3ARGD

Ternary crystal structure of the mouse nkt tcr-cd1d-alpha-glucosylceramide(c20:2)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
241
structure length
236
Chain Sequence
b'AVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDAEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title A molecular basis for the exquisite CD1d-restricted antigen specificity and functional responses of natural killer T cells
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 48
structure length 236
sequence length 241
ec nomenclature
pdb deposition date 2010-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3argD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3argD02
4ODWB 5KVFH 5KJRL 3U1SL 1O0VA 1OT1A 5IB2A 4JY5L 5ETUB 2A0LD 3HR6A 1EHNA 2VN7A 4F58L 3EGSB 3T04D 2ICCA 2AK4A 5E2VH 3QDGD 1B0RA 3H8NA 1PG7H 2EE2A 3QEHB 3QRGH 5HGGS 5IVXF 1A14H 1F11B 1GH7A 3C87A 4NQCA 3MV01 5F7KC 5DDHA 5C0AA 5EG6C 4P2RD 1HDMA 2VDQL 3ZE0F 3UTTD 4ETQA 2YRZA 2ICWJ 3G04B 3LN4A 1ONQA 1XCTB 3QXAA 3TA3C 3X13A 3SO3B 3DOSA 5TQ2L 1U3HC 4XCNA 4JG1H 3G5ZA 3O4LA 4ZFOL 4YPJA 2Y7QA 4PUBL 4GBXB 4JRYB 5T3ZH 2J7LA 3QQ4B 2R4SH 4XNQB 5DD3H 4DAGL 4GKOA 3LPFA 3LKPA 5E99L 3QXDB 5ADPH 1NCBL 4AEIH 4X4MA 2D2OA 2Y36H 2QHRH 2FD6H 4OD3H 5J57B 3OAUH 2PO6A 2FDBP 4M9PA 3VFRA 1R0AH 1BREA 3PABB 1AC0A 1BIIA 1CF8H 3O6LL 5KJRH 1FFPB 4NSKB 4RGND 1YZZA 3ILPA 4JY5H 3ARRA 4F58H 5D9SA 1T5XB 2CDGA 4J4PC 3RNQA 2LE9A 3WS6A 3DSFL 4G9DB 4U2YA 4K94C 4ORGB 1WC7A 5HI4C 4F9PA 3LZFL 4Z5RA 4PJGB 4N8PA 1KCSL 2ORBL 2XWJB 2Y5TB 5A3IC 2CUMA 5GISH 3EJJX 5J3HD 3WE6B 3VI3F 2VDQH 1R5IB 3PL6C 5KVDL 3QG6B 3PV6A 1IE5A 1I3VA 1BMGA 2B4CL 3SJVD 4FQ1L 4NQCE 1SBSL 2CSPA 2QSQA 1A47A 3OB0H 4R96A 5DQJA 5C0AE 1RZJC 4IEFB 2HYMA 2DWEB 3N85L 5EIQA 1AHWA 4D0CA 5DJYA 2EEAA 3VFVB 1UYWH 2PTVA 4DAGH 1VFBB 3W39A 4PLJD 4U3HA 1YEGH 4XCYB 5E99H 1FO0L 2EKSA 4TQEH 2WWKT 1NCBH 4Y89A 3BZFA 3JVGC 4JGJA 4X98A 43C9A 2ZOKB 5M94B 1U8MA 5IEKB 3T1FB 5I6XB 3O6LH 1FZMB 4IRSA 2NY2D 5I18L 3NABL 3RDTD 5IESL 4O2CB 2BOBB 3MRBB 1FZOB 4UTBL 1KELH 5FKAA 3DSFH 4JZOA 4MDJA 5MI0B 1S9WB 5GRUL 3QO1B 5DMGD 4DK6A 1RK0B 4NM4L 2MHAB 4R7DB 3HI1B 5L9DH 1NMBL 3LZFH 2ORBH 4UMGA 1EZVX 3MRNB 1AXTL 5DD0L 3CC5A 4PY8I 4WFFD 5KVDH 1HH9A 4Z0BH 2XICA 1SVZA 4FQ1H 3TYGL 4DVBA 3EYSL 4Q58C 3VU2A 1ZLWK 1D5XB 3QIWC 4GG6E 3N85H 4FQXD 4FTVD 1DR9A 3CDYA 2CR6A 5F96L 1DVFD 5J6GA 2OZ4H 5IQ9A 5ACLA 1FO0H 1ZE3C 4OZGF 5CLWA 1RJZA 2ESVA 3DMMC 5EUKA 4P4KD 4QRQB 3MNVB 3GSNL 5IROC 4PJHB 1KCVL 4TUJA 3TA3B 2YXFA 3FQXA 3C6SA 2Y5EA 4M3KB 5FECA 3NBNA 5D4QA 1U3HB 1BD2D 2YPKB 4WO4A 3GZKA 5IESH 4PTTA 1KSRA 3UJJL 3CD4A 4Q9QL 3BKJL 2BSSB 4M6MH 4OZHE 3LV3B 4WUUD 2OTUB 4OLWL 1JZ8A 4PRAA 3D85A 3DVNA 4XAKD 5IJKC 5GRUH 2GCYB 2EH7L 1A4JA 1QQDB 3DX7B 4P3DB 2P5ED 1FVDB 1NMBH 1MFEH 2V7HB 5A40E 2HT4C 2MJWA 1AXTH 2ITCA 5DD0H 2ZCHL 5KSVA 4PJCB 1MNUL 3S9DB 4JFQB 3RU8H 3TYGH 2HMIC 3C09B 4YEEA 4BZ1L 3EYSH 1N0XH 4JFDB 2OM5A 2EYSA 3M8OL 3UZQA 3P4MA 4D0BA 3S96B 4ZNEA 2IF7A 3RIAK 4WTZG 5ESQA 5ESAB 2R15A 5F96H 3VFPB 5E8DL 4X9BA 1Q9WA 3MCLL 2NXYD 5JXAL 3GSNH 1KCVH 4IMKC 4NUJA 2P8PA 3SE9H 3WNNA 4QHLA 3ARGD 1AHWC 4Y4KD 5F44A 2B1AL 3MRFB 4U1IB 4XCFL 5C09A 4TVPD 1EBPA 4XVSL 1YEKL 3BKJH 2DWDB 1TNNA 1B4JL 3GGWB 2JLLA 3LKRA 4OLWH 1X5AA 4F7EB 5D96C 1KB9J 4WI6A 4Z76A 2VLJB 5HVGB 3CLEL 3MV8A 1DFBH 5EO1B 2LU4A 2VDNL 3UYRL 5K9OA 1ZGLP 3KPTA 3RTQA 5ICZB 3K2MC 2ZG1A 1IM3B 2BXYA 4IRSC 4MZ3A 4OM0L 1I1AD 4Y19D 1MI5A 4HIXL 3DX9B 5E6ZA 3MRPB 3CFIC 4HS3B 4U33A 2ZCHH 3MRRA 4Z6AT 4U1HB 1A22B 2H9GB 5BVPL 5I1AA 1XAUA 3EHBD 2M26A 3I3DA 4JLRB 1J10A 4BZ1H 3OJVC 5A2KH 4LCWA 3O3BA 3M8OH 3O41B 3GSWA 4GOSA 3QNYB 5D2LA 3RNKA 5LKNA 4MB4A 1D6EA 4UUJA 4OFYA 2WUBL 5SWZD 1UZ8B 5LGJA 4QOKD 1VA9A 4X6BA 3V79C 3HZVB 3KYNA 4P5MA 5E8DH 5LWYL 1YY8B 1N64L 3GSRB 2D7OA 3MCLH 3WIFB 1MLBA 4H88H 5JXAH 1NC4D 1CGXA 3T3MF 5BVJA 4WDIA 4IJ3C 1X5JA 4FFWC 4QCIB 3JV6A 2LV4A 5L2KD 1EGJA 4YDLC 3KS0H 4XCFH 5C0IA 2GQHA 3AS3A 3QIWB 5JOEA 2ARJA 4XVSH 4NQCB 5DUPL 3IXTB 4FQLL 3MJ9A 1B4JH 4YDJA 3C8KA 1FFQA 3O2VL 4OF7A 1T7ZA 3C2AH 3OV6A 3MMEB 1A4KB 3SCMC 1XGPB 1IGYB 3CLEH 1A7QL 2VDNH 3ARBA 4LPWA 2DL9A 3QXAB 4UDUB 5C09E 3SOBL 3MRCB 3UYRH 4J1UB 5JQ6L 3DMMB 3SE4C 1FVCA 5BJTB 5TE7L 5HDOA 4OM0H 3K46A 1C12B 1P4BL 2X6MA 5H35B 5JUEH 1FL3A 3MV8E 3UTSA 2BVOB 3M07A 4X5XA 1NGPH 3S6CA 1SVCP 3PWNB 3GIZH 1NEUA 1MI5E 5C07A 5LAXA 2GK2A 3QUZD 2QEJA 4U1GC 3ABZA 5F97E 5HDQH 5HGAB 2Q6WB 3H3KA 3QI9A 4LSPL 5LWYH 4LCWE 1BVZA 1N64H 4KFZC 2YD9A 5D2LE 4L8BA 4GKNA 4ZO9A 2NX5D 1MHEA 3BXNB 2XKNB 4XPHL 2V9QA 3GJFB 4EOWL 5HDLA 3MYJB 3CZJA 1GGYA 1QR4A 1NFIB 5DSCA 4H0IA 3I3BA 5DLML 3DGGA 3L5JA 2PETA 3Q5TA 4FQLH 4HPOL 2BC4B 3IKCA 5JDSB 2ZSVA 1JF6A 1UENA 4GG6B 3OKKB 1A7QH 2R29L 4F9LC 5TE7H 1NAKH 2PF6A 4ZQKA 2BDNL 1MEXH 2DKUA 4UBDD 5IMLA 1P4BH 3I6KA 5H8DA 1UB6A 1CZ8L 4K94H 4Y2DB 3L95B 4CMMA 3BX7C 4P23A 4YR6B 5E0QA 4NQTA 4WW2F 3W39B 2WK2A 4QGYA 1RULH 4PRPE 5I17B 5D96B 4NUGH 4NNXA 3EAKA 2W07A 3RTQC 3IGAB 3OKDA 4R4BB 4OZHB 5IVOA 3P9MB 1V3LA 3HC0A 4GQPH 3OPZL 4PG9B 3D3VA 5C07E 3QIBC 4IRSB 4KDWA 4KK5C 5HHQA 2IPTL 1OGTA 3MV9D 2P24A 3BJ91 