3ARGD

Ternary crystal structure of the mouse nkt tcr-cd1d-alpha-glucosylceramide(c20:2)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
241
structure length
236
Chain Sequence
AVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDAEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular basis for the exquisite CD1d-restricted antigen specificity and functional responses of natural killer T cells
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 48
structure length 236
sequence length 241
ec nomenclature
pdb deposition date 2010-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3argD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3argD02
5EOCH 1BAFL 2VDKH 2XZAL 1CF8L 1BOGB 2AEPL 2NXZB 2KQNA 4F7TA 2XTJE 1CFTA 4U0QB 1FL6A 3QEGH 3L7EA 4MA7H 4BH7A 4C55A 4JRXA 1YQVL 3EYUL 5FOBA 3RX8A 1GOGA 3CMOL 3VXQB 5DT1L 3D2UB 4X7FC 3S88L 1XGQA 1HSBB 2R69L 4I3SH 1A7NH 3ZTJH 2Q8BH 3D9AH 5EZJB 2E9BA 3OKDA 4UDTB 4P5TA 4YIQA 3NCYP 4ZD3H 4OM0H 3D3VD 3MRPA 5D7JA 2PO6A 3ES6A 5EU6A 1QLRB 3MLXL 4K9EL 2GJJA 4I3RH 5F6IB 3D0LB 4QNPE 3VD4A 3RZCB 3ZE2F 5C0ND 4OUUA 1M7DB 5J6GB 2ARJQ 3OAYH 1KCSH 2WBWB 2ZCHL 2FIKB 3MLZL 3ZE1F 1J1OL 5DWUL 3ZE0E 3MR9A 2WBJD 3KXFA 1I3GH 2Y4SA 2V7NB 4P9HH 4P3DB 1QVOA 2NY6D 4TUOA 5KVMC 4PGEB 4MS8C 3KWWB 5E6IA 3WNLA 3BIKA 2B5IC 1AHWC 2NXZC 4NRYB 1FGVL 4CBPA 4J8RB 4YGVA 4PLJD 2CK0L 4PP2B 4Q2ZA 5TF1L 5AWNH 1FN4B 4HJGB 3QIUB 5I76A 3I6LD 2WWMD 1EFXA 1LVEA 3U48A 2APBA 3LH2H 4LPWA 3SOBH 3CU1A 2AK1L 2VITB 5CJQH 2XZQL 4AG4L 1DQQB 1KXTB 1VGKB 4GG6F 1EHXA 3A6CL 1DN2A 4DZ8A 3O6LL 1JN6B 1IKFH 4PJAA 4L8DA 3U9UB 4QT5B 1RULH 3GJEA 3UX9B 4P5MB 5D1ZD 4CU6A 1RZFL 3M17A 3SO3B 1B0GA 1NGXB 2JK5B 2IANB 4JM2A 3VWKC 3MCKB 4Z77B 2R4RL 1UWXH 3TVMD 1MREL 3HNVH 5ALBH 3QISA 4LCYA 3SCMB 4PJBB 3CMOH 4X80H 4X7TA 3L5HA 4U3CA 4U33A 4OF0A 1B0RA 3H6JA 5JTWA 3NIDE 1SM3H 5D72L 4Q9RH 5DD1L 1JZ5A 35C8H 4OF6A 4OCRL 1F4YL 1FVEB 2J12B 2OI9C 4NWUL 4XAKE 4GAYB 4YHOH 4JZOA 2A6KB 3P9LB 4NIKB 3LPGA 3DV6A 1G9NC 1X5LA 1G0YR 3IRZA 4PJDA 1CD9B 1QBAA 5T3XH 3MV7E 1K8DB 3VGGA 1BQLH 3SCMD 1LHZA 4Z0XA 1UENA 1WZLA 1BEYH 3R1GL 1HINH 3SKMB 3GI8H 4L8BB 2DQJL 5IBLD 5KSAB 2E8ZA 2CSPA 1AHWA 1VERA 2QL1A 2WIIB 1UCBL 1EHAA 4UQ3B 1HKLL 2XN9D 5DJ8B 4U6YB 3O9WD 5GZNC 2FZ3B 4HZAA 4GUPA 1ZLSH 1KJVB 5FO8B 3A6BL 3FAWA 4PR5B 4APQC 4HWUA 1C5DB 5FIEA 4D9LL 3QIBB 5FUZH 4P2QB 4E41D 5EG6C 1MF2L 1RUKL 2R8SL 2AXFA 4UIKL 4X4YB 1NCCH 1T3FB 1BJ1J 3NPZB 3WJLC 3MMEA 1XH3B 4L5FL 3OKLB 4LSQL 1ZT1A 3C5SB 3RQ3A 2VTFA 4L29B 3LQAC 2FO4B 3O2DH 2X4RB 5JNYA 3T0VA 2ADGB 2YKLH 5IR1B 2VXTH 3IU3A 1ZLUH 3N9GL 3NH7H 4WJ5A 1UVQB 3T4YB 1QLEL 4JFDB 3CFCL 4G7YL 1EXUB 2P45B 3X12A 1MFEL 1XF4A 5EU6D 1XIWD 4O2FA 1OP3K 4RNRA 1S9VB 4NKMB 4JRXD 4NQED 1OP9A 3TBTA 1I4FB 4ZUSB 3TBYA 1MCPL 2BSSB 5FM4A 3HPLA 2EKSB 1QSFD 4L3CA 5SWZB 1I8MB 1DFBL 2LABA 3QIWC 1Y6NR 3KXFD 4A6YL 4MJ4A 3SDDA 2NNAA 5F9JB 3BDXA 3WIHA 4NNXB 1IKNC 3TBTB 2F8OA 4P99A 5JO5A 5B21A 4PB0H 4IHOB 4M6MH 5JR1L 1J1XL 1HQ4B 2DLFH 5MP6L 1G7IA 1A14H 2WWMC 3RWGA 5IMMA 1JWMA 1YY8A 5DJCB 2C7UB 3QDGA 4AZ8A 1MCLA 1U8QB 3QUMH 3HS0B 2DM3A 5IR1A 4YHLH 2NXZD 2YZ1A 3DURA 4BZ1L 3OKLA 3SBWA 4KZEH 3GJFA 2VZVA 3WFBL 1CD0A 1NAKH 2Y7QB 3QO0B 1KT2A 1AR1C 4QRPB 1W72H 3Q5TA 3FZUD 5GGVH 1ZAGA 5DJXB 3PF2A 4PJFF 3FQRA 5FUZL 1MPAL 1PD6A 4QEGA 3MOAH 5CZVH 4ZFZB 1WAAE 4U6YA 1QSZA 1YNKL 4ZUVB 2MMXA 2UWEB 2QSTA 1LE5B 1WAAA 3UTSB 2VXTL 2XQBL 3AFLA 4RGNC 3U0WH 2A9NL 3QEUA 4GSDL 5E8OB 4Z5RA 5DHVA 1KN4H 3G6AB 3BUYB 4IS6A 3WS3A 5M94B 3F6IA 4JFEE 3HFML 4P23D 2CKNA 2V2WA 4H1LH 1RURH 3C6LC 5IB1A 1MH5B 3V5DA 3T8XA 3FONB 3HN3A 1CTOA 5IVXA 4ELMA 1FNHA 1TPXC 3HRZB 1KNOA 4QCIA 5T3ZD 1KLUB 4HGKC 4CVZA 4DGIH 2F8VA 4AY0A 2PW1A 1VEOA 2GYSA 1I1AD 3DHMA 2XWBB 2QEJA 1JPFA 2BC4B 4FABL 3U0PB 5A2LH 3MRCA 1IEBB 3GSWA 2W59A 5E8OA 4Z5RB 4WI9A 5DURD 1TDQA 4UT7L 1Q9OA 1IZJA 4ZTOL 4QRRD 3MC0A 4ZPVA 2ICWI 3ARBD 4AEEA 1WBZA 2OZ4A 2F19H 4IRSB 2H1PL 5T33H 3VXTA 4X6EB 1OAXH 5DZNA 1XGTB 3WFBH 1NEZB 3KJ4C 4XP5H 3VJ6A 4OLVL 2ICES 4RBPK 3UEZA 3TBVB 3B2UD 5ELIA 2LTQB 3NGBC 1FN4A 4HJGA 1JV5A 4AQ1B 1PW3A 4ZNEE 1FFOA 2NW3A 4MQ7B 2D7TL 3KPRA 2F53E 4MDJA 1G9MH 4HF5L 1A14L 2J2ZA 3D85D 4FMKA 3EAKA 1YEFL 5ITBL 5J1TC 1P9MA 1DDHA 2F58H 3ILQC 4XP9H 4HWNA 1W72B 4MYWB 5C0BA 5FGBC 3C8KA 2DQHL 1QSFA 1OAYL 1QVOB 3D69A 2NW2A 4GRMB 3NTCL 1D5BA 2ADJA 1UB6B 2P47B 4V1DE 1I1CA 1EAPB 1M7DA 5J6GA 3BWAA 3JBG7 1XGUB 2J8UE 4KJWC 3WSQH 3EDDA 3V8CA 1N6QL 5A43C 1ZGLM 2A74A 3LQAL 3FMGL 1KIRB 3IT8D 3I6KB 1CDUA 2DQCL 4TOYL 4P4RA 2OL3A 3DYMA 4DVBB 4PY8I 4HH8A 1S8DB 1AE6L 1F3JA 4YHLL 4YNYB 1CICB 5LQBL 5C07D 3HI1A 5I1JH 4HFUH 5ISZA 3VD7A 1UYWH 3MXVL 3ZKNC 3KPRE 1U3JA 4MB4A 3DO7A 5MI0C 1NEZG 1KGCD 5JIIA 1MEXH 3SKNB 3HNTH 5EN2A 3OKMB 4C58B 3P4MA 3STLB 3QPQD 1HQRB 5TDNB 1UXWA 3X3GL 2FR4A 4I0PC 5LJYH 4U7SA 1OB1B 5DHYB 3QWOA 2CIIA 1NMAL 5F93C 15C8H 5ACLA 2Q86B 3D87B 5CZXC 3P4NA 4UTAH 1JRHH 3GMRB 4XC1H 3ARFB 3DOSA 3C5JA 2WK2A 1G1CA 1CGSL 2VXQH 1T7WA 3DRQA 3S9DB 5KS9A 1QKZL 4I3RL 1YECH 3C6LD 3MACH 2IH3B 3TYFB 1DQDL 4PRPA 5C08D 2E6QA 5FHBH 5E7FA 4L8SB 5CBAA 4PGCA 5I6XC 1UM5H 3M45A 4KMLB 