3P4OB

Crystal structure of h2-kb in complex with the mutant np205-lcmv-v3a epitope ytakypnl, an 8-mer modified peptide from the lcmv
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Crystal Structure of H2-Kb in complex with the mutant NP205-LCMV-V3A epitope YTAKYPNL, an 8-mer modified peptide from the LCMV
rcsb
source organism Mus musculus
total genus 13
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p4oB00
4EBQH 3O6FB 5KSUB 4OSUL 5F7YC 2AJVL 4G5ZL 4TPRL 4ZS6C 5EUOE 5DFVD 4G43B 2EE9A 3CFDB 1PKQB 3RY6A 3BKYL 1CLZH 1HZHH 2P5WB 5TDNB 3TVMC 5DJDA 3EOTL 5J1TC 4I2XE 4FXKB 4IRJA 1WUNT 3OAYH 5HJ3B 2V2TB 3OJDA 3T0AA 4W4NA 4LIQL 2YR3A 3ARBD 2A9MH 2C4XA 4DGIH 5EZIH 2UWEF 1CICA 4X7TA 4PG9B 3ARPA 1F4WH 3JWDH 3QXDA 3AU1B 3NABH 4J4PD 5J89A 1S9XB 1SMOA 5GGRY 3MCKB 2HVKB 3UJIH 1XGRB 2HVJA 4NBZB 2UWEE 4CW1B 1QFWI 1HN1A 1CE6A 1RVFL 1TDQA 3ZTJH 1MRCH 4MXWH 1E4XL 2KL6A 1K4CB 1P4LA 2AEQL 2JJVA 3OZ9H 3O2DA 1EIBA 4HW6A 4L3EB 4Q9BA 1A2YB 4OQ1A 2VDOL 5GS0H 5ANMA 2V6HA 2ICWA 3QDMD 2IH1A 3MLVH 2FH6A 4L8CB 1H15A 2XZQL 4HH9B 1L0YA 1MCOH 3GM0A 5I71C 3MBXL 2HN7B 4HCRL 5ACMA 3VJ6B 3P4OA 4K3DL 3VFUA 5EU6A 3C09C 1CXKA 1U8KB 1WICA 2IPUK 1XR9B 3D85B 1WF5A 5FF6A 2NY2D 1VHPA 2WP3T 3FOLB 4LARH 2FDBP 3Q5TA 1NCUA 2W9DH 4NN5B 5HHPB 2H2SC 5CWSB 1JYXA 2R1XB 3S88L 5HXMA 5JHDE 1NDMB 2F8OA 2VDPH 4ZXBA 2E9BA 1LEIB 5CSZB 1A4JB 4JRXD 5CBAB 2X4NA 3QIWB 1YEIL 2DKMA 3N1MC 4PR5B 1Z0MA 1FNEA 2YK1L 4DFHA 2Q7NA 4WVRA 4RZCB 2IG2H 3BDBA 4X4ME 5B39G 3UTSB 1X6LA 4HXBL 3TBWB 5EBWB 4Z18A 3C5ZA 4Y16A 5DJ8B 4UZGA 4U1KA 1M6OA 5JUEH 4UDTB 4X0KB 1PEZA 4RX4A 1PYWA 4NBXB 1AGDB 1YYLL 2C7UB 1I8MA 5C6TH 4O4YL 3MYZA 2PTTA 4M61A 1QBLH 3MBEB 4JFEE 5TDOB 3SOBL 4DKFL 4F37F 1ZS8B 2BRRH 3RJDA 1P7KB 2DQEL 2C5DC 3EJYC 3FT3B 2RAMA 4JRYD 3K2UL 4LLYA 4JQXC 3V4UH 3CLEH 3MCLH 4I9WD 1CIUA 5IFHH 1DE4B 3DX7A 1BPVA 4V1DA 5FDWB 3TBYA 5B22A 1CFTB 2BSTB 1FORL 2GJZA 3OQ3B 1E4JA 5GS3A 2A6KA 4DGVH 1FZJB 1X3DA 4P0DA 4RAHA 5HPMA 1QEWB 4YHZH 4XC3L 4PRNB 4PB9H 3FFCA 1JTTA 2A1WH 2CDEB 4EOWL 5JIPA 1NBYA 5ISZE 4HWZA 2XT1B 3VG9B 5I1JL 4U7SA 2EKSA 4U3HA 3TO2A 1YEJL 4Q2ZB 3Q6FA 2AJ3A 5EORL 3O2DL 5L2JA 4ONGL 2J5LC 4RMVA 4UQ3B 5DJAB 3WL9A 5F1KC 5HGHB 3MOAH 2A83A 3DX6B 4NO3B 1G6RH 4JDTL 3S96A 4JDZB 4S10A 4M93B 2AJSH 4J23A 4D0CB 3E8UH 5I8CA 3V5KA 4OKVB 2FJFA 4RFOL 5ICXB 5J1SC 1SYVB 3TJEL 4OFVA 4UTAH 3VWKA 4L3AA 4XPFH 4Z7VA 3JV5A 3PF2A 2R9HC 3LN4B 3W11C 4U0QB 3EYOB 3GJFA 3P9MA 1LQSR 4MA3B 4ZS7L 3WXVH 2VXUH 3KPPB 3EFFB 4XCCH 3GBNL 4PRPD 3VFVB 2DLIA 5H8DA 4XTRC 1AXTH 1TVDA 4E42A 3SE9H 4L29A 3AB0C 4M03A 5BJTA 4ETQB 1J12A 4I18C 5IT2H 1NCCH 4DEPC 1HDMA 1N6QH 2NY6C 3R4DA 4G7YH 5FYLD 5KZCD 4MWFA 4TVSa 