 2HJLB 2AXJA 3SE4A 5BVJA 2YZ8A 4JG0H 2VZTA 5J1AA 1HH9A 4WFFE 3ULUE 5DMGC 3VXUE 4PLKD 5SWSD 5HDBE 1DEEB 4FNLL 5EU7E 2UWEE 5C9JA 4DUXA 4CAGA 2VXUH 5EWIL 4NO0A 2R8SL 1EV2E 4HCRL 1UCTA 1VEPA 3WHE0 4DW2H 2NZ9C 2CRMA 2LAGB 1WIUA 3MNWB 1PKQA 1IGMH 4KKBC 4M9OA 3UYOD 2NX5E 2XWBA 4HUUB 3TA3C 1F3JA 5GGRA 4TNWF 4BQ6A 5F1IA 1X5FA 4EVNB 1CD9B 3TGXA 5T3ZD 4ISVB 3FQWB 4C58B 1TETL 4F7EB 5E08L 1E27B 5E2UH 3TH4T 4I2XB 2DM2A 5TE4L 5GGSA 3BDBA 4W6WB 4KKAD 3N0PB 4RZCB 3MODL 3SJVA 3MO1B 4OZFA 4AEHL 3NN8B 3QUXA 4RMTA 5F1OB 5IB4B 1GJIA 4NNPH 2FO4A 1L6ZA 3SQOH 5DA0B 1S7QA 3BIKB 3MMEB 3GMMB 4TRPH 1BVLB 5JDSB 5IMMA 4ZODA 5HHPA 3DVGA 5DHYA 1KPUB 4KXZI 4U6TA 3FOMB 1FNGA 4F15B 3S8WA 3OXSA 3CVIH 2F74B 3QUYA 4UTBL 4JDTH 2Q8BH 3BIAX 4PJFF 3PIQB 5E56A 1X5AA 5C7XH 4JREB 2OTWA 4RFOH 1UM5L 3JTSB 3QZWB 3MBEC 3WXVL 4YH6A 4IIQB 2I26N 1S9VB 4JLRA 1PKOA 3EDKA 3F62A 5SX5K 2HMID 2AEQH 2NY2C 3MLUH 4XP6H 2RB8A 5D1QC 2XACC 3GSVB 3UPRB 1QBAA 3HPLB 3K1DA 3HE7A 2J8UF 1C7SA 4N5ED 1JI1A 1LO0H 1C5DA 2D0GA 2R1WA 3OZ9L 4LPVA 4M9PA 1G7MA 3P9MB 3DXAE 1FYTB 1J5OL 2HTLD 4LKXA 2ZPKL 2FHBA 4AIZB 3MRHB 3TN0A 5IEKB 4BKLB 3HMWH 1E6OL 5EC1A 1X7QA 3HCVA 4HWBL 5GGQL 5ADPH 3WUWG 1A6TA 5ISZA 3E3QE 5T3XD 3ZYIA 2YD1A 3GHEH 1I3RB 2YPKB 3C08H 4DGYL 1HILB 5B22A 3R0NA 3V95A 1Q1JL 5J12B 4WDIB 3LS5L 5HVGB 5T1LB 2HRLA 3QFJB 1R0AL 3FB6A 4U6HB 1JNHA 1YN6B 4JN1L 5D7KD 2FWOA 2AEIT 3VWKC 1EIBA 4NQVB 1GSMA 1XR8A 2AKRB 1OTUC 1IC4L 2DTMH 3BP7A 3HLAA 1TPXB 2J4WH 3NAAH 4FQ2H 4IDLA 4K8RC 4Q97A 3NIGF 4KVNH 1JFQH 3SKOA 1ORQB 5HYSG 5KSAC 4QTHA 1KPVB 4IS6A 3P77B 2WQ8A 3X17A 1E4KA 1MFDH 1Q9WB 3WBDA 1NFIA 4C83B 3WFHB 3LEYL 5JR1L 5TQ0H 4HIHB 3H3BC 5DGRA 4E0RA 4P2OB 4GG6A 1J9CT 5I16A 2PR4H 3KYAA 1KLGA 1F11B 2DQUH 3VGAB 4OZGF 4GT7A 2AEWA 3PP3H 5T1LD 3U4EB 5F96H 4MA8L 3QFJD 5DD3H 1ZEAL 1Q9KB 2PYEE 4KMTH 4YXLL 3C8KA 4D9QE 1U8MA 4Q2ZA 1OAXL 5F1KC 3G5ZB 5AZ2H 2Q86B 1F2XK 5BCAA 4EEEA 5ADOL 4Z7VB 1N2RB 1HKLL 3BMVA 3P73A 5BW7C 4GKNA 4PY7A 1RZGA 5LCVH 3S5LG 3SCMB 2EE2A 4KRNA 2EDEA 1Z6JT 1EGJA 4EIGB 4Y4HB 5DUBA 1KV3A 1H5BC 3VW3H 3X13B 4OTXL 4P2OD 4UIKH 3QCUH 3VG9B 3P4NA 3QCTH 1UWGL 4XPGH 3RWDB 2F54E 4IHOB 3V0AC 1PG7H 5HHNA 1PX3A 4AEIH 3DI2B 3VXPB 3KYNB 4X6DB 1J12A 4CN1A 4D0DB 3WDJA 1QFHA 1H3UA 4XCFL 1PEZA 4CU8A 4U1SA 1MWAH 1ZANH 3PWUA 1MLCA 3GNML 1GGCL 1JHLH 1T5WB 1C5BH 3SCMD 3UBXA 4DUWA 4NNXA 4Y4HD 4DAGH 4EOWL 3LSOB 4JRXA 2ZJSL 4XWGL 2H32A 1QD0A 2FSEB 1QSFB 1JCKA 1U3ZA 4GXUM 3ARUA 2QBWA 5I1CL 2MNUA 4PP2A 2FIRT 3KPSD 5J57B 1AQDB 4LIQE 3AUVA 2EECA 3CLFH 4JAMA 3JWOC 4QCIA 2XT1B 5J3HC 5HGAA 5FYJE 1AO7E 3LN9A 3UCRA 5E9DB 1EHNA 1YPZE 1T21B 5C07A 3MRKA 2A0LC 2P8PA 2F8OA 3MRRB 3VFPA 3FT2B 4KUZL 1FGNH 5C0GA 4LPCA 1I8KA 3QIBC 3QUMH 2BDNH 4C55A 5TH2B 1CTOA 1QSFD 2QQNL 1U95A 3L5HA 3UAJC 3HG1B 3PWJB 3HAEH 1CL7L 4RFNB 5F89B 1K5NB 2WUBL 5F8QC 1O5DT 5D2LF 4Y2DC 1QUNA 3OKKB 4YHNA 4KTDH 3L5WA 4OIAA 3GIZH 4HT1H 2J2ZA 4R7NB 4RAUB 1D5XB 3MLYL 3DO7A 4WUUA 3LEVL 3U7YL 1DANT 4KK9C 4WGWB 2R0ZL 5E9DD 4F9LA 5JO5B 2WP3T 3QDGA 5E5MA 3S96A 3S36H 5CAYB 1J10A 3D3VE 4KJWC 1WV7T 2R2EA 4KU1A 2CMRH 2VQ1A 1MF2H 2NR6C 4KPHL 4Z0BL 1K9TA 2C4XA 3KPTA 1CQKA 1RUAL 4MLSA 3S35X 1SVCP 5EO0A 2WV3A 4HC1H 4WEUD 5TDPB 2JCCF 3HG1D 4I3RL 1FVDB 4PRID 4XCNA 2VLRA 4JY4A 4F7TA 1GGIL 3HI6L 4PRPA 2GFBB 4DK3A 3VXOB 4QRRE 4DKAA 1S7TB 3QQ9D 2P8LB 4HMDA 3TVMB 1UB6A 2AGJH 4NO5B 4YBQC 2AERT 4PB0H 1T5XB 3PHSA 5C6TH 3AREA 3JTTB 3ARFA 2DWDA 1A4JA 2VITA 2PTTA 2FJFA 3PNWA 4OF7A 2VLJB 2W92A 2YEZB 3H0TA 3IDGB 3ZTNH 1T22B 4YDLC 2R0LL 3V0WH 2ED9A 3BRDA 4Z76A 3WHXA 5JLZA 1TJIL 4S1DC 1X5IA 3W0WB 2Q8AH 3PXHA 3UC0L 5HXMA 3QO1B 3BPCB 2QHRH 3L3GB 3MREA 5BRZA 5I1DB 2AABL 1LWRA 2XA8L 4WUKL 1KYOK 4ODUB 2FEDC 4Z7UB 4J6RH 2NW3A 