4HFUL 3RL2B 3GO1H 4ZQKA 3SKUD 4YHYC 3H8NA 4ODUB 1U58B 1FSKC 3N1FC 3BP6A 1FFRA 3RGVC 1HYSD 4LSUL 4U1NB 3WLWC 4B50A 2Q3AA 4HV8B 3FHAA 4Z7OF 4GG6A 2CH8A 5CGTA 1CZ8L 2VL4A 4KJPD 5FM8A 2NW2B 4M9PA 4EN3C 2VISB 3NIDF 4OKDA 1PZ5A 3OGCA 5HHME 4FFWC 4YFLF 5AWNL 5GQBA 1PSKL 2DMCA 4X7TB 4XBGB 3M07A 2P5WB 1FZKB 3KJ6L 1PQZB 2DWDA 3EOAA 2DQFB 2RHEA 3QRFM 2WANA 3O8XB 3VXUD 4CMHC 3VGBA 2DM4A 2IBZY 4YK4C 5ALCH 1WFUA 2FBJH 4JFXB 5IM7B 1D5MB 1LWRA 4I48B 4ZPTB 5I8EA 4F15B 4QHKJ 1A6WH 4LLUA 1QSEE 3CIQA 4GW4B 3PXHA 5FHBL 2Z8VC 4DZ8B 4FQXA 2YD4A 4JREC 4O58H 4JDVB 4M8VA 5JW5A 1RZGB 4Y1AD 5BVPL 2VITA 1T20A 4AENA 2NZ9D 4KTDL 3O8XC 1J87A 5AD0B 5IMKA 1AQKH 1Z9OA 3GNMH 3GMNB 3UJTH 5ITFB 3ZKSD 3B9KA 4AL8H 3FQWA 1KNOB 4QCIB 1MCWW 4EN3B 4WNQB 1CR9L 3BN9D 1KB5L 2AV7A 3THMH 2VDQL 2DMBA 1DSFH 2CK2A 1ACYL 2VN4A 2VR5A 3UTZB 4KUCD 4NYLA 4UTBH 2H26A 1WIUA 3UBXI 2XICA 2ZOLA 3N50A 3O3AB 1RK0B 4PRHA 1A2YA 1IILE 4NFBA 3JTSB 3L3KB 3VFTB 2OTPA 1YMMB 3ARGC 5IB5A 1T0NA 1DLFL 3RVWC 4H25B 3AY4C 4P2RB 2B39A 4RWYL 5DMIH 1J0IA 9CGTA 3NPSB 3P9WB 3HZYB 4UT6H 3EYUH 4FXKA 1EBPA 2ARJA 3PE9A 4ZUVA 3B2VL 3AVEA 5C09E 3BKCL 5TGBB 5BV7B 2FNBA 4NQXA 4J3XA 2BJMH 1HIML 5I17A 1RHHB 2CO6B 5FKPA 3GRWH 3RTQB 1OGAB 4I0CC 1E4KC 4HGWB 4ORZC 1BHGA 1PJ9A 4MNHA 3LKSB 3PHQB 2XOTA 5F3HB 2CKBA 4M1GH 2QQNL 4MJ5B 3O45A 4Y8DC 2BHUA 2GT9B 5HHQB 2C7UA 1FL5B 5I1AB 4F7EA 5IB5B 4WFFD 4MNQE 3DTXB 3VXMD 1NBZA 3L3OA 3REWA 5DR5H 1S7XA 3HI5L 3KPSA 5GGTH 2FGZA 3WN5A 3UTZA 2J6EL 2EH7L 2XA8H 4IJ3C 1BAFH 3MRHB 3QHTC 2ATKA 2DLFL 2GCYA 4K8RH 4I3GA 4PGBB 4X5WB 3VXSB 4TULH 3BP5A 1GZPB 5DGQA 5I15L 1JF1B 4NKDB 2NY1D 2ESVD 4K07A 1F4WH 3BMWA 3ISWA 5DRNA 4ZNCD 5J8OA 1U95A 1Q9WA 3AAZB 3C09C 3BP5B 4NKMA 4OI8A 4NQUA 5ID0B 5JPMA 3RUGB 5I75C 2O5ZL 2C1PA 5D71H 2EDEA 3D2UD 4F37F 2A73A 2NY5H 3MRIB 5FYLE 2GJ6D 4PRPE 1MY5A 3ZZ1A 3B3IA 3PWPE 1T21B 5I0DA 2C1OA 3I3BA 1A8JH 2H32A 3V0VA 5D1XB 3HG1B 3ZHKA 4K3GA 4WDIB 2HVJB 3FFCB 4F7EB 2Q8AL 5T1MA 3TT1H 1LO0L 3GHEL 4XCYB 3MMEB 4FQXD 1VPOH 4JR9L 5D6DC 3MTRA 4M3KB 4OCYH 3MV7B 3TN0B 2OSLA 2PXYD 4JFOA 1RK1B 4G80A 5BV7H 1FYTB 3B9KD 5BO1L 3O8XA 2X40A 3BYTA 1O0VA 4FHBD 2H1PH 4HIHB 4R3SA 4Y19B 2HN7B 5IHUL 2C5DC 4FRWA 4QHUB 1MJUL 5I17B 1KB5A 1MLBB 2E9JA 5C08E 3TT3L 1I1FB 5KAQF 1FO0A 1MLCB 1QOKA 1CE6B 1WUNT 4JZJA 3I3DA 1U3HB 5I1LA 4YHML 1P2CA 2W65A 5T5NF 5D6CB 1UGNA 4OF5A 1HEZA 5D7SH 1PLGL 2F58L 1FVCA 2A77L 4K3EL 3IVKB 3RWHB 4YAQA 3D48R 4XX1E 2CJUL 2D0FA 2BY3A 5J13B 2YUWA 4IRJA 4HZLA 5E6ID 4O00A 1NAML 4FABH 5IJVA 2VERN 5DMJB 3FQUA 4P4KB 3UTSE 1TJGL 3NFPA 2GJZA 3GHEH 1IEAB 4QHMB 3QEHA 4G8FB 4JFFA 3O4LD 5DD6B 5BRZE 5E94A 4PJ7A 2J88H 4V1DD 4WTWA 3GI8L 3S35X 2B4CH 1OOAA 4FZ8H 4ZFFB 5ITFA 2VE6A 2QR0B 2EDNA 3NZHL 5D5ME 3FO1A 5F7DA 1X4ZA 2OP4L 3PWLA 4MAYC 1YNTB 4NPYB 2X9WA 3ZSSA 3TT1L 2UUDH 2CDGA 3B9AA 1R3KA 4M93B 3VFGH 5HI5D 1AQDA 1P4BH 4NQDE 1S7SA 1MEXL 5I15H 4G43B 5FUCE 1HOCA 3CVHB 1DEEB 4FQXB 2B1AL 1K4CA 1R3LA 5L2KA 2XKNA 3U4EB 4KK8D 5ENWA 1BFOB 1WICA 4KKAD 2F9BT 2PW2A 4WO4A 4KK5C 2R2BA 4JFXA 4JANA 1IGFL 1FV1A 5GRVL 2IADA 1KIUA 5C7XH 1JVKA 2VAJA 3ULUE 4U05A 1DZBA 5IHUH 3RRQA 1EVTC 1JK8B 4M6OL 1A6ZB 5AZEH 3LQAH 3N0PB 4ZOBA 3WUWG 1BX2B 2NY1C 4AQOA 4PJIB 5E1AA 2APVA 4X6DF 4Y2OA 3C5ZC 5J0BA 3IF1A 1LK2B 3H9SE 4S2SA 3LKRB 4YHPB 5I1IL 1NBYA 5F9OH 3OXSB 1FAKT 2UY6A 1H5BA 3L3JA 2OK0H 2XZZA 5D8JL 3BGMA 1Z5LB 1KC5L 3KPOA 4ONFH 1R5WB 1I3RB 4FQJL 3AREB 1TJHH 1A47A 2W9EH 2ED9A 3AU1A 4YIQB 4R90L 4J3OC 4XVUC 2FHBA 4WV1A 2VXSL 4EUPB 3GEWB 3EYVB 1F5WA 3T65A 1G7JB 4QXUL 4ZUTB 4PJGF 4K7PY 1BVKB 1G9EA 3TBSB 4FQCH 4LDLB 4V1DB 1G0XA 2BSRA 3LRSB 1CLOH 5H37G 4R97C 2E3VA 3LKOB 4WHTB 4BFEA 2IH3A 1JGVH 3BMVA 3UTQA 2HRLA 1IM9B 2LE9A 3MLWL 2AKRB 3BH8B 1NCTA 3CZFA 1JFQH 3P2TA 1GGCL 1BBJA 32C2B 4YDVB 5T3ZL 1WAAF 3PGDB 1F02I 3K81A 4GG8A 2DMKA 4K2UL 1TJGH 4HDIB 1AI1L 1S5IL 1ED3A 4K23H 3EUUA 1JPFB 1DBAL 2BY1A 4GMTH 5KJRL 3OKMA 4LFHD 5C2BH 4X8JB 3V0AC 2ZCHH 5IJKA 3CFEA 3ME0A 2ZNXA 3HHRB 4MCZA 4G6AC 4MA1B 3DRQB 4PJGB 3V0WL 2AABH 3QHFH 3CFEB 3IJYB 4L4JA 2MCG1 1CGSH 3N85L 1K4CB 3J7HA 2R0WL 3HPJA 5FUOL 4ZD3L 5F1SA 4NQSA 2GK0A 3MRJB 4TNWF 1UADC 1CL7L 3BKMH 1KOAA 1VDGA 5EZOH 1KUMA 4JFPB 5KSUA 1MIML 3H9HA 4S1QL 4N5UA 5MEPA 5J57B 2AK4D 4WFGE 2EDDA 4U1LA 5HPOA 4LCCB 3SCMC 3N06B 3O2VL 1UKSA 3MYJA 5K9OA 3MJ9A 3WFDL 4HFWB 5SWSD 4JM4H 4I9WD 1MNUL 5ANMB 1QFHA 3CFDB 1QSFB 4FG6D 5IW3A 3HI1B 3MBXH 2EYRB 1NFDF 2OR7A 1JGVL 5D7JC 5DFVC 1TXKA 1RJYA 4MDJB 4YR6A 1R5IA 4WVRA 1AD9A 2FX7L 3S4SA 3I6KA 3MRLB 2QJDA 1MHHB 2M2DA 4XPBH 1Q0XL 1ZHLA 3VG9B 1FVCB 1YEGH 1AGEB 3MBED 1ZSDA 2GEEA 4JKPL 1FNSH 5L9DH 2EXWD 5H35A 4P2RD 1ND0A 4XCFL 5B8CC 5IMMB 3B9KC 5TE7H 2CK0H 4ZFOL 5L8LB 4HUWA 5F9OL 3STZB 5B3NA 3UJIH 1RIUH 1GC1C 3QQ4A 3QUZB 1U3ZA 3WD5L 4BQCA 2J3SA 4JM2F 3HNVL 3ZT5A 2NTFA 3TWCH 3BXNB 1H0DB 5J06A 5HYJE 5EO1A 2D0HA 5IK3A 5J56B 4P46D 4JQXC 5C0AD 5KSVB 4DTGH 1F90L 4H20H 1N8ZB 1UZ8A 1V3LA 3RUGE 2X4SB 1I8LA 4L3AA 5C0GA 1EGJL 5L88H 1RVFH 5IBUB 5E24E 3VXME 2X4QA 2HFTA 3DVNA 3EDKA 1U8HB 1ZS8B 1WCQA 2C1OB 1MVUA 3QUYC 5ETUA 2VLKE 2ADFH 3SQOH 1ZT4A 4PLKD 2Q7YB 2A73B 3MJ7B 4HH9B 4HXBH 3WJJC 4OGXH 