4O58L 3TJHD 3FO1A 4U1LA 4U6VH 4JRXB 4HULB 3ARQA 3V5KB 4EOWH 3VW3L 3DSNA 4UDTB 1JGEA 2ID5A 1E6JL 1VFUA 1N0LA 2HT3C 2VERN 3HPLB 4TOYL 4X7CC 5DLMH 1CU4H 5EUOF 3L3KA 2CUHA 3ZKMC 4HPOH 3VGAC 2RR3A 1AXSA 2XZAL 3DRQA 3ECBA 2H2SD 3W5NA 3AC0A 1MCDA 3EDKA 2R29H 4IJ3B 4OZ4A 1JGDA 2BDNH 1DSFL 3EFFA 3Q6FB 1CZ8H 3RVVD 3BD3A 2Q3ZA 1QSVA 3PF2A 3BYYA 4HMEA 4YDLB 4XP4H 4ENED 3VG9C 4OV6F 3O9WC 3H3BC 1WCQA 4OUUA 3ARBC 4ZS6C 2EEDA 5EC1B 2DICA 5FCUH 4L9LC 3C5ZA 4GMTL 3SCMB 3HZMB 2VAJA 4X99A 4HKXA 1XGQA 2X4OA 2EDXA 5F9AC 3RL2A 3OKLB 4TUJB 4Y1AE 3HZYA 2EXYC 1F90H 5F3HA 1K8IA 3IFOB 2IPTH 1C5DB 4O58H 1FL5A 5EN2B 5EOTB 5CIPA 1TNMA 1Z3GH 3KHOA 3VW3H 1IEAA 3D3VE 4U1NB 2V5RA 3ZDYF 3TVMD 1FSKC 2OCFD 5IJVB 4TOYH 4PG2C 1E27B 1YJDC 3UAJC 3VI4E 3DUSB 1YEEL 2DBLH 1OQXA 5IR1B 4HC1L 3ZZ1A 1IJ9A 5I8CA 2XZAH 3NIGE 1JF1A 4IHOA 2PW2A 4OGAD 3N0PB 2IMNA 5JMRA 1S7WB 2EYSB 4I9WE 1KJ3L 1DSFH 1QPPA 3IS1X 4RNRB 3NVQA 1K6QL 3QIUC 1RY7B 4P57A 5F6HJ 3HRZA 1ACYL 1X4YA 1JMZA 3ARXA 2GFBA 4YNYA 4YBQD 5HTSA 2EC8A 2E7CA 4HUXA 1A5FL 2FJFA 2OBGA 1D5BB 1D7FA 2QQNL 4G3YL 4GMTH 2C3GA 1ROWA 2VO5A 1FAKT 2F53B 2KL6A 4EN3A 2X1QA 1MWAA 1JV5B 4HFWA 5JHLL 5ECJE 5L0QC 4P99A 4IOIA 4G8IB 2IH3B 5T33L 4LSVL 4P23C 5KVGL 1LP9F 1INDH 1KN2L 4ZOCA 1S7RA 3B9KD 3D0LA 4DVRL 4G6FB 4XNMB 5HHMB 3VG0L 5HD8C 3OGCB 4TSCL 1U8HA 3FFCE 4WWKD 2OI9C 3TN0D 3ARDA 4Z76B 4LLMA 3MV8B 2HLFD 2G75A 4MS8D 1UA6L 4R3SA 4P3CL 3ROOA 4GW5B 2P5WE 3NCBB 5DFWH 1VENA 3RTQB 4Y8AA 1FIEA 3T77A 3H0TB 1KCUL 4DN4L 4PRID 1MVFA 1GOGA 3QIBB 3U46A 1PW3A 4FRWA 5JORA 4XTRC 1GGTA 2VXVL 5HGDA 2C4FU 7FABL 3O3BB 1KJ3H 1INEH 3MV7A 1FNEA 2CKBB 3DV6A 1YNLL 4WU5A 2Z92B 4NO3B 1ACYH 4Z7NE 4LNRA 1XF1A 4X6BB 4QRTA 1IZJA 3UBXB 5DK2B 3VGAB 4U2ZA 4PRDA 2QQNH 3U9PL 5BW7C 4JO1L 4G3YH 2GT9A 5F7EL 4NQSB 3EO1A 4GLRI 1HHGA 5BVJB 1UXSB 5JIHA 3VWKA 1UZ6E 5D1ZD 5H94B 1BLNA 5JHLH 3HI6L 4YZFE 3VH8A 3O8XD 2BNRD 4U1KA 5I1CL 5D1XA 5KVGH 1KN2H 2FZ3B 4KK9D 3OSKA 3LS5H 5B22A 4XPFH 4PJ9D 4DVRH 4HJGA 4JAMA 1WBZB 4L3ED 4MCYB 3MLXH 2W9EL 4TSCH 3OR6B 3VG9B 3O9WB 2FX9L 3ARBB 4HKBA 4NKDB 4P3CH 4L9LB 5DD6B 3SKOA 1PLGL 2A73B 4LQ1A 5I1LA 5DFVC 2I24N 2C9AA 5I71B 1XF3B 1QLEH 4PRPB 3UCRA 3QUXA 3DYPA 1KCUH 5F9WC 4DN4H 5DEFA 2NYYC 3MLYH 2G9HA 4WFEE 5A2FA 4V1DD 2A74B 4QXGL 4X4XB 3MA7B 4KPHL 3I02B 2HRPL 1YNLH 4PJ5D 4ELKA 1FSKB 3IDNB 3B2VH 3LQAC 1IVLA 1Z9MA 1BBJA 2H2PC 2EXWC 1T5WA 5DC9B 3MV7E 4JO1H 5DJ8A 3ZYJA 1XH3B 3QDMD 4PJBB 5F7EH 3UEZA 1LK2A 1MHEB 2GY5A 3BWAA 4ZXBC 5SX5K 3O3EB 3C9NA 4DKFH 2FATL 1YY9C 4GH7B 3HI6H 1CLYL 4M7KL 4B0MM 2XNAB 5I1CH 1KACB 4YLQT 5AEAA 5FGSA 3F6IA 3QIUB 4YHNB 1YEHL 3MLTB 5DJDA 3U6RA 3EYOB 5F70A 4OCMC 2FX9H 1T03L 2L7JA 1PQZA 3VCLB 4PJ7F 3VGFA 1AR1C 1G6RA 3LSOA 3FOLA 5GGRB 1NGXA 3HI5L 1ZLVK 4BSWB 1JPGB 3D48R 1DUYA 1R24B 3I6KB 5L0QB 1YMHB 3PNWB 32C2B 3RIFK 4OQ1A 4C4KT 1MFDL 1UFUA 4P23B 1CWVA 4Y1AB 5DA4A 3ARDC 1LVEA 4QXGH 2B0SL 3K4DA 4QY8A 1PFCA 1QLRB 1RHHB 3BHBA 2P8LA 5FF6B 1I3GL 4WV1C 4RCAA 5JMOC 1UM6L 3C5SB 5IB1A 4EDXB 2D31A 1ZLWH 1EGJL 2WLYA 2VR4A 5EO0A 4QT5A 2ICEA 1CDIA 4HQQL 1ZVYA 5E4EC 2UYLA 5GRVK 1IGCL 5FO8B 2NY4C 4NQDB 1FH5L 3P73A 1MREL 2FATH 4NHUB 1CLYH 1FNGB 3OHXA 4D9RD 1QSZA 1YEHH 4KKBD 3L5WB 5CEZL 4OFIA 4IIQA 4NQXB 4X80L 3QCUL 4B41A 5D2NB 2EE6A 5ALCL 2K9UA 3G5YA 1I8LC 3KPSA 1HK6A 2DQJL 4KK6C 4OZ4B 1RUMH 3HR5B 5BRZA 5HI5C 5EPMA 4YHYC 1XCQA 5LG1A 2CO6B 1TITA 4NT6B 2IALB 1KXQE 3OKNA 1HXMB 3W2DH 1NCWL 4R7NA 2ZCKL 4X7DC 1JK8B 1U8NA 2F58H 2UZIL 4G6KH 4OUUB 2ADGB 1KB5A 2B0SH 1DEDA 3B4NA 2AGJH 4OZIF 4X99B 1UM6H 1XGQB 4C83B 3RL2B 2YA1A 2GUOA 1YN7A 4AY0A 3FFCB 3ZE0E 5F3HB 1EGJH 3DUHA 4X6FB 3ESVF 4HQQH 3DXAD 4PJXA 2J8OA 2P5WB 1KIRA 5F9WB 3MJ9H 1IGCH 4ZOEA 1FH5H 5LBSL 4RFNC 2AABH 2NY0C 5C6PB 3DV4B 4YAQB 4WNQA 8FABA 3DTXB 4MVBC 2GK0B 1W0WB 5M7QA 3O2DA 5CEZH 4S0TD 3UX9B 4KJPC 4RZCA 4X80H 1PYWA 2IPKB 2V9TA 5ALCH 1OARL 4AQ1B 1S7QB 4PY8J 2NTFB 4ZXBB 3T2PA 3UTZB 2DQJH 5MEQB 1MCRA 4LASL 3WIHA 4M6AA 2VUYA 2YKLL 4P57B 5IIEA 2P43B 1FL6B 2GJZA 2VXTL 4TUOA 2FIKA 1YJDH 1NCWH 5HHPA 2ZCKH 3RWDA 2H3NA 3JWDC 2XPGA 1CICC 3TIEA 3OWEA 3L6FA 3QO0A 1VESA 2HKHL 4MB5A 1C7SA 4IMLB 2AJUL 3VI3E 3FT4A 5IKCA 4YGAB 3NTCL 2VZOA 3WDHA 4LEXH 5J1SC 3CLFL 3SGJA 1AKJA 3STZA 5LBSH 1U8HB 2DQTL 3IJYB 3ARDB 4Z7UA 1J8HD 1DTUA 1P7QA 1KGCD 3I50L 1NBYB 5IW1A 4KJWC 3BPNB 2P4AB 1U91A 2PKDA 5CGMA 4WV1B 3K74B 3REWA 3IU4L 4NO0A 4MNHB 3ZHDA 1OARH 1HN1A 2DD8L 4LNVA 4EUPB 5JORB 5E4EB 3WS3A 5HGDB 2NY4B 3ARFA 2NW2A 4YFLI 3UTOA 5KS9F 1QSEA 3OR7B 1FNEB 5F1NB 1ZXQA 3ZTNH 3FTGA 2VXTH 5DVKA 2BJML 4LNRB 5FOBA 2LVCA 2XFXB 4OZFB 1CR9L 5CBEA 1CFQA 2R0KH 1OSZB 4ODVL 1J0KA 1FG2B 1HHGB 1OP9A 1R3LB 1ZA6B 2HKHH 1S9KC 2AJUH 5T5NF 3NH7H 5BV7L 3QQNA 1EVUA 3NTCH 4YHYB 1NEZA 1IFHL 1T2XA 1MAJA 2DN7A 4LARH 1OD9A 4NC1C 3CLFH 4D94A 3QHZL 3RJQB 3WLWC 3D69B 2UY7A 5FYJL 5F7DA 5E94A 2EEBA 4LKCB 3I50H 3SDDA 3TBVB 5FUCE 4NKOB 4JKKA 4ZFZA 1SJHB 1Z5LB 4P2OD 5I1LB 2WUCL 5CD3B 4OZGE 4Z7UE 5CFHA 1PBYA 5GZOC 4I13B 1KPRA 3IU4H 2BVPB 4N8CL 3QQ9C 4JZJA 4DGIL 3T1WA 2DD8H 4Z8FH 4BSVB 3D2UB 3E1F1 3K80A 4LCIL 1Q1JL 3OF6D 1N2RB 5MENE 1BQHB 2Z93A 3DVGA 4Y4HD 1JPSL 2BSRA 4RFNB 1LGVA 