3DV4A 1OPGH 4HIIB 2FZ3B 5I19L 4S1RL 4LLVA 3FN0L 3LZFL 4UINL 3D2UB 4OZIE 1VFAA 4P5TA 3T2QA 2L7JA 5FUOL 1E4JA 4MCYA 4K7FA 2VLJD 4NO3A 2AS5M 1WFTA 3OKDA 3JUZA 2APWA 2IAMA 2G75B 5HYJE 3MLXL 4L8BA 4ELMF 5EUOE 1AI1H 4UDTB 5EU7C 2R4RL 5DK2B 3NZ8B 1SHMA 2CKBA 2V5YA 4FQQA 4HAGA 3W0WD 4DK6A 1NMBH 4WFGD 2AI0L 1XT5A 3L3HB 1PLGH 2ZOKB 5IHZB 3EOTL 3RIFK 5FGCE 2DLGA 2I5YH 2BNQE 4U1GB 4YUEL 1YMHA 1NBYA 4HV8A 3TCLB 1DBAL 1NEZG 5D1ZA 5KVGH 1MIMH 3GSNB 4OCYH 3H42H 4LEOB 1U2HA 4YHOL 4N0RA 1LEIA 3RVXD 1KJMA 3PL6C 1MJUH 3MRFA 5ETUA 2JIXA 3GHBL 4IOFC 2L4OA 4LEXH 5KVDH 3RL1A 3QA3B 1TFHA 5D2NB 2W60B 5I71C 2KQNA 4K8RL 4H26A 2DDQH 4HWNA 2BRRL 2YA0A 4PJ8C 2VXVH 4PRBA 1AJ7L 1T0PB 5JORB 2BSSB 2F19H 1NUGA 2IGFL 2IBZX 4BELD 4FQHA 1G7HB 1A7OL 2K7QA 3CSGA 3QHZL 4TNWK 3RWGA 1YJDC 4XNXH 1SBSL 4U7SA 4WHYG 2FECL 4LHUA 1OWRM 1YY8A 4UT7H 5E1AB 1E4WL 1S5IH 4YPGA 4LLWB 2HWZL 5T1KB 2PUQT 4KY1H 3VFGL 1MLBB 2UZIH 3V4VH 3MLZL 4MWFA 4DGVH 3P4OB 2LTQC 1ZT4A 1B4JH 1L7IL 4EDXB 1WZ1L 3IU4L 2AK4B 4QOKA 2EXYC 3IFLL 2HN7B 3PDOA 4XTRD 1R5VB 5IW3A 3WIIH 1I1RA 4PJ9A 1FCGA 1QFWL 5L2JB 4LDOB 1DQML 4JEGB 2O5YL 4ONHB 4YXKH 3RNQA 2KQMA 5DRNB 2ARJB 1HH6B 5T1KD 3TYGH 2Z91A 2GSIA 1ZT1A 1YNTA 35C8H 3IETA 1T7XA 3P0VL 3RDTB 3C2AL 1AD0B 4MAYB 4G42A 2LQRA 5KVMC 1RUMH 1H0DA 1I9EA 2OCFD 4TTGA 1IM3B 1SVZA 4WHTB 4NFDA 4ZTOL 2BCKB 2AK4D 2EDQA 4TTDC 5FKAB 2IANA 3BN3B 4M4PA 4PJDE 4OD1H 5EPMA 5C08A 4NSKB 4FQIH 3ARGC 1QA9B 1ZGLA 2E6PA 1MI5B 4HS3B 3FQNA 4HFWB 2AJVL 4XNMB 1WSST 1UZ8A 4FXKB 3ROOB 3JWOL 4UMGA 4NUJA 3C5JB 4K07A 4Y88A 2HG5A 3FB7B 3J8F7 2CQVA 3MJ7B 1NDGA 4MAYD 3DVFA 4Y4KC 2CDFA 3AM8C 4OF0A 3QEQE 5B3JE 4HXBL 4FZ8L 3ZO0A 5T1DL 4D9RD 2DQHH 1G9NH 2D7NA 1EHLL 4YGAB 2FGWL 4GRWE 5MHSE 2BVQB 3O3DB 5KVFL 4WTWA 2J5LB 3B9KC 4D3CL 1R5IB 1MI5D 1AE6L 4N0UE 2OZ4H 3MUY1 2DQJL 4P57A 1CICC 2DQEH 3KPLA 1INQB 3TJEL 5MEOB 2CJUH 2VE6A 3VJ6B 2DQTH 1KTLA 1BLNA 4WVRA 4NZRH 3H2WA 4XPTH 3BH9A 4P59H 4NC0B 5F88B 5ID0A 1ZGLP 4P3CL 1IGTA 2Z35B 1KIRB 2PCPA 1T0MB 1C8PA 3GSQB 2FL5A 4Y8AA 1XAUA 5KN5A 4JCMA 1ONQB 5TF0A 2R0KH 3G6JE 3RNKA 1HWGB 1GCFA 1BD2E 4P23B 1W0WA 3R8BB 3TNMA 1SYVA 3QJHB 4WFHE 4M62H 5SWSA 1I3VA 4P9ML 4XWOC 3PJSB 4PR5B 1VACB 3MA7A 1EEQA 2DQGL 4JO2L 5A2IH 4M1CC 4NP4L 3TBWA 3HFML 1RJZB 4PJAA 4L8SC 5D1XC 3L7EA 1BWMA 3P30L 2ARJQ 4WNQB 1VGKA 5CSZB 4Y16D 3SGDI 3C5ZA 4Y5XA 2N7BA 1J8KA 3GMNB 1G0YR 2XWTA 4Z7WA 4M61B 5EB9A 3RZCC 4GKZA 2FX7H 4ZO8A 2HJLA 1IL1B 4N90E 3TJHD 4XCYB 4I9WE 1WCBA 2IH1B 5KG9B 5FA3B 3PGFL 4U31A 3SE3C 1NAKL 4WTZA 1DEEA 3MV9E 4N5UA 5HYEA 3VGDA 2ICWA 3CFBB 4XRCB 5SV3A 3MRLB 5ALCH 3BPNC 2Y25A 2D7PA 4PJ7B 5TFSH 4UT9H 2BNRB 5FKPB 4HG4K 4OBSA 4MXWH 3X12B 2IEPA 4JKLA 3MNWA 3CH1B 2NTSP 1C08B 4HUUA 1JRHH 2B20A 4PRHB 4EVNA 2R1XB 1CS6A 3NGBB 4ISVA 4QRPE 2XZQL 3FQWA 4MJ6B 4YBLB 4F7EA 1MCHA 1E27A 3ULUL 3MACH 3BJLA 4XI5D 4I2XA 3QPXH 3BDYH 3HMXL 3U83A 3W39B 3GBNL 4LQ1A 3WDIA 3EJZD 4RZCA 1IAIH 3MO1A 4RISL 4U05A 3NN8A 5IB4A 2FEEL 3EO1B 2BNRD 1KTKE 3I3EA 3BIKA 3MMEA 2QSCL 3GMMA 2WLYA 1BVLA 3U0PB 3QG6B 5JA9A 2B8OT 5JDSA 2ZCHH 4DEPC 5BXFB 1KPUA 3NABH 1T2QH 3FOMA 2F74A 5I8CB 3PWVB 1OQXA 4GS7B 3UZQA 2JB6B 3PIQA 1G7LB 1MCRA 2QSQA 2DB8A 1F90H 4GRMB 3JTSA 3RA7L 3QZWA 1R3JB 1MJ7L 2AV1B 4IIQA 1S9VA 4AZ8A 4H0GA 1SM3L 2A73B 5FO8B 15C8H 3W9DB 1AKJB 3H3PH 4FQPA 2IQAB 3GSVA 3UPRA 2UZYB 4PJCB 3HPLA 2EDKA 3DV6B 4KGLA 4WHCA 4PGJA 1K4DB 2N56A 2B1HH 2OSLB 4K7PL 1A4KB 1ZSDB 4F9PC 3P9MA 1P6AB 1W8NA 1FYTA 1F2QA 1JGUH 1F4WL 2HJFB 5DO2C 1KCRH 3EYQD 4AIZA 3MRHA 5IEKA 2YBRB 4BKLA 3CDYA 2AJXL 4KDWA 4JHAH 2IFFL 4OV5B 4WJ5B 1RVFH 1G6VK 5JIKA 1I3RA 5H37H 2YPKA 1HILA 4W6XB 5D72L 2P7TB 5CJ8A 5T1MB 4ZD3L 4WDIA 5T1LA 1AKJD 4EZMA 3TPKA 5T5FL 3TA3B 3QFJA 4OCSL 2R2CA 1NQBA 