4LVOC 4EI5C 1NMBL 4HS3A 3HCVB 4U6XA 3D0VA 4PJ8A 5GIRA 3ZDXF 3O2VH 4HCRH 3MA9L 1JHKH 3VU2A 3VDCA 3O6FB 5GZOC 2WUCH 3RWDA 4I18B 4XZUA 1GZPA 4NUGL 4LVHC 5LGJA 1P4LB 2HRPL 3QIWA 2FB4L 1T2QH 5IFJA 1Q9KB 4Y4FD 3TZVD 3OZ9H 2W9DH 3UYRH 3WNMA 4JFZL 2P44B 2AGJL 2AJYL 1OAYH 1R3HB 1HHJA 3A0OA 3QZWG 4OLUL 4JLRA 4FQIH 4K94C 1RIHH 3O45B 2E7MA 3CFKB 4YZFE 4JFED 5K9JL 5DQJB 3O3BA 3MBXL 3QIUD 2FGWH 1YY8B 2GUOA 3G5ZB 4MAUL 1AGFA 2CRYA 1INDL 5DQDH 3QQ3B 3CU7A 2PO6C 2KKQA 1KT2B 1NC4B 1A7OL 4M48H 4NO0B 2V2TA 4LSVH 4HK0B 2G2RB 5KVFL 2JJTC 3ZDXE 4LGSB 4LPTA 4YEFA 2BSSA 1M6OB 1YJDL 5DVKA 1E4JA 4OCYL 1YEEH 2GAZA 1I1AC 3GJEB 4UV7L 1FZJB 2DQDH 4LCCC 4O2FB 2ICEB 3D39E 3L3KA 3VFTA 1I8IA 2ITCB 4UT9L 5E00B 2HTKC 5DYOB 4MX7A 2VLJD 1FVDA 1S5HB 3B3IB 3IDMB 1H3PL 4TVPE 3DUUA 3RWCA 2YD1A 3L5JA 1VB9A 5I71C 2H26B 4HJJL 2L7JA 4NNXA 3GIVA 4UTAL 2F53B 3QFDA 4U1SB 1YC7A 4WWKB 1ZT1B 3LPFA 4NUGH 3ULUH 1RU9H 4KTYA 5HTSA 3WE6B 1MHEA 2AV7B 2WINB 4HPOL 5JXEA 5ADPH 2J4WL 1FO0H 2R0LH 4XMKL 3EYSL 2W0FA 3F5WA 5D96C 1C5DA 3X13A 2VUOA 4BJLA 2X4OA 2CGRL 4KI1A 3GMLB 2P5EE 5HYEA 1UH2A 3V4VH 1T1ZA 3IDNB 2WUBH 3U0TA 2R0KH 4JDVA 1WT5C 2Y07H 4TTDC 4YK4B 5DRZB 3HE6B 3SGDH 4APQB 5JNYB 4HUVA 4WTZG 2DQEH 3MO1A 5C0EB 4F9PC 3C5SA 1QLRA 5EFIA 3MCLH 5B8CA 3NABL 3BDYH 3E6FA 3VGFA 5EDXA 5FKAA 2BRRH 3W0WD 4JQVC 2D3VA 1BZ7A 1SY6H 5DA0B 4PYHA 5CEXA 2QADD 1A7OH 1HSBA 4U6TA 3MLRH 4GUPB 2Z8SA 5HBBA 2P5WA 2JJTA 4ODXA 3RWEB 3OR6A 4KRPC 5HYFA 2XTJB 4NM8H 4PPTA 2VDML 3GFUA 1AO7B 1IVLA 3O11A 4K7PX 3KS0J 3FO0L 4BH7B 5DTFB 4KAQL 4YE4L 5GS1A 1J1XH 1YEJL 3KPPB 3VXOB 2DIBA 2OTWB 2MNUA 4W4OC 5DUPL 3QCUL 2OLDA 3HZKB 5FOJA 3H42L 2HT3C 5H94A 1K8DA 4GMTL 3BW9B 5I75B 1IGFH 4XPTL 5DC4B 3P9LA 4MD4B 1T83C 4XP5L 4EQ3A 3P11H 1MFDL 3L3HB 4U49A 5FB8B 2GTZB 1DQQA 4MQXD 3SJVE 1OPGL 3H9YA 2V5YA 2IAMA 4RIRA 4U6HA 5HYJA 2X4UB 5IBTL 4RRPG 3PJSB 1Q1JH 5L2JA 3VWJB 1DSFL 2BOBA 5I1IH 5DJYA 1S9YA 3FQXA 3T2NH 5FYKL 5E6IB 4Q0XL 2VDNL 3HG1D 4GG8B 3T77A 1D5ZA 4F3FA 4MLIA 1IKFL 3RX7A 1LK3H 4HKBB 4S1DD 1T89C 2APXA 4ZO9A 3MFFB 3BH8A 5FUOH 5BS0B 2NTSP 2GHWB 2R2EA 1F11B 3VFUB 5D5MB 4ZYKA 3U2SA 1PY9A 3UTSD 1F11A 2FO1A 4RFNB 4IMLB 3O6FD 2CXKA 2VLLA 2J8UA 3OXRB 1DVFA 4WFFE 3EYVA 2CIKA 4XAKD 2BMKB 3PWUB 2X05A 5F8QC 2Y1VA 1QQDB 3P3YA 4JHAL 2HMIC 4M1CC 3BGMB 1G0DA 4GS7B 4HKJB 3VMNA 2DWEB 1XGUA 4KK8C 4OT1H 1A64A 5DSCA 2OJEA 3VWKB 4KKAC 1NGYA 1LE9A 1UB6A 1EO5A 3PNWB 1E27A 1IL1B 1IAIM 2FJGA 4P23B 3JUZA 5I1HL 5C0AB 3WLBB 5FO9B 5ICZB 4XNYL 2A9MH 1TNMA 5HY9B 1UM6L 3CJJA 3NH7L 4LNRA 4DZBA 5C0CA 4FS0A 1FNEA 3JTTA 3BH9A 5F7EL 3ALXA 2FLRT 2B1HH 5EIIB 3CGTA 5KBNC 4Z8FL 4HIJB 2VLLB 2Q8AH 1EJOH 4PJDF 3LOWA 5D1XC 3ULUD 5TDOB 1AGDA 1FIGL 4JFQA 4ZUWB 4NRZA 4OZHB 4X4ME 3DYOA 1U8JB 1QSEB 1S7SB 3MFFA 1U8NB 4QRSA 3VFPA 2P8LB 2FATH 3T4AB 2OP4H 4S1RH 2CUMA 2VXQL 5JORB 4NC0B 3UTTD 5I18H 2XT1B 3RPIA 1SJXA 5GGRB 4DFHA 1GOFA 1KPVB 4Y5YC 4X6DB 4LHUA 4XPGH 5DJYB 5BV7C 3FRUA 1QUNA 3GHBL 3SY0B 5D96B 5DI8B 2FX9L 4HEME 1DANU 1MI5A 1VADA 3E6FB 4KRMB 4ZS6C 3QUYD 3RU8H 1N4XL 1CFVH 3PGCA 2ERJC 2BNRB 5IMOA 3NFPB 4HBQA 4M3JA 5EO0A 1QFUL 4RAUB 3VFOB 2PETA 2XYCA 3S36L 5J13C 2DI7A 5HI4D 5FFLA 1CE1H 3RHWF 4WY7H 4JJHA 5IGXL 1MCOL 1JHKL 3ILQD 4LDOB 3WL9A 1YN7A 5E6ZA 1JPGA 2EZ0D 4Y1AB 1PYWA 2XNAB 2C9AA 4IOFC 4PRBB 5TQ2L 5IF0A 1T2QL 5F71A 3UMTA 4YBQD 1GHFH 3KR3H 3SGEH 5HVGB 4RZCB 5EPMA 1MRDL 2Z0BA 1LO3H 3QP3A 5CP3H 1HH6A 2DQGH 2IQAA 4PJHB 3BPOC 3RIAF 4CU7A 1HWGB 4D9QE 2R2HA 4GFTB 5F7UA 3L95A 5L2KD 4QTIH 4X9GA 4O58L 2LU3A 2HT4D 3IDJB 2BNQE 3KPRB 3MRBA 1S7TA 5SWSB 4XXDA 1NMBH 1MSPA 3WHE1 3PP3K 1KEML 1EEYA 5LBSH 5D93C 1W0WB 2XTJC 3GSQA 3IDGA 3EZ8A 1MHPH 1NFKA 4FFVC 4QXTB 1DBJL 1QSVA 2XZAH 4LGRB 2FH8A 4B7LA 1OF2B 3C5ZA 2VL5A 4ZODA 4P5TC 3UYOD 4QOKA 1QHPA 3OB0H 1CT8B 3LPWA 1AD0B 3CFBA 3VWKD 3VXSE 4PTTB 2DL9A 4FXLA 4FQ1L 4JFFE 2QSCL 1I8KB 4JPIB 2HMID 3PV6A 3QB7C 4U1GC 4OLUH 5DMGC 1A7RH 5EBMA 1BWWA 3CSBA 3RGVB 3BAEL 3DI2B 3BEVB 5TE4L 2A0LC 2HLAB 5A2KH 3F7PC 4WHDA 5C3LD 1QSFE 2VIRB 2HT2D 4FTVA 3QUMA 4U2ZA 4EIZC 2IC2A 4O02H 3OB0K 2ADGA 3K4DA 4N5EC 3GSOB 3QZWA 1ONQA 3HI6H 4GW5B 2K1MA 3RWDB 4JPWH 4FFYL 4YUEL 1QA9B 4D3CH 5HI3D 5CSZA 4TSBH 2A83B 2XKSA 4PJIE 1RZFH 5CSZB 1HILB 1ZGLB 1CBVL 2ZOKB 4XP4L 2W60B 3ELAT 3O6ML 3Q2CA 3QIBA 1AI1H 2Y23A 4QOKB 4WIQA 4G9FB 3B2VH 1KJVA 1RZJL 4P5KB 3QUXD 1T03H 5DJ8A 1I1AB 3KLSA 3NCYS 3W2DL 5E8PB 2NY0C 5LBSL 3BZ4B 1K8IA 2FL5A 2J8HA 2QADC 4IRJC 3U30C 1B2WH 1YEHH 1QG3A 4OQ1A 4LL9A 3PHOA 4LAQH 4JG0L 2Z31A 4IRZH 1S7TB 3N1PC 4MMZC 4KC3B 4TOYH 1CL7I 4JPKL 4IMKA 1UXSB 2Z4QA 3F65A 3UPAA 4C56E 3STZA 1YC8A 1TLKA 4S1SL 1FNGA 1GHFL 4ZS7H 4MMXC 3VFNA 4EXPX 1M05A 4ODHH 5DZOA 2VLRB 4HIXL 3WNOA 3D3VB 2VLJB 4RFNC 1YEKL 5INDA 1EZVX 4JM4L 1QFWI 2AJXH 5F89B 3PV6B 3BKJH 5EIVA 4EZMA 1CDBA 2EICA 5C6WH 1Q9LA 5SWZA 3MCKA 3O4OC 3CNKA 1YEDA 3NCEB 1YEIH 1CT8A 3H9SA 3HNSL 5DK0A 4JZNB 4KKBD 2BVPA 4PRAB 3DX8A 1YN7B 3D3VE 3K1DA 4KKLC 3TJEH 1MVUB 2XQYG 4UZGA 4U1JA 3CAFA 4LP4A 4F7PB 4NHUA 4M43H 2MCPL 4RGNB 4UI2A 4DW2H 5BZDB 4ZUUA 5C0DB 3CD4A 2MHAA 4WEUD 2HFFB 1QLEH 1BMGA 4K71B 4FFVD 4JG1L 5IMOB 4YC2C 4XNUH 5DD0H 3VG0H 