3ARGD

Ternary crystal structure of the mouse nkt tcr-cd1d-alpha-glucosylceramide(c20:2)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
241
structure length
236
Chain Sequence
AVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDAEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title A molecular basis for the exquisite CD1d-restricted antigen specificity and functional responses of natural killer T cells
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 48
structure length 236
sequence length 241
ec nomenclature
pdb deposition date 2010-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3argD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3argD02
4JVPA 3F8UB 4YC2C 5F3BA 3IAGC 4LLVB 3WNKA 4NP4H 1UC6A 4NRXB 4YHOH 1BLNB 1BBJA 1QVOA 5I1KL 3ZKMC 3OR6B 4RGNC 3I02B 5SWSD 1AQKL 4OSUL 2J7LA 1IL1B 2DKSA 1UXSB 3EYQC 1CDHA 2Z0BA 1IARB 5I0ZA 1CFVH 3DHMA 3T0EB 5DRWB 4P2OD 1HN1A 4AH2B 2MPAL 2GJZB 4OGYL 4IOIA 4CJ0A 4M7KH 4TRPH 4FQIH 4DN4L 5D1QB 4I48A 2BERA 4Z7WF 3RAJH 3C6LC 2GSGA 4ZAKC 5JOEA 4WFED 2YN5A 3X11A 3T2QA 1QRNA 3DUUA 2Y25A 1IEAB 1HYSD 5KSUA 2V2TB 5HHNA 5I8KH 2WUBH 3QUYD 5TF1H 5FGCE 4GKSB 4JFFE 4KI5D 5EU6D 5TE6L 4E41B 2NY0B 1TZIA 1QSFD 3DBXA 2M2DA 3QDJD 5KSBA 4KKLC 4LARH 5C0EA 1WLHA 3CDYA 4HV8A 4J23A 2QKIA 2R2HB 1HEZB 1CK0H 3FJTA 3GMRA 1IGJB 5ID1A 1N8ZB 5DEGB 4PJIA 4LRNH 5IF0A 5ISZB 2JF1A 3PL6A 4X6DB 1NGXA 3NFSL 4FXGB 2IANE 4QRRA 2IH1A 4M02A 2VXVL 2J8OA 3QDGB 1UB6A 3A0OA 2BDNH 2CIIB 3P2TA 1UCBL 4GAGH 3IFOB 3GDBA 4OUUA 3CH1B 1ZGLA 1EHLL 2CUHA 1UZ8A 4Y1AA 3WL9B 4NNPL 1BQHB 1IAMA 3VXRA 2ICWJ 4UT7H 4ZD3H 4TSBL 4HW6A 1DBKH 3DXAD 1CS6A 1MRFL 1PAMA 4UUJA 3SO5A 4C56A 3U0TA 4HCRA 1FFPA 2D2OA 3QPQD 3IRPX 3ULVD 1WBYB 2V7HB 3AREB 4YE4H 4YEEA 5JW5A 4QF1B 5EFIB 1ZVSB 3BT2L 3U48A 2DS4A 4ODVL 5D7JB 4U3HA 2X4RA 2HKFL 2A1WH 3MCKB 3ILPB 5EA0L 2FIKB 5L9DL 1FSKC 4XBGB 4G8IA 3O4OB 2YRLA 4RMUA 5GJSH 1CG9B 1Y6NR 3RWDB 2ITDB 3WFDH 5FXCH 1UM4L 3OF6A 2DI8A 4R3SB 4JKPH 3V6BR 3MRGA 4ORGB 3TT3L 3MJ8B 1TMCB 2MHAB 4UOJA 3O9WA 1P7HL 4CVXA 4PJ5B 4UTAH 2VDOH 5T1LA 4AIXA 5DC0A 5DGQA 1U8JB 4HJGA 4KI5F 1UH2A 3NGBC 3ILQD 3QEGL 4YPGA 4BUGA 5IW3A 4EEEA 3FQWA 3LN5A 1EK3A 1AJ7H 1IGYA 3D69A 3NIGE 2C26A 3FQTA 3GSWA 3U1SH 1Z0MA 2GCYB 5GIRA 1JYNA 1WBXB 5IVZA 3RY6A 1FE8L 3D18B 1XGQA 1NL0H 3VGFA 3WLBB 2CIKB 1RUKH 4AZ8A 4EKXA 4WFFD 3FO2B 2BMKA 2X4QA 5MEQA 3T0BA 4UV7H 3AROA 2BNRA 4BFBD 4CVUA 3CVHB 4Z0XA 1SJHA 4LSQH 1JVKA 3HI6H 1HHIA 2DTSA 1CTOA 3LAFA 3JVGA 4NN5B 2JKXA 2GSIB 2R0ZL 1L7TL 4MX7B 2PO6C 1ZMYA 4YDJB 2Y36H 1FGNH 4Z7QE 2FBOJ 3F6IA 1QFUH 2V2XA 5CD3A 3W82A 1J87A 3TYGH 3VXSE 2C5DC 3HMWL 1Q72L 3C08H 5SWZD 2A6IA 3IU4H 5DT1H 3ULVF 4N8VG 1YN6A 3TNNA 1RAMA 2VDRH 4LU5H 4LQFL 2VTFA 4NBZB 5I16B 4R2GC 3ZDZF 1RZ8B 5GSVA 3DX7B 1ZLWH 4X7SH 3BIBX 3M17B 1AP2B 1ZHBA 4KK8D 3VXPB 1EUUA 1RIVL 4IOFC 4PLKC 3CNKA 3RY5A 5L8KB 2HLFD 3BAEH 5B3JF 2KPNA 1KB9K 1QEWA 1VCAA 3FB8B 4R4ND 4WIQA 4X7TB 3SJVE 3IU3A 1OTSC 4X8JA 2NXZD 3Q2CA 1OW0A 3KWWA 4JN2A 2Q7YA 4Z7WE 4MXQC 1MHCA 3L3OB 2HJFA 4CBPA 4OCNC 2FATL 1M1SA 5BOZG 3VFGL 1E28B 3HCVB 4PB0H 5F7DA 3FO1B 2JB5H 1BBDL 1C1EH 1LK3L 1GJIA 3NIDE 1QBML 2XTLA 4LSVL 4PGCA 4HK0B 2PW2B 4OLVL 3IJYA 3RPIA 2YN3A 1A6ZA 1U91A 4TUJA 1P2CB 1JPSH 2FHCA 3RX5A 5GS1B 3OL2A 3BQUB 2X89A 3NFPB 2NY3B 4U4BA 4CMMA 3UTTD 2YD1A 4DVBB 1TVBB 1G7IA 4J3XA 5I1HH 5T1MB 1EO5A 2HFGH 4OLYL 4HUKB 4AIOA 5EDXA 4NHUB 4X7FC 5GPRA 3V2AR 2IPUG 3FB7B 2F5BL 3RWCB 2VDKH 1XH3B 4EIGB 4RAUA 5FA3B 3STZB 1JGVL 2BSSB 2QBWA 3MRIB 1U8NA 4PV8B 5KVFL 5KS9E 4U6HB 4EBQL 2D9QB 2P5WB 3LKNB 4XBEL 3MRBA 4L8DA 1NCBH 3WUZA 4AL8H 1RZGA 3ARPA 4Z77B 3RX7A 3DUHA 5BXFA 4GXVH 2VXTL 5HHOA 5D6CB 3FMGL 4ENED 3KDMA 3SBWA 2MWCA 3S96B 1ZHNB 4P5MA 4X99A 4XRCB 2UYLA 5DJ2B 1EBAA 5DSCA 5J9PB 1O5DT 5IMMB 1PSKL 2UVEA 5D7JC 3GBNH 3MRRA 3C60A 1XF2B 5CFHA 2W0PA 3GSNH 4Y89A 2Q1EA 3I75A 4RISH 3QUML 3IXAA 4N5UA 1KJ2B 3SDAC 2ZSWA 1QSZA 4JAMB 2IQ9H 3UO1H 1QLFA 3VI4F 4MD5B 4MJ6A 4TQEH 1AGCB 3EGSB 4M00A 2X4UA 4LDOB 4XNMA 2C9AA 3L7EB 1MNUL 4Z7NE 1EJOL 4KI5E 2F8XC 5CBEA 2F74A 5IR1B 1KT2A 2I07A 2VKWA 3MV01 4Y8AA 4XMPH 4GSDH 4LHJB 3L6FB 4PS4L 3BPCB 3WIIL 3NFNA 1LO2H 4FS0A 1ZEAH 2ZCLH 1FG9C 4FABH 5LJYH 4DKEL 3OHXB 2NY6B 3C9NA 4EUPB 4UZGA 1M7IB 2H26A 1KC5H 4QNPF 1FLRL 2VXQH 5K9KB 3AY4A 1IE5A 3S35H 2AJYL 1MHHB 3S3SA 1P84J 5J1SC 5DD0H 3TBSA 3GM0A 4FXLA 1BREA 5GZNC 4NUJB 1CICD 3DX6B 3MV9B 1I9RL 1TVHB 4JRXD 1FO0H 1X4ZA 4OQ1A 1EFXA 1QOKA 3HG1A 4OLZL 4NKDA 4DOHE 5CEXA 1YC7A 1X5XA 3RTQD 4XB7A 2EH8L 3MBEA 3NZHL 1U0QA 3KPPB 4ESKA 4NO0D 5BZWB 2DJSA 1LEGA 2IG2L 4NKOB 3IF1A 2FX9L 2NW2B 5CJXA 1F4YH 5MERA 4M8VA 2ERJB 4PJGA 1N7MH 4HH9A 4HXBH 4LCUB 2AJUL 1RMFH 3BH9B 1IAKB 2KUTA 3DRTB 4HJJL 1LD9A 2VDML 3LHPL 3HPLA 3QEQD 1RQ5A 3BGMB 1HH9A 4MMXC 1IAIM 4NYLA 3F7QA 5T1KB 1AGFB 1FL3A 1ZT7A 3MRNB 2D7QA 4RNRA 5BOPA 4G6FB 3KLAB 1R0AH 5D1QD 4WO4D 1GL4B 2R4RL 5L2JA 4I2XB 4HS8L 1CFTA 3LB6C 3BEVA 1OD9A 4FA8A 5ICXA 3WD5H 5EN2B 3JV6B 4WWKD 5T3ZL 5FA4B 5BVJB 3D2UA 3FFCB 1IAIL 1DN0B 4FQXA 2EEAA 1YA5A 2FO4B 4WFFE 3C5ZA 5GS1C 2KH2B 3WIHH 2ITCB 5ADPL 4BELD 1EEYB 3QISA 2F5AL 2NY0D 