1QBBA 4U6HA 3V6BR 4TSAL 1YN6A 4V2CB 4U2ZA 4NQVA 4WWKB 3Q3GB 1KXVC 2A1WL 2AKRA 5D8JH 3MA9L 2YN3A 4P4RB 5DMGD 2P5EE 2ZUUA 1ORQA 1KPVA 3P77A 4HXAL 5F6HI 43CAB 4J4PC 3UTOA 5JW4N 4XNYL 1J8HE 1Q9WA 5IW1B 1U8LB 4NM8L 4OF6A 4AIXA 4C83A 3VFVB 3WFHA 4HIHA 2QEJA 4P2OA 5CJXC 5SX4I 1D6EB 5ESAB 1HIMH 4NKDB 3ESVF 3LD8C 3U4EA 3I6KB 1BECA 2AEPL 1Q9KA 3ARQA 3ZDXE 3BOVA 3G5ZA 2Q86A 4WW2F 4WWKD 4LSQL 5I1KH 1X5ZA 5D7IB 4Z7VA 1N2RA 4POYA 1QSZA 5EFIB 4ALAH 4OGAD 3SCMA 4CN6A 4BH7B 4KZEH 2VXSH 4Y4HA 2P47B 1KC5H 3SDAC 3MLWL 3X13A 5J06A 2FHFA 5D1QB 1CL7I 4AMKH 5FYKE 3RWDA 1VCAA 1D5IH 3CGTA 4HFUH 4IHOA 5ITFA 4G8FB 3IAGC 4O2CB 5EC2B 1IC7L 3VXPA 3KYNA 2YHGA 4G43B 4X6DA 1VA9A 4D0DA 5DRWB 1YNKL 4K94L 1YMME 5GS0L 4HBCL 2NXZC 3QT2A 4JHBA 1G6RH 4LU5H 1T5WA 4WW2C 3RBGA 1L7TL 1CDJA 3HB3C 3U30C 3LSOA 3SOBL 3BXNB 2YKLL 4WCYH 3ZZ1A 3Q1SH 2FSEA 1QSFA 5D1QD 1JZ7A 5FYLD 2W65B 5BO1H 3FO0L 4LBEB 3VWKB 4PJIB 1B2WL 4YE4L 1AQDA 2I24N 3IDMB 3GK8L 4GKSB 5KSAB 1CR9L 4DGIL 2APXA 4L29B 4MJIE 5E9DA 2NYYC 4NWUH 1E28B 3JWDL 1T21A 5A40E 3BMWA 3MRRA 4M6NH 1RY7B 3FT2A 3SDYL 5IV2B 1U93B 3B2UC 2H2PC 4P2CG 9CGTA 5TH2A 1QFUL 3MOAH 1GRWA 1FIGH 5KVEL 3HG1A 3PWJA 5F89A 4ZMAT 1K5NA 4LIQL 4V1DB 3VWKD 1CK0H 4DOHE 3OKKA 3WNNA 3ZKNC 3ZSSA 2CK2A 4IRZH 4CUCA 4K8RD 1CLOL 4GO6B 4YIQB 5EA0L 5FYJL 5IF0B 5CEZH 1YYML 4R7NA 4RAUA 4YXHL 1D5XA 2CRYA 5KSAD 4Y19B 3O6LL 3CSYB 1H5BB 2FBOJ 5FECB 5KSVB 1QACA 5JO5A 4TUJA 1F4XL 4O02L 5BV7L 3HC4L 4N8VB 2JELH 1F5WA 5DEFB 4EUPG 3BP6B 4MVBC 1LEGB 2Y06L 4NUGL 5CP3H 4PGDB 3PWPB 2Z9TA 2XRAL 3F7RA 5TDPA 3W2DH 1CGUA 2BHUA 5JXAL 1FVDA 2DLEA 3G04B 1JYXA 3VI4E 4V1DD 3QPQC 4HIXL 3DWTA 3MGTB 4TVSa 2QQQA 4ZTPL 2I07B 1CDIA 2GFBA 2DTSA 1L0XA 3VXOA 4YX2H 1XGPB 1S7TA 3IFNH 1J1XH 4OLEA 2P8LA 1OM3H 4Y19D 3MYJB 3ZTJH 3TVMA 3A6CH 1REIA 1MCSA 3UEZA 1PKQE 1MRDH 1IKNC 4HQQL 1BX2B 4NO5A 2NY0C 5DQDL 1T5XA 4N0YL 4P49A 2XZAH 2JJVA 3JTTA 4HPYL 2DWEB 1TTGA 3UDWC 2VLJA 2YEZA 5GGUB 2G60L 3IDGA 4C59B 1V7ML 1T22A 2H1PL 3QJFB 1MJJB 4P2QE 1MCEA 1RUKL 2IJ0C 4RWYH 1S8DB 4YHZL 5DJCB 1DUZB 3SJVE 3TIDB 4LSTH 4POUB 3W0WA 5GXBB 4JKPL 3QO1A 5JOFB 3BPCA 3L3GA 5I1DA 2DI8A 1DN2A 1QPPA 4BZ2L 4ODUA 5LJYH 3U82B 2PW2B 3SBWC 3EBAA 4HIIA 4I0CC 3QIBB 2FZ3A 4KJPD 3RWJB 2YD5A 3D2UA 5TPWL 1P7QB 3RGVC 4LVOC 2J6EL 3T0DA 3JV4B 4OM1H 5FA4B 4CBPA 5EIVA 4ODVL 4DVBB 2G75A 4ERSL 4Y2DB 3SO3C 4Q9RH 4UDTA 5IQ7L 4M4RA 5DK2A 3O2DH 3NZ8A 5J3HD 1P4BH 4RMQA 2XQYG 4KJYB 4B0MM 4LCCC 4DTGH 1CFBA 4GOSA 3L3HA 4Q6IC 1QFWI 3BT2L 1VGEH 2ZOKA 5IHZA 3KPPB 4YZFF 2QR0B 4OGXL 3TCLA 5DZNA 3QIBD 3PE9A 3GSNA 1RSFA 4LEOA 3A6BH 3TV3L 1DCLA 5E6YA 4LFHG 4OQTH 4PLJC 1P7QD 1DVFC 3A67L 3UAJD 2VL5B 3T0WA 4G6JH 4GLRI 3WYRA 1BJMA 5BS0B 4Y2DD 3QA3A 2FX8H 5D2NA 2W60A 3AB0C 3DMMC 1IAMA 3W5MA 1KIPB 3DJ9A 4OUOA 3F7VB 4HJGB 2CUIA 3PHOB 4V2BA 3VU2A 1CBVH 4M3JA 4HPOH 4KK9D 2BSSA 2PXYB 3T3MF 5JORA 1S9YB 2OQJB 3JVGC 5EBWB 5DR5L 1NAMH 3CU1A 4KKLD 4UU9B 1G7HA 3IAQA 4LCUB 3WDHA 4KJWD 4YPJA 4MDJB 5GHWH 4P3WA 4AM0B 2DKUA 2NR6D 1DBJL 2ZNXA 5E1AA 5CEXB 4LLWA 4YFEA 5T1KA 4EN3C 2FX9L 2ICWJ 2X6MA 1H3VA 3LKNB 1JGVL 4XGZB 5BS0D 1MLBA 1A02N 3DYPA 3E1F1 3L1OL 3ARPA 4JRYE 2Y07H 2UZXB 4OD3H 1V5JA 3P4OA 1GHFH 4GG6E 3HUJF 1RZKH 2Q87A 1ZMYA 3UROR 4EDXA 5ICZB 1KN2L 2PXYD 1K6QH 1TNNA 2AK4A 4MJ4A 4YBQD 2HN7A 3BZEB 1R5VA 1PDKA 2CUMA 5L2JA 1OLLA 3FONB 2GHWB 2VZUA 4U1JB 4ONHA 4XVUC 5DRNA 2HJKB 2ARJA 1HH6A 2VQUA 4Y5VC 4S1DD 2C1PB 3MLRL 4NJ9L 4NZJA 1CLYL 2AXFB 2J8OA 1HZHH 5KSBF 4XNZC 2P1YA 3RDTA 1RV6X 1AD0A 1MHPL 4MAYA 4BM7A 1F3DH 3HI5L 4X9FA 1IM3A 2FEDD 4WHTA 1E4XL 5IJKC 3FMGH 1F8TL 2CO7B 2BCKA 5MERB 5FKAA 2XKSA 2H26B 4XC3L 4X0KB 1N59B 4NSKA 1OCWL 4O9HH 1IMHC 1SJHB 3PL6B 4KUCD 3SPVB 1QA9A 1MRFH 4YQXH 2D2OA 3VXUD 1MI5A 