2CMRH 3ARED 2DTSA 2NXYB 3KXFE 2F5AL 1KJ2L 3ARPA 4J8RA 3C08H 4FTVD 5MEOB 1XGPA 1L7IH 3O6KH 4JQIH 1AXSB 2EDBA 2VXUH 3EFFA 4JE4B 3V4UL 4B5EA 3G6DL 3WL9B 2PYEE 5DFTA 5DJ6B 5J3HD 1RJZA 2R0ZH 1A1OB 3VXPB 3WS6A 3KPNB 3TIDB 1FSKB 1B0WA 2VDKL 2AQ1A 3DSFL 3T3MF 3BISA 5D7KE 1W0YT 1HN1A 1YUHA 1AGDB 2YA2A 5IW6A 4JY4B 43CAA 5JZ7C 3DV6B 3SKOB 1FZMA 2VH5H 1DUZB 4KHXH 2ZCLL 1FGNL 3L1OL 4QKXB 2Y36H 1BD2D 2KZ1B 3UBXA 4XB7A 1IJ9A 1OAZH 1FNEB 4OBSA 5JOEA 4EXKA 4F58H 5CILL 3QRGL 2J8UF 3S34H 1NJ9B 3GI9L 3LAFA 1L6ZA 3QNZB 2I9LB 3Q1SH 3KHQA 3VFPB 4ZXBA 5DXWA 1CFNA 2VUYA 1JGEB 3SY0A 1QSEA 4XC3H 5D1XD 5C07E 3UTQB 3PV7A 3ULUC 2Q6WB 1H15A 2V7HB 4NFDA 3REVB 2ZUXA 5J9PB 4NCC2 3GHBH 3OKOA 3ECBA 3MRFB 1D6VL 3LIZH 5IQ9A 1G7JA 4DJMA 1MVFA 2FJFB 3LHPH 3RBGA 3NAAH 3RWIA 3MQIA 1JFQL 1QFUH 2VQ1A 5CEZL 4XB8A 1LP9B 2CR3A 2XN9E 3OG4B 4NRZB 4L1DA 4OZHA 3WKML 1OHQA 4PP1C 1AY1H 3RVVD 4DKFH 4Y4HD 4ZTOH 4XP9L 4M7LH 3IF1B 4LLYB 1ED3B 4XVTH 5HVHB 3NA4A 3LRHA 4M62H 1PKQE 3MODH 5DJ2B 5F97E 3JV6B 4ISVB 3ZKND 5DMKB 4JDZA 2VN7A 3PNWA 2BXZA 4PD4K 1DVFB 4LLYA 3OXSA 4WY7L 3LS4L 3S37H 1BQHA 1NDGB 5DSCB 3MREB 1FH5H 5GS2D 1IM9A 4CDHA 2Z31C 3LVEA 1N6VA 2ZUUA 3MLWH 1RJLA 1OAZL 2P49B 1HOCB 1FFOB 2NW3B 2OXGA 1J86A 4HKBA 2B2XL 2DOCA 5GJSH 1HNGA 3RI5K 1IT9L 3LN4B 3O9WB 3DUHA 3FT4B 4XNQA 2VLRE 3BW9A 4Z7WB 2VE6B 3AREA 1DBMH 4R7NB 4M61A 2FIRT 1KIPA 3L3JB 4PD4J 5CJBA 1FHGA 4RFOH 1IARB 2CLVB 5C92A 2A2QT 4QHLA 5LWYH 5DD6A 4JVUA 5ISZD 2X4UA 4RISL 2V5MA 2ZKHL 2HG5A 4GKZB 4DGIL 3LDBC 2I25N 1VENA 4G6JL 4YHNA 3RKDC 5KVGH 4H8WC 1KG0B 1G1YA 5HXMA 4EI5D 4LVHB 4ODVL 2R2BB 4KAQH 4PRNA 4RGOH 2WBKA 3BT2H 2VH5L 5ENWB 3D85A 1L9NA 3P0GB 3PGFH 4R97B 3U6RA 2EIZA 3DMMA 1KULA 7CGTA 2OX5A 3NMEA 3TH4T 1NFDA 4XPAH 3CVHA 3G9VA 1OGTB 5GS1B 3DROA 1KXVC 4F33B 1W0VA 5HGAA 3IDNA 3VH8A 3LDBB 4QGYA 1OP5H 3SE9L 1UACH 2ICWB 3G6AA 1GSMA 3VI3F 1KENH 4NM8L 5BW7A 2H32H 1KCUH 1B3JA 2R1WB 1QBMH 4ZFFA 5F6IC 5H94B 1K3IA 1D5XB 3L3DA 1UWGL 3QUZD 4PUBL 5SX4I 1AXSA 4YFLI 1U3HA 1BM3L 1YQ2A 3C9NA 1IGTA 2KPNA 4OZGB 1T80A 2C3VA 3LMJH 3UTTB 5CIPA 2ADFL 3SQOL 3CCHB 4RX4A 3GMOA 5DJDB 5IW1B 3VFWA 2NY2D 3VXUB 4AEHL 3HR5A 5I1CH 2W1NA 2O5ZH 5BO1H 5IJVB 3ARFD 4PJ9C 1P7HL 1MCSA 1GH7A 1U8OA 4LSUH 4NKOB 1I7TB 5I8OH 3N9GH 1NAMB 3QFJB 5BJTA 2YSSA 5DJAA 4ZS6D 4X6FB 1U8QA 1P1ZB 5I74C 1RIVL 4Y4HB 1XT5A 2IFGA 5T1MB 2FYYB 5JW3L 2E6PA 4NT6A 3C6SA 3E1F1 1J05B 1CU4L 2IQ9H 1MFNA 1NL0L 3MRRB 4PJ5B 3HMWH 4A6YB 4U3HA 2Q20A 1ZHBA 4OLWL 3VRIB 4PJFB 1XF5A 1I8LC 2EKSA 1I8MA 2YC1A 4NRXA 3HE7C 3UTOA 2VO5A 1ZKAA 1JZ7A 1W8NA 2FX7H 3ZT6A 2CKBB 4KTDH 4I77H 2YSSB 4MNHB 4ETQB 3GIVB 1EMTL 3HG1A 1FFPA 3G04B 4ODWA 4OTXL 5I30H 4NJAL 1CGXA 2RGSA 4M48L 5JLZB 5IFJB 1VKXA 1DANT 2EDJA 3AM8C 3G5VA 1I1AA 4PB0L 5FDYA 2I26N 1FL5A 4O2EB 1FZJA 2MPAH 4JQXA 3VFGL 1RUAH 1Q9WB 2IWGA 3AAZA 4OCSH 4O4YL 3F7VA 4WI7A 3WHXB 4UV7H 4PRIE 2ZOKA 3O6FA 4DOHB 4PREB 3ZL4L 4NKDA 4G8IA 2O93L 1YYLH 4C54A 1EK3A 2R1WA 2A83A 1P6AB 3BP4A 3SE9H 4CDGC 5DHVH 3VWJD 5FKPB 4Q58C 5KSBF 3GSOA 5F72S 3TBWA 1CFSB 3KLAA 1AHWB 2VLME 3MV9D 3O3AA 5ANME 3G04A 5L88L 2NY4D 3T3ME 1Q9KA 4L8BA 3VDBA 5EUOA 2PR4L 4OIIH 4HGMA 3S3PA 2OZ4L 4MJ5A 4NGHL 4LVOB 4D8PA 1MCBA 1N64H 4HS8L 3HB3C 2BVYA 2YC1B 4NNPL 3KYAA 2A9NH 5JW4M 1A2YB 4G6KH 3TIEA 1FYTE 4HG4K 1LGVA 1VEPA 2D7NA 5E5MB 4U6XB 3BXNA 4PJ7E 4JFEA 3ZKMD 3LKNB 5KOMC 2XIDA 4MAUH 1ROWA 3CX5K 4BKLA 1T20B 2P7TB 3MJ8A 3NN8B 4XXCA 1MI5D 2HRPH 3MLZH 3SEPA 1FFNB 1N26A 3OAUL 2X4QB 2YWZA 4UTBL 3ARQA 1IFHL 1Q38A 3VA6A 5EO9A 2WV3A 2Y36L 1R5VB 2P48B 5LAXB 1Z6JT 3QDJA 3A67L 1E4WL 3MUHL 4ZXBC 1MHHA 3G6JE 1JN6A 4PRHB 4JN2A 1U8OB 4WCYL 2GTWA 1AD9B 4JY6B 3AB0C 1T04B 2DM2A 1FZKA 1KSRA 5JOFB 1N0XL 3GSVB 3TVMA 3RUGF 4KDTC 4NZTH 1RFDH 3L95B 1U36A 4E5XB 4Z7VE 4QY8A 1JNHA 1NL0H 3TN0C 2NX5B 5L8KB 5IM7A 3RDTB 3BEWB 4X80L 5F7NC 5FM5M 1T7YA 4G6KL 3RWFB 4EI6B 4JN1L 4OZIB 1W2KT 2ZSVB 1F3DH 1ZSDB 4N8VG 1XGRB 1WFOA 1N6QH 5IMKB 5CEZD 4XNXL 2F54B 2QBWA 3G08B 3ILPA 5GRVK 4V2CB 1DE4B 4ZQKB 3WKNA 1T5WB 1YY9D 2DLEA 4XPHL 3ARBA 3I84A 3GK8H 1R5IB 1IC7L 4HUWB 3DPBA 1TZHB 4XMPL 4A2MA 5HHOA 4G9FE 5MENE 2ED8A 2V5TA 1A3QA 4GG6B 5LCVL 3GMMB 4DN4L 4KKNA 2YKLL 1CIUA 3DO3A 3BP6B 4XH2B 5C86A 5L9DL 1BECA 1NLDL 4F2MB 2CO7B 3B83A 3MOQA 5JXAH 3SO5A 4G8EA 2R4SL 5A2IH 2X1XR 4KKLD 3SDAA 3PIQA 4R0LB 1JHTB 3UJIL 3OJMB 4JGMA 3GO1L 1A9EA 3GBMH 1CFTB 3S98A 3A6OA 3CC5A 3OAUH 1QR4A 1EO8H 3NZ8A 1S7WB 1AGCB 1FLRH 1QYGL 1ZWIA 4GBXC 1SJVA 4YDVA 3UBXG 1Q0XH 1BVLB 1KPRB 2LV4A 2HVKA 5DS8B 5EU3A 3U9PH 1P7QA 2D4DA 1HXMB 1U8JA 3BPCA 3OTTA 2CIIB 4DQOH 4QXWA 3GK8L 5AG8A 4JFQB 4ZUWA 4ODVH 1DQLL 4XRCB 4GQ9H 3VW3L 4K9EC 1M71B 1PKOA 1S8DA 1UXWB 4AMKL 5T1KD 4ELME 1HSAB 2NY4B 4PLOB 5ACMA 2FJHA 3AXLA 1FC1A 4FFZH 2ZKHH 2ZUVA 5IHLB 3MREA 4PRIB 4PLKC 5F7LB 3GMPB 1J8KA 3K0WA 1I7ZA 4XNYH 3NCCB 2FJGB 1XCQB 4PJDE 3MUY1 3SJVA 1MJUH 3KPNA 5CD5C 2PYEB 4LKXA 43C9B 1JUFB 4YNYA 5CJOL 1V5JA 4DVBA 1E6OL 4MWFA 3ZYZA 2WZPD 1WZ1L 3HB3D 2YRLA 1NMCB 4DGVH 2R1YA 3I6GB 4LLWB 4X9IA 5IG7A 4NKIL 1K5NB 4Y5VA 1KC5H 1E4KA 4XNUL 5DD0L 3VG0L 1BJ8A 1EVUA 5H2BA 5CP3A 1Z9SA 3VI4F 1K6QH 1UACL 2GKIA 1F8TH 1GIGL 4P9MH 4DTGL 