3TP4A 3QIUA 2NX5B 3NIFF 4GUPB 1DFBH 1GIGH 3NMEA 4JRYB 3THML 2WINA 5FO7A 3HE6B 3GSUA 4X80H 4OB5L 4U1GB 3ZT7A 5EIVA 4HIJA 5HJ3B 3BP6A 4B7IA 2FEDD 5ISZD 4Q6IA 3VFWA 2LVCA 5ESQB 4QWWD 2X1OA 5I8CB 1BVLB 1JNHA 3QDGD 1WFUA 3LQAL 4YXKL 5DJ8B 3VFOB 4QHNB 3VRIB 1JZ5A 2CXKA 1J86A 1BFTA 3VXUE 3UJIH 1DLHB 3BYTA 3VFPB 5GS2H 2FYYA 4QGTA 4N1EA 4OFYD 1ED3B 2J6EH 3TBVB 1A1MB 5EH1A 4GKZB 3SDCC 2LTQB 5I1EL 3IDJA 2DAVA 3BKYL 1OM3H 1X5AA 5EWIH 1KG0B 2CLRB 4KV5F 2BSTB 3GRWH 5CBAB 1OHQA 2YXFA 3MV7E 5KSVB 4NZRH 3O8XC 5E8NA 2X4TA 1ACYH 5T1DL 4RGNE 3ARED 3CX2A 1D5ZA 5F44A 3TVMA 4OM1H 1IGML 4LSTL 1KCVH 3GKWL 4U7SA 3TA3B 1EAJA 2ZOLB 4LSRL 4JVUA 3WJLC 5DJ0A 2BSRB 1SYVA 4L4TA 5KSAB 3QHFH 1Q9WB 1IGCL 4AG4H 4BH7B 1NJ9B 1FYTD 2CKBL 3CSBA 1PYWA 3ZHLA 2VLJB 1RU9H 1JL8A 2X42A 1XCTA 4PJDE 5HGGS 4BSJA 1BEYL 3T0VA 2GUOB 4M1DH 2AABL 3MNVB 4JZJA 3GI9L 3MXVL 4RX4D 3ES6B 1WSST 4PJ5D 4FXKB 1NBQA 4LBEA 3MRCB 3BKCH 3OWEA 3IDGA 1A4JA 4CADB 4M48L 1ULVA 2WSKA 4I77H 1CD1B 2ESVE 1YNLL 5IESL 1JZ6A 4Y4FD 5EC2A 5MEPB 4X6DF 3SKOB 5IM7A 1QFPA 3I50L 3FZUD 3P77B 5JO5A 5HYJB 1TJHH 4FQ2L 5FYKD 1S8DA 4R6UA 2CRZA 5DD6A 5F88B 1KN2L 3ARGB 1NLDH 4Y19E 4QXUH 3GJEB 1SQ2N 1OY3B 1PEZA 4JDVB 1ORQB 4WWID 1FIEA 3MRKB 3HFML 1XGUB 1RIUL 2Z91A 1ZGLP 1KIQA 4G80A 4Q9QH 3EYSL 5I76A 3PIQA 2OI9B 1T1XA 3MXWL 3WO4B 3DGGB 3V6FB 4PJBA 3QWRD 1MPAH 2VQ1B 4IDJL 5FDWB 1F6LL 4TVSa 1J0ZA 2H1PL 3K80A 2FRGP 5EUOB 1HINH 1JRHL 2DWEB 1QZ1A 1AGDA 4OCXH 4N0CC 3GB7A 2DWDA 1TJIH 4M7JH 2ZKHH 5I1JH 4KKCC 3WFHA 4PV9B 1UADC 4ZPTB 1P4IH 4ODSH 2UUDK 2P8LA 4KKNA 3JWNC 3MLZH 4PUBL 3ZMRA 4U1LA 3T77A 3G5ZA 1ZLWK 2BHYA 1K5NA 1S7TA 2D9CA 3QCVL 3JV0A 4H0GA 2WBWB 4ODTH 1YMHB 1ROWA 1I9JL 1F11B 5HXMA 5DEZA 1YEEL 1H3WM 4F7PA 1DVFD 3RVXC 1EXUA 4ELKB 1J5OL 5DJDB 3I2CH 5KTEH 2H41A 1U93A 4FQQB 4X7EC 2OJZL 4H5SB 5E5UB 5DFWH 2DL9A 2XWTA 4U1GC 5FO9B 5ITFB 1CTNA 2CSPA 5FV1L 4U05A 3DSNA 1Z5LB 2XFXA 3PWLA 4JM4H 3QZWA 4U3CA 4UQ3B 3O41B 4JZNA 1Q94A 1IKFH 3T65A 4NJAH 5AEAA 5EG6C 2VISB 3SCMA 2P5WD 3VWJA 4OZGE 1L0YA 3P9MB 3RWJB 1WUNT 2FD6L 4KUZH 2VR4A 1UM5L 2VO5A 3MRMA 4GBXA 1FFRA 5L2KB 4KV5E 1XZ0A 3BXNB 2BVQB 3MBXH 3BKML 2Z35A 2E8YA 3JUZA 3LZFL 4J8RA 4NQCA 3A67L 3LN9A 1MQKL 4NFDA 2KQNA 4P2QA 1DEEB 3AMKA 5IJVA 3T0EE 1OQOA 5GRVK 3U46A 2ENYA 3M1BA 4V1DB 4Y2OA 43CAB 2Y6SC 1R3JB 3DO7B 2CKBB 1Y0LA 1DQLL 1GZQA 1MJ8L 2HMID 3FQXB 2NZ9C 5D5MA 1CDUA 3OXSA 3S37L 5DUML 1JF1B 3RGVB 1TTFA 4O58H 1JWSA 3C6SB 4G9FA 4XPFL 3ZSTA 2FL5A 1T6VN 4YNYA 1JZ8A 3VXQB 3WXVH 5C0JB 5HHQB 4CU7A 4EOWL 2F54D 1W72L 3HAEA 3ARZA 3V4PH 2EC9T 5E00B 2B4CL 1MI5B 4LDLB 4S1RL 2WP3O 5JXAH 4E41E 4UB0L 3WSQH 5T33L 3T2NL 3BWAB 5D1XB 5DYOB 3WDIA 3QUXB 3CH8A 2Q3ZA 2V17L 4KDTA 3QFDA 5HHVH 3QG6B 4G6KL 2J4WH 4XMLL 1GRWA 4LLMB 1YPZB 3VMOA 3MGOB 3RY4A 1CZ8H 4X6DE 2NY6D 1YEHL 4KKBD 3UP1A 3MJ9H 3QT2A 3QNXB 4YHLL 1NCUA 4YHZL 4CW1A 3QDGE 1PX3A 4R0LA 4Q9BA 5I30L 5HI4D 4KHXH 5TDPB 5DHXB 3TO4A 4NT6A 2HLAB 2G60H 4OUOA 1FFNB 1T04A 4JQIH 2W9DL 4IRJB 1YNKL 4APQA 3IDIB 4LKCA 5I1CL 3MYJB 4Y4KA 4JDTL 4TTDC 5JDJA 5B8CA 1I9EA 4PRPB 5BVPH 3DYMA 2DQUL 3MV9D 5DQDH 1BQLL 3LPFA 5D93B 4N0UB 5J8OA 1HHKA 1RUMH 4BJLA 1I1CA 1UA6L 4JR9L 2AERT 3FOMA 3HNTH 4Q2ZB 3MRFA 1BAFL 2XZAH 2OI9C 4H20L 3LEVL 1XF3A 3WXWH 1QHOA 5F9WC 2ADIB 1HZHH 5FIEA 2AGJL 3FQUA 4A2LA 1XMWA 4FFWD 1KELH 4QTHB 5DJZA 4NN6B 5E0QA 3WFCL 3MRLB 2DD8H 5E8OA 4PLOB 4P46D 1GHFH 5F9AC 2XZCH 3QJFA 4MNGE 1X9QA 5D7KD 1SM3H 1QSEB 4NJ9H 4M1GL 4MXVF 4UTBL 4OD2A 5GQBA 5ID0B 4ISVB 4R96A 1F45A 1CDCA 3I9GH 2VITA 4AEIL 5I8OL 2NW3B 1AFVH 4EN3C 4PJ5E 2CUMA 5T1KD 4G7YL 4M93B 4U0QB 2R29H 2AEWA 3WS3B 4G6FD 1TPXB 3VFVA 4PGBB 4P5KB 4X6BA 3U9UA 5FAAA 4MA3B 4M43L 5FB8A 3L3GA 3WUWA 5I73C 4M6OH 1XGPA 4X6CB 5H8DA 3RA7H 3FFCD 1FCCA 5AYUL 1UH3A 1AHWB 3MMEB 1XGYH 2ZCHL 4XGZA 5FYKE 3WIHA 2DYPB 3RVTD 3U36A 5CUSL 3BW9A 1IQWL 4YH6A 3WNNA 1TETH 2NX5D 5EZOL 2AK4E 1WT5C 1EEZA 4JRYD 2VRAA 1ZHKA 3HE6D 3JTTA 4HZAA 4X5XB 2DDQL 1LEKA 1A6PA 1RZJH 1TQCB 5FECA 3SO3B 3MC0A 1OAUH 2NZIA 3CFDA 1NAMB 4XP9H 3PWUB 3C6LA 1A2YA 2I9LB 2PCPB 5IB3B 4ZAKA 3MFFB 4B50A 1WWAX 3EFFB 2CGRH 2EEBA 3WKNA 4KJPC 3Q1SH 5D2NC 2GT9B 4JG0L 5AZEH 3H3BC 1CE1L 4LRIC 5HI5D 2P43B 2Z31C 2VDLL 3LQZA 3IDNB 1E27B 4K71B 1FORH 4M1CD 4HAFA 1UM6L 4HC1H 2J6EA 4P2OC 4P5TB 1N5YL 3ARXA 4HUXB 3RWHA 1A1NB 1NMAH 4XNXH 3U9PH 1ONQA 3L95A 3GRWA 3QQ9D 2NTFB 3NABL 1GGYA 2CDEB 5BV7H 5CHNA 4M3KB 3E3QC 4G6JL 2GIYA 4MA8H 5C0CD 1AH1A 5GZOC 1SJEB 1XF4A 1C5DB 2DI7A 3P4MB 4ZODA 3TA3D 5I71B 1MLCA 3T0WA 5C8JA 5T3XL 1DUYB 4I9WE 3RGVC 1WICA 5KSAD 2JJVA 2QV2A 4MNQA 5HBBA 4OGAD 2I5YH 1UKSA 3WHE1 3EO9H 5IBTH 1ZTXL 1EUTA 1YYLH 3KXFA 5CZXD 2EIDA 1Q0YL 2HWZH 4YHMH 4LCIH 1FNGB 2WBJD 3IFPA 5C9KA 3MOQA 1IILE 4XPAH 4UDTB 3V52L 3V8CA 4EQ3A 4LEOB 5D1XC 2D03L 5D71L 3QJHA 4ZS7L 4HXAH 1EMTL 4LPUA 4JO3H 3H9SB 1G9ML 4U1IA 3T3PE 1NCWH 4NRZB 4ZO6A 4NKIH 4ZQKA 2FZ3B 1OWWA 3GK8L 4E0RA 5K9QG 4NBYB 3U79A 3P4NA 4MAYB 3CC5B 5F1OB 1H3UA 1H3TA 4ODHH 3TIDB 2XZZA 1QKZH 1KTLA 4NO2A 4XNQA 2P5WE 4PJEF 1NDMA 4P57A 1B4JL 4F37K 1G6VK 2J5LB 1I8IA 1RVFL 1ZS8A 2CLZA 4Z7VB 4JPVH 2Y72A 4OF0A 1GPOH 3ARGD 4F58H 3NCCB 3ZT6A 5I75B 3ARVA 