4HS3A 4HFWA 4XNMA 2Y23A 4FXKA 1VPOH 5I71B 3ROOA 2C3VB 2VLLB 4RA0C 4ETQB 3C5JA 3IXAB 3IFPB 4ELMB 3FB7A 5B4MC 5L8JB 2DMBA 5D6DA 3MJ7A 1GZPB 2Y36L 4LAQL 1SQ2N 3DGGB 2EIEA 2DLIA 2EEBA 1JPTH 4R4FH 2NX5D 1U8OB 4X4MA 1NCBL 1YNLH 1IM9B 1FFNB 3CMOL 4LGPB 3I50L 1LO5B 1VB9A 4TVPH 2ADIB 2BVQA 3CLEH 1T66D 3O3DA 4HWBA 5F71A 2XQBL 1R5IA 3T2NL 4IOFD 5CLTA 3BFOA 5GGTL 4XP1L 3REWB 1INQA 1BQLH 5MEOA 4DKEL 5DFVC 3VJ6A 1YEIL 1QG3A 1TCMA 1CDBA 3EOBB 3TT3H 3QCVL 3QISA 5F88A 3KYKL 4ZUVB 1DLFH 3WJLA 2Z35A 3B6SB 4Z78B 4W6YB 1T0MA 1EDQA 3E6FB 3NCEB 1AY1H 1GXEA 3GSQA 3Q48A 1ONQA 1PYWA 1IM9D 3RQ3A 3QI9D 1RZIB 1BFVL 1FNSL 4AL8H 4P23A 3T2OA 1M1SA 5EH1A 3R4DA 1JF6A 1QNZH 3QJHA 4WUUE 5GZOC 4XXCA 4PJBB 5E2VL 3PJSA 3EKCA 4PR5A 1VACA 2FEEI 4I3SH 1WEJL 5ALBH 3BGAA 1KNOA 3QDGE 4HK3J 3WKMH 1RJZA 1FG9C 4W4OA 3OBAA 1KEGH 1XR9B 1BQSA 4HEME 1FL3B 3LV3B 4JGMA 4L9LC 5HDLA 5IEHB 1KJ3H 4U1MB 4WNQA 2EXYD 5CSZA 4K7PX 1CT8B 5IB5B 5E4EC 2H45A 4M61A 2RFXB 4HZLB 3ARGB 3MBXL 1IL1A 4PRPE 4LKCB 4XCYA 3KPOB 2VQTA 2CRZA 2IH1A 2KZWA 5KG9A 1QLFB 5FA3A 3RVWC 1LO4L 4K9EH 2X89D 3RIAF 1EAJA 3CFBA 4XRCA 2VZ1A 2HFEB 3MRLA 1CCZA 4OSUH 3E8UL 4PJ7A 1C7TA 1PD6A 4Y4KB 2A6JB 2BNRA 3BZFA 5EZJB 5FKPA 4C4KO 3FOLB 1EUUA 3EYFB 3IDUA 4JPVH 1QKZL 3X12A 3SKJL 3CH1A 1RUQL 1C08A 4KI5C 5D7LE 5LGJB 3TBSB 4Z95L 2PKDA 5MEPB 4PRHA 2R1XA 5FCUL 4AT6B 4JZOB 4ZUUB 1ZHLB 3ARGD 4MJ6A 1MJ8H 1HQRB 2VZVA 1NMCB 3B9KB 5I15H 3LH2H 3BPLC 4MGXA 4PTTB 3NIFF 1CICB 3U1SL 2Y7QB 3W39A 3DSFL 5K9OB 4NRYB 1INDL 1C1EL 3U36B 4ZFGL 1GGYA 1TJGH 3OF6D 2YN5A 5E7FA 2G5RA 5EU3B 4Y4KD 1MIEL 3EO1A 5ICYB 4TSCH 3BKYH 3LQAC 1TQCC 2ID5A 2DI7A 4DKFL 3DRTB 3U0PA 3QG6A 5I1HL 1GC1C 4JPKL 1ADQL 4D9QD 5BXFA 5E2WL 1CXHA 4PJ5B 2R56H 5I8CA 1GGBL 1FO0L 3PWVA 2IPKB 4H5SB 1FSKC 2JB6A 5IIEB 3OKOB 1G7LA 1CICD 3Q6GL 5FAAA 4GRMA 1NSNL 5CD3B 4X4XB 4FQ1L 1R3JA 1KCUL 1VADB 4L8SB 4P46D 5D1XB 2AV1A 4DN4L 2CLVB 2A73A 3KJ4C 3WS3B 5FO8A 3W9DA 1AKJA 4TNVF 2IQAA 1RUPH 1QHOA 4PJCA 3ME0A 3DV6A 3O2WL 1EJOL 2V9QA 1K4DA 3RZCB 2YC1B 3MLVH 4KVCH 1A4KA 1ZSDA 4MNGE 3DX6B 3O6KL 4ZFOL 1AO7B 2HJFA 4PJ5D 2YBRA 1RIUL 4XWOD 2X40A 1YPZB 4OV5A 4WJ5A 1DL7L 4LGSB 1ZLSL 2HVKB 1HHGB 3BPNB 4J3VA 1CN4A 3RL2B 2EDLA 3NTCH 3SDXF 1MFCL 2EH8L 4EQ3A 5KANI 1PX4A 2P7TA 3I2CH 5T1MA 1CLZL 1NLDL 1U3HC 4WHDA 4HF5L 3K4ZA 2RAMA 2CDEB 3TA3A 2IQ9L 5J9PB 3ULUF 1NCCL 2OJZL 1A3RL 5DD0H 3KLHC 3RZCD 4TOYH 1SY6H 4WWKA 5IGXH 3Q3GA 5B21A 1DBBL 2P24B 4XAKD 2UWEF 1WWWX 1RZJC 3HC0B 4M5ZL 4P4RA 1AO7D 4JFOB 4OGYH 5ESQB 4K23L 1ND0B 4Z7NF 3TO4C 2VERN 3WNKA 3WD5L 1AGFB 4QOKE 43CAA 4DVRL 4KROC 1MRCL 1U8QB 1Z3GL 5FF6B 5IW1A 1U8LA 1QBLH 2WNGA 3D3VB 4KAQL 4BQBA 1PGRB 3VFVA 4OCWH 3VXSB 2RIKA 2ENSA 3N50A 1D6EA 5TQ2L 4PJGE 3CVHL 3VGHA 1T89A 5ESAA 4NKDA 1M6OB 2IG2L 5GISL 3I6KA 3TIEB 3H7BB 4R90H 4DEPB 4OZHB 1MCNA 1TZHB 2ADGB 4QTIL 1KJ2B 1PZ5B 5D7IA 1UT9A 4QRRB 4WEMB 5EFIA 1QBML 4JFDE 4BH7A 5F9WC 2XXCB 1I8MB 3MBEA 1YQVH 4DZBA 1XGYL 1A6UH 4NQCE 3FAWA 4OIBA 5JW3H 3D3VD 5CILL 3VXSD 5C08E 5D1QA 5CZXC 3GRWH 2YD2A 1KCLA 2UVFA 2Q6WB 1XFPA 4G8FA 1RZ7H 4O2CA 4ZO6A 1Q38A 1FZOB 5EC2A 1IGCH 5C2BH 3GJFK 4G43A 3S35H 3S9DB 3S3SA 5CKAA 1VENA 4GBXC 4XP4L 5DRWA 1AC0A 3B5TA 3WFDH 3OTTA 4QRRD 2X1WL 1PFCA 1YEEL 2H8PB 2UY7A 2VR5A 1MCFA 1KEML 3FT3B 3MV01 4MB4A 3GSXB 1YYLH 4RGOH 2CIIB 1S7SB 2W59A 3BXNA 3DSNA 5FYKL 2OL3B 1X9QA 2W65A 4BFBD 1J0IA 1FORL 2XQYK 2J1KA 4LBEA 3VFWB 4PJIA 3VWKA 5EUOB 5T33L 2O61B 3IDMA 2YXMA 4N8CL 3OXRB 4GKSA 5KSAA 4NRXB 5IROC 4S2SB 4XMKL 4L29A 5FYJU 4PG9B 3IDXL 3CZJA 5FUZH 1CG9B 1E28A 2EYTB 4N0FB 4BA8A 4PUBL 5IV2A 1U93A 1W72L 1UCBH 3RVUC 4WI6A 3AY4A 1X4ZA 1CFQB 4XHJC 4DUVA 5E00B 4XMPL 1N6UA 4JFHE 3CXDL 4V1DA 3H6JA 4I0PC 3RX7A 5KZCB 4YC2C 4U7MA 2XG4A 