3Q1SH 3U9PL 2J1KA 3B9KB 3P4LA 35C8L 2GTWA 4DZBA 3S34H 4BFEA 1BD2A 2NXYB 4GKSB 4RQQB 5DO2C 1MJUL 1JWMA 4WHTA 5E6YA 5F21B 3UCRA 5FO8B 3BO8A 4G9DA 1ADQL 4K7PX 4UOW0 4FQXB 3WFHB 5IEHA 1Q9LB 1YY8B 4F7PB 2DQGH 1SM3H 1YN7B 4AY0A 4F8QA 1T3FB 1PSKH 4PGJA 4JFPA 2E3VA 4R4BA 1JUFB 3EO0B 5BV7B 4KKAC 1KLGB 4RMUA 2OJZL 1QUNA 3FQRB 1MCDA 4LLDA 4G8GE 1RJYA 1SJVA 2IH3B 3H2WA 3SCMB 1QD0A 4MJ6B 1MRFH 3C9NB 4PJGB 3T3PF 5D6DA 2DLTA 4GBXD 3TCXA 4Y2DD 2R2EB 4XZUB 3PNWB 5LAXB 4EI5A 4B5EA 5FO7A 1MQKH 2CKBA 3ARTA 4WUUD 4F9PC 1OGAA 5F9WB 5C0RH 2BVYA 3BI9X 1BBJB 4P3DB 2J3SA 3T3PE 2LU4A 4ISVA 5JMRA 1SY6L 2VABB 3LQAC 4QY8A 5B3JE 4KTDL 2AV1B 2GYSA 1NC4B 3O6MH 5E6ID 4WW2A 1YA5A 1T20A 1NDGA 4HFWB 3DSNA 4ZUSA 3ARFB 2DJ4A 4HG4K 4XWGH 2PO6D 4KAQL 5J4MA 4P2RE 4J6RL 2ZNXA 4TOYH 1A6TB 4YBQD 4J2XA 5ICZA 2ICCA 4GS7C 5DGQA 3B5HA 4KJWD 1UJ3C 4JHAH 4WJ5A 5GZND 3RTQD 3K2MC 3QDJA 4QWWC 4D3CL 1NEUA 1REIA 4I3GA 3FMGH 1M71B 3PIQA 2VKXA 1BM3H 4IIQC 5IB2B 3RY5A 3IVKB 1IEHA 4OLXH 1WLHA 4R7DB 1WWBX 5AZEH 1OWRM 1EPFA 3O8XA 4UTBL 2IMMA 2VLLB 5JO5A 2EDNA 2FL5B 1N6UA 4YHMH 1VFOA 2F58L 3D0LA 5FUOL 1KEGL 3FN0H 3VD5A 3VH8B 2HTLD 1U8OA 3IFOA 3KPRB 1AGBB 2F5AH 4NM8H 5M7QA 4I9WE 1C5DA 2MHAA 3TBTB 5IFJB 3L1OL 5E94A 3M1BA 5EU4B 2DBJA 1Z6JT 5DRNB 3OKEB 5E08H 5BMFH 3C8HA 1JNNH 5MHSD 2AGJL 4H0GA 4UI2A 4TUJA 2FR4A 4YXHL 1UA6H 4UOW1 2OR9L 4KUCF 2QJDA 5TE6L 1OP9A 4OCSL 5I1GL 3VFWA 1FBIL 1MF2L 5IF0B 5HHNB 5EBLA 2VC2H 1T1ZB 5LWYH 4KKLC 5CSGA 4O2CA 3ROOA 3O9WB 1J0JA 4RGNB 2WUBL 3EJJX 1H5BC 1R5VB 1UH4A 2J4WL 1MHEA 3LIZH 1IGIH 3KS0J 3GI9L 4JPVL 1PX4A 1DBAL 3WSQL 2H32A 1TIUA 2G5BB 3ARGC 3IJYB 5FKAA 3RPKA 3WO4C 3NCCB 4G42A 4M7JL 5DSCA 1ZLUK 1KT2B 1JNHA 4NWTH 5TH2A 3VXPB 4AENA 3DO7B 3SDXF 2DKSA 1J11A 3BDXA 2OTWB 5I6XC 1NFDA 5MERA 5L2KA 3T4YA 5I74C 3VFNA 5DMYA 4R2GC 4M6ML 3DVNB 4JRWA 2RR3A 4LAQL 3UTTD 2H9GA 3IFLH 3SDXE 1ZHLA 2JE8A 5J11B 1QTYT 4KROC 2OL3B 2B7DT 4PJBE 4WWKA 2VH5L 2ZPKL 3UTZB 4M7LT 1JGVH 4JKKA 1FNFA 1YEGL 3V6OA 3MRCB 4X8XA 4D8PB 1RZFL 1UB5A 1MFBL 2ESVD 4FOMA 5EWIL 1QO3B 3N1QC 4LNRA 3RGVD 1ZLUH 1G7JA 2G2RB 5FO9B 1E28A 2YOCA 4MA1B 5ETUB 1AH1A 4HK3N 3B43A 3FHAA 4MJ5A 5E8EB 3TBSB 3L5WB 3A67H 1V3JA 3MRMB 5K9QG 5ICYA 3WJLC 1FFNB 1AQKL 2KUTA 5CHNB 3ZHKA 3S37L 1KJVA 1WFUA 1ZEAL 1NC2B 4UINL 4BH7A 4LLWA 3GSWB 1RIVL 4P9HC 5TFSH 4PJEB 3QFJE 1FAIL 4U1NA 4M1CD 4OB5L 3S4SB 2AK4B 4PJXB 1MVFA 2X10A 1AI1L 1WIOA 3QXTA 1T6WA 3IB4A 3MV9D 4HGMA 5DHXB 4TNVK 2HLAB 4L8SC 3R06A 2ADIB 3GMMB 1A64A 2D0HA 2JF1A 4C58B 3EYUL 2H1PL 5IBTH 2EEBA 4J4PA 4OZHF 3BD5A 3ULUH 3HNVL 1KLFA 5KN5B 4Y4HB 2WBJD 3LB6D 2VXSL 3SKNB 3U7WH 1DANT 3I84A 5EU3B 1HKFA 3AAZA 3PL6A 4OZHE 4X6DF 1HEZB 1A1NB 1LVEA 5CZXC 