3JV4A 2NY0B 2EYTB 2R2HA 5FM5M 2DLFL 2NW3B 1D5MA 1B6DA 4PP2B 2BJMH 4QRUA 4YXHH 4DGVL 1BBJB 1X4ZA 3Q3GA 4RWYL 5JNYB 3OBAA 2IAND 4FXGA 4NQEA 1QSEE 2R0ZL 2V9RA 4JM2A 4ODVH 3PDDA 3BVNA 4OFVA 5CIPH 2V2XA 5FYLE 2CPCA 1KTRL 3CDFA 3X3FL 4LKXA 3BN3B 2HFTA 1G7LB 1T1WB 3Q5OA 1ZT7A 5BV7H 2H8PB 4PJ8A 1F02I 2IG2L 5EA0L 3TO2B 2P7TA 3UJTL 4B50A 3QHZH 4PYGA 1IAOA 4YWGL 5FYJH 5KZCD 1DQDL 1CICB 4JY4A 1WWCA 1HEZB 2GITA 3QEGL 4L3CB 1M71B 2VQ1A 3F7VB 1S8DB 4GQ9L 5E6IC 3TWCL 5IVXB 2WUCH 1ZAGA 3MRJA 3MCKB 1LD9B 5FUCC 2E6QA 4YDIL 2K1MA 4N8CH 3SGJC 2NXZD 4DGIH 3EYFB 4EI5A 5GRZA 4LCIH 1Q1JH 2IFGA 2D0FA 3SKMB 4X9HA 1EFXA 1JPSH 4K9EL 5IGXL 5TQ0L 4P46D 3C5JA 3N50A 3GMLB 1MWAH 2DLFH 4HXBH 2OL3A 3BP5A 1J11A 1F3RB 1ODAA 1G7PA 3MGTB 1JUFB 4RWYH 4QT5B 4JFOB 4XBPA 4E41A 5ISZB 3SBWA 2R0ZH 2NZ9D 4I0PC 5JOFB 5IB4A 4G8GD 4F7PA 1MCIA 1Q9KB 3ARFC 1DQTA 3X3FH 1G7JA 4MAYD 3U82B 3FB6A 3MXVL 5B21A 1NAMA 3VXMA 5DO2D 4NQEE 2J8UF 1JYVA 4MA7L 2IG2H 5EA0H 1B2WL 3IRZA 3UJTH 4LIQL 1DLHA 4PTUB 4G9FA 5JHDD 4YWGH 1DQDH 3U2SA 3H3PL 2FEEL 5D1QA 3G5YB 5DJXB 5JZ7D 3QEGH 3OTTA 4OF6A 4HHAA 2Z31A 3EJYD 4GQ9H 3TWCH 5I2IB 5E9DD 2VABB 3GSUB 3P4OA 4DWHA 3G6JA 3T3ME 3VH8G 5F7WC 1J1XL 2XG5A 2BSTB 1HYSC 1EV2E 4IRJD 5FYKU 5TDPB 3JTSB 1BAFH 4K9EH 5IGXH 3BYTA 3UPAA 4U1SA 3SGKA 5ESVA 2QL1A 2XRAL 2YC1A 4QHKI 4TYUA 3V7AE 3VWJC 2IQ9L 4ZO8A 1A3RL 1URLA 1X6LA 4JZJC 4U7SA 3LRSB 1ZT1A 1MLCA 5FK9B 1EJ6A 5FIEA 2AKRA 3NPSC 1UWXK 4QXTA 3V4PL 3KDMB 4BQ8A 1MCCA 1R5VA 5K59E 4X5WB 4L4VB 5HBBA 4E41E 1ZHBA 4JKPH 3MXVH 3BH9B 5D7IA 1G6RL 3ZKQD 5F1SA 1U0QA 5AG9A 5DJ2B 1B2WH 1HHIA 5EO9A 4LCUA 4LIQH 3O6FB 2P8MA 2GSGB 1CT8B 3I6LE 4JM2C 4U4BA 4GBXD 4YXLH 3VXME 4NBXB 3F7PC 4G43B 5ACMA 3UPRB 3H3PH 3MBEA 4G6AD 3RWIB 3BKML 3LB6C 4Z77B 3VXSD 1IGJA 4G9FE 1EAPB 5K9KA 3S37X 4J6RL 5SX4I 1HCFX 1S7VA 4ZTOH 4YHZL 5IIEB 5J1TC 3BO8B 1U8LA 4MDIB 4Z7VA 3RRQA 1N3NB 3TIEB 2XPGB 4ZUSA 3CXDL 3ZT7A 4JPWL 3G6JE 1TPXC 2IAMD 2ZP0T 2PW1B 4O02L 3RZWA 1T04B 3FZUC 3FQNA 1MCOL 2XRAH 1ZA3A 4U1MB 5CZVL 3AS0A 4N0CC 3FAXA 4XCCL 5E6IB 3MRIA 1AFVL 4HWBA 4DCQA 4R4ND 3V4PH 5HGHB 3QNXB 1EX0A 4OZGB 4Z7UB 1T22A 2A83A 1H3PL 1P7QB 2W60A 1G6RH 5IW1B 3NN8A 2F19L 3F6LA 1T4KB 3BN9C 4NC0B 5J0BA 2ZZUT 4O2FB 3T3PF 5MENB 4HS8L 4NO0B 4DUXA 2ITDA 4GKZB 4IOFD 3BWUC 4JJHA 4I0PB 3QULB 5BQ7A 4Q9RL 3RY5A 1U92B 3WKNA 1BX2B 1FRGH 2X70A 1KB5L 2OJEB 2NW2B 1YEIL 3QDJA 4J6RH 3ZDZF 4WU7B 4ZPVB 5KANG 4YHZH 5CZXC 5EBMB 2DQFA 3SY0A 3BP4A 4P48A 4BFBD 3TBTA 3CXDH 4HUVB 3ZHLA 2CRIA 2NY6C 4O02H 4HUMB 4MXQC 1J1OH 2HT2C 2Z31C 1DE4B 1MCOH 4Z7VE 4DZBA 5E4IA 3RWEB 1F42A 1ZLUK 4XCCH 1QRNA 4NN5B 3ARZA 4TN9A 1JTPA 3MV11 1QFWM 2QQLL 3B3IB 4F57L 1E28A 1FGVL 1XZ0B 1P4IL 1MIEL 1QFPA 4AZ8A 1LE9A 1H3PH 3VFOB 2NR6C 5SX5H 3SKNB 1FFOB 5GRVL 3FT3B 3MRGA 4J3WA 5DJ6B 3WNMA 2HLAA 4FFVC 3GFUA 4LFHD 2F19H 1A3LL 3WIHL 3V4VL 3GI8H 3VWJB 3VXUD 3L3OA 3IETB 4HS8H 3T09A 4AH2A 4HG4J 1ULVA 4WW2C 1RV6X 4A2LA 4ZNCD 1T7WA 2O61A 4JZJB 5EC2A 3QH3A 3VRIB 4Q9RH 3NPSB 3R8BB 5C7XH 1KB5H 4NRXB 1OGAA 1LO4H 4JFPB 1YEIH 5ENWB 1MH5A 1I8MA 4I2XA 1ZLVH 3FT2A 3ETBF 1ADQA 3T65A 2X89A 3MLSL 1U3HD 5ID0B 2WM0A 3U9UB 3MBEC 3FONB 1FN4A 4FNLH 4RFOL 5E8PA 4RMVA 1QFWL 3F12A 3TPUB 4RSVA 2OTWB 3N1GC 4LKXB 1WIOA 5IW3A 3VXPB 3BRDA 5DWUL 3RWCA 3KPRD 1FZJA 4K71C 2E9IA 2QQLH 3VE0B 3O2DH 1HHHB 3GBML 4F57H 4HV8A 3BW9A 4GXVL 1O5DT 1I8IB 3BPCA 1FGVH 3V2AR 5JPNB 1MIEH 1QRNE 1S3KH 4JHAL 4KKCC 3IVKA 3QR2A 4PJIF 4MJIA 5L2JA 5DK3A 4ZFFB 1A3LH 4KU1A 4J4PD 1J7VR 3V4VH 3WIHH 1OWRM 4JN2B 1S5HB 5JO5B 4OD2A 4HKJA 5FYLL 4L9DA 5HVWA 2NZIA 5D5MF 35C8L 5HI4D 4MD0B 4IS6B 3OKOA 4XNZC 5D93C 2AS5M 4K7PY 4LSSL 1KEML 2D7TL 1E0OB 4DKEL 1LP9E 4FQ2L 2D03L 2DB8A 4ZOBA 1A6AB 3OZ9L 4L8DA 3PL6D 1FDLL 2UZXB 1IAMA 4KH2A 3E6FA 1ZGLA 4FZEL 3DIFA 3MLSH 5JW3L 3LEXA 1RU9H 4I2XE 2YPLB 4RFOH 4WHTB 5HI3C 1ZK9A 4K2UL 4HAFA 4L29A 4RAUB 4RA3A 3UBXI 1RMFL 1QFWH 4WTWA 4F7PB 4UNTA 1P2CB 2X4UB 4U1JB 4JO3L 4U6XA 3A67L 3PXHA 3WN5A 5C0JB 2XWBB 1JE6A 4CVUA 3PQYB 1T7XA 2B8OT 4GXVH 3O11A 3ULUE 3K8LA 4XXCA 1I7ZA 2HTKC 3EFDL 2EDQA 2NY6B 2HFGL 3VA2C 3TBYB 4MJ5B 4R26H 2OMNA 1KNOA 4ELMF 3QEUA 3DX6B 2VISB 1HSAA 3LRHA 5FYLH 3CIQA 1X5HA 4JO4L 1ITBB 1ZMYA 4CMHC 4LSSH 1KEMH 3WFHB 4DKEH 4FQ2H 1S7SB 2Y1VA 3OZ9H 1YEJH 1FDLH 3UYOD 3IF1A 4PGZA 4DUWA 1HI6B 4FZEH 2XA8H 2H26B 5FAAA 5JW3H 3QIWD 3L3GB 4CKVX 1A2YB 1ORQB 4NQCD 2ZUUA 4WW2B 5C0AD 2VYRE 1V5JA 3D87B 1MCFA 4QXTB 1RMFH 4DUVA 3KWWA 1U8IA 3ZSSA 1J5OL 1VADB 2YUZA 3CSBA 5LGKA 1TZIB 4M61A 3CPLA 2JE8A 1VKXA 3DWTA 1JGVH 3A67H 3DMMD 3VD9A 4P4RA 3WFCL 5DVLA 4ZUWA 4Q74A 3T2OA 4CDHA 2V5SA 3C8DA 5K9JL 2A0LC 1JPFA 1U8PA 3GMMB 3BGFC 4J3OC 5C0FB 4GAYA 1GGIL 1KIQB 3ULUC 2HFGH 3G08B 4MNQA 1JBJA 4UI2A 1U95A 5DJZB 1ZEAL 1N8ZA 2FBOJ 4P2CG 5EUOB 5DVOA 3G5VB 2OL3L 4CNIA 4K71B 2IQAA 5TF0A 1JRHI 1LO5B 1GGCL 1XGRA 3A6CL 4Z7VB 2Z35B 3F8UB 5F9JB 2HT4D 3LKSB 5EFIB 15C8H 2PTTB 3BQUA 1I3RB 1TQBC 3ZLQC 5C0BB 1T0NA 1ZA3B 3GSXB 2HMID 3D39B 4KGJA 1WBYA 3RX7A 2VC2H 1NAML 4HWUA 4PJ7E 2CIIB 3QEQB 1JHTA 4YHIB 2NCMA 2QHLA 4HEPG 3WKML 2ZUTA 5HVHC 4XNZB 5D93B 1KT2B 3V7AG 4AMKL 5KW9L 1ND0B 1HIML 1AE6L 5C08B 4Y5VC 3UYPA 2ZUQB 