4YIQA 5BW7A 4LSVL 5IF0A 1Z5LB 2BOBB 3CNKA 4WI7A 4Y19A 3CSYA 4J4PD 1H5BA 4PGCB 4G8EB 1I4FB 1KGCD 4XP9L 2HP4A 5FECA 5KSVA 2NY1C 5C0NC 4N8VA 1EFQA 4QXWA 3EUUA 2R4SH 4Z7WE 2NY6C 4PJEF 5DEFA 3BP6A 3S34H 1MOEA 1LEGA 1EO8H 4PGDA 4XBEH 3PWPA 4I18C 1YEKH 2X10A 3MRGB 5GRVK 3G04A 1J1OL 5CGYC 3ILQD 2ZUSA 3MGTA 3VI3F 5KZCD 4BQCA 4J3UA 2I07A 2NXZB 1FAIH 5LWYH 1JNLH 1XGPA 1WBYB 3MYJA 3U30B 3RVTC 5KAQG 4MA3B 1BX2A 2V2TA 2MPAH 2YK1L 2AJSH 3IS0X 4WO4D 2MMXA 4JPWH 1I9JH 1TTFA 5EOQH 3O2VL 2L7UA 3F5WB 2DWEA 3NH7L 3P3YA 1JTPA 1UJTA 5GGUA 3RKDD 3HZVB 3QJFA 1XF3B 1FYHB 1U0QA 4FFZH 4M7LH 2E7CA 1BGXH 1K85A 5MI0C 1S8DA 5DJCA 3KPMB 1DUZA 4LPWA 3TIDA 3M8OH 3U0TB 5JOFA 1KBGL 2NXZD 1VKXB 3L5XH 3TBYB 2VDOL 1U8KB 4H0IA 1MPAH 1MVUB 3U7WH 2PW2A 4UV4L 3BKJH 2VXQH 1OLZA 3QIBA 3RWJA 3IJHB 3KPRE 5EOCL 5I8KH 2G2RB 3EO9H 4AG4H 3ZMRA 1P7QA 1WFOA 1FP5A 3ZL4H 3JV4A 1NANI 5FA4A 1RJLB 4DVBA 5T3XE 4GRLB 4Y2DA 2WWKO 5I30H 2ZZUT 4QLRA 4YDIH 8CGTA 4GXVL 4NHCL 4KJYA 4PS4H 3HHRB 4FQXC 4F57L 1U6AH 2GT9B 5KAQF 4FZEL 2NYYD 4KRMB 4XCCH 3KPPA 4ODHL 4NM4H 1KOAA 1MCCA 2QR0A 5D7KE 4TPRH 1QFPA 2VYRE 3C6LD 3B2UD 3S3PA 3T4AA 1FYTE 4PYHA 4R6UA 2MQCA 3RIAK 3B9VA 1OTTC 2VL5A 5AUMB 3RU8H 2WIMA 1D7FA 2C3XA 4GRLD 5BS0A 1GH7A 4X4ZA 3MRPB 1RZJL 2RQ8A 2DYPD 2VIRB 1IAOB 4FNLH 5E24E 4OLWL 3F7VA 4HJGA 1UYWL 1LDPL 3PHOA 1AD9B 2VISB 2PXYA 4D94A 1S9YA 4OAWB 5CSBA 2OQJA 5EBWA 2NY0B 3QFJE 4MYWB 4H20H 4MXVE 4UU9A 5J13C 4LCUA 4HCRH 1OAQH 4PY8J 1F58L 2LE9A 3OGOE 3CFCL 4MDJA 3JV6B 1MREL 4AM0A 1J18A 4XVSH 4BQ8A 5CEXA 4DCQB 2R2BB 3AFLA 2DQCL 3IYLW 4L8CB 1TETH 5I66B 3LKNA 4JG1L 5J11C 1C5CH 4XGZA 3QPQD 5E08H 4HHAB 1CDYA 2DIBA 5EU5A 4NJAL 1TNMA 1S9WB 4MZ3A 4AEHH 1WFNA 5ICZA 5ECJE 1S9XB 4ZFZB 5MENB 5FM5M 2NY0D 1YECH 4J12A 1KF9B 3BZEA 3ULVF 3CFKB 4JGUA 1J7VR 3O4OC 5JPNB 4DFHA 4Z7QF 3RGVB 3FONA 3K0WA 4LVOB 4ZS6C 4OLVH 3G5XB 4U1JA 5HHVL 1HK6A 1WZMA 1FLTX 4Z7VE 3EYUL 4GSDH 3LS4L 4WFHD 5CSGA 5FUCC 2HJKA 3SO3B 4NQSB 1QLRA 1RK1B 1FE8L 3HNTL 2C1PA 4NZDA 5F6HJ 1SYSB 2AXFA 1BHGA 4UTBH 1WFUA 3U48A 4LCCB 1BZ9B 4O2FA 4TNVK 4Q6IB 1UM5H 2DMCA 3DURB 5H94B 1IGYB 1V3LA 4OZIF 3WXVH 3A0OA 1PG7W 5L8LB 4HUMB 5MEND 2H26A 4X6DE 4QRPB 1N26A 4X0KA 3IU3B 3MGOB 1N59A 2NY5H 3RGVD 1DVFB 1NJ9B 1FO0B 1SJHA 3PL6A 3VFOB 3SPVA 3W11C 4OFYD 1ZK9A 4WFED 3AB0B 1EGJL 4OI9A 3DMMB 2C3VA 2AQ3A 5DWUH 3IGAB 2VLLA 3LQZB 4ETQA 3GEWB 3IXAA 2R39A 3IFPA 4ELMA 2DM7A 1SEQH 3FRUB 1GZPA 1ERNA 4K3HA 5FB8B 3NCYP 1QSFE 2DL2A 3DGGA 6FABL 1KYOJ 1U8OA 2EC8A 1I7UB 1IM9A 1FFNA 2UVEA 3LS5H 1JHKL 2B4CC 1BQHB 4BSJA 4ZFOB 4QRPD 1LO5A 4MJ2A 2MSPA 4Y5YC 1NMAL 1DVFD 2ADIA 4JN1H 4EN3B 2WUCH 1UM6H 4OLXL 1KSRA 3N1QC 5E9DE 4JM2F 1IC4H 3REWA 2O5ZL 3DMMD 3FZUD 3MUZ1 5C09B 4LOUC 2I9TB 1SJXA 5IFHL 4WI9A 2DLHA 3BYTA 3EOBA 5DJZB 3GJFB 4NC1C 4ZUVA 4LHQB 4JFYB 5JR1H 4Z78A 3B6SA 3HG1E 3E6FA 4H8WL 3UTTB 1R3HB 3ZDYF 1RZIA 1ZEAH 2FR4A 3FB5B 4YXLH 1UFUA 4EN3D 4Y5VB 4PJBA 3K8LA 1YEHH 2UUDK 2X89A 2PNDA 2JJWA 3QUZC 1H8SA 1HKLH 3FAXA 5IVXE 1DDHB 3H7LA 5BVPL 4JO4H 1N6QL 5C09D 3CVHB 4E5XB 4EBQL 4N1EA 1FL3A 4P4KC 3LV3A 4U49A 5IEHA 4N1CA 3K8MA 4U1MA 1PSKL 2W0FB 4JVWA 1O7SA 3T77B 5HHXL 1I9RL 4OTXH 2C7UA 1CT8A 4Y1AB 5IB5A 1UWGH 2RFXA 4HZLA 3UTTD 3ARGA 3TCXA 4LKCA 1OSPL 3KPOA 2P5EB 1QLFA 3T0AA 4P3DB 5EBLB 4R0LC 3QIWC 2R69L 1J8HB 1M7XA 4U6YB 3QUKB 1H3PL 1KCSL 2HFEA 4X9HA 1GGCH 2MKLC 4HMEA 3OF6A 3WIFB 1FFOB 1NCWL 1FC1A 4Y4KA 2A6JA 3AM8A 5EZJA 4JFEE 4PJDF 3FOLA 3GMPB 1OY3B 2D7TH 3EYFA 3T0EC 3LKRB 1CXFA 1OAZL 5LGJA 1O0VA 3TBSA 4P5KB 4Y1AD 5MEPA 1IGFL 3W0WE 3QRGH 1TXKA 4AT6A 4JZOA 2A77H 1ZHLA 1MVFA 4NO2B 4ZUUA 1HQRA 3B9KA 4JVUA 3FT4B 2P5ED 4B50A 3IFOB 4PTTA 1Y6MR 4X9GA 2DLFH 1CICA 3TT1L 4AYFA 2Y7QA 4S1SH 5K9OA 1J8HD 5B3JF 4NRYA 4ODSL 