1F00I 2G5RA 3UZEA 1HSAB 1MFCL 5I66B 2Q1EA 4HS6A 4X4XA 3QDMA 4YHLH 4WUUE 5DMGC 4X6DE 4WHCA 5DWUH 1FZOA 3T4AB 1BJ1H 5F9JA 2CDFB 2FYYA 5IW3A 2CPCA 1I8IA 1N6VA 4RGMC 3KHOA 2VSCA 3UROR 3LHPL 1Z3GL 2OP4H 1G9ML 3RY4A 2XN9D 4L8DB 1BMGA 2Q86B 1DLHB 3TNMA 4AIZA 1NGYB 3GJEB 3QNYA 3SO3B 4XWOC 5FYKU 4EDWL 3HC3L 1BQHG 3G5ZA 5E1AA 1M7DB 2FIKB 2IALA 5HHOE 1FDLL 5H94B 4K23H 1LO2L 4XNMB 2VXQL 1HILA 3RIAF 2R0KH 5IHUL 4LDOB 1CFVL 2VISA 1ZA6B 3QRGL 1HXMA 5T3ZH 3LDBC 1UVQB 1RZ7H 3RL1B 5GGTA 4CVWA 4JRXA 1KELL 2AI0L 4RIRA 3WIIH 2A0LD 3G9VA 3LKQB 3CVIL 3ES6A 3RU8L 3OKMA 3D48R 4BA8A 4FQ2L 1S7VA 1GGIH 3GSRB 1ITCA 1G0YR 2WINB 1HHHA 2UZXB 2B2XH 1AGEA 2OS7A 2ZCLL 3QZWG 2BVOB 4FQHA 3OKOB 5MHSE 1JRHH 1BFSA 3V8OA 2VLKD 4P59H 4M62L 4U2YA 4PTUA 4JVUA 5I1DB 5FGCB 3TJHC 5GXBB 4K3EH 4DK6A 3MRHB 1UCBH 1QYGH 4PUBL 4MNHB 3DV4A 3T0EC 3IGAB 4JRYA 2EH7L 1IQDB 5I17A 2ZUUA 2BNUA 2EZ0D 2VAAA 3DSFL 4RMSA 3EO1B 4O51B 4Y19D 3WBDA 2Y5TA 4Y1AB 3MJ8B 2YPLE 4MSWA 2E6QA 1RURH 3QA3B 3DRQB 4XVUD 5H2BB 3KPTA 3G5XB 2APVA 2CRZA 4EI6A 1CD1B 3WFCH 3VXTA 1UKSA 1GIGH 5CILL 2CDGB 2B5IB 3D6GA 4YK4C 4K7PY 1IGJB 3R8BB 4NNYA 4ZD3L 4EIZC 4G7VL 4XMPH 1P4BH 2AXHA 1AIFB 1XCQA 4X7SH 4LRIA 4K7PL 3HKFA 3HE6B 4W6XB 3VWJD 4HULB 1KC5L 3MXWH 3UTTE 4DQOL 2DB8A 5KG9B 4P23B 5F9OH 3VI3F 1HIMH 1A6AA 1FNAA 2Q20A 4XCFL 3W2DH 3RVUC 1MWAA 4OF6A 3RDTB 4JG1H 4LFHG 5DYOB 1IAMA 3ULVH 4UAOB 2VDLH 4WGVB 4ELMF 1KF9B 5IIEA 4NFDA 3LKRB 4PY7A 1TCRA 3VI3E 2JJTC 4PJHB 2LVEA 1MUJA 5GJSH 1VFAB 3MGOB 4KPHH 4ELME 4PRPA 4F57H 4XP9H 4OUOA 3IDNA 5KANI 3MRDB 3F62A 4JM2B 1T1YB 5HHMB 4PGEB 4LCUB 1TZIB 5I1IL 2H6PA 4X7FC 3N9GH 3BH8A 2F54D 5D7LB 5C0CE 3PP3K 3NFSL 2XKSA 3WLWC 3MV9E 1VGEH 5FGBC 5IHLB 4Y5VB 2QHLA 2OCFD 2XA8L 4Y4FB 5EIIA 2CSPA 3VGDA 4L5FL 1T80A 5JDSA 3WEXB 4YDIH 1MCCA 3BRDA 1A21A 1TMCB 2Z93B 2N7AA 1P2CA 4LEXH 4UIMA 4YR6A 3SGDH 1VCAA 2H32H 5JORA 3D3VB 3OPZL 5JXED 3FQNA 3F7YA 1CQYA 1QQDA 3WCYA 5MENE 4I13B 4N5ED 3B6SA 1BZQK 3RA7L 2LABA 2EXYD 2XY2A 3ARUA 1IC5H 4BSWB 3I9GL 3QIBC 4N9GA 2KZ1B 1U8NA 3KYMA 5CKAA 5I73B 5CD3B 1RU9L 1CDJA 4QRPE 3QXUA 3PDOA 2EICA 5SX4H 5L0QB 3LRSA 2FO4B 2XN9E 5I8OH 4NQEE 4GBXA 4HUMB 2L4OA 5F7UA 1B0GB 4QT5A 5FCSH 1FGNH 4QHNB 4I0PD 3SGKA 4OZ4B 5IVXA 3NFPA 4WIQA 5DEGB 1A6UL 3X17A 5E4IA 4ZFFA 5CEZH 4I48A 1F4YL 4XRCA 5IW6B 1GZPB 4Z0XA 1FYHB 3GIZH 4HT1H 5IG7B 4KRMB 1DQJB 1JNLH 3EGSB 1A6ZB 1AKJD 5HGAA 1YNLL 1NGPH 5E6IA 2FSEB 4MB5A 4ZG1A 1DUYB 4M8QA 3D9AH 3TH3T 1HK6A 3FB5B 3WS3B 2PO6A 3O3AB 2M8XA 1YEKL 1MWAL 5JXAL 1DBML 5AEAA 4KMTL 2EIDA 3T77B 5DEFB 3O41A 3RTQA 3RWGA 3SE8L 3QUZB 1ZVSB 5FOJA 4OGAD 1K3ZA 3O4LE 1ZHNA 3ZL4L 5HGGS 5DLMH 4S1SH 4X6FA 2W0PA 3BPCA 2XKUA 1YZZA 3E2HC 1G84A 