2DM4A 3WFCH 3FOMA 3OG6B 3HNTL 4RGNC 1EHLL 1MAMH 5IFAL 5K9JH 5KSUB 4YBLC 4KDTC 3F5WA 3H7BB 3CFJB 5MHSE 1TZGL 1QBML 2ITDB 3NOIA 1GGIH 1VFAA 5E08H 4PJFA 1A1OA 1J0ZA 5DK0B 2GTZA 4FS0A 5C0RL 2OL3H 4JFXB 5HYJB 4Y8DC 3A6CH 4MNQE 4FQHA 4LLQA 4CVXA 2V5TA 3EYQD 4IRSD 1AGBA 2BY0A 3S7GA 1G7QB 3MLWH 1CI5A 2VDPL 1JTOA 5HYEA 5FCSH 2PYFB 4BM7A 1EFQA 4XBEL 5ACZA 1BQUA 1NAMH 4YXKL 4X6CF 1GJIA 1I1FA 3BFOA 3ROLA 3S36X 4P2QB 3FQRB 2BHYA 4PLJC 1CE6A 3SDYL 4JDVB 3W5MA 3RUGA 2XI9A 1NKOA 4ZPTA 4CMHB 3KPPA 4IM8A 1HIMH 2E3VA 2EDJA 3VFTB 5AYUL 3ZKND 2Q87A 3RAJL 3P77A 4FFWD 2CDEB 4M8VA 3L3OB 1SY6A 4OZIE 2VZUA 1EHLH 1LP9B 1NMAL 2PN5A 3V6ZA 3RDTC 1F6AA 5C9KA 4NRYA 2FL5A 1TZGH 1QBMH 4PV9B 4K7FB 1C16A 2R0LL 2DJ4A 3VGDA 4ZYKB 1DN0A 5K9QG 4W6YB 2FR4B 5C0RH 3GDBA 4Y4FC 4HIHA 3HLAB 4PJFE 4TUKL 4PLNC 1OTSC 1E4XL 4I3RL 4UU9A 2VDPH 5E8PB 1MHHB 2DM3A 1TTFA 3BGFB 3D85D 3FO9B 4C56E 3QDGB 2QQQA 4FQXC 4ERSH 1QYGL 4YXKH 5MERA 3JTTA 3CMOL 5F9OL 4KJYA 3GSOA 4JHZA 3KPNB 4K3DL 3SDYH 5FO7B 1DVFC 1B88A 4P2RB 1RI8A 4FN0A 1ED3A 3MNWA 1Y0LA 5GS2D 4P4KC 3AREC 1FV1B 4F2MA 1SMAA 1A9EA 4G42A 2FYYA 3IVKB 1E4KC 3CX5J 3Q2CA 1IL1A 1TQBB 1NCNA 3RUGE 4EJ1C 4RMQA 1I7RB 5JW5B 3GMRA 5C0NC 1P6FA 2R1WA 3C60A 5HSFA 1NMAH 5DHYA 1NJ9B 3VRLE 3D9AL 1QO3A 2I25N 2R0LH 3QUKB 2XKSA 5GGTA 3E3QE 4TTDD 5HVHB 1UACL 3WDIA 4Y5VB 4J3TA 1A6VL 5FA4B 1J1PH 2A6JA 3BZEB 4PJEA 4TUKH 5F71A 3LEXB 1QA9A 5C09D 1E4XH 3R06B 5A16A 4RGNB 2ED9A 2FX8H 4I3RH 4QTHB 3RI5K 4HWBH 4G6FD 1MCLA 4YBLB 4XP9L 3I84A 5CJOL 1ES0B 3MV8D 4UV7L 1CTOA 3CMOH 5F9OH 4JJ5A 3RTQD 4OF8A 4F15C 3GNML 2GYSA 5I74B 2Y23A 1OM3L 2NXYC 1BPVA 4KK5D 3CCHA 1I7ZB 4U7MA 5BCAA 1UWXH 1KJ2L 5I1DB 3WYRA 1NDMA 3SJVB 2W0LA 3ARGC 1X5KA 2YD1A 1CLZL 4LCWD 4Y4KC 3WCYA 4ETYA 2ATPA 1UM4L 1LNUB 2CK0H 1ADQL 4OFYD 3D9AH 2HT3D 4FHBD 3CDCA 5DYOB 4W4NA 3E6HA 3ZKMD 5E24E 4JFYB 4G6ML 4PJ7B 2WWMD 1GZQA 1ZGLM 3TGXA 1I9JL 1GCFA 1OAXL 3GMNB 2VB5A 1IKNC 2BOCA 1K4CA 1A6VH 1I1AC 2DTML 5IM7A 2EDEA 3LEYH 1FZKB 3GHBL 3SE3A 3BUTA 3JWOL 2WINB 2VJXA 2X4TB 3RDTB 3EHBC 4PREB 3A0OA 4XP9H 1KPVA 5CJOH 3OXRA 1MQKL 1U8IB 2C3HA 5JPMA 3SDXA 3ARBD 2GSIA 4M61B 3MREB 4M62L 5EZLA 4ZSOA 1MY5A 3GNMH 2FGZA 4PRPD 1J12A 4XC3L 4Y4FB 2DIBA 2CH8A 2BHZA 2F5BL 4M7LL 3BD5A 1FNFA 1L0QA 2J6EA 5T1KA 4UT9L 2BNQA 3IJSA 5T3XE 5I1HL 2R23A 5C07D 1AD0B 1CLZH 2YRLA 5JTWA 2VXSL 3B6SA 3VRJA 1BZ7B 1UM4H 4GG8A 4F7TB 4FQXB 4FTVB 1ADQH 4PGDA 2MCPL 3UAJD 1S5IL 2EDLA 1K9TA 1V05A 2XQYK 1DVFB 3QISA 3S35X 5SWQB 3CDGB 4G6MH 4GW1B 2CKBL 4FABL 2XA3A 1I9JH 4P4KB 3AREB 1OAXH 5CSZB 5MEOA 1L0YA 3OB8A 5A43C 4LVHC 3ULUH 4QHKJ 2DTMH 3QA3A 4HGKC 2GAZA 1BD2B 3GHBH 1PY9A 3JWOH 4QRRA 3QIUD 1SJEA 1LEIB 3WNKA 4CU8A 1YNTA 2JTDA 2AV1A 3ZL4L 4WUUB 2D0HA 1T2QH 3QNZB 5CJ5A 2R1YA 4OZIB 1MQKH 2R1XB 3G6DL 3EW3B 4M62H 1IEBB 1FVEB 5CHNA 1CLOL 1G7IB 1ZLUH 4Z7QF 3SGDI 2OQJB 1NLDL 4XC3H 1GXEA 2C5DC 4P23D 3I75A 3WMSA 1N4XH 4M7LH 5EBWB 4Y1AD 2A1WH 4ZSOE 3CVIL 2DOCA 3L3JA 4UT9H 2ZUWA 3GRWL 4E0RB 1X5GA 5CJXA 2VXSH 3V4UH 1QR1B 1QSFA 4XGZB 1IQDB 4QWWC 5GXBB 1LQSR 2Y07L 2N7BA 2MCPH 2BNQE 5C0CA 5A1AA 4M7JL 1RJCA 4C56B 5H2BA 2CRYA 1MVUB 4CADB 4F15B 3D3VD 1AGBB 4AQOA 3MFFB 5FOJA 1JZ7A 2NXYB 3HZKB 4FABH 2BFVL 4L8SA 1RJYB 1RIUL 5ACZB 1ERNA 3ARGB 4K8RL 4Y4KB 5DRNA 5ITFB 3VGGA 1PZ5B 4QF1B 1IAKA 2X4SA 5EU3B 2BRRH 3MOBL 3U4EA 3ZL4H 4I9WD 3U79A 4PGBA 4WW1A 5IHBA 1A6ZB 4NDMA 4PV8B 1P7KB 3FCTA 3G6DH 2VAAB 5FDWA 4JANA 1X44A 3CU7A 3SO5A 3H9HA 2HJFA 1CLOH 3SE3C 1PSKL 2OP4H 1V3MA 4M7ZC 4FQIL 1I1AB 1SEQL 4Y19B 3V6ZB 1Y18B 1RK1A 5ICXA 1R3JA 2FSEA 1G6VK 1MJUL 1YN6B 4V2CB 4PBVC 5IQ7L 4J2XA 3CVIH 5FEBA 1KXTB 4QTIH 1F4AA 5FA3B 3C5ZD 2IBBA 3WJJA 2VLLB 3RKDD 3BIKB 3HE7A 4KUCD 3RZCA 1H15A 3T0BA 2Y07H 2OSLA 4PFEA 3FFCD 3S8WA 3TJEL 3WJLA 2H2SC 5FKPA 2W0KA 1QSFE 1MFAL 1QTYT 1SMOA 2P5WD 1XGTB 4KI5F 1NC4B 1JVKA 3R4DA 1K4DB 2BFVH 4PJCF 3PIQA 5C0CE 3FJTA 3ULSA 4HWZB 1RIUH 3RWJA 5KS9B 2A6IB 3RVVC 4CGTA 5GSRB 3TYFA 4K8RH 3TNNA 1WEJH 3IDJA 1RUAH 3ZTJG 4KJYB 2BVQB 3RWHA 4HIJA 4WUKL 1NDGA 1OL0A 3MOBH 1BZ9B 1OW0A 1GPOL 2H2PD 4XH2A 5CSBA 5ANMB 1TTGA 4ZXBD 1W72A 4FMKA 1FG9C 1NGQL 3ZTJH 1PSKH 3LH2L 5MP6L 3DECA 2V17L 2ZOLB 4MXVF 1CFTB 3QUMA 1SEQH 4J3XA 5DHYB 1A7RL 1F58L 2VDRH 3ZHKA 1MJUH 1GC1L 3MC0A 1J87A 1BVLB 4MYWB 4BSJA 5IQ7H 4WI3A 4NZJA 3TIDB 3TVMC 4TSAL 4EN3D 3PJSA 4DTGL 4P0DA 3VFSA 3PXJA 1MRFL 1JYWA 2YSSB 1AO7E 4BK4A 4YPGA 2A6JB 1Z9LA 5CEXA 3NZ8B 2FECI 1MFAH 1D9KA 5DQDL 1IGFL 1JZ6A 2NX5B 3BH8B 1MHCB 4JPIB 5DUBB 4LAQL 1T80A 3T3PE 3ARDD 3OJDA 1XF4A 2E9BA 4DGYL 4GUPA 1YEFL 3J8F7 1NGYB 3CSGA 2I27N 4HCRA 2Z0BA 3QPQC 1SY6L 4WUKH 1T20B 5IFHL 3O3DB 3CCHB 2PYEA 4X8XA 1CIDA 1J0HA 4FFZL 1B0GA 1TVHA 2ZKHL 4DQOH 3ARWA 3EOBA 2NY4D 1NGQH 4P5KB 3LH2H 5MP6H 1T7YA 2V17H 3RGVA 1A21A 4I3SH 3B9KC 2GW5A 1F58H 3VDCA 4OFPA 1SYVA 3QQ3B 1GC1H 3GMQA 3RVWD 4KTYA 5EIIA 1TETL 2AXGB 3CUPB 4M1DL 4WWKC 4B53A 3PWVB 1BFOA 1CFNA 4MX7B 3C6LA 4PR5B 1M05B 3MLZL 1GZQB 4TSAH 5DURB 4PJIA 4DTGH 5C8JB 5TH2B 2WMPA 3STLA 2X4QA 1MRFH 1TFHA 3VWKD 5ABDE 4FQQA 5LQBH 4Y5YA 3X12B 4KK6D 2GTWA 2EDDA 5HI5D 2R2EB 3CFDA 4M7ZB 4XB7A 4HFUH 1VGEL 4ONHA 1K8DB 4LAQH 3HN3A 2VSCA 3RVUC 