3GMMA 1R5WA 3QIBD 3U4EA 4TVSa 5HGHB 3LKOA 5HHXL 1A6WL 3EGSB 4NN6B 1WEJL 4KJQC 4BZYA 4H88H 4ONGH 5I8KH 4HC1H 4JY6A 1AQDB 5ECJE 4Y2DA 4Y4KA 4NKQB 4Z7UE 5IEHA 3HC0A 4PJIA 5TFSL 3REVA 4NQCD 3DWTA 1J0HA 4FQHB 3BWAB 4KPHL 3MA7A 1FLTX 2FECI 1U3YA 5GRWA 3H9SD 5C6TH 4LSVL 1NCBH 4X4ZA 4GSDH 4IRSA 5CJOH 1MCNA 4UB0H 3HRZA 4YDJA 3MGAA 3UC0H 3D69B 1P4BL 3LN5A 3ROOA 4WO4B 4K7FA 3LKRA 5C0BB 3ZYOA 2ESVA 4MQSB 3OKNB 1D9KA 3DVIA 4JFHE 4G8FA 4PV8B 1CLOL 4NBZB 1C08B 5I1EH 3BPLC 3CVHH 3WFZA 1XIWB 3SKOA 3MLPA 2B4CL 2D0GA 2H8PA 3T2OA 1NCAH 5GRZA 1OTTC 4K94H 4KXZH 3IS0X 3IDXL 1QEWA 1R5VA 1BVLA 1KPRA 1XGTA 4F9PA 1KCUL 4UNUA 1NGZB 4CMMA 1TZIB 3DX9B 3S8WA 2WBJC 4EBQL 1MCFA 4ZPVB 3WIFB 1U8MB 4GRLA 3ULVC 1OP5K 5CD3B 3LHPL 3TA3D 1L7TH 2KL6A 2VZSA 3BUYA 4IS6B 5FA3B 5KVEH 3BKYH 3GRWA 4G6FB 5FUCC 4Z7NF 4XWGH 5EUKA 1SEQH 1CD1B 1T66C 1XZ0A 2I9TA 1VCAA 4MVBC 4V2BA 4LRNH 1QRNA 3FTGB 3PWJA 3IJSA 5J11C 3SDCB 5FYJH 3OAZH 4OGZA 4XCYA 3GB7A 5SV3A 1R0AL 3FONA 4U7KA 1C5BH 2QQLL 2YD8A 3MO1B 5C0EA 1CE6A 2LAAA 4ONFL 2IBGA 4UT9H 1P9MC 5IESH 5EORL 3FN0L 2DL2A 4W68A 2VQUA 4KK9D 3WMSA 3QXWA 3SDDB 1HEZB 4Q74A 3B9EA 4JZJC 4R8WH 5D70L 4G6ML 3VXNA 4OD3H 1FO0B 1I4FA 4ZUSA 4OIAA 5TQ0H 3Q48A 1RIUL 4Y5YA 1JNHB 3CUPA 4KY1L 3WD5H 1FNGB 1AXIB 4N0FA 1YPZB 5EOCJ 4W6WB 4M7ZB 4ZFGH 4KKCD 1P7KA 5CGYD 3OX8B 1GZQB 3O2DA 5E1HB 3W11C 5E99L 4LNVA 3HRPA 3GJFB 4HLJA 1FNAA 2ZG3A 3MRMA 1CDCA 1QD0A 3FQNB 1J88A 3C6LA 5C71A 1I8IB 2YN5A 3MLVH 2A1WL 3MGTA 2HTKD 1BFTA 4Q6IB 3LQMA 1CXFA 2EDRA 1T3FA 5BVJB 4QWWC 1G9NH 3C6LB 2YR3A 1PSKH 1BLNB 4FFWD 4M62L 2VMFA 3CX2A 1EZVY 2CLRA 4G9FA 2IQAB 2DD8L 4W6YB 3VXUA 2RJMA 1N2RA 1YZZA 3ET9F 5EA0H 1QO3A 3CFCH 2LTQC 3NGBB 5EULV 5JZ7D 2Z91B 3HZMB 1DL7L 1H3VA 1X5ZA 1QA9A 4O5LH 5HPMB 4PRDB 1ONQB 4WO4C 5FECB 1WT5A 2AJZB 4MSWB 1INQA 1CGYA 1YMMA 4I2XE 1CGTA 1TQCC 1SQ2N 4K7PL 3WN5B 2VIRA 3NA9L 4JFDA 5IROA 1W0VB 1CFQB 2BNRE 4FXGB 4RFEA 3P11L 1N59B 3HR5B 4GKSA 3MV8A 1LMKA 4NN7C 3ZMRA 1CR9H 3VA2C 5F8RC 4Z0BH 4PJBA 2FGWL 4JREB 4LPYA 1J12A 1IKNA 3QDMD 4PJHF 3QIUC 3TJEL 1J8HD 25C8L 4WNQA 4B41A 1HWHB 2P4AB 4P2QA 4OD2B 1KG0A 2JE8A 3QH3A 4RX4D 4EVNB 3PXJA 2BSTB 4KRPB 4H25A 5EORH 3DECA 1UA6L 3TFKC 5B3JF 4X0KB 3GDBA 2AJXL 1OAQL 3T0EA 3EOTL 3MJ7A 5F1NA 4JRYE 3THML 4RA3A 2EO1A 1NBQA 4KDWA 2NZIA 4QHLB 1FFPB 4FXKB 2BDNL 1N5YL 2EIZB 1T6VN 3DMMB 3HZYA 4W81A 1JGLH 3V6FA 2WBJA 1ACZA 2XTJD 1NGQL 3EO0A 4LVEA 3QUKB 4JN1H 2RQ8A 3QDHA 4WFED 1OCWL 2A6KA 4XCNB 1PG7X 4PJ9A 1TVBB 3KYOA 4BH8B 1CDYA 3BHBB 5C0CB 5AG9A 4MJ2A 1NANH 4JKLA 4XNXH 1FPTL 1U3HD 3UP1A 3SGKA 3UYPA 2EE3A 5D2LB 4KROB 5SWSE 4MA3B 3IAGC 2DM7A 4GXVH 5DEFB 4XMLL 2ESVB 3VGAB 5F1IA 1QLFB 4JPKH 3ULVL 1PZ5B 3QJHB 4Q9CA 3EYSH 4HKZB 1XR8B 5TDPA 1PBYA 2IFFH 2IANA 5DA4A 4NHCL 2XRAL 3BP7B 1NLBL 5IVNA 4YQXH 4FQHA 4NO2B 5EC1B 3PWUA 4GAFB 1N5AB 1NC4D 3MR9B 1I7TA 1NCWL 3D1MC 3BESR 3F12B 3GSNH 4YDKL 2IF7A 1OD9A 3P0VL 4KVCL 4ORGB 5E08L 4BSWB 1U92B 3TO4B 1UCTA 4J3WA 5D7JB 2PXYB 3QEQB 3P4OB 1PKQA 2P1YA 5GS0C 1P6FA 4MHHI 3QUXB 1A0QH 5BZWB 3I6LE 2HJKB 5BRZA 3FO9B 3ARFA 1MFCL 1I3VA 1FRGH 3BN9C 4PRHD 1UA6H 4PJ5D 3S97C 4LSTL 1NBVL 2X1PA 4OZ4A 3EO9H 3T3PF 4DFIA 3LKQA 4MJ6A 5SX5H 1AIFB 1CXLA 5KSBA 2R1YB 3ULVH 2CLZB 1REIA 4ZO8A 4PGCB 3ARFC 2RCSL 2G9HA 1L0QA 5GHWL 2I9LA 1KIQB 4Y5XB 4HQQL 3S5LG 1INQB 5D71L 2AABL 2B5IB 5I66B 3DGGA 5J6HA 5ISZB 4X7DC 4MA1C 3EYFB 1JYXA 1XF1A 3D25A 4KVNL 2RR3A 5L2KE 4TRPH 5CAYB 1T4KB 1DUZA 5K9QG 3IS1X 2NY2B 5J6HB 2MPAL 5IGXH 3QQ9D 4YXLH 2VC2L 3HZVB 1YA5A 5DC9B 3VG9C 3VFRB 1HXMA 4DUXA 1NQBA 1JGEA 2IFFL 4Q9RL 3HUJB 2AK4E 3HAEG 2FEDD 1Q72L 4ZXBB 1BLNA 1VFAA 1UJ3A 4OFPA 3LKQB 2BVOB 1X5JA 3CC5B 1LEGB 1SYVA 5DMGD 5MERA 4JO2L 1HHKB 3O9WA 2MKLC 1CICA 1S3KH 2FR4B 3F62A 1F3JB 4FZEH 3MCLL 5J12C 2MFNA 3CVHL 5IW6B 4IMLA 4DEPC 4JFFD 2QSCH 2O5XL 2IH1B 5B4MC 1U92A 3TBVA 4ZTPH 4ORGA 2F15A 1TTFA 2EKJA 3RY6C 5HHNA 3V52H 1F90H 4H20L 2NPLX 4OV5B 1UZ6F 4F9LA 2IMNA 2NY2C 3QWRD 2PUQT 1T0MA 3MJGX 5DMKA 5HD8C 1V8HA 3EIFA 4IMKC 5DJ2A 3AS3A 2ADIB 1T1XA 5C08A 3WV0A 3ZSTA 5C8JB 2BVQA 5JIHA 1BJ1H 1NCNA 5DK0B 4RMRA 5E5UB 4PGZA 1EX0A 1YEDB 4X8XA 4KGJA 4N9GB 3WFCL 1JPSH 4F57L 1XF2A 1EDQA 1EUTA 2ZUTA 5C09B 2BCKA 5C7XL 3PDDA 1N0LA 3I2CH 2AEQL 3HAEB 3RA7H 3QO1A 4ODBD 2YS4A 4TNVK 3IXTB 1DN0B 3U7YH 1YECL 1CZ8H 3WXWL 2PTTB 3T8XB 1EGJH 4RGOL 4UILH 4O9HH 1Y6KR 4RMTA 1KELL 4Z95H 4TUKL 3EO0B 1XZ0B 2I9TB 3T0XA 4KQ4L 3S96B 3D9AL 3FB5A 1JL8A 2I60H 1C7SA 2IMMA 2Q6WA 5CHNA 2BC4A 3ARYA 4FP8L 3D39B 3LEXB 3VXOA 3LN9A 2QR0A 2QQKL 4QXGH 1O7SA 5INDB 1KLUA 2Y6SC 3TYGH 3E0GA 5FGRA 2JKXA 4P59L 1NGZA 1X5YA 1NGWA 1QZ1A 5HHOD 5IVXB 3KPLA 4C56D 5CEXB 3GSWB 3QH3B 4JGUA 5DJXA 4XNZB 4OD2A 1EJ6A 5E03A 4PG2A 3QXDA 4WI3A 4PRID 4RBPH 3QNYB 4KKBC 1JHLH 3VI3E 5HGBA 3HR6A 1N4XH 3K2UH 2YMXH 3G6JB 4L9LA 3NZHH 5HGBB 2FHCA 1I7RB 4LSPH 3QXDB 4I0KA 1JPST 2UY7A 5IESL 2AGJH 5E8DH 2KZWA 5SX5K 5JDSA 1CYGA 1A6UL 4KROC 2RAMA 2PO6D 4Z7OE 3ZO0A 2VZ1A 1SYSB 2HP4A 3EFDL 3ZE0F 2A6JB 1A3RH 5E2VH 4QNPF 2V2WB 1U3HC 3ZE2E 1BIIA 4U7MA 3E3QE 3MRNB 3F7YA 4BZ1H 2GY7B 4QHUA 4H0HB 4YO0B 5FHAL 3ROLB 3T09A 3GSRA 2MKWA 3ARXA 1CLYL 1MQKH 2A9ML 4HIHA 