5FM8A 3U36A 5B4MD 5TDOB 2X9YA 4G6AC 3NCJL 1DFBH 1L0QA 5EU3A 3WLBB 4BFIB 5ICYA 2FHCA 4XX1E 1K2DB 2VDML 4M1DH 4KZDL 3KLAB 4GRWF 2QQLL 5C0CE 3DRTA 1RJCA 4BSVB 2CLRA 4U6XB 3FQXB 2QQNH 1RULL 4EUPH 4JO1H 1OAKH 3TH3T 1GGUA 1T6VN 1YMMB 2WUBH 4I4WB 4PJ5A 1G9EA 4PTUB 2IPKA 3REVB 1KB5L 4H5SA 1RU9H 3PUCA 5IIEA 1MHHB 3QG7L 5CD3A 4X4XA 3MLYH 5FOBB 1N6VA 1VADA 4L8SA 5D1XA 1PW3A 1ZTXH 4RGMC 4NBYB 5DFVD 1W72B 5LVEA 5EBGA 1RMFL 4L9LB 2CLVA 1ZLVK 4G9DB 3K7UA 3G6JF 3WS3A 4PJHE 3UJTH 2XKUA 5HJ3B 2VDPL 4P5MB 5FYKD 1RZFH 1NGXB 3CC5B 5E4EB 3V6ZB 5I1JH 3RZCA 3DGCR 3PF2A 2HFTA 2VKXA 2YC1A 5D2NE 1QLEH 3DX6A 1AO7A 3SE3A 5GZOD 4MLIA 1YMMD 1KJVB 4E41B 2UY6A 1A7RH 1JTOA 3MJ9L 1J05B 4TUOB 3T4YB 1YPZA 5DRXB 3HI6H 4J3XA 4U6VL 2HVKA 1WWBX 1HHGA 3RL2A 2B5IC 5FGBC 2YPVL 2ITCB 5IESH 5HD8C 3AGVA 4WI2A 1HDMB 1HWHB 4D2NA 4JJ5A 5E1HB 2CDEA 2A74B 4PYGA 4OCRL 4LPTA 5J9PA 1HCFX 1YEGL 4DOHB 5TF1L 1RQ5A 5F9DC 2HKFH 5A3ID 2ZKHL 5LG1A 4RBPK 1WT5C 3OJVC 2P5WB 5IFJB 1F3DJ 3N1GC 4XVTL 3BPLB 3R1GL 3HC0A 3VFNB 3RVWD 2VSCA 4JFOA 5ESQA 4DQOH 1ND0A 3CXHK 4E41D 1ZGLM 3UC0H 2PYFB 4N68A 2AK4E 1AGFA 3C9NB 2DBLH 3UTSB 2AABH 1U8QA 4WUKH 4LASL 3WHE1 5IQ9B 1MCBA 5FF6A 3LN5B 4Z8FL 1S9KC 3D3VA 5EO9B 1MCQA 3VXSA 2MOVA 1TQCB 4JG0L 3QXUA 1M6OA 2UYLB 4MS8C 5I19H 2NQCA 4Z7OE 3TIEA 4KI5D 3H7BA 4S1RH 3FN0H 3LZFH 4UINH 1YY9C 4OZHA 1B4RA 5DURB 3DX8B 1WWAX 1TZHA 2ADGA 3V7MA 5A2JH 1KJ2A 1PZ5A 2P5WD 1FSKB 1MCKA 4M7ZC 4L1HA 4ZUTB 5IJVB 3EIFA 1B3JA 3C8DA 1UXSA 3GI9H 1PKQB 4LL9A 5CP7B 1I8MA 1Z2KA 2A2QT 4AK1A 3UTSD 2AI0H 1ZA3B 1UADC 4WGVB 3KJ4B 1BWWA 1ZHKB 3LRSB 3EOTH 2J6EA 4YUEH 1IEAB 4FFWC 3BN9C 4P2QB 1DBAH 2Q6WA 1X5JA 4HG4J 4F2MB 1T80A 2VLME 1CZ8H 5FYKU 1P4IL 3V6OC 1FZOA 4A6YB 5DEGB 1ZVSB 3GHBH 5I18L 3ZE2E 4I48B 4XB8A 2H8PA 4RAHA 2XI9A 4XT1C 5B38B 4KRPC 2F8XC 5EUKB 1AJ7H 3BAEH 4PGBB 4RIRB 3KPQB 1ITCA 3FT3A 2VTFA 3GSXA 3MV8E 3WNOA 2CIIA 1S7SA 4CW1B 3QHZH 2BY2A 5L8KB 2OL3A 2YWZA 4P2QD 5I8OL 3VFWA 4PJXB 5EUOA 4CN4A 3WKNA 2R0WL 4KKCD 2HWZH 2O61A 4BFEA 4IRJB 4GH7B 5E6ZA 1TIUA 1OP3K 3TO4B 2AEQL 1NL0L 4NRXA 4S2SA 2D9QB 3MLUL 4J4PA 4XP6L 4MX7B 4KROB 4PG9A 3K8KA 1CG9A 4YDJB 4GFTB 2EYTA 1WIPA 4N0FA 3O11B 2CD0A 4FXLA 5CJXA 3D39B 4XNQB 1WZ1H 3IU4H 3RRQA 3GKWH 2BRQA 2WWMD 1CFQA 3HMWL 5E00A 4CVWA 2R2HB 3KLHD 5GJSH 1DQMH 4JKMA 1JGEB 1SJVA 1I3GL 3LDBC 4OLZH 4X6BB 1CXKA 5F3HB 5C9KA 1IBGL 4KTEL 1FH5L 4JFFB 2KBGA 1OSZB 4IRJD 1NEUA 1Z5LA 1UACL 3FTGB 2BOBA 5F9WB 4JQXC 3TF7C 3WFEL 3P0VH 3LVEA 4PGCA 3C2AH 1I4FA 4G8EA 4KROD 3KHOA 3JWNC 4YDVB 1UKQA 3WO4C 4YHPA 5F7EL 2GQHA 2P44B 3D39D 3ZDXF 1FRGH 3NAAL 3ELAT 3EJJX 3TN0D 2L0DA 3V2AR 2EEAA 3MRGA 1R3LB 4JRYB 1FV1B 4GBXB 2ZOLB 3T3PE 1AXSB 1NFIB 1T2XA 4HJ0C 5J56B 1I7ZB 4Y0GA 1FHGA 4JFFD 2BNRE 5IWLC 1P53A 2F53B 5FOJA 3I6LE 2DQUL 4MA3A 5F96L 2OR7A 1X5YA 4HK3N 5CZXD 4PRHE 4QNPF 5K9KB 3LQAH 3F5WA 5DVNA 1JZ4A 3CIQA 4FZ8H 4YHYC 5J1TC 3HZVA 1CXEA 1XF3A 1EHLH 3MZTA 2E3VA 5I1AB 4JDVA 5HI4C 3GGWA 3KPMA 3P0YH 5E5UB 4JRYD 4JDZB 3U0TA 4YWGL 4GBXD 4D3CH 4XPFL 2M2DA 3VRIB 2DQJH 1VKXA 3R0MA 4UIKL 3QCUL 3TBYA 4XPGL 3TJEH 1U8KA 1D6VL 2F53D 1MVUA 4JANB 4UDUB 1FNAA 4AEIL 2ADFH 2EKSB 1WGOA 5J6GB 3RGHA 3IJHA 4HBQA 2G2RA 4KH2A 3HTLX 3NFNB 4FQJH 1UB5B 1MWAL 1ZANL 4ODTH 4UNTA 4C56B 1RJLA 1JHLL 4GRLA 4I0PB 5GGTA 3VG0L 4YC2B 5E7BA 1UH4A 3ALWA 1V3JA 5DD1H 1U9KA 5E99L 4KGJA 4P9MH 5DMIH 2DQGH 2GT9A 4FQCL 4JO2H 4CADB 4NP4H 1CD1B 3V8OA 1WIOA 2NY1B 2VWEE 4PJCE 3HZYA 2YMXH 4NZUL 1DQTA 2X4OB 3NCBB 2NNAB 2NY6B 4GMTL 2WBWB 4KHXL 1TTUA 5AWNH 1GIGH 3MRJB 4KRLB 4WI5A 5HVHC 4WWID 1CU4L 4I18B 4KK8C 4XHJD 5CEZE 5GGVL 4UNUA 4OZFG 2XYCA 5AUMA 4HIEB 2RR3A 1JGDB 4IMLB 4C56D 4P99A 2QQKL 1BJ1H 4I0PD 4X80L 1PY9A 3PGFH 3QH3B 4G7VL 4XVJL 3MRPA 3D0LB 5J0BA 