2JK5B 4E42A 1MRCL 3HE7C 5ELIA 4D9LL 1J05B 1YEFH 4TPRL 3ESUF 3WJLC 1SY6H 5IFHH 1MJ8L 3QUXD 5HHOA 3MROA 4I1NB 1ZSDA 3CJJA 3O3AB 3WUWA 4FFZH 4OIIL 5GS0C 5CKAA 2ZKHH 4XHQA 5D1ZC 3SE8L 5GGTL 4PRNB 3TC9A 1BOGA 2YBRA 3NZHL 2J8UB 4I4WA 1OAKL 4KK9C 2NY0D 4K7PL 1P4LA 2PYEE 3M17B 4LHQB 4PJ9C 1AD9A 1PG7W 1TETH 1KEGL 3LKOA 4O5LL 1OAQL 4RDQG 4Y2OA 5C1MB 4M1DH 4X6DA 5GGSY 5HDBE 2RJMA 4MD4B 1RZIA 1QHPA 4KJPD 3Q6GL 1GZPB 1RD6A 2DKMA 3FQWB 2NNAB 5MEOB 1KLUA 1LO2L 3V6FA 4NFDA 1LDPL 3N1MC 4BUGA 2VDLL 3MJ7B 4F80A 1CXHA 2EIZA 3CVHA 1HE7A 4PJIE 1VGEH 3BGMB 3MRMB 2BMKA 4OM1L 4G80B 5E8OB 1MRCH 3IXAB 3M1BA 4LLWA 4D9LH 3DROA 4RFEA 3TVMB 1NC2A 4KWUA 4TPRH 3VXOB 2PR4L 5CHNB 3ZE2E 1KCRL 2W65B 5E2TH 2IBZY 2Y6SC 5CAYB 1MJ8H 1XF2A 1OSPL 4XCEB 1CGVA 2J88L 5T1LA 4OT1L 3E0GA 2F8XC 1DN2A 5TJWK 3RHWK 4OIIH 3SE8H 5GGTH 2ENSA 3GMPB 2ZSWB 3P0YH 5HHOE 1QSFB 3EOAB 2FJGB 1OAKH 2VLKA 4K7PH 2BNUB 4RAVB 1N5AA 4KJWD 4JM4L 5DRXA 5C0CB 1KEGH 4O5LH 1OAQH 4YK4C 1WZLA 4OCWL 4N68A 1EEZB 1GAFH 4N1CA 1FFNB 3KGRA 1C8PA 4A6YB 3Q6GH 4R4FL 4ZUTA 4OQTA 4DW2H 4GKSB 4MQXC 2CQVA 3REVA 3B5TA 1TZHB 1LO2H 3RGVC 1IGIL 4X6DE 1LDPH 4LP4A 3TZVA 2VDLH 1JHKL 1U3ZA 5T1MA 5B39A 3LQZB 3B9KB 2Y4SA 3L9RA 2HG5B 5T3XH 1YEDA 2X4SB 3U4EB 3MUZ1 3GBNH 4WWKB 4WW1B 1LO3L 3DVFA 4LPCA 4N9GB 2FO1A 1A1MB 3NCJH 3AS2A 4HK0A 4NRZA 5DZOA 4ZAKC 4JANB 1Q9LA 2EDNA 5K9QI 4QRSB 4Y5YC 2PR4H 1A1NA 3K1DA 1CXKA 1KCRH 1C1EL 5C6TH 3MO1B 1OSPH 4ODUB 1KPUB 2J88H 4LRIC 3UDWC 1DQQA 3JWDL 4PJDA 4PRIB 1KC5H 3O6ML 1AGDB 3B9AA 5CWSB 1KTLA 1AO7B 4OLZH 5AUMA 3BJLA 3WLWD 5DMJB 4P9ML 1KB9K 5JW4N 2IC2A 4M43H 1CQYA 3SKJL 1SM3L 4JM4H 2A2QT 2QR0A 4LLDA 3U4BL 1JZ4A 5FB8B 1F8TL 1FP5A 4BQCA 1NGZB 3QQ9D 3PWPE 4NJ9L 1S7XA 2X4NA 3KLAA 3PIQB 5GJTL 3CFBA 5EBLA 5HHXH 1SEBB 5D1ZB 5D72L 1UWEH 3S37L 4Y5XA 1JHKH 3TNNB 1Q38A 2XWTB 4LCYA 2FBJL 2Z4QA 1KV3A 2Q7YA 4PJ9B 2JIXA 4B5EA 3QUYA 3MZGB 1QFHA 3O4OC 3RX5A 3DPBA 4XNYL 4O2EA 3LHPL 3KYMA 1CD0A 4HWEH 2J6EH 4FXKB 1LEGA 1G9NL 3EKCA 3X14B 3LN9A 4GXUN 2J5LC 4OGYL 1C1EH 1OPGL 3V5HB 1WWWX 5IP4A 4BKLB 3EYVA 2MPAL 1JWMB 3AM8A 3PGDB 5KG9A 3PV7A 3MRKA 4Y16C 2F5AL 4RMRA 4RIRB 2YOCA 1ZLSL 5IK3B 3PJSB 4PJ5B 3DX8A 3SKJH 4X6EB 1CL7I 2HVJB 1MCWM 2B2XL 4PRBA 2FCBA 1F8TH 4M4RA 1G9EA 4PGCA 4HBCL 2YMXL 2YEZA 4HIEB 1A9BB 3QDMB 5I16A 3DBXB 1AKJD 4FG6C 3QT2A 5GJTH 2CIKA 3GBLA 3RFZC 3TT1L 5D72H 3S37H 1P7QD 1XF4B 3D25B 2R0WL 4O51B 4PBWD 5EB9A 3EZ8A 5D2LF 3QZWB 1HNFA 2FBJH 2VE6B 1QLFA 5MEND 5IF0B 1N7ML 4YK4B 2HJLB 4XNYH 4NO0D 3LHPH 1QZ1A 4HLJA 3WL9A 2WQRA 4LLYA 3T0EA 4NP4L 1D5ZA 5HJ3B 4I0PD 4R2GC 1G9NH 3PDOA 2E7LC 1PGRB 1T1XA 1UXWA 2B20A 3ARFD 3OGOE 1P6AB 3AAZB 3EDFA 4ZFOA 5H37G 3T4YB 1QSED 1JNHB 4POZC 4XB8A 3LKQA 5CUSH 1G7MA 5GS1A 1QBAA 3RIAF 5CGTA 5EU6E 5DJCB 3HCVA 1S9VB 2V6HA 2VLRA 3VFWA 4NNYB 4QHMB 1KJVA 1UB5A 2XQYG 5T3ZE 1HHJB 4G8FA 5HYSB 4MLSA 4PJIB 4NKMA 2HVKA 5H37H 3WEXA 1XIWA 2Q76A 3ES6B 4ZAKB 1L7TL 1U58A 5IW6A 5IV2B 4Y5YB 3KPMA 3QJHB 5I75C 4K3JH 2WWKO 5D5MB 4ZS7L 4HBCH 2YMXH 5AD0A 4UINH 4C55A 1ORSA 2X9WA 4JG0L 1WFUA 1MCKA 3T4AB 3O45A 4N90E 3KR3L 3TT1H 2XIDA 1MFCL 1HYSD 2R0WH 3SDDD 2ICWB 3WFBH 4N0YL 1W72L 4EIGB 4ZDHB 4M93C 3VWJD 4N0UA 3QUML 1N7MH 4U6YB 3OJ2C 1I1CA 1I9RL 5DMIL 1JWSB 3OMZA 4GMSL 1A6TA 3VFNA 1MCPL 3JZ7A 4Y5XC 1CS6A 4NHCL 1T1ZA 4KVNL 1N59A 3SGEI 3FB5B 3MRDA 3VXQB 3T0EE 1QRKA 1EK3A 4LSRL 1CXFA 1S7UB 1RIHL 1J0IA 4PLKD 5TPWL 5GQBA 2CLVB 1J88A 3BP7B 1IAIH 5DJ0B 4NQED 1NCDL 4JM2D 3O4OB 3LVEA 5CP3A 4L4JA 5GGSA 1H8SA 4ELMB 1I1YB 1U93B 3TF7C 3LB6D 3QWOB 2VLRE 1A6PA 2J5LB 3HRPA 3HC4L 3ZSTA 1UVQA 1INQB 1T83C 3BOVA 3CVHB 3IDIA 4OKVB 4LHUA 3KPLB 5DF0A 3RVXD 2OMBA 4Y4HC 3KR3H 1AGFB 4X4YB 3IDMA 3EYUL 4KHXH 3W9EB 1MFCH 2F9BT 3DO7A 3QYCA 2JCCA 4LLWB 4Y16B 2LVEA 3DROB 1O7SA 2LU3A 1H3GA 4N0YH 4YO0A 1W72H 3BPOC 1G9ML 1MFNA 1UCTA 1TVBA 3MLRH 1SYSB 4BZ2L 3CSYB 1A8JH 3QUMH 3S34L 4N0CD 1Q0XL 5DMIH 1UKQA 2AXJA 4PP1C 3VI4F 4XXDA 4N0UE 4NHCH 1F5WA 4QHUB 5DEGA 1EFXD 4KVNH 5JQHC 5EDXA 1JF5A 5E8NA 1AGCB 1AXIB 3NIGF 4Z0XA 3VFUB 1ZHLA 3PWPB 3VXTB 1N5AB 4LSRH 3P9LB 2HJKB 4KQ3L 5TPWH 4JFEA 4QHNB 3BN9D 4TNVK 4E41D 4KUZL 2CGRL 1NCDH 5CP7B 1BOYA 5IOPA 1WFNA 2AW2A 3LKNA 5F88B 4MQ7A 3J7HA 3I6LD 4R2GB 1VFMA 5DHVB 3VXMD 3U0WH 4RQQA 2NXZC 4OUOA 3HC4H 5DRZB 4G6JL 4HCRH 3FQTA 4MD5B 3PWUB 5CZXD 1CLCA 1BFVL 5F6IC 4HGWA 1RZ8A 1ZTXL 4KTDL 3EYUH 1ZHNB 5JW4Q 4P46C 1J8HB 2EKJA 3NPZB 5EZIH 4U6HB 3PGFL 2Z31D 4YJZL 1JNNL 2FWOB 4BZ2H 2G60L 3AY4C 4JREC 4M5YL 5IMKA 2H32A 2CLRA 1WIUA 2Z91B 4ODXB 5GGUA 1WCBA 1T66C 1FYTA 3D18B 3F7YB 4XPTH 1UQSB 5J1AA 3P0VL 4M5ZL 4PY7A 2NR6D 3D0VB 4WJ5B 4X7EC 1NBZA 4X7TB 4D9QE 4GRLA 4AENA 4OJFH 4ZODA 4FFVD 3PHOA 3W11D 2VIRA 4KQ3H 2DIJA 4LLDB 5EU4A 3OAZK 4M93B 2XYCA 4KUZH 5BXFA 4NKIL 2B4CC 3S5LB 4GRMB 1S7XB 4LU5L 2X7LA 1ZOXA 4ZTPL 4Z7NF 4JFEE 2QSCH 5EBLB 2I9TB 1EUTA 1OTTD 3QXUA 4JVPA 4N0FB 1S7TB 5CILL 3NCMA 4G6JH 3L1OL 5E1AA 1QEWA 1CFSA 2DDQL 4IRJC 3Q0HA 1UZ6F 2WIIB 4YH6A 1ZTXH 3HUJA 1MJJB 4YZFF 4KTDH 4O2EB 2YWZA 3QCTH 2MFNA 3MBED 4OCRL 3QXVA 1H9VA 1KG0A 3FN3A 5EU6B 5T1DL 2J8HA 2Q8BH 4P2OB 1TCRB 3V6OE 4CRPA 4HUWB 2I5YL 2V7NB 4X6CB 5GRXG 3MRHA 1HINL 