4R3SB 2B4CC 1W8OA 5CZXD 2UZXB 3RDTD 5JQHC 3O4LB 1F42A 3W82A 4O9HL 3WFHB 2F53A 2E7CA 4KQ3L 1J0YA 4AIOA 3QIWD 4PS4L 2OM5A 2CUIA 3JWNC 2FEDC 3IXTA 4OFDA 4RNRB 1A6AB 3QUMB 1C1EL 3HAEA 4MLSA 5B4MD 5DR5L 5C09A 3LH2L 5D7LB 2YPVH 3H3BC 1IGMH 3DMMC 2DD8H 2H2PC 3WFCH 4F57H 1KEMH 1GGYA 1T1YA 4TVPH 3DURB 5F88A 5KSVA 3PP4L 4ODTL 1NUNB 3GBNL 1AC0A 1JI2A 1UWEL 1Z0MA 2AI0L 4HK0A 3V5HA 2RFXB 3LRGA 4LARH 1EFXD 3ZDZF 1ZVSA 3U9PL 1T0MB 4RAHA 3RWGB 3C09B 5T1KA 4Q6IC 1E4XI 1EIBA 4NQVB 3VFNB 2AK4B 2WM0A 1G7PA 1DQJA 3T04D 1FFQA 4UOJA 4MD0B 2AK4A 5JW3H 1KCSL 1RZKC 4R2GC 1KBGH 4TUJA 2OI9B 3MXVH 3TH3T 5CJXA 3VXNB 1D3CA 1MWAH 2FEEL 5IT2L 1EEZB 1T22A 1H3XA 4PS4H 4M7KH 1T1YB 1EPFA 2EH8H 3MRLA 3QCVH 2GT9A 5A40E 2NY6B 4KTEH 1X5KA 1WEJH 2WIMA 4L5FH 5DJAB 3P77A 4UOW0 2N4IA 3UAJD 1ZWIB 4OQTH 4QF1B 3SDXF 1OARL 1XIWC 1SM3L 1UVQA 1ADQA 2NY5C 3HUJA 5TE6H 3HI5H 2JIXD 3WXVH 1PG7H 2LQRA 3MBEA 1F3DJ 2FO4A 2X4RA 4X6BA 2DI9A 4NQCE 2XY1A 5DVOA 5I9QC 5IW1A 3QI9D 2COQA 4WHYG 1OW0A 5K9OB 2D7PA 4UB0L 4NQXB 3MXWH 3CSGA 3TPUB 4AEIL 5HDQL 3FRPA 1IM9D 1AY1L 4PR5A 5GGRA 3T2NL 3IKCA 4P5MA 1BIIB 4CNIB 4P57A 3MRJA 3FN0H 2KUTA 4G8GD 3CSYB 1ZS8A 1KCVL 2C3HA 3MRQA 3MZGB 4DKEH 4KRLB 4M03A 1CQYA 3RPKA 1JYNA 3WO4C 3RWJB 3C60C 4E41A 4F33A 3SGDI 4RAUA 3VFOA 1F4YH 5I1GH 3SHSA 5C6TL 2F5BL 7FABH 3PGCB 1NFDB 3LS4H 3ARBC 3EKCA 1EFXB 2YD7A 3UTTE 1A5FH 2PXYC 1NUFA 4NQEA 5EO1B 1MJJB 1I9JH 1F6LL 4YGVB 5DQ9A 1XIWA 5FHAH 1IC7H 1BQLL 5L8JB 3I75B 1ODAA 5BZWA 3R8QA 3M17B 4G6FD 4GAYA 3RTQD 3BZFB 2I07B 4ODHL 3V95A 3LD8B 5KOVC 3KXFB 1DBJH 5JOFA 4AENB 3BGAA 3GUTB 4NP4L 3O4OB 3HNSH 2X4NA 2BHZA 4U1MA 3S35L 2H3NA 1YMME 3JVGC 4M7LT 3D0LA 2CDEB 3UDWC 3ULVF 5BXFA 4LLUB 3TVMC 1KJ3H 3QDJB 2HFEB 1VEMA 3QUML 5I8EB 4P23C 1NGPL 4JCLA 4QT5A 1YEHL 2W38A 3IETB 3BZEA 1X5IA 1FFNA 3S3SA 5BOZG 1QLFA 5FO9A 4CJ1A 5HHOE 5ICZA 4PG9B 1HH6B 3NPSC 2V7NA 4HLZH 1LNUA 4HFWA 4JFEB 3RX5A 4LCCA 1E4XL 2CKBL 4IEFB 3ZTNH 4RFOL 4ZS7L 3T0DA 1L7IL 3O6KL 4JQIL 2CQVA 3JWDL 5FYLD 2GITB 5DRWB 1KTDB 1X4XA 3P73B 4HV8A 4I4WB 3KNBA 4IDLA 4DOHE 2E27L 4Y1AE 3PP3H 4K71C 3OKDB 4ZG1A 4OM1H 43C9A 5C0BE 5EZJA 2R4SH 4LAQL 3R0MA 5EUOB 3IJYA 5BOPA 3ULUL 1VACB 4PJGA 2DKSA 3GMPA 1TTUA 3ZKQD 1QFOA 5I66A 2AXJA 4ZOCA 3ZDZE 2DF3A 2YXMA 1RD6A 3E6HA 2B1AH 5TF1H 3AS0A 2IH1A 1KIQA 4X8JA 4WFHE 3BYYA 4NSKA 2G9HB 1ZHNA 5IB4A 4EVNA 2R0ZL 5C0FA 4JY5L 3RGVD 1MCDA 2P8MA 5E70A 5AYUH 5JHLH 2X4TB 4OM0L 1HHKA 2ZP0T 3BPCB 2P8PA 4KXZI 1MAMH 1TMCB 2X7LA 1KENL 3FT2A 3CDGA 4RAVA 2X4PB 4XTRD 5BRZB 2CKBH 3G5VB 4MA8H 4TN9A 1MRFH 1IAKB 4U6VH 4M02A 5LXGL 4LF3A 1I9RH 3G5YB 4WWID 2DQJH 4I0PB 1H8SA 2DLHA 3QNZA 2ZCLH 2DQDL 2AK1H 3E6HB 3MLRL 4HJ0D 4HXAH 2G60H 4J1UB 4E42A 3SDAB 4GBXB 4LP5A 4BZ2L 1K2DA 3QNXB 4OZFH 1X3DA 5GZOD 2XWJB 4F15C 4DGYL 3RWHA 1FZMB 4NO2A 5EC1A 2FBOJ 4CVUA 2E7BA 5AAMA 43CAB 1AE6H 1RUAL 4IBLT 1HH9B 5CGYC 1ZLWH 1IL1A 5LVEA 4M5ZH 1INDH 4PV9B 5E9DA 1P69B 4JFYB 3W11D 1ORQA 2F19L 5DJZB 5E2WL 4S2SB 1HKLH 1A7QL 1MLBA 2VAAB 4HWBH 3AREC 1EMTH 5E6YA 4LHUD 4OZIE 3CFJB 4OZFG 4OJFL 2EYTB 3QQ9C 1W72A 1UJTA 1OLZA 6FABL 3WEXB 3WLWD 5CEYA 1DDHB 4X9HA 2C4XA 4OCSL 4XNMB 3VCLA 1IGJA 4JR9H 1XGPB 1QSED 3QUXA 4BQBA 3KLDA 5HVFB 4F9LC 1LO0H 5LGHL 1LEKB 4NQCA 2PXYA 2NY4C 1JYWA 2L7UA 1RZIA 3GSXA 3TO4A 1X7QA 4M4PA 5MENA 2CRZA 2EDKA 3GSVA 3H7BA 3GMOB 3K74B 1X7QB 3TVMB 5MENB 4POZC 1U8PA 2H32B 3O3UN 2B0SH 4R96A 3MACL 3MRIA 3VXTB 1ZT7B 4J4PD 2AV1B 1H3GA 3MLYH 2DQGL 5I1KL 1MREH 3D18B 1FL3B 4KV5E 3BPNB 2HKFH 2BZDA 4TQEH 2ICWA 4YXKH 2X41A 3RVUC 2AJ3A 4HKZA 1B6UA 3VH8B 1G6RB 2P7TA 4CGTA 2C4FT 2GQHA 3O6FC 4CVZB 3DIFB 2R15A 1ORQB 1IQWH 4WU5A 3QEHB 4LLMB 3SGEI 2F8XC 2A6IA 3O8XD 1KN2L 1DVFD 4H26B 3Q3GA 2P5WD 5T3XE 4YDKH 4JDTH 3D85B 1BJMA 4UAOC 4XCFH 1DBML 4MD5B 3OAYK 3MNWA 4RMUA 1DLHA 1EERB 1DBKH 4MD4A 4LSSL 1HINL 5LGHH 2EH8L 1WFTA 3WUZA 3IVKA 3IDYC 4OLXL 5HYJD 4KUZL 3DV4A 5F7KC 3WS3B 2BOCA 1BPVA 4Z76A 3BPOB 1MLCA 1R3HA 2Z91A 3PUCA 4R4NC 4HGWA 4G6JH 5KTEL 3ZHLA 5E8NA 3FJTA 3VRJA 3IJHA 1P7QD 3DYPA 3RY5A 4X5LA 3F7QA 3TESA 4LSRL 1CICD 1YNKH 3L3GB 1RUPH 2Z92A 3QUZC 1MPAH 4G8IB 3OQ3B 4N0UA 1J8HE 4M5YL 1X6NA 4BUHA 1KB9K 4HCRL 1B88A 3KYKH 4Y16B 3FFDA 4MB3A 4TVPL 4LLQB 3MGTB 4K8RD 3U0WL 4NBXB 3TC9A 2UUDK 4M6NL 1G7MA 1A02N 1A0QL 4MJIB 4GRLC 3RVXD 4MDIA 3U0TB 3L3IB 1J8HB 4JB9L 1ZT4B 1F4XH 4WW1A 4ETQA 4P2OB 3BE1L 5AZ2H 2FX9H 1FG9C 1KACB 1YPZA 1RZJC 1TPXB 4MNGA 4ELMF 5I6XB 5BQ7B 4KZEL 3FCTA 1YN6B 3RY6A 2NR6D 4R90H 1Z9MA 5GGUB 3HZMA 2IPTL 4NO5B 1R24B 4PUBH 5GJTL 3HMWL 4KJYB 2OTUB 3MOAL 5CZVL 2VXSH 3IAPA 1OTUD 4KY1H 1H9VA 4TTDD 1OF2A 4NP4H 5CINL 4DK6A 4F7CA 3LS5H 5C2BL 4PJ8D 1XCTB 3FOMB 5HDOA 5KS9E 4L4TB 2ICEA 4LCWE 1OTTD 3MV11 5C0GB 2X89A 4X6FA 4MXVE 4NZUL 3TV3H 1JIBA 4G8GB 3MNZB 4YBQC 2VQTA 5E4IA 2V7HA 1MWAL 4NDMA 3GSNA 3MBEC 2NX5E 2X4NB 4H5SB 4NKOA 3KDMB 1MCOH 1RIVH 5D70H 4PG2C 2W91A 1I1YB 1CL7H 3BKML 4XBEL 3IFOB 3KVQA 4XBPA 1T2JA 1OM3L 4UT7H 5T1LA 2V2XA 3LMJL 1R6VA 2HT4C 5KG9A 4PJBF 4N0UE 3B4NA 5DQDL 1IQWL 1SEBA 1U8MA 2ZJSH 5L7XH 3C2AH 3SQBA 5JHDB 1BQHG 3L7FB 4NZRH 1Y0LB 5DQ9B 2VABB 3TEUA 3G5XA 1UB5A 1T1WA 5M7QA 8CGTA 4Q9BA 4XRCA 1FE8H 3CDYA 