3A0OA 3DURB 2YKLL 3GDBA 1WBYB 1BEYL 3K1DA 4F3FB 2AK1H 5D8JL 3MQIA 3ALPA 3FQTB 2NW3B 3QRFM 2O5XH 1C1EL 5FYLL 4LLVA 5BXFB 3O45A 3C87A 4LGSB 1BGXL 4AEIL 1CXLA 2XFXA 1NCBL 2B20A 5MEQA 2EDWA 4TNWF 2ZUWA 2HFEA 1QACA 3IS1X 3H9SB 1N4XL 4NIKB 4OCYH 4JR9H 1OHQA 2JIXB 5CMAA 2FJGA 4ZTPH 1RUPH 2VXTH 1IKFL 4H1LG 5EA0L 1FVCA 3FQWA 5AUMB 3IXTB 2P8PA 1S7UB 1CZ8L 5DDHB 3WO3B 1D6EB 2EDKA 3CK0L 2D2OA 3NZHL 4EUPB 3KYNA 1K4DB 4FTVB 1YMHB 1IQWL 3BGFB 3CVHB 3V6BR 2XTJE 3NGBB 1IAIM 3K1KC 3KJ6H 4QOKD 3U0WL 2V7NB 1GJIA 2BERA 2AABH 2IPTL 4XBPB 3KNBA 2F19L 4X6EB 5ID1B 2XQBH 4HFUH 5GGTH 4U6VH 3MMEB 5KVGH 2ERJC 4LK4A 5EULV 4PJ5D 2JCCB 2XA3A 2JB6B 1MY5A 3O81A 5D2NA 4NDMA 3UZVB 2HFTA 2EC9U 3OKLA 2R69L 4NUJB 3X12A 2ZNWA 5TDPA 4ODXB 5JR1H 1WVZA 2AEPL 3E0GA 1OGTB 4XNUH 1DBKL 1EXUA 3GB7A 4QEGA 4LU5L 3HCVB 1U8JB 1B0RB 5B39A 4TRPL 5AWNH 3U7AA 1GGTA 2CUMA 1P4IL 4YXKL 4Y4KB 5SWSB 1H3TA 1LGVA 1U3HB 3R8QA 5CLWA 4MHHI 5I1LA 3QAZB 1KPUA 2ESVA 3GGWA 2ZCKH 2F54E 3D87B 3RGVA 4R3SA 2GFBA 4QRTB 1LEKA 4FQ1H 4PLNC 3O2VH 2DAVA 3GMLA 5L8KB 4CNIA 1HYSD 4BQCA 3UJTL 2NY7H 2G9HB 3DO3A 5ACZA 3HNSL 4HC1L 1ZMYA 2MQCA 3FOMB 2J8UA 3TH2T 1PD6A 2X70A 4X5WB 5F7HA 3EDFA 4KRNA 2I60L 1BECA 2JJSC 5FKPA 1KFAL 2HT3C 5CJ5A 1DQTA 3UPRB 4R96A 2VQ1A 4NGHH 5J0BA 3RWEA 5J12B 4LSUH 1ZA3B 5CS7A 2EXWD 4UB0H 2DQFB 1S9VB 1KB9J 4PTTA 5CJXA 3WNOA 5CD5C 5FYJD 2WK2A 3FO9B 1EFQA 1N0XL 4OLZL 1PGRB 5IUSA 2CRMA 2WBJA 4P2QD 1TTGA 5D70L 1A14L 1GH7A 3RVXC 3VMOA 3O6KL 4TVPH 3IDYC 4UT6H 3DUSA 2PYED 4P4RB 4PGBA 3RRQA 4E41E 4JFDE 4YBHA 3E1F1 4WFED 2WANA 2XTJC 2PXYD 1IMHC 1IEBB 2ILLA 3CPLA 5IESL 1R3KB 1TCMA 3FTGB 4FFYL 1BZ7B 4LSPH 5GJTL 3GKWL 4XB7A 4YGVB 3F7VB 4X6BA 2HLFD 1RJLB 1Y6MR 5DUPL 5H37G 2BJMH 3VFOB 4LFHD 4N0CD 2HFGH 2R9HD 3W11D 2C3VB 4L3CB 5KJRH 4JREC 3QH3A 1BZ9B 1MH5B 2ADJA 4XCYB 4X6CF 1U91A 1CD9B 3WLBA 2X41A 1PZ5B 2E9WA 2R4SH 2ZOKB 3AM8C 2B4CH 2DQCL 3BEVA 4X80L 5B4MC 2CJUH 3MZGB 1N59B 2AP2A 4HBQA 1J8HB 2BSSB 5IBUB 5LJYH 3V7MA 2F5BL 2I07A 4ZAKC 5HYJE 5J13C 2W60B 3HC0B 1T7XA 4GAJL 4BZ2H 1TVHA 2ZG2A 5JW4N 3SY0A 3MJ9L 1TJIH 3LD8C 2NMSA 1MJ8H 2VLME 2X4PB 3L7FA 4WI6A 1ZVYA 5F8RC 5HGBB 3SN6N 1T04A 3FRUA 2GJ6B 4IM8A 3MRBB 2QQKL 1XIWD 5DK0B 1UG9A 3SJVD 4GW1A 1FSKB 3NMEA 4HJGB 3NACH 3UTPE 3WHXB 1L0XA 1LP9A 4PRDB 4QRSB 3V95A 5JQHC 2HMIC 1IAKA 4LLUA 5KSAB 1IKNC 3GRWA 5J7CC 1Q94B 3FB7B 4KDTA 5DD1L 2VLKA 3PHOA 5FAAA 1EMTH 4G6JH 4AIOA 1GHFH 1IGML 4WTWA 1QBMH 4HIIB 4KKAD 4Z0BL 1ODAA 4HBCL 3H3PL 3QIWD 3T0XA 3TN0B 4N8PA 1Y0LB 2IADB 4JFFE 1A6WL 5C9KA 5A16A 2VLJE 1A7QH 1K8IA 4Y19A 2HJFB 4M6AA 1BFOB 4MD4A 1TVBA 2Z4QA 5CEXA 1OTSD 3RAJL 3W9DA 1UM5L 4ZNEA 4O5LL 4PJ5E 4DN3H 3KYKH 4MB4A 1A7NL 5FUZL 3MNVB 1TJHH 