4XZUB 3CFCL 2UUDK 3VJ6B 1XR8A 2P5EA 2N56A 5IG7B 1I1RA 5TDNA 2WW8A 4Y4HB 4OQTL 3P0VH 4MSWA 3JV5A 4KKCD 4JZNB 3F58L 3BPOB 1FYTE 1F3DJ 4PRBB 2Y9RT 3FMGL 2RB8A 1BF2A 4Z7OE 4NCC2 4JVWA 2YD3A 3CVHH 1SHMA 4NKIH 1PKQE 3LAFA 1OD7A 1DDHA 4G6AC 3T0VA 4LU5H 1V7ML 4ZTPH 1IM9A 5BZDA 1RVFL 5CILH 1DBJL 4FMFA 4W4OC 4LVOC 1LWRA 2ZUSA 3L1OH 3SDAA 2DDQH 3P4NB 4QRPE 2V2TB 5DRWB 1BJ1J 1EO5A 2IAMC 1OT2A 5KZCB 1XR9B 3LS4L 4G7VL 3B83A 3VXRE 1V8HA 3EIFA 4OCRH 4OLUL 4UILL 1R6VA 5CGYD 3PDOB 5HI3D 2YD6A 5T1DH 5D7LA 3QG7H 4LF3B 4K23L 3HUJE 4JCLA 2I5YH 5HGBB 2NXZB 2EECA 2XY2A 3CFCH 4LSTH 3V6OC 1Z0MA 1X7QB 2HN7A 1PY4A 2VLRB 5F6IB 5BS0A 1JPST 4OQTH 4LEOA 4JDZB 1LHZA 4P46B 3IFPB 4RBPK 2HTKD 3U0PA 5F3BA 3BP6A 4HKZA 2AXFA 3KPMB 1QRND 4NZTL 2E7HA 5D7JA 3FMGH 1JWUA 4MJ4A 4JREB 1I8KA 4XP5L 1N6QL 1HCVA 4AL8L 4G8GB 5SWZA 4H5SA 1NLBL 4DFIA 2NLJA 3IB4A 1IGTA 1UH3A 1RQ5A 3O2WL 4RMTA 1RVFH 4GRLC 1DBJH 2LTQC 3ULVE 5GGQL 1Q94A 4MNGA 2CRMA 4R6UA 4F7MA 1J0YA 3SPVB 1CD9B 3NA9L 5JHDB 4XMLL 4RGMB 5L2KA 5C0DB 5TF1L 4OLUH 4Y7MA 4BH8A 3S5LG 4ALAL 1HQRB 4K23H 5E9DB 2I9LB 1CVSC 4KI5E 3CU1A 1DEEA 3MGAA 1RZFL 5D7LE 4M1CD 1LMKA 3TNMB 1FO0B 2SEBA 4IRJB 2KQNA 5TE6L 3HC3L 2Z8RA 3ULUD 1LE5A 4NWUL 5CD5C 4NZTH 5DS8B 3KLHD 5BS0E 4UQ3A 1EHAA 1U8OA 3QUZA 4K55A 5TDOA 3IDIB 4XP5H 4DZ8B 2AV7A 4PJAA 2W0FB 4MXVE 4HZLA 1NLBH 2BCKA 1JNLL 4RRPA 3OG4B 5C2UB 1JN6B 3KYOA 4HS6A 2YUXA 5E2WH 2QSTA 3CK0L 5FYKL 3W81A 5GGQH 4LLVA 1JNJA 3CFKA 5HY9B 5IB3B 1KJMA 2FEDC 5DQ9B 3TCLA 5KSAC 4G8EB 1EEYB 3NA9H 4XMLH 3RBGA 3N1FC 1EXUB 4N8VA 2C1OB 4UV4H 4Q6IC 2P45B 4MNGE 1YQVL 3QFDA 4ALAH 3VXSB 1HHKA 1FNSL 2XACC 3DLQR 3L3HA 2BX5A 2CUIA 4APQC 4M03A 1DBKH 4FP8L 1AP2A 3QJFA 1P53A 3GSVA 4JFEB 3WHXA 2CLZB 3SN6N 4KI5C 1ZT4A 3U1SH 3BEVB 4JY6B 1DQJA 1T21A 2JJSC 3GJEB 1F3JA 3OX8B 5TE6H 2IAMB 4G7YL 4HJ0C 1AIFB 1VACA 3GSNB 5M95B 1S78C 5E5MB 2XTJE 5ERWB 2PXYC 3CZFA 4LLUB 4NWUH 3KNBB 2HWZL 2ADJA 2AJZA 1BP3B 2WP3T 2AK4E 4HT1L 3S4SA 1HOCA 2P46B 3G5XB 5F7UA 3FHAA 4MJ2A 5ID1A 1ZS8A 1JNLH 1ETZB 2I07B 1K2DA 4F3FA 3MV9A 3MLVL 5FYKH 4PJAE 5TQ2H 2QADC 3RWFA 4UOW0 3TO4A 2HFFB 4HC1A 5DZNA 3MJ8A 2W1NA 4PUBH 1KTDB 3RIFF 4Q7DA 3PE9A 2AJVL 2P49B 2BVYA 4PJXF 5IMMB 3H9SA 1QUNA 5F89A 1YQVH 3O4LE 4JR9L 3NCCB 1U36A 4XBGB 1ZWIA 1PKQB 1DUZB 3GO1L 1NBQA 4GRLB 1J0JA 3EO9L 3GB7B 4HK3J 3RWGB 3EO0B 1R3KB 1H0DA 3GSQB 3TBWA 3MRLA 4GW4A 4X4ME 2F74B 1RZGA 2W91A 5FUOL 4GFTB 4G7YH 2X7LB 4KHTL 2CDFA 4M00A 3KAAA 4ODBD 4D0DB 1EMTL 3L5XL 3MJ6A 1QPXA 1UGNA 2ZWLT 4QRPB 1BVKA 3QCVL 2Z8VC 2HWZH 5MHSD 3QFJA 3VXRB 5C0GB 1GHFL 2XTJC 4DFHA 1PX4A 5I30L 3GIVA 2G5BB 1KCSH 4HT1H 3RGHA 1QG3A 4Y4FD 3S35L 1PKOA 5B4MC 3HUJB 2H6PA 5D7KE 3B43A 1OTSD 2FGWL 5CBAA 5FM4A 4OKDA 5F1IA 3HMWL 2B4CH 1MCQA 4MNQD 4CDGC 1KG0B 1SBSH 3RPKA 2O26U 4WEMB 4E9LA 4MHHI 5D6CA 3VXUB 4S2SB 3VGBA 3HMXA 3MA9L 3QP3A 1NGWB 1W0VA 4QKXB 2OS7A 1NQBA 2QQKL 1MELA 4UIMA 2EIEA 3GK8L 1CGSL 4LHUG 1E4WL 4JR9H 5INCA 2VL5A 4Z7UF 3HG1A 5CP3H 3ARED 4MSWB 3GO1H 4K07A 4NPYB 3EO9H 3RL1A 2CJUL 3H9SE 4AEEA 5F7NC 3RPIA 2JB6A 2R2BA 3PHQA 2HH0L 3L3DA 5C0ND 5IFJA 5I18H 4ZFGL 3NABH 5IBTL 3V5DA 5KSAB 1HSBB 2E8ZA 3T8XA 2APTA 5C9JA 4O00A 3KPOA 5DFTA 2YD2A 4KHTH 2VRAA 3S88L 4UTBH 1EMTH 2DTSA 3L5XH 3AXLA 3PWLA 1VCAA 4Q6IB 1Q9OA 3OXSB 3QCVH 2PO6C 1YPZA 4NM4H 1UKSA 2C1PB 5K93A 4APQB 3KPRB 4BH7B 1GHFH 2HRLA 1G0DA 1UEMA 4L4TA 4L8CB 1C08B 1ZANL 2A6DA 4WEUD 2KZWA 3QFJE 4H25A 3WS6C 3HMWH 1P1ZA 5B38A 1NFDA 3FRUB 1OCWL 2E5EA 4JKMA 2PXYB 3TN0A 4F9PC 4EVNB 1OAZL 3QXTA 4Q2ZB 1NFKA 1JPTL 3MA9H 4HH9B 2BERA 4C56D 2QQKH 4HW6A 4O9HL 2AJ3B 1CGSH 1HH6A 1E4WH 2I60L 2VQUA 4EKXA 3ARUA 4YQXL 4ZO6A 3IDUA 4C4KO 3PL6B 1H8OA 3IU3A 3WIIL 4OLYL 2CJUH 2XQBL 3UZVB 2QADB 2WANA 5IBUB 2APFA 2HFEA 1RZKL 2HH0H 2ESVE 4CN1A 3HG1E 4RMUA 4ZFGH 5IBTH 2C3VA 4XVUD 3UJJH 4Q9QH 3JBG7 4I18A 4XRCB 3S88H 2C3WA 1R5WA 1HYRC 4OTXL 4JVUA 2NLJB 2EH7H 2ATKA 4CAGA 1S9XB 2YXMA 1N6UA 5EZJB 3EYQC 3AU1B 2Q86A 2QSVA 2YUVA 1FJ1B 1ZANH 3O8XA 2BNRA 1YPZE 4LPUA 4JM2F 1MNUH 1M6OA 2H32H 5DGRA 4KI1A 4L4TE 4BH8B 3CMGA 4YGVA 1OCWH 3ARPA 5HYQB 4L3EA 2NPLX 2VZ3A 4F7CA 3HE6A 1NMCC 3DVIA 1VEPA 2DL2A 1XF5A 4X8JA 4XP6L 1S9YB 5SWSA 2K7PA 3MNZA 1KCLA 1M7IB 3KPQA 2WBJA 1F4WL 2DJSA 5AAWA 4O9HH 5CEYA 2I60H 3X11A 5IB2B 1VFOA 2LQRA 4ZNEE 5FM8A 3ZKNC 3VFMA 3ULVL 2AK4B 4KXZH 4V2BA 2ZUVA 3HS0A 3UTQA 3WIIH 1B0RB 1A7OL 4OLYH 4V1DA 3HB3C 1FQ9C 1WVZA 3ZO0A 2VH5L 5CMAA 4UQ3B 1RZKH 2B1AH 1PZUB 2DM2A 4NZRL 3BGAA 2NTSP 1YEKH 3MR9A 5DDHB 5C0AB 4MA3A 3A6OA 1WBXA 1HDMB 4LDLB 4YHPA 2QBWA 4OTXH 4ETQB 3LN4B 1ONQB 1V7NL 2YS4A 2QKIA 3X13B 4M6NL 4WO4C 4XCNB 3G5ZB 3O4LB 3C60D 3F65A 4LSQL 2Y7QB 4HIXH 4HUUA 3TCLB 3EDDA 5K59F 1X3DA 4KMTL 5FHAL 2APVA 2YR3A 3DHJA 2ED7A 5BVPH 5IEHA 4IOSD 5BZWA 2DQCL 3LKPB 3FFDA 2CR3A 2OYPA 1L9MA 1N6VA 4XP6H 1AP2B 2VTFA 4OGXL 2PO6B 2WUBH 3VFRB 2R39A 3GSVB 1BIIB 5FO9A 5HHNA 4X0KA 1L7IL 5DXWA 4RX4D 1MUJA 5B8CA 3ILPB 4ODTL 1T21B 5SWSE 5D9SB 3ULVH 1P84J 2CDGB 3RNQB 1A7OH 3WXVL 4UIKL 5J4MA 5C71A 2VH5H 4NOBA 4WVRA 3WNPA 1WC7B 4NZRH 3G6JF 4WGVB 1EIBA 4QWWD 4Z5RB 5DUPH 5T3XD 5DJAA 3S4SB 2DQUL 4TTDC 1AC6A 3O2VH 3OAZH 1IT9L 1CXIA 3BMWA 4AIZA 