3MUGA 2E6JA 3TH4T 1XR9B 4GMSH 2NY4C 4PY8I 5HYSA 2VERN 4AENB 4JFOA 4LHUD 3SDYL 4GAJH 1G7PA 1QD0A 3NN8B 1T7XA 3LKQB 4PJ9D 32C2B 5ALBL 4FTVB 1TLKA 3GSXB 3T8XA 3OZ9H 3QIWC 2CDFB 4C57C 2BP3A 2X10A 3E8UL 4WNQB 5CEZL 1FZOA 3K2UL 4LHUG 4D0DB 1RJLB 3ILQC 4Y5XC 5I17B 1OAKL 3O6KH 3ESUF 3ZL4H 2VC2H 5DJXB 2BCKB 1ODAA 2PO6A 4X4YB 2FR4A 4ZDHA 4JFXB 4M93C 2YWZA 3V4VL 3OKMA 1J1PL 3QYCA 5EZLA 1TPXC 1F2XK 3JV4A 2GK2A 4ZUUA 4OZGA 4GW5A 3IFNH 1GAFH 1KIRB 1UVQB 4MXWL 5T3ZD 2XI9A 4JN1H 5EU5A 4KK6D 4NPYA 1MLBB 1WWBX 3DYOA 3BJ91 3QXDA 2R1XA 5GSRA 5DEFA 5ACZB 1RZ7L 3E6FB 4PJ8D 4ZOEA 2NR6D 3MREA 1FYHB 4UT9L 4PGDB 1RZFH 4MHHI 3F12A 3RHWF 4OZIA 4KJWC 4FFVC 1DUZA 2VLRB 4I5BB 3MV9E 3FO9A 1QBAA 1TQCC 2H3NB 1J8HB 3SO3C 4P23D 3ZHKA 5D7LA 4DAGL 4P4KB 2GTZA 4HPOH 1NGYA 3W2DL 1JF5A 2AXFA 4O4YL 1KCUL 1BIIA 2NY1B 3O0RH 3CXHK 2W60A 1I7ZB 3BUYA 1WZ1H 3RNKA 4G6AD 1T03H 4TUKL 3R06A 3EYVB 4MVBC 5TDOA 1FH5H 1S7VB 3GSOA 1QNZL 2DQIH 3BP5B 4M61B 4JLRA 1OF2A 3MLVH 4X7DC 5IHZA 2FSEB 2P47B 1CXEA 3O3AA 3A6CL 5DMJB 4LIQL 5D1ZC 1CGVA 5DD3L 4F3FA 1YUHA 4V1DD 5AUMA 5I71C 5CCKL 3GSRB 1EVUA 3EHBD 4YAQA 1S9VB 3U7WL 2N7BA 2SEBB 1X5FA 3HC3H 4HLZH 4PRBA 3G5VB 4BFIB 1DSFH 4I2XE 4TPRL 5J56B 2ICCA 2A6DB 2J88H 1KSRA 4L8BB 4OV5A 5H2BA 5L0QB 4DGVH 4DVRH 3UZEA 1KCRL 2DBLL 1MCRA 3FFCE 4M6AA 3K4ZA 2E7LA 4QOKB 4PJCA 5DRXA 4ZS6C 2N1KA 4J4PD 5FV2A 1C5CL 1GC1C 5IVXA 1MI5D 3FO0H 2K1MA 5J6HA 2NX5E 2A2QT 3QUXD 3X3GH 4OF8A 1HI6B 1P9MC 4JRYE 4JREB 4GLRI 1LP9B 3LKPA 1PVHA 3VXOA 5CIPA 3PABB 2VNCA 2O5XL 5LQBL 1NMCC 4OF6A 3VFSA 1JTPA 2EYSA 3MJ9A 4MNGA 4QY8A 5C0BA 1NFIB 3SDAA 2R0LL 2OR9L 2DQGL 2EYRA 4KTDH 1WFNA 3QFJA 3LPWA 1JYVA 4M9OA 4LF3B 4JZOA 2JE8A 3DV6B 4KRMB 4MCZA 2WIMA 4IRJD 3WMSA 1Y6MR 1VESA 3KYMA 2P5EB 4PRAA 1S7SB 2NYYC 5E6ID 4YDIH 3A6OA 3BI9X 2EDXA 1KCKA 3LMJH 4NZDA 1KB5H 4MB5A 3UBXB 1HOCB 4HBQA 1NGPH 1OGAD 1U3JA 4CKVX 4GRLC 3LIZH 5JORB 4ONFL 1U95B 2D7NA 3R0MA 2C3GA 1K2DB 3WEXA 1Z3GH 1NEZG 5DK0B 5J0BA 3UTSE 3R4DA 3OKLA 2AK4A 2ZUQB 5DQ9A 4FFYL 4JANA 2F19L 2VLJE 5F3HA 5DS8B 1F6AA 4OQTL 4LPXA 3K1KC 1BHGA 4XCEA 3L7FB 2BNUA 1GOFA 4JCLA 3FB6A 1YMMA 2HT2C 3EDEA 4UI2A 4Y16B 5EBGA 1T83C 1X7QA 3MGAA 3MO1B 3KYKL 2ILLA 3C5JA 3FQRA 4TULL 1DQJB 1U3ZA 3MR9A 3U7YH 1G7JA 5K59E 4ZUSB 3VFNB 3F7VA 2ATKB 4NQDA 4PJFF 3REVA 5IKCA 2WWKO 3LN4B 2DLEA 4UIKL 1T1ZA 3SDXA 1BIHA 1I3RB 5F7NC 1E0OB 1MCSA 4MDIB 5HYJE 5HDLA 4L3ED 4PP1D 3ULSB 4XCCH 4NCDA 1MCHA 5INCA 1T21A 3G08B 3ARDB 3HZVB 1KLGA 4P4KC 1QO3A 1MAMH 1B2WL 1T3FA 3VXNA 2AJSL 2I9TB 4LLQA 1OGTB 1UQSA 3QHZL 3Q3GA 3T0DA 5F1IB 3QA3A 4RFOL 4BQBA 4DKAA 5J13B 5FYJH 1TQBC 4PP2A 4OFKA 4P3CL 5L6YL 5JZ7C 5KVEH 3MROA 3C2AL 3GMNB 2ZJSL 3UYRL 3LV3B 1JGUL 4LSSH 3WNMA 3HUJF 5DK2A 5MP6L 4WGWB 4M4PA 3RU8L 4HC1A 4P5TD 3S4SA 5ILTH 4HEME 4DQOH 5DMYA 5EUOE 1A7OH 4KMQA 4F7CA 3RNQB 3GKZA 3SPVA 2VDNL 3ZT5A 5GGRB 1ZWIA 1J0HA 4MCYA 2FGWL 2AXGB 4N5EC 4LLDA 3VE0A 5DD1L 1JNNL 2R2BB 3QULB 3VGGA 5L0QC 3WE6A 5C92A 3E6HB 4X4ZA 3SDCA 1FAKT 3BO8B 3G04A 3F7PC 2NLJA 3KJ6H 4QHLA 4PRHD 1MRCH 2APVA 2DQTH 4OCSH 1KXTB 5DMIL 2XICA 5GRZA 1JHLH 5DUBA 3FTGB 5GGSY 3BZFB 1KENL 4YDLB 1YEIL 3GIZL 5J1TC 5E7FA 1ZLUH 3BHBA 4JREC 3RVVC 4ELMA 3QI9B 4P2RA 2FJHA 3BZDA 3C8KB 4Z7OE 1TZHB 2OL3L 1IT9L 3SKMA 2CPCA 3WJLA 5LBSH 4MAYD 2DTMH 1BGXH 1OARL 4JRWA 1R5IB 2ZPKH 1HSBB 3EFDH 1PZ5A 3ARBD 2DQFA 3OXRA 1ZKAA 2W0FB 4OD1L 2ADJB 2CRIA 3IXTB 5JW4R 4MQXD 3QB7C 1W0YT 2AEPL 1F8TH 2D7MA 4XPTL 5E5MB 5CEYB 5I15L 4X6EA 4O02H 1MCJA 5FUOL 1KEML 4D0CB 1MHEB 1WIPA 1A3RL 5F6HJ 2IPKA 4OT1H 5L2KE 4WI9A 3OTTA 5GRUH 2FIRT 4YUEL 4RMQA 1BJ1H 5EU4A 1GGIH 7CGTA 4ERSH 4G8GD 3MJ7B 5JW4M 3E3QE 4NQVA 3WDJA 3WFEH 4EVNB 5ICZB 4EQ2A 3C09C 2EDHA 4FTVD 2VJXA 3V5DB 3CCHA 2DRUA 5TQ0H 2EDNA 3VWKA 4BQ6A 1PKOA 1FNEA 3Q6GH 4ONHA 3CSPA 4DW2L 3ULVH 1A1OB 2Y7QA 3K81A 2R9HD 5JDSB 1A14H 1MOEA 2D4FA 2GJ6B 1AXSB 2RCSL 5C7XH 4Y16C 3PWVB 3JWOL 4QHKI 1FZMB 1F6FB 4GG6B 2B2XH 4Y4FC 4PB9H 3ME0A 3DWTA 2ADFL 3BP4A 3HMXL 3FZUC 2VLKB 2BVTA 2X41A 1IC5L 5CWSA 5ICYA 2DQEL 4CAGA 5EBMA 1N6QH 5C0RL 5TE7L 5E08H 4IOSD 1NC4A 1AR2A 1YPZE 1UXWA 4MNHB 3F6LA 3GMPA 2Y5TB 2R8SH 3G6DL 2G9HA 4OLWL 4WHTA 4PG2C 4DKDC 5KVDH 4Q0XL 1YQVL 1RZKH 4KQ4H 4OZHA 2Q8BL 3TCLB 4X4XB 4F2MA 4YHIB 1HWGB 5C0FB 4PRPE 2VLRD 3HI5L 4Z7VF 2O26U 4JFPB 4N0UE 4GRWB 4XVJL 4MAUL 1JUFA 3Q5TA 1HDMB 1OP9A 2JJTC 1AKJD 4ZTPH 2PYEB 3FN9A 4YHKL 3KPSB 3MA9H 3F7RA 1JPFA 1V5JA 1VGEH 3D3VD 2NY1D 3QIBB 1FL6A 2JJSC 3L5JA 5I9QB 5I8EA 1MJ7H 2YD3A 4WU5A 2HRLA 2QR0A 3BH8B 4P9HL 4Z5RA 1EA9C 2FB4L 2R0WH 3KS0H 2NY5C 2EXYD 1YYML 5D7IB 4AM0B 2QADC 1BD2A 3F7YA 4OZFB 1MWAA 4U6TA 5GGUA 1N4XL 1VPOL 1Q9KB 3LEXA 5CSGA 2CR6A 1QSEE 5I74C 3RZCC 3IJHA 1NGQL 2VLMD 1TFHA 2IC2A 2I27N 4I4WA 5HGHB 1A7NL 3C2SA 4Y0GA 5T3XD 1T2QL 1U6AL 4B5EA 1BZ9B 4L3CB 5TE4L 3KHQA 4MS8D 5A40E 1II4E 5BMFL 1LO0H 5I1GH 2P4AB 1O7VA 3RWEB 4ZSOA 3S3PA 2ZCKL 1JWUA 3QDMB 3M8OH 1IGFL 5DWUH 3RIAF 3BUTA 5LCVL 5BS0B 3RL2A 4ALAL 3HKFA 3ZKQD 1DZBA 4XNUL 3QNYB 3D9AH 4OIAA 1IMHC 1HILA 4X6CE 5FKPA 1EJ6A 5EBLB 1WWWX 3VXMD 1H3VA 4K7PH 5E2UL 2OL3B 5EOCH 1T5XB 2EO9A 3NACH 4F7MB 1ZHLA 3QI9C 4AEEA 1CT8A 3QQNA 3F58H 3TJHD 3TPUB 