4M1DH 3BYYA 3BZEB 1P7QB 5C8JB 2CIKA 1JZ3A 3F7PC 4APQC 1WZLA 1WEJH 2X1WL 5BQ7A 4ODWB 4WEBL 3VWJA 1ZTXH 3QUYD 5T5NG 3NN8A 1MFEH 3A6BH 1LE5B 2CH8A 4MAUH 4QWWD 4HUUB 4R90L 1IGCH 5FB8B 5D5ME 1D6VH 4LLQB 5E9DE 1TQCC 2A74A 2YWYA 4TULH 1NMAL 2AQ3A 2EDXA 1FYTD 2VL5B 2BVUA 3MLSH 5GZOC 1YEEH 5IV2A 1JHTB 3BHBB 2DWDA 4LLMB 3CH1A 4XBEH 1F6FB 3QCTL 3TO4C 2HG5A 3VGGA 2VTFA 3CFJA 3NAAH 4AH2A 3AREC 5E00A 5JW4M 1TPXB 4XNXL 4N8CH 1XF3B 2EE2A 4NPYA 3IXAA 2D03L 4U6YB 3GMQA 1L9NA 4OFDA 4XNZB 4Y5XC 4IS6B 1IM9D 1EEZB 2R23A 3X13A 4QHUA 3O6LL 3UJJL 1U92B 2EDRA 2DM3A 1ZWIB 5J6GB 1E6OH 1FZMA 4YHYB 2VXVH 4ODHL 1I1YB 3ROLA 1DR9A 3CU7A 1D9KD 1GRWA 5K9OB 4ZNCD 3EFDH 3ETBF 4NFCA 4KKLD 4KH2A 5AAWA 5CGYD 5C0BB 4PJ9C 1V7ML 4KRPC 4GW4A 1S7QA 4WU5A 3VXSD 3DMMB 1ZLSH 2X89D 3S5LG 4YX2L 3SGJC 3QDGB 3MR9A 4Z7UB 1U8LA 2LFGA 5FA4A 1PKQE 4UNTA 1IC7L 5DFTA 5EZOH 2P5WE 1CFNB 2AXFA 2BVQA 4WU7A 3RPIA 5M95B 3BISA 3V52H 3ARGD 1R3HB 2YBRA 2APFA 4H25A 1RZ8B 1H0DB 1QFWM 3U82B 4YDVB 1A7RH 3K4AA 2NY1B 3KYOB 5LXGL 3CZFB 1ZSDA 3ZT6A 2R0ZH 2YN5A 2ZUQC 3OV6A 5KVDH 2E9JA 1ACYH 1KEML 2BZDA 4Q9QL 3OKYA 4DVRL 1QLEH 3ISWA 3SKOB 4ZFGL 1QLRA 4KU1A 3U1SL 5FYKE 4OKDA 1JFQL 1CFSB 4LBEA 4OGZA 2QSCH 4Y5YB 4RRPG 4I0PA 2BY2A 1G7MA 5C09B 1CLOH 2UVEA 5EU7E 4L3EE 3BP5A 1OWWA 3BZ4A 4HUXA 2O5ZH 5C07B 2QV2A 1TNMA 3GSNL 3C8KB 4OM1H 1AKJA 3F5WB 1IM3B 4Y8DC 5KVEL 2GUOB 5D9SB 1INDL 4LCWD 4UUJB 3BKCH 3F58H 1NFIB 1EAPB 4R6UA 4U6XB 3TM6A 5C0AB 4M5YL 2XKNA 1MEXL 2FATH 3BWAB 3KLHC 5HBBA 4YQXL 2ATPB 1LDPH 3BXNB 1MHCB 1KJ2A 3TVMA 4M7KH 3TWCL 4ESKA 2Z0BA 1GC1H 1WIUA 3TYGL 4NWUH 5CJOH 5FHAL 2FH8A 2GSGA 1UXSB 5ALBH 4X98A 1K5NB 2DF3A 5CZVH 1FNSH 2X4SB 3I50H 3MLWL 1MREH 4K94C 1F58L 1G6RB 4MDJB 1UWXK 3CMGA 4R8WL 5HHVL 4YC2C 4QGYA 1EUTA 4RWYL 3RL2B 4X8JB 4F7EA 1JGUL 3EDEA 3KPSB 1AR2A 3IRZA 3DIFA 1T0NB 3TT1L 4Z7NF 1YEFL 4OSUH 3LKPB 3QHZL 1G7QB 4I5BB 2F53D 5C86A 2YS4A 5JW4Q 3O6FC 3G6DH 5TGBA 5FUCC 1S9WB 3C2SA 1DQML 1FZKA 3UTSE 3BKYH 3HR5B 4KHTL 4BUHA 3U83A 1Q9OB 4AG4H 2MCPH 4Z7NE 3EOTH 4QF1B 2QTEA 3GZKA 3SKUD 5C08D 4K8RL 1HHIA 2Z31D 4JO1H 3MACL 1UWXH 4M1GL 4BSVA 4GQPH 3GUTA 1KENL 1T03L 4U0RC 3WIFA 1S8DB 4QXGH 4NRZA 5BO1L 4JFZH 1QFUL 4P2CG 4WO4B 5GGQH 3B9VA 1CGTA 2AXGB 5KW9H 1BQHA 4QOKA 2BNQB 3OX8B 4YNYB 5IB5A 3F65A 3LKNB 4LSSL 4XXDB 4GAGH 3TCLA 2GAZA 4KK5D 3DBXB 1CXFA 5SV3A 2F8XC 4NZRL 1DFBH 3K80A 4HWEH 1OARL 3K8MA 3VXMB 1MHHA 4ZODA 3V8CA 4HCRH 3G6JA 5BW7A 3QCVH 1S7TA 3MFGB 2BHUA 4AZ8A 1E4KC 5GRVK 3P11H 3GRWH 5SWQB 1IL1A 3IDMA 5D1XB 1Q9WB 4BQ9A 1RFDL 4RGND 3ZTNH 2N7BA 2H3NA 2P7TA 2XQYG 1L7TH 5MEOA 4GXVH 1WJ3A 4PGCA 4I2XA 2Y36L 2QL1A 1FLRH 1MCKA 3OXSB 1B90A 3QZWA 4BM7A 1EZVX 3QJHB 3A6CH 2HKHL 