2GSIB 5I1GL 4G9DA 2D9QB 2VLRD 1UB5B 4GXUM 5SV4A 2OK0L 1YNLL 2PR4H 3I50H 1TFHA 2GK0B 3M1BA 2YEZA 4APQD 3DLQR 1Z3GL 4P48A 4HUUA 3GRWL 4LLAA 3NZ8B 1I3UA 1MIEH 1RUMH 4CNIA 4R4ND 3QULB 5KG9B 4M6NH 3FB8A 3FO0H 1MOEA 1JHTA 4YXHL 3UZVB 4HEPG 1QPXA 2IAMC 4U1LB 4CL7A 5EUKB 1X5FA 1EGJA 2DI8A 4PJ8B 5GIRB 4P3CH 5A3ID 4ZDHA 3C60A 2O26U 1UEYA 1JGLL 5IFAH 4O02L 2MQCA 2BRRL 4WW2C 2EE2A 1UWXK 4KQ4H 1E0OB 1G7QA 1E6JH 3WDIA 4G3YH 1KIPB 1TZGH 4GW4A 3TPKA 4K3HA 32C2A 2NQCA 2J6EH 3P77B 2J7LA 4KPHH 4NZDA 4P46A 3OHXA 4JCMA 5KANI 4G9DB 2QQKH 4HUMB 1CVRA 1AFVL 4LVNB 4AM0B 1ZLVK 4XTRC 4JFHD 4X98B 2JJUA 5IK3B 1Q9LB 3TBSA 4XP1H 5DUPH 2BHYA 5F89A 4R2GB 5BCAA 2BNUA 3IFPB 3CDFA 1NCAL 5BV7L 5I1DB 3F7RA 5T5FH 4NO0D 3VMPA 4TUJB 3M8OL 2VZTA 5D6DA 3TNMB 4YWGL 3OR7B 4JQVA 5C0AA 3WLBA 1A6PA 5T1LB 4WUUB 2PYEA 4LKXB 3JV4B 2AEPH 4XBPB 5KANG 5CEZH 3D39D 1BBJB 1NFIB 3IDXH 2Q87A 4ERSL 1TETH 2Z31B 3LZFL 3TNMA 2HAZA 3QDGD 1MCPH 4XHQA 3V6ZB 5E1AB 4HWZA 3ARRA 3S37X 1HSAA 4BM7A 1YY9C 2QKIB 2WP3O 1M71A 3KYNA 4L4TA 3IXAA 4TNVF 5GGSA 3BD3A 5E8PA 1QRKA 4P5KA 4BK4A 4P46B 4UBDD 5ANMA 4Z7QE 4MCYB 3R8BB 3LQZB 4ELKB 4AT6B 2HJFB 3OJDA 1S78D 5JA9A 4YHPA 3PHSA 4F7TB 1M7XA 5HVWA 5IG7B 1NCUA 1RAMA 1A9EB 1OT1A 1RZJH 4GO6B 2IGFL 1KLGA 3GSRB 4YDLC 1NSNH 4HS8H 1IFHH 4S1DC 1YEKH 5J89A 5GISL 1IGCL 4HXAL 1L9MA 3D25B 3GNML 4HWEH 3NFSL 4HD9A 3W0WE 3MNWB 3OV6A 3WBDA 4XWOC 1X6LA 3KLAB 4NNYA 2DTMH 5IFHL 3Q3GB 2FJHB 2XZQH 2IAMB 3RAJL 3G6DH 3WIIH 5ACZA 4JKKA 5FYJU 3FB6B 4Y5XC 1EO8L 4N90D 3W39B 3QI9A 5FB8A 5TPWH 1L0YA 3CFIC 2FX8L 4N0YH 5I71B 3MRDA 3TLRA 1AIFA 5KSBB 5FGCE 3CFBB 1RJCA 2G60L 2EDHA 4OKVB 4X99A 3EJYC 4D0DB 2FD6L 3IKKA 5DO2D 1SJHB 5TH2A 3G5XB 4R6UA 1NBVH 2IAMD 3S35H 1X5AA 4RWYH 3UTSA 2VB5A 4HIEB 1VKXB 1LE5A 3V6BR 5DVNA 1FC2D 2G75A 4PGDB 5C0IA 1NFDE 4R96B 1TQBC 3DGCR 5GGVY 2BVUA 1SY6A 2GJZB 3V52L 4RDQF 3UJTL 2HN7A 5HI3C 4FQIL 4MQ7A 4M8QB 5DRXA 5CBEB 2IALA 3GSNB 1KB5H 1DLHB 4OSUL 4Z7VB 4YAQB 4QRRE 4R4BB 4MD5A 3EOYG 1XFPA 5FO7B 5B8CB 2E6JA 2HKFL 2HFFA 3VRIA 1YYML 1WZ1H 3HAEH 2F5AH 1Z5LA 1QBBA 3KPOB 1JPTH 4WDIA 4FNLL 4LLMA 5D8JH 4FQQB 5AZ2L 2YA0A 1TZHA 2NY0B 1CFVL 4PJCE 4EN3D 4LLDB 1T5WA 4OZGE 5F6HI 1KTRL 3H9SB 1CQKA 4L9DA 4GAJL 3EOBB 4UINL 3UCRA 4L3ED 1A6ZA 1QFWM 1GC1H 1V7ML 1YJDH 3MV8D 1C16B 3QCTL 4BQ6A 1EBAA 3TFKD 1J18A 1RQ5A 1ULVA 3QEQD 3FKUS 2EDFA 3NABH 3MV7A 5F21B 3TN0A 2AV1A 3QJFB 1E4XH 5I73B 1H3WM 4MNGB 4M8QA 5DRXB 3P30H 3V6FB 5FK9A 1GPOH 5IBUG 3DHJA 5GRXG 3V8OA 4HULB 3QPQC 5IOPB 5E8EA 4HX1B 5AAWA 2PTUA 1UXSA 2K7QA 4S0TD 1INEH 4FQLL 4CU8A 3KR3L 3E2HB 3UTTA 2WP3T 3IU3B 4UBDC 2CXGA 4LCWB 2UVFA 1J11A 4XGZB 1V7NL 3I9GH 2D7TH 4IOIA 4KMTL 2X4PA 5DEZA 1M7IA 1DCLA 5CWSB 5T1DL 3SDXE 3LKPB 2EYTA 3LEYL 5GRJL 4OIIL 2DLGA 1CK0L 2R8SH 3SE3C 5JOPD 2BVOA 3X3GH 2V9TA 4X5XB 5GS2H 4YLQT 1F2XK 1VGEH 5JORA 1JYVA 4ENEC 1T7VA 3J8F7 25C8H 4I8DA 1H8NA 1IE5A 4NSKB 1UC6A 1CN4A 6CGTA 3FQRB 4DKDC 2QADB 2NXYC 4UQ3A 3RNKB 3TCLB 5D1ZA 1BFVL 2DTML 5IFHH 1EEUA 2VLMD 5KZCB 4J3VA 2DYPB 5H8DA 4C57C 4ZAKC 2X10A 1G6RL 3QZWB 1V3KA 1FBIH 2B7DT 2DJUA 3EYOA 5ITBH 5HY9A 2GFBA 3H42H 5JW4Q 2K7PA 5F3BB 4FTVB 3QDGB 5D7SL 1KLGB 4TSBL 2AJVL 4Y5XA 2DYPA 2GITA 4NHCH 3O9WC 1LE9B 4IDJL 4LPCA 3PWVB 1EA9C 3GGWA 1XR9A 4U2YA 1PVHA 4H26A 1OAUL 3OJVC 4OM1L 4MXQC 3MUJA 1FZOA 1WZMA 3DIFA 3SCMA 3PL6C 4X6CF 1QQDA 1B9ZA 1NUGA 1JBJA 3UPRB 5EU6E 5T3XD 2BMKA 2HWZL 5GZND 3HPLB 4URTB 5T5NG 1S9XA 3TJHD 4Y4HA 1NMAH 4IRSD 5CWSA 4Z7WF 5J1AB 2XRAH 3DVGB 2OMBA 4JY5H 2YD9A 3WXVL 5CP7A 4I2XB 5DD5L 3DUSA 3P40A 1T21A 4Y4FC 5C9JA 5JXEC 4HUXB 2NY1B 3ULVE 2N56A 4JM2C 1W72L 1NCWH 3GSNL 3EFDH 5JW5B 3PWPB 1P7KB 4HSQA 4MNQA 3DBXB 3P4LA 5ID0A 1C12A 4PTUA 3HMXL 1CXIA 2I07A 3ALPA 1N8ZA 5IVXF 4QRTB 5DRNB 3DX6A 5HYSG 5J7CC 5B3JE 1IGTB 2N7AA 3EYQD 4GRLD 5DRWA 1UM6H 1DR9A 1GAFH 1QACA 4QYOB 1F45A 1OQXA 3PJSA 2J1KA 2PCPB 1LNUB 2AP2A 4LCUB 4N8PA 1LP9A 1MAJA 1RZ8A 1AFVH 2DIAA 1DQDH 4BFIA 3MV7D 3TN0D 4D2NA 3B6SA 3REWB 1SBSL 5IB3A 1Y6MR 5DJZA 3RU8L 5HYQB 1A6VL 4AJ0A 1G7QB 3C2SA 5MEND 2YUVA 1P1ZA 1TCRA 4I48A 4UQ2A 4ZPTA 4KROD 5IVOA 4YHZH 4OUOA 3EHBC 4HIIA 1C5CH 4LIQE 5FYJD 3CX5J 2Y5TB 4ZDHB 3ARGD 5SWZD 2KQMA 5IEKB 2B1HL 1RUPL 3FOLB 4MAYB 5HHPB 1RJYB 4CADB 4PLJC 5EO0B 4GH7B 2ITDB 4WEBL 3V2AR 4AEFA 3QEGL 4MA7L 2DQHH 3V6OC 3ZKXB 1OAXL 3W5MA 4LQFH 2G75B 5C0IB 1JZ8A 1AR1D 3UJJL 5JIPA 3WIFA 5IEKA 1JPSL 4KDVA 1KN4L 1AP2A 2P43B 3FZUC 1ORSA 2O61B 2X42A 4OZIF 2FLBT 5ICXB 2YEZB 3GMRA 3UZEA 1HYRC 1RURL 5I18L 1S5IH 4ODUA 3FT4A 1UWGH 1CD8A 4L4TE 5HDQH 4AEIH 2AXHA 2A1WH 1QBLH 3ARWA 5C0FB 4E41B 1FORH 1CTNA 3B6SB 3RWJA 1J0JA 1LDPH 3BQUC 1RZ8B 3O3EB 3O2WH 4K7PH 4O51A 5FYKD 1RJLB 2VWEE 4WW2B 2VKWA 1C08A 3BWUC 3Q5YA 3T2PA 1WITA 3QWQB 4HT1L 1A1OA 3DO7B 4PV8A 3DRTB 3SE3A 4PLNC 5TDOA 4PP2A 4Q2ZB 3EJZC 1KCVH 3N1MC 4P2QE 4FA8A 3ZDYF 5HPMA 2EDOA 5D7KD 3RVUD 4KHTL 4JDZB 5MEOA 4KMQA 2XQYK 5D1QB 5FGCB 3C08L 1YDPA 1IAII 4TUOB 2C4FU 3FMGH 5D2NC 4TULL 4TUKH 4G7VH 5F7MC 2MTPA 3LB6D 1BD2E 3UJJH 3WJJA 4EOWH 4UIKH 1ADQL 5TFSH 3LCYA 3LSOB 2MHAB 3RAJH 1GGTA 3BD4A 4JRYD 3VWKA 4OUUB 4RGMC 4LKCB 4GRMA 3LQZA 4ELKA 3T08A 4JKWA 5D2NE 3O2DL 