1JK8A 4WW1A 2Z92A 3UTSA 2BNQB 4XX1E 2YUXA 5ACMA 3STLA 3DETD 1SBSL 1CQKA 4MDJA 7FABH 1GGTA 4XZUA 2CK0H 4JHWL 4Z0BH 1I7RB 2WUCH 1UKQA 2OTUB 3V0VA 5JIHA 3GZKA 1FNSL 2GJJA 2HG5B 5SX4I 1ZANL 1HIML 3GHBH 3FB5B 5EUKB 1IC4H 4PY7A 4PGEB 5SX5H 3VH8A 5M94B 2B5IB 1KB5A 2YD6A 4LNVA 1CU4H 4JFZH 4KTEH 3SGDH 1J7VR 2EKSA 1ZT1A 2IFFL 4UMGA 2AV1B 5K9OB 2O61A 5CEZD 1N3NB 3QRGH 3RJDA 3CGTA 1IGTB 4N0YL 2W07A 1T0NA 3L3DA 1YN7A 5I2IA 2JK5A 4HCRL 1CXIA 1AD9B 3DVNB 1DBJL 1EHAA 4LLYB 3FN0L 3UTQB 3I6LD 2GAZA 1X3DA 2MSPA 2F53B 3X12B 2LU4A 1MSPA 2H8PB 1FIGH 1G0DA 3QUZA 5JR1L 1OPGL 1U41A 1ORSB 4GQPH 2HFTA 2OK0L 3H9SE 1A7RH 3PXJA 1X5IA 2E5EA 3UPRB 3FONB 2FBJL 3X3FH 3NOIA 4H8WL 5FYLL 1FCGA 1LP9F 2XPGB 1S5HB 5E95B 5F7MC 4CVZA 5JTWA 3MOBL 3SOBH 4XAKE 1TITA 3B2VH 1OAZL 3D0LB 2AK1L 3P9WB 4LEXL 4PJXB 5SWQB 4PLJD 3KLHC 1YEDB 5LGJA 1AXTH 3B83A 2Q86B 3B9VA 4NGHL 3B9KB 4NQSA 2EC9U 4K9EL 1A9BB 4Z7VE 1JNLL 4EN3A 4F9PA 1XIWC 3ARDD 3CK0H 2UWEF 2PXYB 3LEYH 1WJ3A 1VKXA 2D31A 5F96L 1B6DA 3MNZA 4D2NA 3MYZA 3QIBC 4F8TA 1LE9A 2WW8A 5I9QC 1OSZA 3Q6FA 3UJTH 1N2RB 4XXDA 1G7MB 3CMOL 1WEJH 1KEGL 5I6XB 5CP7B 2WMPA 4UAOB 3DSFH 3AMLA 4FTVE 4W6WB 5IIEA 4U1SA 1JPGB 4U1KB 5F7KC 3L9RB 1EFQA 1VHPA 2BY2A 1EO8H 3MCG1 1WT5A 1MF2L 5F3BB 1WVZA 5HDBF 3OKDA 1MCPH 2YZ8A 3O3DA 4HF5L 1QVOB 1BBJB 1MAKA 3E2HB 3O6ML 4QXTA 2GITA 1YJDC 5KW9L 3HS0A 5F1KC 3B2UD 5D2NA 8CGTA 4IOIB 3VXTA 4AQOA 5SWSA 2Z31A 3RUGF 3BYYA 3SDDC 5EZIH 4I48B 1AI1L 2CXGA 3RL1A 4P2OA 3G5XA 5E70A 2GSGB 2OSLA 5IFHL 3V0WH 3X11B 1QRNB 3DUUB 2WM0A 2EE9A 15C8L 4RMWA 1T66C 5KSUB 5HHNB 1BZQK 1I3GH 4YFDB 1F3DJ 1D6VL 2MOVA 5LGKA 2VLRE 2Z8SA 4JPKH 1J8HE 4Z9KB 1TZIB 1ZLSH 4K23L 5KSBB 2HRPL 1KYOK 5C0EB 2VZUA 4HV8B 2QKIB 3QUYA 1HWHB 3MLUL 5EU6A 3GMRB 1KACB 1KJVA 3PQYD 5ID1B 4IRZH 3BE1H 4PJIB 1JN6A 1V7NL 4M6NL 5IF0B 1N5AA 1QSFA 3HC0A 3PL6B 1NGXB 4QRRB 2IH1B 1QP1A 3RVWC 1UB6B 2V5YA 1ZLUK 1F13A 2YPKA 4OUUB 4OM0H 1ZGLB 1UZ8B 4Y1AB 1X4YA 2BFVH 1K4DA 1KGCD 2B5IC 3VXRB 4WEBH 4KK9D 5CINL 5D72H 3MLRL 2IBBA 5BJTA 3BPNB 2FX7H 1QLRA 1I85C 4UUJB 4C56B 3KPRD 4WI2A 3U0TB 2LU3A 3SKNA 1FFPB 4FQPA 2C3VA 3DXAA 4KH2A 2Y07L 5IHUL 1FVEA 5C0AA 2CMRL 2WBJC 5JW5B 1MCEA 3RRQA 1OAXL 2X4RB 1I7UA 1T20A 1X5YA 1KJ3L 4G8IB 4O9HL 3PDOA 5E4EC 3P3YA 4L29A 1DTUA 5EIIA 3SE4C 4EDWL 1A3QA 1RURH 4LVNC 5FF6A 3P0VH 3U6RA 4QOKE 1JBJA 2P42B 3MRGB 3GMQA 2AEIT 2AKRA 2EE6A 2NMSA 3B5HA 3O9WB 2R69H 5CILH 3UTZA 1PY4A 1B6UA 4EI5D 4CVXB 4M8QA 5T1LB 2VLKD 2OJEA 3WBDA 1JP5A 4HJGB 1LP9E 1FBIH 4M7LT 4YPGB 1V3KA 3FQWB 3LN5B 3QIWA 1R3IH 4S1QH 3U0PA 3D69B 3FQTB 1HKLL 3GSWB 3LRSA 5GIRB 5IVZB 4Y5XA 1XGQB 3OJMB 4IJ3B 4P49A 2QL1A 3VGAB 2PR4H 3HB3D 1TZGL 3B9AA 3BRDA 5IFAL 5IOPA 4NQED 2BMKB 3WS6A 3U4EA 2P5EE 2X4QB 3RVUD 5MEQB 2PXYC 4AIZA 2BNRB 4Z0XB 1SJHB 2VYRE 6FABH 1CGXA 4BZYA 5A3IC 3VG0H 1HHIB 2X44D 3H9YA 4LLUA 5FYKH 1A6UL 1FC1A 4H1LG 4KROC 4XNYH 3CVHH 4Z78A 4XI5C 2V2XB 3QHTC 5CD3B 1CGSL 2BVPA 4UAOC 1DL7H 4N8VA 1KCSL 5CEZE 3JUYA 4S1SH 4YQXL 1XCQA 2XRAL 2A6IB 2Q8AL 4OLEA 4TSCL 1YN6B 3OB8A 3TNNB 3K2MC 1JZ4A 2MNUA 4XC3H 5E99H 4HKJA 1N6UA 3BSZH 4BZ1L 4W81A 5SWZA 5GSVB 2VDQL 1BMGA 1MIEL 3PG2A 4L5FL 5B38G 1RUPH 5I1KH 5MHSE 4ODWA 5AG8A 1ZHBB 2E9BA 3HZKA 4YLQT 2IBZY 1P7QA 1AQKH 4Y5VA 4OSUH 1QEWB 4NZUL 3IU3B 4X8JB 2FHFA 3QDMD 3AS3A 3KWWB 4JN2B 4OLUH 2Q7YB 2NY5H 1IC7L 4PJAA 1NUDA 1MHCB 2HJFB 5ANMA 4LVEA 3O3EA 4XCFL 1LILA 3ZKNC 4TRPL 4U6YA 5F7DB 3EBAA 5JPMA 2NTSP 2BHZA 1BX2A 1YQ2A 4PGCB 1INEL 3IJYB 3RPIB 4L4VD 1A6ZB 2XQYG 1U91B 4TUJB 5D1ZA 1MY5A 5TE6H 2K9UA 4UDUA 1NBYA 4PREA 2BNQD 4GRWF 2WWMC 3IKKA 4UNUA 1G7IB 3PL6C 2BSED 1B0GA 5GS0L 2DJ4A 4HGWA 3NFSH 3OAZK 3UTTA 2VXVH 4JHAH 3RWFA 1CK0L 4Y4HC 5KZCD 1U8NB 1UCBH 4IHOA 4LRNL 3G9AB 1EHLH 4D9RD 1AIFA 5HGDA 4NNPH 3MRBB 3MRPA 1G0XA 4JQVA 4L8DB 4LIQE 2BVEA 2BDNL 2IPUK 4QHKJ 1RZGB 2VXSL 3UJJL 1MHPL 1MVUA 4KPHH 5BXFB 3CFKA 1JF6A 4OIIL 2OYPA 5HHOB 5CS7A 2AQ3A 1MRFH 4OJFL 3KDMB 4LCCA 4UT7L 2FX8L 2ARJQ 4P5MB 3SY0A 4RQQA 4X99B 2UYLB 5DSCB 1UG9A 1FVDA 1WTGT 3EYOA 4BH8A 3MRRB 3BT2H 2AJXH 3C60B 5K33A 5JQ6L 5E9DD 4E42A 4GW4A 4K3EH 3I75B 5EA0H 5L9DH 3EO0A 3ULUD 5D70L 2F53D 3IXAB 2HAZA 1TNMA 5HHME 2ZSWB 4H8WC 1QLFB 3FRUA 1UM4H 4J3OC 5JNYA 5IVOA 2A1WL 3O2DL 3O9WC 5C08E 4MJ6B 3PWJA 4KY1L 3TT3H 4R26L 2X4UB 4XNMB 1MJJA 4GRLA 2IJ0C 2KBGA 1CDGA 3WFDL 5CBEB 2F74B 2W65A 4JY4A 3DVGA 4ODBD 3V7AG 4O2FA 1KT2B 2I07B 3JWDL 1ZVYA 3TBWA 3IAQA 3QEGH 2V6HA 1AR1C 5IV2A 4L1HA 4H26A 3NFNB 4IJ3C 3O2VL 3ZKXC 1FE8H 4RFEA 3C9NB 2D7OA 2H26B 1R3KA 3B9KD 1T7YA 3CXHJ 3MFGB 2APBA 5HYIA 3KPOA 3TBSB 2FJFA 2QJDA 4M3JA 1DDHA 3MX0A 1J8KA 5KANI 4Z95L 2PF6A 4UBDD 3BDXA 4H25A 5FOBA 3O4LA 5L7XL 3CD4A 4NNYA 4UV7L 3OR7A 1EFXB 3HG1B 4NKDB 2H2SD 5CEXB 5JW4Q 3R8BB 5JHDE 4JRXA 5EOQL 3A6BH 3IDYC 3HMWH 1Q72H 1FPTL 1MCLA 3MBEB 3BN9C 1FGNL 2ZG3A 2F8VA 4NWUH 1QFUL 1L9NA 5CGTA 3NZ8A 4UIMA 3TYGL 5EO1B 5E03A 1LEGB 5BQ7A 3KLDA 3RTQA 3IF1B 1JFQL 5MERB 1UYWL 4JJHA 2M8XA 2GJ6E 4PJGB 1HQ4A 3ROLA 3ZSSA 1NUFA 3QCUL 3DVIA 4NO0A 4GG6E 2DJUA 1KFAH 1LD9B 4L8CA 3HPLB 2YC1A 4K94L 1HH9B 3OG6B 4AYFA 4NYLB 3VD3A 1FL3B 4WUKL 1ZT7B 2UY6A 4RNRB 4S1DD 3LOWA 1J05A 3QEQA 2X9YA 