1EBAA 2H8PA 4FRWA 2DQTL 2CO7B 2DWEB 4YDJB 3VXRA 4NN5C 4NNXB 2G75B 5ITBL 4NRYB 4XHJD 2DMBA 5C0FB 1FE8L 2R56H 4I4WA 4LVNC 1N3NA 3T0ED 1QBBA 4Q58C 4K71C 2MMXA 4XC1L 1TTFA 2AS5M 4H0HB 5LCVL 2VZUA 4LSRH 15C8L 3TV3L 2ADFL 3HZYA 4XCEA 2BVPA 1X5FA 1IAOA 1X5XA 4JO2L 4JFXA 1KG0A 1L6XA 5I1HL 5DJDB 1JV5A 5D96C 3OGCA 1J0ZA 4U7MA 4IRJB 3VXNB 3EKCA 3OJDB 4D9LH 2NY5H 2UV3A 1CICB 1JI1A 2P47B 2H41A 3DXAD 1VKXA 4OLWL 4X7TB 3QXDB 4P2QA 5EOCJ 5I76A 4JANA 1BJ8A 4EN3C 4Z5RA 2PYEA 3MBEC 4PLJC 2HVJB 1NAML 5IVZA 4GLRI 3CXDH 1CE6B 2PXYA 3C08H 5I75B 1P4LB 3EOAA 3EW3B 3ZMRA 5E2UH 4FQIL 3E6FA 3SGDI 1N8ZA 1B4RA 1T1XA 5ANMB 3HS0A 4XC3H 1HKLL 3HLAA 2ICWB 12E8L 2IH1B 2VDML 4PD4J 4EOWH 5IP4A 3ILPA 4KK6C 1OPGL 4EEEA 4HIHA 2GT9A 3WFBH 1H15B 1BVLA 1OY3B 4PJGF 1WWCA 1IC4L 8CGTA 4Y4HD 3VG9C 3P4OB 4I77H 3VFUB 3QI9C 3QG7L 5DC9B 4NFBA 5EU6B 2QQQA 4OLYL 5HYQA 1IGYA 2FGWL 4PJGE 4RNRA 4GAYA 4XI5C 3L3IA 5FV1L 2Q3AA 5FF6B 4I18A 1JL8A 3TIDA 5JIHA 5BVPH 3S35L 4HMEA 4LHJB 2B0SL 3TJEH 2IGFH 4LRNH 4H8WC 4HIXH 2JB5H 3ME0A 3MSPA 5EOTA 2XPGA 4GRLC 1EEQA 1JPFA 4ZXBB 2BC4A 1LEGB 5JW4R 1DN0B 4FS0A 2NTFA 2V17L 3IYLW 2X4NB 1XIWA 4KKBD 1F8TL 2DQHL 4M48L 3SJVA 1FNEB 1ZGLM 1CBVL 3KPQA 2CLRA 4XAKD 4U05A 3C5ZB 4Y16B 2EECA 1NMCB 3OG6B 4U1KB 2P42B 1M6OB 3IJHA 4KGLA 1PYWB 1EO5A 1FIEA 4ZDHA 1L0QA 1XF4A 3FZUC 1I8MB 2IAMB 3U7YL 3NIFF 35C8H 3UO1L 4PS4L 2PTTB 2OTPA 4M61B 5HGDA 4G6FB 1N26A 4CJ0A 2XTLA 4K94L 4LLYB 4MA8L 3KPRE 5EBWA 2PW1A 1CVRA 3DX7B 3NIFE 4V1DB 3TBYB 4F8TA 4F9PA 4QLRA 1GGBH 3LPGA 3PDDA 1OM3L 2GJZB 3C5SA 3MOBH 5EFIA 1BQLH 2A6KB 2X44D 4FQXC 1NBYB 4PJIB 4HWZB 5TDOA 2D7PA 5DJ2A 2EKSB 3ZKNC 3LH2L 3TO2B 3Q6FB 2AJ3B 4M7LH 1II4E 5LBSL 1PX3A 2OJZH 5BV7C 5L2JB 1KLUA 1U42A 3MLUH 4NKDA 3QUYA 5I1CL 2JJWA 4RGNE 3KJ4B 2A83B 3S96B 4WHYG 4Y1AD 3K8KA 1FZJA 1TJGL 1OAUL 5EU5A 1K6QH 2GJJA 1XGPA 4IIQA 5I8CB 3V5KB 1U8HA 5B21A 1N5AA 2FX7L 2FJFB 1FYTA 2WNGA 3VWKB 3BYTA 4XP1H 4IDJL 1CF8H 1LO0L 4U1JA 3GJFB 2HRLA 2IBGA 5CGMA 3T1WA 3P9MB 1NLBL 4QTIH 3D69A 2RB8A 3J8F7 3ARFC 4Y0GA 3GI8L 1TZGL 1J8KA 1KN4H 1IM9A 4E42B 4L1HA 1U8IA 3S36X 1JNJA 4L29B 4J3SA 4O00A 3UYPA 2Z8RA 4NC1E 4MWFB 4ERSL 1D9KA 1BOGA 4UTBH 5IQ9A 4H1LA 1DLFL 3BJ91 4Z6AT 4PJEF 1U6AH 3NCMA 4PJXF 2R15A 3VXSA 2X89A 2B1AL 4DZBB 5GGVY 4ZUTA 3DPBA 5FCUL 2VDNH 4JM2D 1BD2B 1J1PL 1BHGA 3IDXH 2XG5A 3L1OH 1JWMB 4PJEE 3LKOA 3DVFA 4WHTB 2FBJL 3ARGA 2AK4E 4PJXE 2UYLA 5D7LD 3BO8B 4G9DB 5IEHB 2VZVA 3G5YA 2M2DA 1KGCD 2GCYA 1T22A 5F7NC 4GSDL 4IHOA 4PV9A 2GKIA 4YXHH 3BAEL 3P9LA 4JHBA 2RHEA 3SE3C 3GMNA 4JFPB 4R4BB 2A6DA 2QQNL 2FD6L 4LLDB 4N68A 1RJYB 5T33L 1U8PA 3BKJL 5CUSH 3ZKXC 3HI5H 4FG6C 5KANG 1CU4H 5F8QC 3O9WC 4POUB 2J88L 4NC0B 4EI5B 