1EBPA 3RTQC 3GI8H 5J4MA 2VIRA 3BRFA 3ZKMC 1IAOA 2XG5A 3F12B 3QUML 4LF3B 2BDNL 5B38G 2Y72A 1AD9A 1K8DB 2VKWA 3LB6C 4OAWA 1IKNA 2NY1D 5C0ND 3LOWA 3D9AL 2DAVA 3UDWA 3JV6A 1CGTA 3ESUF 4KTDL 3VI4F 3VFTB 4WRLA 5FHBH 1BOYA 3GIZL 1TZGL 2VDLL 3EFDL 4DCQA 5EO1B 2R2BA 3I3DA 3F8UB 4MMXC 1CVRA 2XZQH 4L8CA 2GY7B 3SKMB 3T65B 3WEXB 5I66A 3UJJH 4HHAA 3ULUH 4JY5L 1LP9B 3S36L 3KG5A 1J11A 3HMXH 1S9WA 1ACYL 1FDLH 1I9IH 2ERJC 1MF2L 4ODWB 4RISH 4U1IB 3SBWA 3RVTD 1S9XA 2FDBP 2X05A 4ZFZA 5MENA 3SGKC 2ZCLL 3CFKA 3P11L 2YD6A 5JPNA 3RGVA 1XZ0B 1LVEA 3G5XA 1I8LC 4OFYA 2E9WA 3LQMA 4L4JA 4JQVC 4WUUD 1WC7A 1NUFA 4NQSA 1RK1A 1UA6L 3KXFB 4JRWA 3S37H 1SYSA 4JKKA 4ZPTB 2AGJL 2X4NB 4LCCA 1BZ9A 4FQXB 3BIBX 4O4YH 4E9LA 4Q6IA 2OS7A 3DURA 5FYLE 1UH2A 5H94A 1IGYA 4M6OH 2MKWA 1L4IA 3CSBA 1MJ7H 1F6FB 3ZTNL 4XCEB 4I8DA 5D7LB 3KPNB 2HLFC 2UUDH 2XTJE 4QRPA 1X44A 3IU3A 3MGOA 4X7SH 2Q8AL 1DVFA 4PRPD 1CIDA 5E94B 1FO0A 4N0CD 4PLOB 3VFOA 3RUGB 1KB5B 1HCVA 4LHJB 2IPTL 5DK0B 5EZLB 2AQ2A 5I17B 2IADB 5BOZG 4NKQB 1F4WH 3SGEH 3IVKB 3DMMA 4J6RL 5FHAH 3IGAA 1OPGL 3LQZA 2AJXH 3PV7A 1UKSA 2IFFH 3KYMB 4FQXD 4LLVB 3B43A 3FRUA 5IHUL 5FB8A 3JVGA 4QHKJ 4ZYKB 5EDXA 2DJSA 5D72H 5B39B 1A7QH 2ATPB 3LIZL 5CINL 2KH2B 5D7LD 4ZD3H 1I7UA 2E8ZA 2J8UE 1BQHA 5T5FH 4OCSH 1LGVA 2X44D 1F45A 4TSAH 1OAUH 4EN3A 2HVJA 5J11B 1PLGL 1OW0C 4QRSB 5H35B 3MA9H 4JN2B 2LVEA 4I77H 2I5YL 3F7QA 2P8MB 4ZAKC 5C09A 2I9TA 5KVGL 1MIML 4OCYL 3H42L 1MFBH 1L9NA 2M1KA 1DEDA 4XNYH 3BRGC 5DJZA 3GJFA 1GGTA 4JFYA 1ZHBB 2CUHA 4ZG1A 3B5HA 1N64L 2XN9E 2HT3D 3O4OB 4OIIH 4V1DE 5KVDL 3UTTA 5F7NC 3IJSB 1R3HA 4J3TA 2VUYA 4MNGB 4H26B 2AEPH 2DDQL 3FB5A 2VXVL 4YHKL 1EJ6A 4Y5VA 4M5YH 4GG6F 4Y19E 5IMKB 2F19L 3U4BL 4GW5B 1P9MA 4LSQH 1GAFL 3ES6B 1U8IB 3OJMB 5D9SB 1DDHA 1FQ9C 3CUPB 2DIAA 1T3FB 3CVHA 4E5XA 1PAMA 4P9HH 1JNNH 3QQ4B 5IJKA 3DTXB 4UT7L 1S5IL 2W0FA 3MLWH 5C86A 3PWPE 3T77A 3L7FB 3RBSA 2UV3A 4JB9H 4Y1AA 4H1LH 4ZS6D 4CGTA 4AENB 2P5EA 3NPSC 4P3DA 4QOKB 5EBLA 1ZLVH 1YNKH 3AC0A 5BQ7B 1J8HA 3G9VA 2ILLA 3INUL 4U6YA 3QUKA 3BUYB 4URTB 5GS0H 2RGSA 3MXVL 2DQDL 1AXTH 3WIFA 1FFOA 1AHWC 3CX5K 4PJGB 1L7TH 1VERA 2XNAB 3GMPA 4HKXB 4OFKA 4K3DH 3MR9B 3LKRA 3ET9F 5DUPH 3ZT7A 3ARRA 3TYGL 1ZVYA 2VDRH 2MJWA 5CIPH 1YQ2A 4KQ4L 4P5KA 4Y5YB 35C8L 4NO2A 3FO0H 4Q6YA 3W11D 1LO3L 1QTYT 4YE4H 3FT4A 5CGMA 1JZ3A 3IFOA 4JFDB 4M7KH 8FABB 1I1AC 4W81A 4L4TB 4QOKD 4NQCB 3GK8H 5I1IL 1CR9H 3HN3A 1LE5B 3MJGX 4DGIH 5DC0A 5TDOA 4JFXB 3JWDH 5J7CC 1JHTB 1F6AB 3WLBA 4TVPE 3T0XA 4BFIA 5I1GL 1K2DA 4HGKC 3KLAA 4RBPH 3MUJA 2C4FU 1NGPL 3A6OA 4U3XA 4BSVA 4AEFA 4U6XA 1QFUH 2J3SA 3D18B 3FQXA 3F7PC 3LEXB 2YPLE 5KVEH 2E5EA 4HK0B 2YUZA 1YMMA 4I4WA 5L0QC 2BVTA 4LIQH 4PTUA 3REVA 3M45A 5HVFB 2Z4QB 1Q94B 4JFDD 3WFZA 3QUZB 2HKHL 1MHHA 1FGVH 5FYJH 5E2TH 1YYMH 4L4TD 5EG6C 4YXHH 5D7SL 5FOBA 4NQCD 3F58L 4LOUD 2JTDA 5ANMB 2BNUB 3G5YB 1J0JA 1U92B 3OKEB 1W72A 3VXNB 4P4KB 1G9NL 4L9LA 4G9DA 2DL9A 4R96B 2NXYB 2WQRA 5HJ3A 4P5MA 5BV7H 1KT2B 3HC4H 3OAUH 3WNLA 4IOIB 1NGXA 3CC5A 2W9DL 3V6ZA 2LU3A 4I3GA 4RNRB 5BS0E 2IMMA 4Y7MA 2VDNL 3P9LB 1UEYA 4OCXL 2XRAH 4O5LL 1XIWC 5D2LE 5IHLB 1KJVA 4E41A 3HE6C 4NZRL 1J05A 3QIWB 4R0LB 4P59L 4TUOA 3T4YA 3P9WB 5DRXA 3T8XB 5LXGH 5L9DL 4ZTPH 3QUZD 2APFA 1IKFH 1ETZB 2YOCA 4YHLH 2ITCA 2R0KL 4UILL 1HDMA 4PD4K 3QDJB 4JQIH 3T0EB 2LU4A 1WUNT 4HQQH 4IEFB 5JQ6H 3AVEA 5C0AB 3V8CA 2NXYD 2A74A 1CYGA 2DF3A 5DVLA 2X4PB 1F00I 4LRIC 4GJTB 1W0YT 4WI8A 4HPYH 1O7VA 1V7MH 4GMSL 1S7WB 2JCCE 3BJ91 4S10A 1S7XB 1BIIB 2P5WA 5IFJA 2DN7A 5C3LD 2CGRH 3VFNA 4NKIH 1LK2B 1VDGA 4X6EB 3IS1X 3QIWD 2PYFA 5DDHB 2P48B 3C9NA 5DJ0B 3UTSA 3AS3A 4UIMB 2NY3B 1T03H 5IQ9A 3GBLA 3LN5A 3K46A 4BZ2H 5EO9A 5F1SA 1A0QL 4HLZG 2HFGH 1TDQA 1VFMA 5DUML 