5L2JB 1MCWW 2C1OB 2HJLA 1X5HA 1CFTB 2RFXA 3O45A 2FATH 3BEVB 1MCCA 5ICXB 4Z8FH 3I3BA 3IDUA 3SE9H 2UZXB 2V7NA 1BBDH 3D2UB 4WO4A 4JO1L 1I1YA 1QBMH 4LSVH 4OLVH 1CIDA 3C5ZB 1FC2D 2UVFA 4PB0L 4WWKA 2JB5L 2OTWA 2KL6A 4GRWE 3QIUB 5DZLA 1I1AC 2PYEE 5C0GB 3KPSE 2WINB 5D2LF 5FO7B 1VFOA 3GSUB 1U3HC 4IMKA 1R3LA 3P73A 4OLYH 5IBUG 4HIIA 4HIJB 3BP6B 4Q6IB 1PKQA 4K7FA 3VFWB 2F5BH 2DIBA 1JGVH 1DJSA 1JNHB 1HEZA 2R1WA 5KVFH 3L5HA 3Q5YA 5D7IE 5F89A 3FQNA 1GCFA 5A2KH 2FYYB 4JEGB 4XBEH 3VXRD 1NBZA 4P2YA 3IDJB 4U7KA 5GRVL 2R56L 2J8UA 3AGVA 2VXTH 3NCYS 5HDOA 4P59L 2EC8A 1NCBL 4OFYA 4AL8L 3D0VA 4QCIA 1G7LA 1QFWM 5E8NB 2X4TB 2D7TL 4GXVL 3C60C 5LWYL 1D5ZB 1PSKH 3MV8D 4N9GA 3TVMB 3QDME 5C3TA 3KYAA 2FEEI 5BS0E 1XGTA 1QUNA 1WFOA 2Z8WC 5DJ0B 4R8WL 3QUMH 1SYVB 4L4TB 4CGTA 4ETQA 1D6EA 1GOGA 1HSAA 1PYWB 1QFWL 1J0IA 4KZEL 2ZP0T 1XCTB 1J88A 5FYLD 3PP4L 4U1JB 2VL5A 3HC4H 4JZJB 1BF2A 1FYTA 1MNUH 1EJOH 4FP8L 5T1LD 2YBRA 1B4RA 1ERNA 5DLML 4LBEB 4HJ0D 4TQEL 1BQSA 1HNFA 2W38A 1UACL 1P5UA 1EO7A 3IDGB 3O2WL 1PG7X 3VFRA 3WIIH 3AB0B 1A4JB 1A7QH 3S98A 4JFDA 4R90H 1JI2A 5EC2B 2EZ0C 5IM7B 2A0LD 4XH2A 3KPTA 1FLRH 4K3DH 3TESA 2IGFL 4K8RC 5JO5B 4M7LL 4WY7L 1JWMA 1AO7D 1S8DB 4Y4FA 1NSNH 1UZ6E 3UROR 4D9RE 1KC5L 5DD6B 2E9IA 3S35L 1MFBH 3OKNA 2XG5A 1I9RH 4ACPA 1P4LA 3Q48A 2XN9D 4OLZH 1EGJH 1A47A 3PGCA 3UCRA 2Z91B 3IAPA 1KIQB 4XP4L 2EH8H 5I76B 3PIQB 4YDJA 3UPCA 3NZHH 1CBVL 1RJYA 5LG1A 1T1XB 5CJ8A 2F8OA 1FAIH 4PJBB 3RKDC 2X5PA 2PETA 2X6MA 2IG2H 1R5WA 2VAJA 4URTB 5EZJB 2E7CA 3J8F7 3U2SA 3VGBA 5F7HA 1AGDB 2BVUA 1S9YA 3BMVA 3GB7B 2DWDB 2VDMH 3LHPH 4FZEL 1LDPL 4YIQA 3VRLE 4WDIA 3SGEI 3NH7L 2KDGA 4RGMB 1MIML 3DI3B 3WFHB 1RMFL 2NY2C 1G9NC 3B3IA 4NIKB 2EDYA 4TN9A 3TZVD 4MD4A 2ORBH 1E6OH 1GGUA 2BY3A 5FUCE 2R23A 2P8LB 1T22A 3ZYOA 4U1LB 3FT4A 3T77B 1FJ1A 1VDGA 3G5ZB 3GNMH 1K5NB 1S7TB 4PJXE 5GGSA 2BRRL 5T3ZH 1R0AL 2DQDL 4FQXC 5D9SA 5C6WH 4GW1A 3C5ZC 3F5WA 3RZCA 1IAIH 2G75A 4I0PB 4F7PB 1EXUB 3OB0H 1YEFL 4Q74A 5DVMA 4R7NB 5ADPH 1U93B 4LMQI 3CLFH 1VEOA 5AWNH 1CFNA 2F5AH 2VZTA 1LNUA 5EO9A 1DVFA 2XWTB 3ALWA 2H32H 3WIHL 3THMH 4OB5H 4GQ9L 4Q6IC 4RFNB 3WNOA 3QO1A 4EIZC 2XFXB 3PWLB 3QZWB 4JZNB 4I8DA 1Q94B 1NGZA 1FG2A 3T65B 4X80L 5C08A 4YXKH 2GTWA 3R8QA 1MEXL 2NNAA 3SCMB 3VWJB 4KKAC 3TNMA 4NFCA 4MB4A 4Z7UF 4O2EA 4UILH 2EO1A 2VH5L 4JPIA 5I1EH 3MRMB 4GBXB 3TN0D 4CN1A 3V95A 1QSVA 3BKYH 8FABA 3C8DA 1XZ0B 2Z35B 3ARFC 2JTDA 4J8RB 4NQCB 4KK5D 4RAVA 4WI3A 2J6EL 1S78C 3TH2T 5DJAB 5L88L 3TIEA 3NA9H 5DMKA 4P2QB 1OM3L 1TIUA 5IJVB 3TVMC 3U46B 3M1BB 2E7BA 3MLYL 5M7QA 5DO2C 5DTFB 1E4WL 3B8SA 5JOPE 1IGMH 2E8ZA 4LSTH 1LO4L 4KDWA 4MZ2A 4WTWA 3GKWH 4NZRL 1Y0LB 4LSRH 1U8HA 5EOTB 2L4OA 1GZQB 3BPLC 3WLWC 4PJ7F 5D5MB 3TJHC 3OXSB 5GGRY 4OM1L 4XVTL 4JY6A 1KCVL 5DHVH 1KIPA 5BW7C 1JWSB 1QRNE 4G9FB 5C71A 2FL5B 4YNYB 1FZKA 2CQVA 2AABH 3QDAA 2ZZUT 4GJTB 3MXVH 3HAEB 4DGYL 5J06A 5MEOA 3SGDI 3FT3A 2YD7A 4PRIA 1D9KD 5KSBE 4M1DL 3LRGA 1MFAL 2F54A 3QFDB 2DQCH 1MH5A 3T08A 1DR9A 4M48H 2PKDA 3EJZC 5IMOA 4KRPC 4LVOB 1QR1A 4IS6A 4PJIE 2WIIA 2BOBA 4QRRE 1NC2A 3MLXL 4R0LB 1FNLA 4CW1B 1OL0A 1T2XA 4Z76A 2BVOA 3TO4B 2OQJA 4FQ2H 4NT6B 4N68A 1T04B 4NQXA 4APQB 1VERA 1VSCA 4Y1AE 5I1IL 4YFEA 3EO1A 4Y4KB 5B8CB 2ATPA 3MUHL 5E5RB 1SYSA 1EFXD 4FQ1L 1C16A 4C56E 1HHKB 1EIBA 3DMMC 3HFMH 2JB6A 3CFBA 3FOMB 2BC4A 1IAOA 2A6KA 2EKJA 5CSZA 5IGXL 3MRFB 2OZ4A 1NLDL 3BD5A 1YY9D 3MBED 1XF3B 3EYSH 2L7JA 4JFFD 3FQUB 4QTIL 5DJZB 4M9PA 4IDJH 1XIWA 4XP1H 5E8OB 3RP1A 3EUUA 4LPYA 5CJOH 5J6GA 1NAKL 3V8OA 3QJFB 1TJGL 4WW2A 3P4OA 3QXAA 3ZTNH 4OD2B 5FYLE 4R96B 2VITB 2IAND 3PHQA 4P46A 5E8PA 3OV6A 2XYCA 4K3HA 2Q7NA 2WLYA 3VCLA 4BFEA 3S7GA 3BN3B 4PUBH 3HRZA 1CVSC 1FNHA 1YY8A 4ODUA 5I1JL 3VFVB 1NANI 1JPTL 1MAJA 2AV7A 4X6BB 3U9UB 1CGUA 3QCVH 2XWJA 5FB8B 3L3GB 4YC2B 3WUWB 2HN7A 1XGPB 3MLZL 1I9JH 1TTGA 1YEEH 2VN4A 1CE6A 1U92A 4DGIL 4WI5A 1S3KL 3P0YL 4ODTL 4GG8A 3BW9B 2BNRE 5IBLD 2OJZH 5GS0D 4POZC 3QEHA 1EEZB 43C9A 5DR5L 5IW6A 2XKNA 2FO4A 4RFNC 1ZHKB 3JTTB 1ITBB 4WVRA 2DQHH 3UZVB 1LEKB 5FECB 5KBNC 4HUUA 1QFHA 3SDDA 5ITBL 3CFDB 2A77L 4JO4L 3C6LB 1A2YB 1G1YA 1XFPA 3AS0A 4ZAKB 1K9TA 3SCMC 3VWJC 35C8L 4G5ZL 1RZIA 5DURB 3CSYA 4HWBA 3IDMA 1J0YA 4JM4L 3LQZB 4Q6YA 2FD6H 5I8CA 4WTXA 3O3UN 4NJAL 4GBXC 4J2XA 2W59A 1UM5H 4PJEA 4HS6A 3UC0H 4NRYA 2VOTA 3RWHB 5JUEL 4OAWA 2MQCA 3ARWA 4PJGF 2GQHA 1ONQB 3L95B 2ESVB 4KUZL 3CAFA 3A67H 4ODXA 3SEPA 2J8HA 1J11A 5CHNB 4HT1L 1MQKH 4NCC2 3V0AC 4KVCH 1XEDA 5FDYA 1XF4B 1ZV5A 5ERWA 3WYRA 3WHXA 1MLCB 5E8EA 5C8JB 2DIAA 2H2PD 1DQLH 1MJ8H 2YKLL 5HY9A 3QUMA 4L4TD 5C0CA 1DQML 4HPYL 4MNQB 5DUMH 4J12A 1OAYL 3KXFB 4XPFH 1HH6A 1IEBA 3UDWA 3IFPB 5F9JA 4JJ5A 3SQOL 4OCMC 2OMNA 3S5LG 4EOWH 4BH7A 1W72H 5ECJE 3VXSD 1B0WA 4S1RH 3TBTA 3QJHB 2BY1A 4UB0H 5T33H 3HE7D 2VUYA 3DYPA 3T2NH 2WBJA 3S88L 4U1IB 5F7FA 3ARYA 2V17H 4ZQKB 3V4PL 2DKUA 4XMLH 4G6KH 4E0RB 1MUJA 1OAQH 4PIRF 5JXAL 1FSKB 3P4NB 2B39A 3HRPA 4KK9C 1YEHH 4R0LC 2ZG2A 3SE4A 2Y9RT 5D96C 3TO4C 2D0HA 4LK4A 1Q1JL 1KTLB 5I30H 1FN4A 4NO2B 4XC1L 1UB5A 4APQC 4XNQB 1NDMB 3EIFA 1CZ8L 2I24N 4P57B 5JQHC 3ORJA 2YSSA 1I8IB 3SJVD 2W9DH 3MJ9L 1YNKH 3OX8A 3DX9A 