5MI0C 3WFHA 5FGSA 3GI9H 5CCKL 5FO7B 1M4KA 1HNFA 1BBDL 2FEEL 2PCPB 2VDRL 2CKBB 3QQ9C 1OGAB 5DD0H 1T3FA 2EO1A 2VZSA 4JO3H 1P9MA 4ISVB 4LCWA 3P0VH 2DLFL 5I8KH 4QY8B 4G8EA 3QEHA 2WV3A 3J7HA 3EHBC 1J18A 4WW2B 1T20B 1NDGB 4ZUSB 3VMPA 4Y2OA 4TYUA 5EC2A 2BP3A 2WWKO 5KS9F 5CJQL 5ICZB 5IJVA 5FK9A 3B2VL 3B5GA 4XX1E 5DHVA 4MQSB 5J11C 4WJ5B 4KI1A 4GQ9H 3QDJB 2VN7A 4H0IA 3DX8A 2HJLA 4NO5A 1HXYB 1GGYA 2E6JA 2V2WA 1KULA 2BVEA 5EWIH 5HI5C 3AY4C 1KIQA 1E6JL 1LO4L 3PIQB 5GSVA 5L9DL 5KS9E 1F90L 2VDQL 1I8LC 3V0WH 4GG6F 1HWHB 1EHLL 4HAGA 3O8XB 2WBKA 5JO5B 1EZVY 2F53A 5IB4A 1CYGA 3D0LB 3GMOB 1AQKH 4H8WL 5DD5L 5ESVA 4MQ7A 1U8OB 4YHOH 1I1CA 3IFOB 3QP3A 1CCZA 2HJKA 2IWGA 3MRLA 1C5DB 1AXSA 2MHAB 3HZMA 5E94B 3M1BB 4OB5H 3QUZD 1AI1H 1JPTH 4CU6A 4M6NL 1AC0A 5C08A 5K33A 5IB2A 3QQNA 4KWUA 1M7XA 2Z31A 1KIPA 4TUJB 1Q1JL 2FR4B 3BZDA 4F37K 2FL5A 1F4HA 1HCFX 5FGCE 2FJHA 4FQJH 1EBPA 5EBLB 5B4MD 3LY6A 5L88L 4KJYA 4L4TD 3CIQA 2QADD 4ZAKD 3ROOB 1G7PA 1IAIH 3THMH 4PB0L 4BELD 2R1WA 5DRNA 1WCQA 1MHEB 1T4KA 4Y1AE 3T0BA 3WIHA 3IDIA 2K1MA 2YMXH 1QHPA 4DTGL 2H32B 4KXZI 1T89C 2FHCA 3QWRD 5HYEA 4G42B 5DSCB 1JNHB 5TH2B 4AENB 2KZWA 4XP6L 3LHPH 3BRFA 5MERB 5L2KB 3D18B 3T4YB 3QO0A 5HVHB 2LQRA 1GOHA 1ZHBA 4LHUG 1EO8L 3I3BA 4PP1C 2H9GB 1J1OL 1ZHLB 2C9AA 1FDLH 4TSBL 4WWKB 2DDQL 4OD3L 4WTZA 1EA9C 1T5XA 1J0IA 4JKLA 1SEQL 1LO2H 5HVGB 2RJMA 4KI5F 2NY4B 4DCQA 3VXOA 2YA2A 5IHUH 1CS6A 1CFVH 4JLRA 3DO7A 1UB5B 1UEYA 1WAAF 5JOEA 5LGKA 3BP7A 3T0EA 2DMCA 1G7JB 1E28B 4B53A 4KI5E 4MJ5B 4Q0XL 2DS4A 4CU7A 3MRKA 3VRLF 5ICYB 1WAAE 1I9RL 3IJSA 4CN4A 2OL3A 1KJVB 1OF2A 3CFEA 5HHME 4BH7B 4Y4KD 4LLWB 4HKXA 3U46A 2A6IA 3EYSH 4U1NB 5TQ0L 2WLZA 1FC2D 5GRJH 2ZCLH 1N0LA 1XZ0A 5D7LE 1BVZA 2WZPD 3VRLE 4NNPH 4JQVC 2ORBH 3R06B 3N06B 3DXAA 2PR4H 4WW1A 2RFXA 3WN5A 3BN9D 3O4OC 5DMKA 1U58A 4GRWB 3K46A 3MLXH 1IT9L 5DJ6A 5CHNA 1IE5A 1S3KL 3D3VE 5D2LA 3GSWA 1A3RH 1U2HA 5CIPA 5JPNB 3AAZB 3PL6B 4S1QL 1EGJL 1HINH 4BZYA 2IEPA 3U2SA 2XZAH 4OQTH 4MHHG 4HS6B 1UM4L 3QDMB 1FPTL 4X4XB 2K7PA 4OIBA 3CZJA 2DYPB 2C1PA 4FXLA 2JJTA 2YPKA 2JJUA 1IZKA 1NSNH 1FZOB 3QISA 3DV6A 1KACB 5F9JB 2FYYB 1I85C 1UQSA 4GW5A 1I8IB 1FCCA 4YPGA 5A1AA 5EU3A 4K7PH 4XP4H 1PG7X 3TNMB 4AIZB 4Z95L 3QNYB 4PJ7B 4MCZA 4HKBA 2CRIA 4POZD 3HE6C 2NY2B 5E1AB 1YQVL 3QQ3A 2IALB 2R0LL 4POYA 4H1LH 2RIKA 2ZJSL 4P23C 3BOVA 1PW3A 1F3DH 3BQUD 1NCWL 2CKNA 1OLZA 4RMRA 1HILB 4A6YA 4PBXA 3T4AA 4PREA 2PUQT 2VISB 3VXUA 4DWHA 4UAOC 1HXMB 2UY7A 4F9LA 2VLRD 3OKKB 1SVZA 2Y7QA 3U4EA 4L8DA 4JRXB 1DL7L 4KRPD 5ELIA 1BFTA 4OCWL 4LF3A 4KI5C 4RIRB 5TPWL 1QA9A 4XPGH 1C5CL 1CK0L 4KQ4H 4LEOA 5EDXA 2L0DA 3ES6B 1YYML 3ZKMC 1PBYA 1S7VB 4LGPB 1CLYL 4ODVL 3SQOH 4KDVA 4W4OC 