3KPTA 4FP8H 2OR9L 1C5CL 3DX8B 4XNQB 2D7OA 4KGLA 1YEFH 4CW1A 5B39A 4EQ2A 5IKCB 5EOQL 4BSJA 5IHZB 4LIQL 4M4RA 3RZCC 1K4DA 4OSUH 4XMKH 5D7IA 3QDMA 1K5NA 5I1EL 4NO0A 3TWCL 2V2TB 3VFVA 4XPTH 4HC1A 3OKOB 3C2AL 4H88L 4QOKE 3MODL 4HWZB 4ZYKB 4TSCH 3OX8A 3HKFA 4GJTB 5ICYB 2H3NB 5L6YH 1JTTA 3GGWB 2X09A 4PJ9D 3ZT7A 1G7PB 3EJJX 3X14B 3TA3B 2ADJB 4NC1E 5T1KB 2Z4QB 5DJ0B 5HJ3B 3S37L 5D1QC 4U1NA 3UTPD 2FCBA 4EBQH 4OFKA 1Q9OB 1TVHA 1KV3A 3CFKA 5C0JA 1LK2A 1C1EH 4JB9H 3FAXA 1KTLA 1QP1A 4HPOH 3ARVA 5DUML 3F8UB 1U8LA 4R4FL 2K3TA 1B6DA 1EAJA 3ULSA 4Y16A 3CMGA 2KBGA 4MJIE 2NYYC 4JY4A 4LEXH 4HT1H 5T1LD 4XVSH 3BZ4A 1JGDA 4X98A 3GSUA 1AKJD 4KI5D 1G7LA 1JWSB 3MRGB 3VXSD 2OR9H 3W5NA 1U0QA 2XPGB 1ZTXL 5DS8A 1TITA 4D9LH 3EOTH 4P3WA 1P4LA 2ZUQC 4KVCH 2IJ0C 4LHUG 1ZLUK 2R0KL 4PJGE 3VRJB 1AGCA 4K3DH 3O6MH 3FT3B 5BS0E 4JPVH 4K3JH 3KYMA 3ECBB 3MRFA 1HHHA 1A9BB 5KVEL 1YNTA 4Z76B 1AQKL 4GW5A 1VGEL 3PIQB 3F7YB 4LCWA 1AO7E 2XQBH 2UVEA 2B2XH 5GJSL 1CFNB 1BGXH 5F96L 1Q8MA 1S7QA 3AMLA 3MLTA 4KK5D 1U8HA 2AXGA 2VKXA 5E0QA 5HYSB 4FQ2L 1V7NH 4RQQA 1NMCC 5CKAA 5FEBA 4WUKL 4G42B 1J1OH 4ZUUB 1QRNE 2PYFA 2PF6A 4YEEA 3QXUA 3M1BB 3GSUB 4LEXL 4OB5H 4Q97A 4L9LB 4FFYH 2VDOL 2O5XH 4YUEH 5F9AC 5DLML 1H0DA 2ZUWA 4PJHE 1A7PH 4JZNA 2AJ3B 1DE4A 3BKJL 2H9GA 1T5XA 5DFWH 1SHMA 3HLAB 5ILTL 1XGRA 1ZLWK 3MSPA 3BQUB 1T1ZB 2G5BA 4OCXL 3TO2B 3TIDA 1G7HA 3D3VA 4L4VE 2UWEA 5DJ0A 5HJ3A 2VLRA 3BKCH 4J23A 3IB4A 4OV5A 4G5ZH 2YPLA 2RB8A 2BNQD 5GSVA 3V79C 3N1GC 1ZHLB 5ALCL 3RDTC 3WYRA 3I50L 2EZ0C 4KUZH 4DWHA 5FYLH 1JZ6A 3RVTC 3ARGB 1K85A 1DLFH 1URLA 4IOFD 1FNLA 2WINA 4BZ2H 4HWBL 1UH4A 1P4IH 5EOQH 1WK0A 4M1GL 2DBJA 2YWYA 5D7LE 3DUUB 4HG4J 3W2DH 1NEZA 1LEGA 1SYVB 3HE6D 3F6LA 3VXRB 1HZHH 1RZ7L 3L5XL 1UJ3B 2B20A 3BX7C 3OZ9L 4L9LC 4F7PA 3TO2A 1GPOL 3V0VB 1I3GL 2VAAA 3NCMA 5CJQL 5ESAB 2HT3D 4AG4H 4PJEF 2EXYD 4FFZL 4WJ5B 3WCYA 1BD2B 3R0NA 3HLAA 5CILH 4BELD 5B39G 1A7NL 2H9GB 5AZEL 4L4TD 1T1XB 3FB6A 2D4FA 1S7RB 1A6TB 3B5GA 4M7JH 4N9OB 1A5FL 5J12B 2FH6A 4WWKD 3TNNB 4NNYB 4YHYB 5FO8A 2ATKB 2Z9TA 4HBCH 2GUOB 3CH1B 3X17A 1OTSC 4U1IB 2IPKA 3G6JF 5KVDH 4XP6H 1BGXL 3AS1A 5INCA 1YEIL 4Z7UB 5E8DL 3TBWB 4OD1H 1IRAY 1IAIL 4NWTL 1BF8A 5GJTH 1YEEL 2XWTB 3BUTA 1XH3A 1YPZF 5T3XL 1HI6A 1WBXB 3NIFF 2X7LB 4LLQA 4N0CD 4OLXH 1OSZB 4HKXA 2BDNH 1N5YH 2NMSA 2R23B 2ATPB 2O5YH 2V5RA 2OCFD 1D6EA 3R06A 4FG6C 3T3PE 2A38A 5L0QB 2GSGB 1AP2B 2HT2C 1ZHNB 1MELA 2JCCA 1RY7B 5F70A 1OGAA 5FF6B 2C3GA 3VFRA 3MRGA 5ICYA 3GMQA 1C7TA 1JWUA 4BSWA 3RA7L 3EHBD 2DQIL 2HA1A 4QRPA 2BSRB 3LRSA 4CADA 3JZ7A 1BVKA 5EU4B 1S7VA 3QDJE 3PL6B 1HHGB 3B8YA 4F2MA 1GCFA 3V6ZA 1HHIB 4Z0XB 1MFAL 2DQUH 4PGJA 1IZKA 5LG1A 3WIIL 1LP9F 5C0JB 4XT1C 4CN1A 1TCRB 4UQ2B 3CXHK 1A4KA 5DJCA 3QHZL 2XG4A 2EIEA 3IDJA 3X3FL 3MOBL 5SWZE 1E27B 5D93B 2LU7A 2EDTA 4JO3H 4N90E 5HHMB 3EZJB 4QLRA 4GRWB 4OCXH 5JQ6L 4OI7A 4P4KD 1SJEA 3QO1B 1P5UA 3S5LB 3CSPA 3ZDYE 1HK6A 3GIZL 1KJ2A 3FO2B 4M00A 3G08A 3ILPB 1BX2A 5C70A 3W0WA 4NM4L 5E2TL 3S4SG 1NH6A 1F3RB 1DFBH 4RWHA 2GJ6A 5C8JA 4S1QH 3RDTA 3BKYL 4XVTL 2VL5B 4P2OD 2AJSL 3KJ6H 5F6HJ 4I5BA 1C12B 1NLBH 3RY4A 3U2SB 3PDOA 1HDMA 3QI9C 2P5EB 4J6RH 3UO1H 1DEEA 1FPTH 1LO2H 3WFEH 4YJZL 3GUTA 1T03L 1RZ7H 1R3KB 2WMPA 3BZDA 2P5EA 4J3SA 3UPCA 4KRNA 4LASH 3PWLB 1DTUA 1JPTL 3MV9B 3P30L 3SDCD 5CIPH 4CKVX 1PX4A 4PIRF 4XC1L 1KFAH 2A77H 4K3EH 4NRYA 3BIKB 1Z9LA 3U46A 3RIFF 5E99H 5E94B 4HPYL 1P84J 5AYUL 4YHIB 1MJJA 4X6CB 5DZLA 4YXHH 3LKNA 4O51B 4XAWL 5HGAB 1OWRM 2FIKA 3O2WL 5IF0B 3PWVA 2YD2A 2W92A 1MRFL 1JZ2A 1FNFA 1TVBA 3KYOB 4BH8A 1MCCA 2AJVH 5A16A 1NPUA 2RCSH 2WWKO 3MRQB 4Y1AA 1UM5L 4Q0XH 5EU6B 4DN3L 2ZG1A 1J0KA 3MJ9L 3MRPB 3MGOA 3KPSE 2P46B 4NZUH 4OFYD 3A67H 4X7CC 1HXYB 3PL6A 5F7YC 1X9QA 5CUSH 3KPPA 3MLVL 4YHNB 4DZBB 1WWBX 4LRIC 4OLZH 1F58L 1QO3B 2V2XB 4Y4HC 2UZIL 4PRPB 1U91B 4OT1L 5E6IC 2X89D 3L7EB 2NR6C 1I1YA 4PJFE 2YUXA 4X6CA 4Z18A 5ADOL 1NGYB 4YDLB 5DI8A 3KDMA 3MV9E 2IQ9L 3RZWA 4Z7QF 1JNNL 4QF1A 3RIFK 4G80B 3UTPE 2ORBL 4PREA 3RGHA 1QFWH 4R7NA 5FA4A 3DX6B 3VD9A 4L4VB 4PRPD 4GRWF 2WQRA 5F7HA 2AS5M 4LBEB 2YRZA 1NAKL 2F5BH 1RULL 7FABL 3DBXA 3RVTD 4GKNA 4GKSB 2EEAA 3MRMB 1ITBB 3QXAA 4HAGA 4QTHB 3ZHDA 4EDXA 4W4OA 1NC2D 5LGKA 1MRCH 5HD8D 4JHZA 4TSCL 1EV2E 5F9DC 3NTCH 5I1HH 3SOBL 4LCUA 1UH3A 1BQSA 2XFXB 1GGCH 1SVCP 4N0FB 2EIDA 2YHGA 5FCSH 5JIKA 2CUHA 3O81A 4EUPH 2R39A 5GISH 2JELL 4WHCA 3VW3H 3BH9B 4ERSH 4NQEE 1BM3H 2E9WA 4P3DA 3D6GA 2DRUA 4P2OA 5ADOH 4GBXD 3PDGA 3MRRA 1BD2A 5C07A 5D2LE 1VHPA 3HG1E 3QRGH 4HUXA 5T5FL 4S1SH 3RZCA 4OLYL 4XVUD 4N5ED 3OB8A 2ITCA 3GKWH 4GW1B 5IB2A 4MB5A 3DVGA 5F9WB 2PO6B 1QNZH 3ES6B 5JMRA 2MSPA 4Q6IA 2GTZA 4ZXBD 4LVNC 1A1NB 1EH9A 3EO1B 1HHIA 4PJ9B 2EECA 4X7SL 3SDCA 3GJFK 3UXFA 2P5ED 3VGAC 2Z92B 5EU4A 5KAQG 4OB5L 1BOYA 5GRUH 5L2KB 4NQDB 35C8L 4JRXB 5CD5D 4YO0A 1FL6B 1NKRA 4PJEE 1I9EA 4PGDA 4HJ0C 2EDYA 1SBBA 1CGVA 3WNKA 1MHPL 1YMHB 3BQUA 3NFNB 5EBLB 2AEIT 2ATPA 1F4WL 3WS6C 3BZFA 3IRPX 4PJEB 3L9RB 2QQNH 3UBXB 4OKVA 3OKYA 2HKHL 5C0BD 4JO1L 5HI5C 3TM6A 3WNNA 1BREA 1WCBA 3QAZB 4OAWB 3U36B 4MNGE 3BJ91 3N85H 4KFZC 3MV01 4RIRB 4NYLB 4GAGL 4CRPA 4QXGL 2Z93B 1N59A 1BF2A