4C83A 2CLZB 4JDTH 5DFTA 4XTRC 2X70A 3P77A 1BQLH 1GGCH 3BIKA 3NGBB 3FRPG 1IBGL 4Q58C 3MUGB 2IADA 5HHOE 5DD5H 1VADA 3NIGF 5HYSB 4PTUA 1UA6H 4JR9H 1GZPA 1EGJA 4HG4K 1MJUL 4JFOB 1BAFH 4CRPA 4OLXL 1G7PB 5TPWL 3OAYH 1OWRM 1F58L 3FCTA 4G8FA 1QA9A 3ALPA 3T8XB 4LHUA 2IFGA 2YXMA 3EDKA 1E4XH 1FZOB 4IRSD 4PJ9A 3GMMA 3V6ZA 2HFFA 3DURA 1NFDA 3EZJB 2ICES 1KELL 5CLWA 4UTBH 2DD8L 2PO6B 5H37G 5I8OH 2C1PA 2FR4B 4GAYA 1A9EA 4ZDHB 1NPUA 1WZLA 3OKMB 1SM3L 1BQUA 1K4CA 3RKPA 5EZLB 5IQ9A 3JV4B 4ZUUB 4OZGB 4OKVB 4RDQG 4GW5B 5C2BL 5EU5B 2HTLC 5A2IH 4C54A 3CFEA 1QPPA 3HZYA 2R29L 4NPYB 4R2GB 4M43H 1BVZA 1TNNA 3QXDB 1D5IL 2R1XB 5GSRB 5DEFB 3I3DA 4I0PD 4Y2DC 3QXUA 2DM4A 4HUWA 5F9OL 2ZCHH 3MREB 5CUSH 4D8PA 3QCTH 3MLSL 1IQWH 2UZYB 3RDTC 3F12B 4OZIB 1CLZH 4AK1A 5EZOH 1DUZB 2UV3A 1G9NH 3FO9B 3P40A 4OZ4A 3CXDL 1XGYL 2H32A 1I8KA 4PJ8A 1PZUB 3IDXH 5C07A 4V2CB 4QRQA 4R7DA 2DDQH 5D7LB 2OS7A 3HG1E 1C08A 4LCWE 1NGYB 4HX1A 1CDIA 2AXFB 4K3JL 1BIIB 1ZAGA 3HTLX 4P23A 1NLBH 3MSPA 5E2JA 3OB0K 3DARA 4OTXL 2W60B 3T1FA 3BUYB 3N1FC 3RNKB 4JG0H 3NIDF 3R06B 1R5VA 2YD2A 5DMGC 5TDOB 3O41A 4U0RC 5JXED 3GSOB 1T0PB 2VDLH 2DLIA 3N0PB 4PJBF 1UM6H 3MLWH 3Q1SL 2A6JA 4JLRB 1OF2B 4EJ1C 1N5YH 4PJGE 4TSAH 5IHZB 4BA8A 4RDQF 4YBQC 1CIUA 3O3AB 2IAMC 3EDFA 3NABH 1CXKA 1NH6A 3H9ZA 4F3FB 1YUHB 5AUMB 4YAQB 2HVJA 5F1SA 4Y4HA 5KS9F 2YOCA 3GEWB 3QXVA 4ZO9A 5T3XH 1N59A 1T1YA 4PRBB 4YK4C 5GXBB 5F93C 5CGYD 25C8L 2ADGA 4EZMA 4X0KA 4HQQL 4MSWA 3S8WA 4OV5B 5H2BB 5ACLA 1B0RA 1QACA 5DHVA 3D87B 1Q0YH 2K7PA 5IB4A 3HPJA 4GT7A 2QLVB 4PJCB 5EU7C 5IFJA 2I5YL 4POUB 3EO9L 5IBTL 3V52H 5IVXB 1YYLL 2D03H 5D71H 3D85D 4ZS7H 5J6HB 1WFTA 2HWZL 1EPFA 4PGZA 1EHXA 1NDGA 1OVZA 3LKPB 3VXOB 5CIPB 4XPAL 3GK8H 2FHBA 3N1PC 4NO3A 3VFSB 3VMNA 4JO3L 4MB3A 5IMKA 3K3QA 2FLBT 2EYSB 4MNGB 4QY8B 3SDAB 5C0BB 4NKIL 3VFUA 1C8PA 2EYRB 3UYOD 4KQ3H 5HYFA 4PJFA 3NA4A 3QFJB 1KJ2L 4JZOB 1WZKA 5HVFB 4MCZB 1B4JH 2ZNXA 4HFUL 4B0MM 4Z7NF 4Y4KD 2Y23A 3KYMB 5IB1A 4PRAB 2BVYA 5EORL 3W11D 1G0YR 1MVFA 4NNXA 5HD8D 4KMLB 5HGAA 3NAAL 1E4KC 1KN4H 4JPVL 4ZOBA 3BKJL 1GPOL 3IJSA 5E6IA 3ULUC 2ICWA 2KKQA 4JPWL 1NEZA 3QUKA 2E27L 3QH3A 5GISL 4HFWA 5ALBH 3OPZH 2Z9TA 1OGAA 3WEXB 5I1LA 3P11H 2Q76A 5CD5D 4M4RA 4L4TE 3MV11 3OKLB 3E8UH 4YHPA 5CEZH 1WGOA 1JIBA 2AK4B 5D5MF 3QPXL 1CXLA 4PRDA 5DQ9B 1CGYA 4JANB 3HUJA 2YRZA 3P30H 5C0DA 3QR2A 3OKKA 1AC0A 5F3HB 2EH7L 3ZE0E 1F6AB 1FFOA 4XCEB 3W0WE 2BNUB 2OXHA 5KVGH 3SKJL 2DF3A 3FB6B 1YMMB 4LSUL 2DI9A 1F4WH 1X7QB 3VXUD 3C5JB 1S7UA 3FQRB 1U8PA 5LKNA 1I9IL 3JV5A 4N0RA 1HQRA 1KXQE 4MXWH 4RGOL 3GIVA 3MR9B 3TJEH 1G7JB 4P0DA 4ZXBD 2GEEA 3F7VB 1LQSR 1CLCA 1J0KA 4NQDB 1KTDA 4B53A 5ESVA 3REVB 5IKCB 4CUCA 1NCDL 1T1ZB 3SDXB 4JN1L 5CP3H 4GOSA 3MV7D 4MYWB 1PLGH 1YDPA 3ZKMD 4RGND 1W0VA 5HPOA 4UT9H 3EYQD 5INCB 5B39G 1CFSA 1T21B 5A2LH 1KLGB 4OCLC 5GRXG 1QO3B 4L3EA 3CU7A 3BPOC 1T3FB 4S0SD 1CF8L 1W0WA 1FVCA 1RZFL 4M5YL 3VXNB 4F80A 4O4YH 4OI9A 4LLQB 1KCUH 3C6LD 1HE7A 3LH2L 1UQSB 4ZAKD 3Q3GB 3QA3B 4PP2B 5DURD 4QHUA 4YJZL 4TUKH 5TJWK 1T0MA 3MROB 4N90E 1QNZH 2I9LA 4PJBE 4L9LA 5IT2L 5DK2B 3MFFA 2XKSA 1WZ1L 3S4SB 1RFDL 4KKLD 1I1AA 4S1DC 4F7CB 3UTPD 3IDNA 2ESVD 4RMTA 2DQIL 1U3HA 3SPVB 3A6CH 1FNFA 2CUIA 4OF3A 1MWAL 4UNTA 2NXYB 5DD3H 4MCYB 4WFGE 4YZFF 5CCKH 5DRZA 5TFSH 5AAMA 4LLDB 4XCNA 3U7WH 3VE0B 5DRNA 1NFKA 3O6FD 4DUXA 3TO2A 1SEBA 5TF0A 3DECA 4TPRH 4KZDL 3WE6B 3AFLA 4Y19D 4HWNA 3QXTA 3SDCB 1KCRH 2DBLH 4DFIA 4CL7A 3HC3L 2E7LC 3G04B 2NLJB 4QHLB 2CDGA 4LP5A 1OCWH 4JFEA 4FG6C 5JMRA 1BOGA 1CGTA 5DUBB 1W72A 4DGVL 1C5CH 3MUZ1 4XP6L 3O8XB 2C7UA 3BHBB 4CU6A 4ELMB 4P2RB 2FJHB 4PRHA 1G6RH 4LOUC 3GFUA 1YEKH 1SVZA 2XXMB 3SKMB 2O5XH 4QO1A 5LQBH 5DI8A 1AY1H 4KMTL 2GY5A 5DHYA 1MREL 2R0LH 2EXWD 2OR9H 3NCMA 1PZ5B 2DQFB 3OXRB 1M7DA 4PJDF 4D94A 1J1OH 4G7VL 2MKWA 1RUQL 2CJUH 1YEJL 4KTDL 4D3CL 3ARBA 4X6EB 2HT3C 2APXA 1C12B 2IPKB 3GHEH 1YEGL 4YO0A 1OD7A 4QHMA 4TVPH 5DVLA 3RIFF 2AP2A 3L3IA 1UJ3C 4JGMA 4NQCE 5K9QI 5FGBA 4A6YA 5EU4B 2XOTA 5HDQL 4P2QE 4ZO7A 4ONFH 1H9VA 3GMOA 1KB5L 4NQVB 1NGPL 1MQ8A 2CR3A 4ZOCA 5J3HC 3CCHB 3VWKB 2IPTL 4MJ2A 3TFKC 5D5ME 1FNEB 4G8GA 4ZNEA 1IEHA 4ONHB 4GXUN 1BFOA 1NCCL 1LEIA 2Y7QB 4FFYH 2F19H 3ARRA 4I0CC 1FL5A 1S7RA 4HIHA 4G9FE 2YD4A 2IQAA 4LCWA 3K8MA 4OQTH 4D9QD 2Z93A 4BM7A 3T3MF 3OAYK 2X09A 3HI1A 1UEMA 2IEPA 3NPSC 4NQTA 3KYKH 3BP4B 5IB2A 5CWSB 4F37F 5ICYB 3OJVC 5EBMB 4C4KO 3V5HA 5CJQH 1NC4B 1RULH 3BGFC 1UXWB 3OKYA 3GMPB 4TNVK 3U82B 4R2GD 2OP4H 4UIKH 2G9HB 3GUTA 4WHTB 2YPLA 4TUOA 2IBZX 2EE2A 2VLLA 5DGRA 5EPMA 3VDBA 4OZHB 4PLKD 3CZJA 3T0ED 1KPUA 1HHGA 1Y18A 3VU2A 3AM8C 4F2MB 3QQ4A 1F97A 1OTSD 4H1LH 1RZJC 1H5BC 1JUFB 2VR5A 2P8MA 3MRQA 1B2WH 5I19H 4OI7A 4XCCL 5HI3C 5A16A 1JPFB 4DZ8A 2AJSH 2AEQL 2HT4C 4K07A 2MJWA 4YR6A 4HMEA 2XZQL 2GY7B 2R39A 5IW1A 4RFOH 1AKJA 5I8EB 1K6QL 2EICA 4P3CH 5L6YH 4WU5B 2QR0B 3D3VA 3BDYL 4Z5RB 4LP4A 3C2AH 4ZUVA 5MI0C 1JGUH 4E41D 5MP6H 1IAII 1P84K 1BD2B 3F7YB 5FYJL 1P4BL 1MWAB 2DLFH 5GGUB 5KVEL 2E6PA 1I4FA 3E1F1 1D5XA 3LEXB 1S7VA 3IT8D 2WQRA 5BV7C 4LSSL 2C3WA 4HS3A 4DN3H 1U8OA 3IJHB 1U42A 2NXYC 2VDNH 5FYKU 5ILTL 4I4WB 1AGBA 5AYQA 1NUGA 5DC9B 