4H8WL 4UNUA 1V7NH 3PV6B 3SOBH 4BFGA 5JQ6H 5E8EA 4M6NH 5DQJB 4R96B 2EZ0C 5L8LB 5FGCE 2ICWI 4YDVA 4LSQH 3MJ8B 2XKUA 1AHWB 4KMTH 5FHAH 1AI1L 1YYML 4D0CB 5DJYB 5IBUG 4JFFA 3QWRA 4HMDA 1MFBL 5CEZE 2BVUA 2EKSB 3JUZA 2P48B 3UTSE 3BZFB 4CVZA 4X98B 5DURD 43C9B 5D7IF 3CFEA 4OGXH 2V2WA 1U8MB 4Q9CA 3MLUL 4PRHA 4LSPH 3CGTA 1L7IH 4BFIA 2E27L 2UWEA 4ODTH 4CJ0A 2UUDH 2N7AA 4PGJA 1ZVSA 2QV2A 4XPHH 5FKAB 4JZOB 4MDJB 4HX1A 3WXVH 3QFJB 1TDQA 3NFNA 2WBJC 3OKEA 1UADC 1NMCB 2E8YA 2V5YA 2DQUH 4Z7VF 3FHQA 1CD1A 1IT9H 4X9FA 2WWMC 3RY4A 3CC5B 2D7PA 4GRWH 5F1IB 5T1KD 1HH9B 2BNQD 4DVBB 3DXAA 1MCHA 2OJZL 3V0AC 1AGEA 2C3XA 1NANH 4XHJC 4N5ED 1H5BA 2E6JA 1AI1H 1YYMH 2VUOA 2VITA 4BQBA 5LVEA 4FQCL 3BSZL 3B5HA 3TFKD 1MFBH 5J6GB 5IQ9B 4OF0A 2O93L 1EZVY 1RJZB 2ESVB 5EUKB 3FO2A 2FJHA 3GUTA 2DQHL 4JFFE 4QLRA 3VXNA 4RRPG 1K3ZA 3FQXB 3C6SB 4WIQA 4NM8L 1IBGL 5FECB 3OPZH 4R0LA 4X7FC 2JB6B 5GSVA 4WO4B 1HXYA 5IVZA 3W0WA 4HG4K 3MUGA 4PTTB 4BYHA 4XI5D 5J89A 4PRHE 3CSPA 4PRAB 3HNVL 1YYLL 3D85B 1Z9SA 3DVNB 4I77L 4N8VG 1OY3B 4XX1E 2WNGA 1E6JH 1A4JB 4RBPH 5SV3A 1YPZB 1NUFA 4ZOAA 5I0DA 2DI9A 3QI9C 4L4TB 4U1GB 4AYFA 2VXQL 3W82A 3MSPA 2ITCB 4MXWL 1CQKA 2YWYA 5KSVB 2FHFA 1BFSA 1VGKA 1EHXA 3PDGA 4KRLB 2OJZH 4ZUUA 2OTPA 1QSFD 5GJSL 3PGCA 3P4MB 1Z0NA 4D0BB 5C0CD 5ESQB 4FQCH 1TQCC 3BSZH 2EDRA 3QPQD 3L7EA 1Q9WB 3S4SG 3M45A 4WGWB 1U2HA 2DQHH 3IU3B 2P42B 4NUJB 2P8PB 2XN9A 1MF2L 4NM8H 1IBGH 4QHLB 4ODHL 4NO5A 2HFEB 4UZGA 4ZMAT 5C09B 1UCBL 1F4YL 4EI6A 3LKRB 2IJ0C 3HNVH 1YYLH 4I77H 4X7SL 4KMQA 1X5IA 3W0WE 2IH1A 4M8QA 4JO2L 1T0PB 5K9OB 3B2UC 1YEEH 4BELD 4X9GA 4HC1H 3DI2B 4F33A 2VXQH 2HP4A 1MI5B 3HMXL 2DLGA 4MXWH 2EYRA 3MRRB 4I3GA 2YD4A 4OLVL 5I1AB 3HA0A 1M6OB 1AO7D 1U8QA 4W81A 1FC1A 2XOTA 5DI8A 4NBZB 3BKCL 1MCBA 1OQOA 4LCWB 3ULUF 5GJSH 3RVUD 3GSWB 5FYJE 4F7CB 5D2LB 1K6QH 3HE7D 3RNKB 1L4IA 3SDCA 1XF5B 1OF2A 7CGTA 1AQDA 3MYZA 1D6EB 4UUJB 3WV0A 3RY6A 5LGJB 5B3NA 2MKWA 4OBSA 2WBJB 4PBXA 5I8EA 1WWAX 3KYNB 4P5MB 3ZT6A 1A5FH 3LPWA 1HWGB 1T89A 1MLBB 1A7NL 5DUML 3WNOA 5EU5A 2FO4A 2KBGA 4WDIB 2X4PA 5GS0D 1Y6NR 4LAJH 5E00A 1UWGL 3JV6B 1H5BC 4ODHH 4P5TA 1FPTL 4LSVH 5T33H 4CL7A 2AK1L 5C0IB 1P9MA 1UCBH 4M4PA 2ARJB 4KRMB 5I9QC 1F4YH 3HAEA 4YDJB 3VG0H 3C8KB 2YA0A 3C5ZC 3STBA 2XN9E 4YHPB 1HQ4A 3RKDC 4LL9A 3K8MA 2YZ1A 2IANA 2VR9A 4H26A 3NCYS 4MWFA 1UA6H 4JO2H 1FVCB 3NIDE 1FL3B 2RGSA 5DTFA 3HMXH 3UTSB 5B3JE 1RUPL 4X5XB 1PJ9A 4NO2A 4LPVA 1GSMA 4ZG1A 2VXVH 4JQXA 5DMKA 5BV7C 5MEPA 6FABL 2D3VA 3BKCH 5C07B 5LAXB 7FABH 4HIIA 5EIVA 3QI9B 3VMNA 5C70A 3V0WL 2RFXA 2Y6SD 3RVTC 5C0EA 4YHML 1D9KD 4J8RA 3U9PH 4M6OL 4L8BB 1AH1A 4GKNB 5DUMH 4NGHL 2GJ6A 3KXFA 3IDXL 4P49A 2G2RA 4YFDB 5B38G 2OX5A 5DSCB 2AK1H 3DGGB 4Z78A 1M1SA 1VDGA 1RJLA 3EUUA 2W9EH 3IKCB 2ZSVB 3IDYC 4N1HB 4AIZB 1KLGA 3W9DA 4AM0A 1WK0A 2PYED 2DYPA 4EN3C 3R0NA 1A0QL 3EOTL 1PLGH 5E8EB 4MQXD 4NBYB 3U36A 5D6DA 4OCXL 1WICA 5I66A 3DRTA 4ZQKB 3RGVD 2YD7A 5I8OL 3U0TA 5IMLB 3FB8A 4YDVB 1U8JA 5E70A 5EZOL 1T3FA 3WUZA 4AT6A 1UB6B 4MAYA 4KKLD 2IANE 1RUPH 4KVCL 4CMMB 4M7LT 2MNUA 1MIML 5GIRA 1ZHKA 2E9WA 1J8KA 1RHFA 4YIQA 4LIQE 1YDPA 3MXWL 6FABH 1LEKA 1FNAA 1YMMA 2OI9B 4HDIA 4KPHH 4NNXB 3SQBA 2HRPH 4P9HL 4ONGL 1TCMA 3OKDB 4ZAKD 3HC0B 4UQ2A 2EDHA 3IAQA 1JGLL 1JJUA 3D3VB 3V0WH 4YHMH 5HHQB 1OGTB 4I48A 2P24B 3MRQA 4M6OH 1JTTA 3FO1B 4U1LB 4XPAL 1RIVL 5AZ2L 4ODWA 5IWLA 3IDXH 4HX1B 4M7KH 3SDCC 1JGEB 3RVWC 5ETUA 4S1RL 3EGSA 2XZCL 3L3KB 2K7QA 4R9HA 2ARJQ 2GJ6E 1AXSB 3DRQB 3KXFE 3QEHA 3ECBB 4K9EC 1T03H 2YA2A 3H42L 1U6AL 1F11A 1MOEA 2DMBA 3RQ3A 3VWKC 1A0QH 3EOTH 4UTAL 3HI5H 4OCXH 4P5TC 1JGDB 3FAWA 5D1XC 5I8OH 1P9MC 4LMQE 3EFFB 3G04A 1XCTA 1H5BB 1MFDH 4KVCH 1MIMH 5I9QB 4JB9L 3QPXL 1IILE 2OXGA 5JIKA 3MXWH 2F54A 3C5ZB 4GBXA 4JRYA 5J11C 1I3GH 3QQ4A 4HKXB 4P9HH 4XNQA 2FJHB 2X4OB 4ONGH 4M1GL 2RCSL 2J4WL 3HZYB 1D3CA 5HPOA 3FL7A 3MPCA 3QUXC 3QXDA 1JGLH 1K8IB 4MMXC 1YMME 3KJ4C 2E7MA 3ARYA 1FL5B 3IAGC 1B4RA 5CIPB 5I0ZA 1PD6A 1QFUL 4DEPC 1MREH 3PABA 1IEAB 1FFPA 4Y16D 4NSKA 4PJFF 5BV7B 2F15A 4S1RH 1EEQA 1T5XA 2J3SA 1REIA 5I8CB 4G9DA 4HXAL 4X83A 4H1LA 2VN4A 3QCUH 4WTZA 1JF1B 3H42H 4ORGA 1U6AH 4IHOB 3K0WA 5FHBL 3WO3B 5HYIA 4UTAH 3T0XA 4PJGA 4FG6D 2PW2B 2XWJA 2Y5TA 1BWWA 1R5IA 3IFNL 1B0WA 3D1MC 3QG6A 3HRZB 4R97C 2AQ3A 3PWPD 3KPSE 4CW1A 2GFBB 4YNYB 4HUXB 2UZIH 3QPXH 4JB9H 3RUGF 5BRZE 2FJFB 2DWEA 5C6WH 3IDYB 4FXLA 5D6DC 4EN3B 4M1GH 3VRLF 2RCSH 3VFVA 1MWAB 3IKKA 2J4WH 4HFWB 3CX5K 4R2GD 1VFBA 4IOIB 3B8YA 1VEOA 2NY3D 4XCYA 2VDOL 2F54E 4JRYE 1S7RB 4POZD 2R9HC 3D0LB 5IEKA 3T1FA 2HA1A 4LOUC 2YN3A 1FZMA 5AWNL 4ESKA 4LLMB 1A3QA 2G75B 4R3SB 2ZJSL 1LDSA 3ROOB 4PJXE 4XWGL 1RZ7L 4X5LA 2BOBA 3MRBA 1FZOA 1BWMA 3T77B 2IFFL 4OCYL 3QO1A 3X3GL 1RK0A 4XX1G 1K3IA 2MHAA 3U46B 4R7DA 1DZBA 3HI1A 5FHBH 4F8QA 1H3XA 3NGBC 5I8KL 4LASH 5DI8B 3V9FA 4P2YA 3EDEA 3IJHA 3MV7B 2YKLH 3DV6B 4RDQF 4WU5B 4IIQC 4OI7A 4PJGE 4QRTB 2X5PA 3BIBX 2LU7A 4PRDB 2GT9B 5EU5B 2FO4B 3EO1B 1KBGL 2X4PB 2ZNWA 3WD5L 1WV7T 3VWKB 1BLNB 5HPMA 3VH8B 4X9IA 4U1KB 4P5TB 2VDOH 5D1XB 2O5XL 4QRQA 3MNVA 3BMVA 2GKIA 4PJHA 3QUYD 3HAEB 4HJGB 4JAMB 3TA3A 1VEMA 4P59L 5J7CC 2DQTH 1C7TA 1U3HA 