1WCBB 3QDJD 2BP3A 2UYLA 4JFHD 4OBRA 5TPWH 2ICWB 1OP3H 1XF2A 3DX8A 2GW5A 2X7LB 3U9PL 1E6JH 3ULVH 4ODVH 4ERSH 1BAFH 4XPAL 5ACMA 3CFIC 3TM6A 1HNGA 2C3GA 3QNZB 4R8WH 4ZUTA 5IJVA 3EAKA 5K9QG 5CP7A 1FFQA 2EDOA 4LHUG 3C5ZD 3EDEA 4RGMB 3AREC 1KENH 1JRHL 1ZA3A 3WIHH 2NY3D 3VXMB 4G6AD 3B9DA 1ZHKA 4PLNC 5LGKA 3LRSA 3O41B 3WNPA 5TE6L 5F7DB 4EDWH 1MNUL 4J23A 4OGXH 1IEAA 1MWAB 4P2QA 2Z93B 2FGZA 3MACL 5IVNA 4F2MA 5CJBA 2B4CH 3QPXL 4J8RB 4G6KH 5F7HA 4LVHC 1IAIL 3A67H 4A6YA 5CUSL 2I27N 4LRNL 1A7BA 4ELME 1P7HL 5DEGA 1ZVSA 4RSVA 5F7LB 4EJ1C 3VH8B 4I48A 4BZ1L 3KLDA 3WNMA 3MCLH 2B5IB 5B38A 1DQQB 1CIUA 3JBG7 5EUKA 4PGBA 4RIRA 3KPQA 3OWEA 3KPRB 4MA1C 1RHHB 4K2UL 1BFOB 3GSUB 5CS7A 3VXMD 1EVTC 5DR5H 4CW1A 1RIHH 2Y6SC 2YSSB 3T2PA 2B1AH 2JK5B 1VFBB 1JN6B 1NCDL 4PJXA 1DN0B 1ULVA 2VOTA 1DBJH 3KS0H 1IQWH 5GS3A 4IRJA 3QUMB 2GAZB 4JY6B 1NANH 3TO4A 2YWYA 15C8L 1VEOA 3L1OH 3OQ3B 2HAZA 2J7LA 3H3PL 5CBAB 5FEBA 4MX7A 3V5DB 5ILTL 1I7RB 4YDJA 3HAEB 1HINH 4OLUH 3O11A 1CD8A 5IP4A 4QXGL 3EJYC 4WU5B 5D1ZC 5HD8D 3D39A 2Q76B 2YD7A 4XNQA 2QJDA 1KN2H 3DX7B 3KPRD 3UTQB 2XTJC 1FNHA 3V7AE 1JGUL 1KCRL 2ICWI 4QT5B 5CJ5A 2OJEB 4UB0L 4PJBE 3L9RB 2R2HA 2ZWLT 3VFRB 3S98A 4C54A 1M4KA 1JGEA 3NACL 3CX2A 2VJXA 4X6BA 3FQRB 5F3HA 2ZUWA 3GJEB 4G5ZL 4M7ZB 4MQXC 4JFFA 1OSZA 1ZT7B 4NJ9H 3FTGA 3RPKA 3OAYH 2FB4L 3LKSB 2DQFB 3D48R 4YDVA 3MZGB 1E4XH 3CDGB 1FYTD 5D8JL 4UTAH 4MS8D 4XC3H 3ARSA 1OCWH 1R3LA 2EDRA 4JRYA 1FV1A 4GBXA 2ZOLA 3WFBL 1AXSA 2D0FA 4H88L 1I7ZA 5GRUL 1OT1A 2WMPA 2EKJA 2F53A 4LDEB 3W9EB 1XF1A 5F93C 1FL5B 5LGHH 2MCPL 5J89A 2Y36H 3QIUC 4JO3L 4LAQH 4MDIB 5FGSA 5T5NG 2EICA 5K9KA 4O2EB 4FFWD 4ENED 3BN9D 1NCBH 1WZLA 2JKXA 4HD9A 1Q0YH 4BK4A 2GITB 4RQQB 1Q72L 3HNVL 3I50H 1KG0B 4HUVB 1RZKC 5I1AA 1WITA 3QBTB 4NC2B 5GRWA 4W70A 3SGJC 1PY4A 3CFEB 4JDZA 3BKCH 4UT6H 2XQBH 3S36X 2ZUYA 3BHBB 1EFXB 3T2NH 3QEUB 3VRIA 2I60L 5IROA 5F7FA 2FLBT 5L2KE 1KFAH 1UM4L 4WY7L 3BW9A 5ITFB 1D5IL 4DKEH 4JANA 4UDUA 4HZAA 1P4LB 3WLWC 1YEIH 2EKSA 3ZYOA 3QCVH 3STBA 2Z8VC 5GIRB 5J6GA 3KYKH 4OUUB 1U58B 2DM4A 4WTZG 4ONOA 4PJ5E 3TZVC 3NFNA 2EE3A 1UB5A 4YK4B 4C56A 3LDBB 2PTVA 4I0PA 2QSTA 2BHZA 1FNSH 1QOKA 2GCYB 2I9LB 4GRWH 2HT4D 4MNHB 5ICXB 5JMRA 5AG8A 1XF5B 4BK5A 1WF5A 4YGVB 5E2VH 1EFXD 3CCHB 4K3GA 4NQEE 3Q1SL 4X8JB 5EORL 3FQTB 4CADA 1CD1A 1JUFB 5T5NF 3D25B 4OQ1A 5BO1L 3WO4B 2X4OA 2NNAA 2VAAB 4XAKE 1UZ6F 3O3EB 4HS6B 3MRJA 2J88L 3NFPB 4I18A 4PJAF 1A14H 4HIEA 1Y6NR 1JGDA 3MBXH 4IMLA 2C26A 4KK5C 3KDMB 4TULH 3QH3A 1HXYB 1LO4H 3MRBB 5C0RH 3D0LA 3F7YB 4TUKL 4X99B 3F12A 4Y4FC 4Z7WF 4LF3A 3AROA 4QO1A 5DVKA 1K8DA 4ONGH 4PBVC 1N0LA 1GYAA 1FIGL 3FQUB 4WEBL 4X6CF 4FS0A 1R24B 1UG9A 1T4KB 4MD5B 4YHYB 4B5EA 3VFTA 1MCJA 1EEZB 2EIDA 1RUQH 4IRZL 3CDCA 1EO7A 3RJQB 5CEZL 3QEGL 1QSVA 3QZWG 5EO1A 3S88L 5FCUH 4K3JH 2IH3B 1BEYH 1U8JB 3QXTA 3SKMA 4TUJB 3T65A 2WANA 3WEXA 5IVXB 4HJ0D 4WV1C 1LP9A 3N85L 3U1SH 3VXSE 3ROLB 5JA8B 2GTZB 3DSFH 1UEMA 4ODWA 4U1IA 3I84A 1INDH 3SE8L 4EXPX 1OT2A 4OZHE 1XZ0A 4XP5L 4LSSL 1QYGL 1ADQH 1MCWW 4LLYB 5AEAA 1N7ML 2F5AL 1J1XL 4LMQI 3KXFA 1UKTA 3T04D 5E2WH 2LU7A 3NOIA 3O81A 1GGBH 1IEHA 2YD8A 4G7YH 4ZPTA 2X4NA 4UQ2B 4FQXA 1G84A 2IMNA 2Q7NA 5HPOA 4JFEB 3Q6GH 1NSNH 3C6SB 2DQIH 3K74B 4YAQB 3O0RL 4XCEA 1D9KC 5D7LA 4K9EC 3KPNA 2PTUA 1QPXA 5HVHB 4N8PA 1H3WM 5E94A 1EJOH 4KQ3H 3RUGA 2BFVH 1J0ZA 1KB5A 5DK0A 5EZLA 2FH6A 2CPCA 5I17A 1M05B 2IADA 3TVMD 3IVKA 3BWAB 3PDGA 3RTQB 1U41A 1RIUH 4XPBH 2X5PA 3KYMA 1DL7H 1ZLSH 1CGXA 2D9CA 4JFED 5FYLL 1HI6B 4KDVA 3H9SB 4K71B 5GSRA 4N5EC 4N1HB 4ZYKA 2HT2C 1MFCH 5C0CB 5B39A 2ATPA 1CXIA 2V9TA 1CLZH 1NLDH 4FG6C 4HF5H 3FB8B 2HTLC 5CWSB 1QFWM 3O2DL 2IQ9H 1P4BL 1NCCH 2OJZH 4KK8D 1A3RH 3RWCB 4NN6C 2QSVA 1OP5K 3MJ9A 3KJ6H