4DEPC 4YZFE 1C7TA 4BKLA 3UXFA 2FGWH 5F71A 5IMLA 4ZSOB 2D0FA 5DD1H 4OZGF 1JWUB 1URLA 3P4LA 2XA8L 3CVIL 3L5WA 1JNNH 2HTKC 5J12C 1ZA3A 3RL2B 3QXWA 2VWEC 4F57H 3N06B 2EDBA 3QRFM 1HILB 3K74B 5FKPB 5TGBA 5DJCA 3ARFA 5DMIH 5CZKA 5E2TL 1BQHG 1ZHLB 1DCLA 1KENH 2JIXA 3NVQA 1CT8B 1YEIH 3GIZH 3CPLA 3VXMA 2GFBA 4IDLA 2DQTL 5D7JD 2OL3H 2VAAA 1IT9H 1JK8B 2Z92B 4WW1B 3UTSB 2G2RA 4YXHH 2M26A 4XBPA 4GKNA 2ZG1A 1JZ3A 3STLB 1ES0A 4AEHL 4WI4A 3PDGA 1A5FL 4MDJB 2W1NA 5KOVC 3TN0C 3S37X 1UJTA 4XZUB 5BW7A 3W0WA 1UWGL 1N0LA 3MZTA 1XT5A 4OD1H 3QNZA 2FNBA 4F7EA 3V0VB 1UCTA 2VDPH 1SMOA 2ZPKL 2AEPH 4XPTH 2W92A 2FEEL 3ZDYE 5FUOH 4OV6F 1KEMH 4F33A 3VH8B 4LVHB 3TT1L 2YS4A 3V5KA 2XTJB 3UTPE 2FGZA 1KB5B 3MCLL 2UWEA 5IUSA 1TTUA 1WBZA 3RGHA 2EKSB 1ZT1B 2O61B 3MLTA 3WHE0 3MACH 3GO1L 2A9ML 1T0NB 3L3DB 3VWKC 1YN7B 5I2IB 2CRMA 2JK5B 2VQUA 3VD9A 1QBLH 2AK4D 2QQKH 4MNQE 5FUZH 4DW2H 1A6VH 5GZND 3WFEL 4HWEH 3IETA 1JV5A 2GAZB 2KQMA 3KXFE 1A4KA 3T3ME 2BOCA 3BESR 1X5GA 2RCSH 3ARSA 1KV3A 2MTPA 3DMMA 4MA7L 1A6AB 3QUZB 5E2VL 5EU3A 4PJCF 3ULUH 2H9GA 3IGAA 2HVKA 4WEMB 2XQBL 5IVXF 5AD0B 2ADFH 4WUUA 5C7XL 3HMXH 3T1WA 4JG1H 1IC5H 2ICWI 2MKLC 4ZFFA 5F9WB 5C0RH 5TE7H 2B2XL 2RGSA 2CLVA 4PB9L 3FN3A 1BM3L 1OB1A 4Y88A 1VACA 5GGTH 4CVZB 5C9JA 2MCPL 5F8RC 3RUGA 5C09A 4OLWH 5LGJB 5CP3A 5E08L 4BQCA 4HD9A 4Q0XH 3OGOE 5FM4A 2Q8BH 2R8SL 4NQSB 3D25A 4LLWA 3W9DA 3U0WL 3LD8B 4EN3B 5F97E 2IMNA 3HNVL 1FRGH 4BUHA 1Z2KA 3NCJL 2WZPD 4FQHA 4C59B 4XVJH 4R97B 4Y5YA 2D31B 3MJGX 1VKXB 2RHEA 1F4HA 4MJ5A 3MNZB 4I9WD 2VZ1A 5DFVC 3GI8L 4XPGL 1I1RA 4XCYA 1LE9B 1OSZB 3Q6FB 3GSQA 3B9EA 3LB6D 5HHXH 4XXDB 3ZDXE 1AE6L 1MCIA 2FH8A 3V7AE 2A74B 5I73B 4GRMA 1NBVH 2EDQA 1V3JA 2EDOA 4P9HH 4FQLL 5IIEB 2FB4H 4U1SB 2W9EL 5JLZA 1YYMH 4JM2C 3BQUD 1I8MA 3MOAH 1PDKA 1VGKA 2NY3D 1N4XH 2E6QA 1U8KA 5KG9A 2R0WL 3LV3A 3OKDB 2ZOKA 1VEPA 5C86A 4D9QE 3O3DB 1M05A 1X44A 1IJ9A 1A7NH 1U6AH 4QXTB 1D5MA 3TCXA 2QQLL 2GITB 5TE4H 3BEWA 2VZSA 1H15A 3EJYD 2YUVA 5FKAA 4HMDA 5BMFH 1NAML 3HS0B 5D2NB 3TM6A 1U8IA 2JLLA 1LWRA 2ZCKH 4HBCL 1IGFH 3VXTB 4XAWH 1F5WA 5LCVH 2Z31B 4I0KA 5SWSB 1SJVA 4DZBA 4ALAH 3TV3L 5I1GL 3RL1B 4XNUH 3PV6A 3SDCD 4P2OB 3G5XB 4UV4L 1TCRA 2OSLB 5DWUL 3BZ4A 5E2UH 4I3RL 4KHTL 4QT5A 2DOCA 3O8XD 3DPBA 2Q6WA 5BRZA 4OZIE 5GGVL 4K7PL 4GH7B 1Q0XH 1G6RA 3TBYA 4R4FL 1ITCA 3GSNA 5EOCL 3CX5J 1UWEL 2FJGA 5D7LE 5DXWA 5FM8A 1MELA 3QUYB 2X7LA 3F58L 3L3HA 2AJ3A 1SBSH 5EU6B 2EDKA 1LO3L 3CIQA 1KJVB 1JN6B 1N5AB 1QSFB 3HC0B 4JHWH 2F15A 2EE3A 2J3SA 2A73A 4PBXA 4R4BA 4G6ML 3PQYA 4HKXA 5HVHB 1FNSH 2YPKB 4MWFA 1ZANH 3PWPA 7FABL 4LVHC 2CK0L 3V4UL 1K4DB 2EDWA 5KJRL 2XTJC 2E7HA 3T3PF 1CYGA 5BJTB 1QHPA 4PR5A 1GC1L 1QLRB 1IC4L 2B1AH 3G6JA 1EAPA 4G42A 4YDKL 2IFFH 4HIEA 4I18A 5F9DC 3SKNB 2C3VB 3DXAB 2YPVL 1EX0A 4N0YH 1FVEB 5C0AB 4KTEL 4XHJC 3N1GC 3EAKA 4ZUTA 4XWOC 3KPRA 3ROOA 2NCMA 3PNWA 4J1UA 2B0SL 1WIUA 3N85H 1CGWA 1I7UB 4EUPG 3FN0H 1T20B 2ED7A 1Z6JT 1WCQA 2XY1A 1FO0A 3PDOB 5FCUL 4L29B 5EIIB 5FF6B 3QUZC 3U6RB 5INDA 4PJCE 4U1NA 2NY4B 1HKFA 3GMQB 2L7UA 2D4DA 3S34L 5IVXE 3LCYA 5JR1H 3MPCA 2AKRB 3K4DA 3UTZB 2OK0H 3G6AA 1JGDA 1I75A 4HULB 4CMHC 4M8QB 3D39A 2OJEB 2YA0A 2FBJH 3K1DA 3VD4A 5FYLH 1CLYH 3EOTL 4M7ZB 3QIWB 3U0PB 3T0XA 3MOBH 4EI5A 3PP3H 4KAQL 4UT6L 3MRHA 3LRSB 5C0BE 3X3FL 4YWGL 3EOYG 4LEXH 2GI7A 4Y5XB 4JDZA 1S5IL 1KPVA 4PD4K 2GYSA 5D8JL 2J12B 1CCZA 3QFJE 1E4XI 1MFEH 3CFJA 4NGHH 1INQA 3LD8C 3SOBL 3UTOA 4F9PC 5IOPB 3BVNA 2VABA 3U4EB 1JNLH 4R97C 4KKCD 4FN0A 4AIZB 2ED8A 4H1LA 1UGNA 3G5YA 2MCG1 3VW3L 4U6XB 5F96H 4UQ2A 1FNAA 1RHHA 1DLFL 4LLUB 4NQEA 1S7XB 3FFDA 4AEFA 4S11A 1J0JA 1H3XA 3P9LA 4IRSC 3CK0L 4Z78B 1T5WA 3BP7A 3LEYL 2H6PA 4H0HB 2BVPB 4MA1B 3HLAA 5BZDA 4N8VB 1D7FA 1T7VA 1KEGH 2P49B 3F65A 4Y2DA 3RVXD 1XCQB 3IYLW 4P9ML 3UJTL 4P4RA 4QRUA 4RMSA 3S3JA 3RDTA 4HKJB 5B4MC 1QLEL 1IFHL 5B38A 4P2CG 1MF2H 1OP5H 3CLEL 5SV4A 4HF5H 2X4SA 5IQ7L 1C5BL 4ODWB 1YMME 1FZJA 3PGFH 3HZKB 2ZWLT 1P7QB 4Y5VB 1PY9A 1MCPL 5KW9H 4ZO8A 5IG7A 5IEHA 1U36A 3BD3A 4D9LL 4TNWF 4PJAB 4NQDE 1EH9A 3IKCA 1WZMA 5ANMB 1AI1H 1OSPH 2VMFA 3VA6A 1O0VA 2R15A 3PDDA 3O3EB 4NM8L 2NXZB 3DUSA 2YRPA 3SDXE 3ZYZA 5IFHH 4MJIA 2ARJA 4X4ME 5JPMB 3PJSA 1BX2B 2WNGA 1Q38A 2IAMA 15C8H 2O5ZH 1CXHA 4G8EA 1A7PH 4ZG1A 1DBML 2DN7A 1ND0A 3MNWA 5D1ZB 3V0WL 5JHLH 1D6VH 1HYSC 1S7QA 1CFQA 2Y6SD 4UDUB 4GAFB 1T5XA 1NBYB 3UTSD 4PREB 3QUYC 3STBA 4S2SA 1IM9A 4YHNA 2BZDA 2HRPH 4KI5C 1I3GL 4L4VA 4Q9RL 3MLUH 2NZ9D 3O3BA 2VXUH 4L8SA 3PHOA 2EDJA 2VLJD 1B0GB 4XPBL 1HHHA 4HGWB 2XQYK 1V7NH 3L5IA 4KVNL 3KPQB 4PTTA 4RMRA 1KCLA 2AJVL 3UTTB 2NPLX 5HVHC 1W8NA 1A21A 2NY7L 1RK1A 4U33A 3T4YA 4GMTL 4IHOB 5J11B 3ZHDA 5GHWL 3SE8L 1AIFB 5HGDB 1E6JL 3MRPB 1W2KT 3KPNA 5CINH 2OTUA 2LU7A 1RIHL 2YD8A 3MLRH 2ARWA 1MVUB 3N1QC 3G9VA 1B90A 5KOMC 2BJML 4X9GA 1NMCB 5C6TL 4LCCB 3SY0B 4RQQB 2YK1L 5IHUH 2Y07H 5HYJD 5LXGL 4NZTH 1FVDB 1H0DA 2FX7L 3EYOB 5F1NA 4BH8B 2BXYA 3QPQC 5K9JL 3ULVC 4E42B 4GW4B 1OAXH 4DTGL 1ZT4A 3HR5A 4TTDD 3EO0B 1KJ3H 2EDRA 4M6ML 5E94A 2VWEE 1GGBH 5E9DA 1R3HB 4H88H 3FRUB 5DJYA 4U7MA 5JNYB 1XGRA 1HCFX 1E4KA 3PWJB 4S10A 3LY6A 2B7DT 1MJJB 4GRLB 1RURL 4ELME 4P2RE 