2YPKA 5AWNH 3JUYA 4MWFB 4HKBB 5E5UB 4KKAD 4XWGH 3SKOB 5EU6D 5J11B 2BSSA 2K3TA 3LV3A 2OTUA 4OCYH 2GCYA 4PJEF 3QUXB 1W0YT 5T3ZD 3X3GH 1FCCA 1QQDA 3DX7A 5DEFB 3KJ4B 2G9HB 4P3DA 4KC3B 1P5UA 1FVDA 5I8KH 1OB1A 4DEPB 4S1SL 1NH6A 1IKFL 4ELKB 4JFQA 3RKPA 4N90D 5KAQF 4JFDA 1CR9H 4J4PA 3MBXL 1T5WB 5IUSA 4J8RB 1UM5L 4WI4A 5DJ8B 1LK2B 1MY7A 3S96A 3BWAB 1KBGH 1E6OL 3WD5H 4PP1D 5ESAA 3MOAL 3C9NB 3VFPA 5KVFL 4MGXA 2O5XH 1IFHH 4Z78B 1T7VA 2X41A 4R97B 5DJDB 4TNWK 3U6RB 4P59H 3BDBA 4S10A 2DLEA 4AM0B 1A14L 1PQZB 3MRFA 3MGOA 3T0ED 1G6RB 3LSOB 3FOLB 2DLTA 1CFBA 4PJHE 1NGXB 2IGFL 3GGWA 1DUYB 1TENA 1EBAA 2VLJA 4GS7C 1CD8A 5HVFB 5EO1A 4OAWA 5ICZA 5I6XC 2UV3A 1IM3A 3MUY1 1W8NA 2VLRD 4I5BA 1ZV5A 4QY8B 2NY5L 3DX9A 3MRPA 4HS3A 3BHBB 3SDXF 2P8LB 5DD3L 1CCZA 4U1HA 2H9GA 1XIWD 5IB1B 4DGVH 1WQVT 4JLRA 2D31B 3GJFK 1TVDA 4JHWL 3MBXH 5F8RC 5EO0B 3O41A 1X5ZA 2ICEB 2KKQA 3QNYA 3UTPE 3RI5F 3OAUL 2UYLB 1UZ8A 3MOAH 3P73B 3HZVA 1CF8L 2N1KA 4JFDE 1YY8A 2N4IA 3NGBB 1T66D 5JDJA 3GSRA 1JGUL 3OHXB 3WIFA 4J23A 1TJIL 3ALWA 1WGOA 5KVEL 3ILQD 4IIQB 4QCIA 4WFGE 2R69L 1DLFL 2DS4A 3BT2L 3QIWA 4OCSL 3KPSB 2IGFH 3IXTA 5GISL 2DQEL 4L1DA 3ZDXF 3MMEA 5BRZB 5EPMB 1A4KA 1XGPA 1XCQB 2VZSA 1IGYA 4FA8A 4YDIH 5JOPE 2UVEA 1J9CT 2WBKA 3OKNB 4UDUA 3MRCA 4J1UA 2NQCA 1DBML 3UC0L 3DMMA 5BJTA 4R7NB 5IROA 1U8NB 1C12A 1KB5B 3T0AA 3SDDC 5H35A 3HAEG 2F54B 2NY5H 2VLJE 4EXPX 4YHLL 2BVOA 5TQ0H 2LAAA 3DI3B 2A9NL 1UYWL 4GLRH 4OLXL 2GUOB 3I2CL 3PWNA 5FDYA 1YN7B 1YEGL 5IT2L 4TQEL 4JHWH 2BY3A 4ORZC 5IJKA 4LHUD 4OBRA 4PJXB 1KIRB 3HAEH 5HGAA 2Q6WA 1NUGA 3TH3T 3WLBA 1JGUH 4MA7H 4WNQB 3C09C 3BXNA 2XKNA 3NCEB 1TJIH 8FABB 1RFDL 4PLKC 2VMFA 5DR5L 5KVEH 1QNZL 3GJFA 1KELL 3MYJA 2EIDA 4RZCB 1EUUA 4H1LB 1NFIA 1PYWB 2R69H 4D9QD 1DLFH 2VKXA 4Z9KB 3GKWL 3BT2H 3V8OA 4OCSH 5L9DL 4GAJL 4I0KA 2BRQA 1I9IL 5GGRY 2QTEA 2DQEH 2BC4A 4PJ8C 2B39A 5JDSA 5C86A 3MJGX 3OKKA 2AEQL 4GG6A 2GJZB 4TUOB 2FIKB 4Z0BL 1DBMH 4CW1B 3UC0H 4JFED 3RVXC 1J1XH 5HHPB 1MJ7L 3RWDB 4IMKA 2H3NB 4Y2DA 4YHLH 2JJTA 3L95A 3L6FB 4MAUL 2GI7A 3QO0B 2A9NH 4YR6A 2OK0L 4OLXH 3I2CH 2IQ9H 1A3RH 3FT4B 2OZ4L 5IT2H 5IKCB 2APWA 5I17A 4NZUL 3QDHA 4EI5C 4GS7B 3IGAA 1Y6KR 2AQ2A 4OZHA 4R4BA 1AKJB 4D2NA 3P9MA 3STZB 4PG9A 4WFHE 3IS0X 4S0SD 3IDGA 5LCVL 1U91B 2C4FT 4JRXA 1RFDH 4LCCA 4M6ML 5DR5H 2CRZA 3V5KA 1QNZH 1UEYA 3REWB 3SBWC 3LDBC 3DETD 1CDUA 4UDTA 5D7IE 5BMFL 3HPLA 3GKWH 4OLEA 4GAJH 3BKMH 3WS3B 1MFEL 1FYTD 1I9IH 2VDKL 3ARFB 1QSEB 3IJHB 2AEQH 4JPKL 4GRLD 3FTGB 1HZHL 3RU8L 1F6FB 5FOBB 1FAIL 1N0XL 1MJ7H 5CBEB 1CFQB 2VR5A 2H1PL 3MUJA 5D1QC 3Q6FA 3C08L 4JPWH 4MAUH 4PPTA 1NCAL 2OK0H 4ONOA 5CZVH 1MHPL 4QRPD 5HPMB 5DVMA 3RBSA 5EC1A 4NZUH 3SCMA 3VXRD 3HZMA 1NEZB 1AFVH 3T0WA 3OKLA 3SE9L 1WAAA 3SE4A 4L3AA 3I9GL 3IFOA 5F7DB 5E94B 3S3PA 3SGKC 1C5DA 3SDDB 5EN2A 5EOTA 5LCVH 3W11C 4ZFZB 1RAMA 5CD5D 2JJUA 1CGTA 1DFBL 4U1NA 1KPRB 5IJVA 5BMFH 1FBIL 1E27A 1KJ2A 4JRXE 3DUSA 1JI1A 4LLAA 1D5IL 5IR1A 1OTTC 1YECL 3WDJA 1R3HA 1OB1B 2VDKH 1Y6MR 2Z93B 3DVGB 2BSRB 5GZNC 2VZ1A 4JPKH 3JV4B 2R2HB 5FFLA 1GGUA 1D5MB 1HZHH 4QRUB 2EDKA 4MCZA 3VFGL 2O5ZL 1FAIH 1JZ3A 3Q3GB 2ADFL 1S7WA 1FE8L 3QDJE 4FZ8L 2H1PH 4FXGB 4IDJL 2FEDD 4RNRA 4NQEB 5KSAD 4JM2B 3C08H 2A77L 3BVNB 2V2XB 4H1LG 3UJIL 3ULVD 1NCAH 4HD9A 1MHPH 1RUQL 3EOYG 1IM9D 1FNLA 5HDBF 1BIHA 1ZT7B 1D5BA 4PJ8B 4APQD 4H88L 4LGPB 5AZEL 2IPUK 2F53A 3SDAD 2P7TB 1JV5A 4FQJL 4F9LA 4H1LH 3I9GH 1P4IH 4G8IA 4Y2DC 2JJTC 1IAOB 2IH3A 2RBLA 4KI5D 4OGZA 1A64A 3MGOB 4JY4B 4W70A 3I3EA 2GITB 3BIAX 1TPXB 5D7LD 2VQ1B 4HJ0D 4XNMA 1WAAE 3BZ4A 1S78D 3OGCA 3S3SA 3C2AL 2PXYD 3MRJB 2IEPA 5EORL 2KH2B 1OOAA 1DCLA 4GW5A 4IBLT 1FBIH 4OAWB 4EI5B 1D5IH 3RX8A 1T6VN 1YECH 3UZEA 2AAVA 4I5BB 5D71L 3ZE2F 5BS0D 5JUEL 1EFXB 2CKNA 1FIGL 3H0TA 4LCCC 3C5JB 3QIBA 5JA9A 1NGPL 2OL3B 3BP5B 3G9VA 3GIZL 3EDJA 3VFGH 2O5ZH 1G7PB 1HKFA 1OGAE 2QADD 5D7JD 2ADFH 3MLPA 1FE8H 4E41B 4XBPB 4FZ8H 4IDJH 3VD5A 2CKBA 3LDBB 2A77H 3DUUA 1WZMA 5CGYC 5IB4B 2NY1C 2Z92A 3UJIH 4NO3A 5HDQL 1RUQH 3UBXA 1G7JB 5DK2A 3FB6B 4YC2C 1NAMB 3VXMB 5DWUH 4NQSA 1XGYL 5AZEH 1OWWA 1UXSA 2BXZA 3GBMH 5H94A 4FQJH 1DLHB 1JI2A 2WAHA 4X6DF 4G9FB 2LFGA 4LFHG 3NIFE 4XPBL 4JHAH 3U2SB 2F53E 2EO9A 2FZ3A 5D1QB 1WBZA 2VL4A 4HHAB 4KZEL 2Z31B 3O0RL 4MCYA 5E1HB 4XAWL 3OR6A 3O9WA 5EORH 3P4OB 3G6JB 5E03A 4NKDA 2VDML 4L9LA 4DN3L 5DD6A 35C8H 4MJIE 2XTJD 2A73A 5HHME 1NEZG 4CVWA 5BOPA 2D7TH 1NAKL 5D71H 1TTUA 1MEXL 3GRWA 1XF3A 5E2UL 2D03H 4PRPA 5B4MD 1FIGH 2FLRT 4K94L 3WO4C 4MA8L 2AK4D 4U1SB 5ESVB 2YC1B 4GJTB 2IADA 1IMHC 2A74A 1GOHA 4X4XA 3IAPA 1RULL 3MA7A 4GAFB 2XV6B 4NUGL 1ZT1B 3I02A 1MLCB 1IQWL 2AKRB 4PYHA 3IDNA 4K2UH 4EDWL 4PG2A 1LK3L 1R5VB 1RZJL 4JO3H 1ZHBB 2EDOA 3WLBB 2AEPL 5D7IB 3K4AA 4YE4L 5DC4B 1XH3A 4OF5A 4PJBA 1CDBA 1XGYH 1HHIB 4U6VL 5EO9B 3O3EA 3FRPA 4MMZC 5IMOA 4M1CC 3O4LD 3BUYA 4LCUB 1FHGA 2P8MB 2XNAA 4YEFA 4XPBH 1CU4L 3MBEB 3QIUA 3EFDH 1P69B 4YHNA 3MLTA 1CGUA 3EYOA 4KZEH 3O0RH 3KLHC 1IGJB 4XAWH 3BZDA 5K9KB 3JWOC 3P30L 1S7VB 3VCLA 2VDMH 2PO6D 4JO4H 2AJYL 5DT1L 4DN3H 4E5XA 5GGRA 1U8LB 3BAEL 4BSWA 1JPGA 2BZDA 3L7FA 1FLTX 4ZUSB 1R24A 1YMHA 1JMXA 5E2UH 3PNWA 32C2A 4MA8<