5CZVL 4JY4B 2W65B 3DVGB 4M7ZC 1HHJA 4O2FB 3TBWB 2C3XA 3IFLL 5IV2B 2VB5A 4H26B 1NKOA 2EIZB 5GGTA 1ADQH 1HKLH 3SE3A 3ZE2F 5JMOC 4YDVA 3WKML 4RFEB 3W11C 3BJLA 1RZKC 1R3IL 1FGVH 1R3KB 3WS6C 4IIQC 1T1WA 1TZGH 5IFAH 3MGTA 4FNLH 4NCC1 2VN7A 3KPOB 4EN3D 2FJFB 2YEZA 2YUZA 5I66A 4NWTL 5F7UA 5J1AB 4HKZA 1DDHB 2ZNWA 4WI8A 5K59F 4RZCA 4H25B 5FOBB 1A6UH 3O4LB 4NNYB 4MA1C 3OR7B 1WAAA 4P3DA 2YWYA 1CGSH 1S7WA 3KR3H 5D2LA 4PBWD 1KCSH 4JRXB 4YQXH 4AMKH 4XVSL 1ETZA 1K85A 2Q8AH 1N64L 1KTRL 4LASL 3NZ8B 4UIMB 3H7LA 1DE4A 5BQ7B 4LNRA 3MA7A 3RTQB 4BZ1H 1CR9L 2W0KA 3ISWA 2VDQH 4W4OA 4U2ZA 1HQ4B 3ROLB 4ZXBC 1KTKE 1MIEH 1D5BA 3R1GL 2Q3AA 4L5FH 4NO0B 4OFPA 4XC3L 4Y5VC 3RI5K 4HUNB 4ONGH 1WITA 2A9NL 4L8CB 4OCWH 2YC1B 5MENA 5E2WH 2G5BA 4KK8C 3BZEA 2ENSA 4NZUH 1TQBB 5FM5O 4KJPD 1BECA 1RUPL 1KIUA 2HLFC 1LK2A 2Z31D 4R4NC 1J05B 4J6RL 5KAQF 1IC7H 3QEQB 2NXZC 5IROA 5L2KD 2HJLB 3OGCA 4QRPA 4XCFH 2RFXB 3O45B 3CFIC 5EUOF 3T2OA 4OLUL 1MRDL 2NY5L 2V7NB 4WO4B 4OZHE 2E9WA 5IVNA 1I1YB 2XWBA 2AXJA 3QO0B 4M62H 1U58A 2BX5A 1INEH 1J12A 5GZOD 4YHYB 3LKSA 4WWKB 2OTWB 4WRLA 4DKFL 2R2EA 5JPNA 1A6WL 3NCYP 3REWA 3AVEA 5LVEA 3RGVD 2DQJL 4MLSA 3X14A 1NQBA 1R3LB 3P73B 5GS0H 4HIIB 2ICEA 1PKQB 4K7FB 1LE5A 5J11C 2R1WB 1EHNA 4YXLL 4G3YH 5F89B 4JQVC 1BPVA 3FQNB 1KF9B 1J1XL 1BD2E 5D1XD 4LPVA 2EEDA 1CXFA 4JHAL 4Z7OF 1UH4A 1NBZB 1Q9LA 4XNZC 2VXSH 4RWYH 3UJJH 1MHPH 3O6FC 4OIIH 2J8UB 4LCCC 1PEWA 4BYHA 4OJFH 5IHBA 2FX8H 3D0VB 5ENWA 4QCIB 1G7LB 1P6AB 4KPHL 1BFSA 1IZJA 4I3SL 4ENEC 5C0AD 4LSDA 3ET9F 4ZSOE 4N9GB 4HUMB 2QQNH 2FECI 4FQCL 1Y6KR 3VJ6A 5JQ6H 1XGTB 3H3PH 4PRPD 1N0XH 3OAUH 4O51A 4U1HA 4ETQB 1D6EB 1P5VA 5D70H 3MV8A 4UOW1 3MTRA 2AJXL 2DB8A 1HSAB 2A83A 4K3EL 1F00I 3QWOA 1UJ3A 4NN7C 2NY4D 3O2DH 2VL5B 4KY1H 1KUMA 4R26H 4C58B 4ZFOA 3J7HA 1FYTB 2KZWA 2EXWC 1KB9J 1EV2E 2YBRB 3HR6A 2MMXA 2JCCA 3JWDH 4FFZL 1PQZA 3C09B 1NUNB 1QPXA 3QIWD 1EDQA 3VFRB 3ZE2E 3L3JA 3TPKA 2ZSVA 4JFDB 4KU1A 5F7WC 3O2VH 3S36L 1QSED 2K3TA 3H42L 1HXMA 1ZSDA 4PJHA 4XH2B 2AQ1A 4HDIA 4LKXB 3HNSL 1JWMB 1INDL 4Y4FB 3VFMA 1K8DB 2QSQA 4YX2H 3SHSA 2XV6B 3OKNB 1JHKH 4Z95H 2XTJE 1CQYA 3PP3K 1AO7A 1P4LB 1YPZF 5L7XH 1CICC 2PTTA 3O11A 2HKHL 3PGCB 4X4MA 3OBAA 5EOQH 3HZMA 2DYPD 1FPTH 2XN9A 5IK3A 1RJYB 2IALA 1I8LA 2OZ4L 3RTQC 3VI3F 2FWOA 5ALCH 3AM8A 5JA8B 3A6BL 4KJWD 4FFVD 4LPWA 1R5WB 1JFQH 3MZGB 1UYWH 4NWUL 1H5BA 4O2CA 5H37H 4Z7UA 3U2SB 3QCUH 3DJ9A 1XR8A 2UUDH 1S9YB 5H94A 1P7QD 2OMBA 4YIQB 5A2JH 4WDIB 5DUPH 2V5TA 4K94H 4IMLA 4XX1G 3B3IB 3DTXA 4OCRH 4WUKH 4MD4B 4MVBD 3PE9A 5M95B 1KFAL 3T0EC 3OKEA 2R23B 4NSKA 4OGXH 1T22B 1OP5K 3FT4B 4FZ8L 2QADB 1FJ1B 3NPZB 4FQJL 4O5LH 3WNLA 3TZVA 5GGSB 3TF7C 5D1QC 4WO4C 2P8PA 5AZ2H 5I74B 4PJ7A 1WQVT 5CLTA 5D9SB 4GW1B 4XMKH 1DQDL 3F5WB 3RZCB 2G75B 1WC7A 4JO1H 1T4KA 4UU9A 3PF2A 4YHYC 4WWKC 4Z8FL 2VR9A 5D1ZD 1M4KA 2Z4QA 3SE9L 1G7HA 1SY6H 5IWLC 1CFNB 4JHBA 3KVQA 4WCYL 3ZTJG 4KTYA 1LNUB 5EO9B 1DVFB 2HH0L 4IMKC 3MLPA 1GVIA 2K7QA 1U8QA 5C6PB 2NY0C 2X2YA 1YJDL 3W39A 4K2UL 1L6ZA 3QO1B 3T4AA 5LGHL 2HFEA 2WBKA 5HHMB 4JKMA 4X6CF 5FYJE 1NGZB 1FG2B 5C08B 3L3KA 2FEDC 1WCBA 2GTWB 4K55A 5GRJL 5DK3A 2NNAB 4LGSB 4ZS6D 4ZFZA 4QWWC 3H9SD 4UINL 2N4IA 3TNMB 3UZQA 3H0TB 2C4FT 4O2EB 3NBNA 4JPIB 1CDJA 4HWBL 2R56H 8FABB 4XAKD 4P59H 2EYTA 3EJJX 5HSFA 1AQDA 4RAVB 3FHAA 3TIEB 4AY0A 3TN0A 5DMKB 2D7TH 5LWYH 3I6KA 1AGEA 5D2NE 5SWSE 3AREC 3SGJA 2FDBP 3IRZA 4GLRH 1U8HB 3KGRA 4R8WH 5FO8A 5KN5A 1V7ML 3V6OC 4PJAF 4D0BA 2NYYD 4P48A 5FGSA 5JW4N 1A0QL 2EDEA 4ZTOL 4JY6B 1KIPB 1QFWH 4F8QA 4N8CH 4WTZG 4KZEH 3O4OC 2OX5A 2VZ3A 3LS5H 4HZLA 4N0FA 1NCAL 3PP4H 1FZKB 2JELH 2R4SH 2B1HL 2X4OA 5JHDB 4GRLD 1ZVHA 4WFEE 4FP8H 5MEOB 3FT3B 1CN4A 5DLMH 4PRIB 1LHZA 3EYFA 3WCYA 3HC4L 4I3GA 3HAEH 2F54B 1UACH 1VEMA 3O2WH 1MH5B 5EU6E 1F3DH 4JB9L 4HHAA 1ADQA 5IMOB 1QR1B 2G5RA 2XG4A 4IS6B 1QSFE 3QDJE 1D9KA 1T2JA 2WIIB 2BOBB 1NC2B 1V3LA 1JGLL 5D7SH 1A7QL 4Z76B 2IGFH 1FDLL 4M7LH 5B22A 4R90L 2BVOB 2HT2D 2OQJB 3P0GB 4WY7H 1S9WA 2I60H 4NQXB 1U8LA 3EO1B 1T7WA 4K3DL 2ATPB 2ZUYA 4WHYG 4R9HA 5H35A 5TQ2H 1DQTA 1SMAA 1SYSB 3O4LD 1CLOH 3DHJA 3NTCL 1NSNL 1C16B 2GK0A 5DDHA 2JB6B 3CFBB 3MODH 2BC4B 1IAOB 2A6KB 5CSZB 1MFBL 4NN5C 5E1AA 2P24A 3FL7A 3WFBL 3L5XH 3DXAE 1P6FA 5C0AE 4XP4H 2QSCL 2CK2A 3RWGA 3N1MC 4JY5L 3VI3E 1CBVH 3BIAX 1EGJL 2R0KH 4GXUM 2EDFA 1J8HD 3OJDB 3ULVE 3MRDA 2UZIL 1XIWB 1NMBL 4P4KD 1WK0A 1M6OB 5J6GB 1JHTA 4OFVA 1RUAL 4JFFA 4NUGL 4WW2B 1G1CA 2PW1A 4DCQA 1FAIL 5EO1A 3P4OB 3ZDZE 3QXAB 1M71A 4FZEH 1LDPH 2V2WA 3PHQB 4P46B 3NH7H 5F70A 5E8PB 1MIMH 2AI0H 5JZ7D 4M5ZL 3W9EA 5B3JE 3VCLB 2IANA 3HRZB 4JM2A 1YY8B 3EYUL 4ODUB 1X6LA 4FOMA 1T89A 3S97C 5CGMA 1I1FA 2AV7B 1SEQH 2XWJB 2ORBL 1E6OL 2BRRH 3H6JA 1B9ZA 4MGXA 4KGLA 4MD0A 2HN7B 2W91A 1AD0A 2DQDH 1PFCA 1IVLA 3MRJA 1Q9OA 2F9BT 1CE6B 3JTSA 1U92B 2C1OA 1YZZA 3GNML 4ZFGL 1YEFH 3EOBA 4KWUA 4XWGL 5DQJA 3B6SA 5HHPA 1SBBA 2N7AA 4GG8B 1DVFC 4X98A 5GGQL 4PFEA 1K3ZA 4N5ED 2DL2A 2V5RA 3QEHB 1OP3H 43C9B 3DLQR 2XKNB 5IW6B 1T7ZA 3BQUC 4G43A 4GQ9H 4HUUB 4QXGL 3EDDA 2NY3C 3CLFL 5AWNL 3SDDB 4XPHL 4PG9A 5C0GA 4QRTA 4QOKD 4OCYH 3GSVA 1RZIB 1YECL 1K8IA 3CSYB 1MEXH 2X4NA