1DBBH 3P4NA 2R0WL 1RAMA 1JTOA 1HHHB 1JZ7A 1JGLL 3QIBA 2EDJA 4KUZH 5IB1A 1GGCL 1LDSA 4I3SH 3BN3B 3WMSA 5CAYB 4Y5VC 5HYSG 4L5FH 2OL3L 3HZKA 2GJ6D 5JA8B 5ILTH 1T7ZA 3DV4B 2FECL 1ZAGA 3D0VA 5I17B 2BNUB 2VAAB 2FRGP 1ZLWK 2FWOA 1BAFH 4RRPA 1R5WA 5J6HA 4JEGB 1VA9A 2Y5TB 4WDIA 4MSWB 5IQ7H 1JPSL 4H20H 43C9A 4EI6B 3H9SE 3MUJA 3VXTB 4P9HH 1RU9H 3MLRH 1S78D 1CGYA 1L4IA 4KTEH 5I73C 3M8OL 3HNTL 3L7EA 1IQDA 3QYCA 4NNYB 2HRPL 3BUTA 3ZYZA 1G9NL 5L0QC 1ZE3C 1XCQB 4FTVE 2A9NL 2JCCF 2D4FA 2BY3A 4LASL 4TUKL 5DRXA 1ZLWH 4JB9L 1AE6L 3L5IA 3WDIA 4AYFA 3VA6A 1WISA 4OGXL 4UV7H 3JSSA 3QT2A 4DKAA 5BS0E 3FRPG 1A6UH 1NAKL 5FIEA 4FFVC 3GO1L 1OTUD 1A6AB 1MWAB 2JCCE 5ITFA 5DR5L 1WZKA 1E4XI 3H3BC 3S97C 1N64L 4JY5L 1A3LL 5IIEB 1XT5A 1CWVA 4PY7B 1TCRB 4PPTA 5C2BL 2AJXL 4KZEL 3GNML 1MUJB 3BE1L 4WUKL 3UYRL 1P53A 4D9QD 5H37H 1DBMH 2X4RA 3IFPA 3C6LD 1OLLA 3QEGL 3IDNB 4PLKC 5E2VH 3SE8H 1X5LA 4NQTA 2I25N 5SWSE 1DTUA 3S8WA 4IJ3B 2H6PB 3BH8B 4PBWD 1T2JA 2EC9T 4QRPA 5KSBF 5DC0A 3NZ8A 5C7XL 2QQLH 4IRZL 3OL2A 5EIIB 2EH8L 5GS0D 2PKDA 3OTTA 5JDSB 3MV01 4PJFF 1CR9L 2YKLH 3W9EA 4HGKC 5J1AA 3WFDH 3VH8G 1P2CB 4YR6B 4UIMB 5D8JH 5KSBE 2YD8A 5JORB 3FQNB 5ERWA 4MDIA 4OZFA 3F7YB 1RQ5A 3E6HB 3TBVB 1FL6A 1YNTA 4OCRL 1QQDB 3B6SB 3LPWA 4AEIH 1R3IH 2OR7A 1B0WA 3Q48A 4L4VD 5I1EL 3BW9A 2FX8H 1CFQB 3BKML 2EDQA 3LSOA 5DRZA 2DD8L 4N9GB 4RGOL 1U8NB 3X3GL 1H3XA 3WFEL 25C8H 3PDOB 4HWUA 4MD0B 3LRSB 3T2NL 2P8LA 2IQ9H 1AJ7H 1X5JA 4MJID 4LSQH 4GBXB 4HJ0C 1A6VH 4QT5B 3DVGA 5KVFL 2F19H 4HQQL 1MCRA 5IVXB 3NFPB 2LAAA 1F02I 3QXAA 4ZFFB 2W0FA 4XRCB 3BP6B 3NCJL 4Z0XB 4M6OL 5CGTA 1NBZA 1OT2A 2D7TL 2R69H 1MCNA 4XPAH 5DK2A 3QQ4A 3I3DA 5HGAB 4P5TD 4KQ3L 3FT2A 2WIIA 5E6IB 5ALCL 4M8QB 1JPST 1DUZA 2MJWA 2PO6B 1I3GL 3FQUA 1J8HE 4JZJC 5C09D 2HT4D 2YZ8A 1OAKH 4CVXA 4U1MA 3KVQA 3O41B 3RTQB 3RWGB 1FV1A 2BSED 3RIAK 3MRFA 1DQJA 1HQRA 1U3HC 1ZHNB 2DL2A 3ZT5A 1GCFA 5C0JA 1ULVA 3I75A 5FM8A 5EIVA 4TUOA 1EHAA 4X6FB 3BPCB 4DKEL 4KTYA 4U4BA 4R9HA 3UJTH 5DUMH 2CK0L 3VW3H 2GJ6E 2ENSA 3QPXH 4R4FH 4KZDH 3HNSH 3HE7C 5HHXL 4GJTB 3OR6A 3MLZL 4LDEB 2I60H 4KK9D 4LLVB 4N1CA 4PJ8D 3CFIC 3LN5A 2XFXB 5I19H 3ILQD 5MEQB 4LQFH 4IMKC 4OF0A 5F7MC 3QIUC 2HFEB 3VGFA 1MI5B 5J12C 4XVJH 3VFTA 3LQZA 4WTXA 1YEHL 1N0XH 5CMAB 2FJGB 5TE4L 1I9JH 1A14H 1FVCB 1KB5A 2WMPA 3FQWB 4RWHA 4CVZA 2P8PB 4L4TA 4ZAKA 3BGMA 3KYNB 2CUHA 2KQNA 4A6YH 1MFDH 3MRNA 1A0QL 4LPXA 5INDA 5SX5H 5GGSA 3KNBB 5D7IF 3WS6C 1DVFD 5DUPH 5D2NB 4GRLD 2XZCH 4NDMB 2YUZA 3F12A 4HWBA 3OKLB 1FL5A 3X12B 5TDPB 5E5MA 2NCMA 2FB4H 3SGEI 4EUPA 1FC1A 2FEDC 2DQCH 1G7IA 4X80H 4BYHA 1JPGA 3GB7B 2OK0H 5F6HJ 3ARZA 2BNQD 3T8XA 1IBGL 2ZKHL 1EJ6A 3EDDA 3LVEA 4XX1G 5B39B 1PZUB 2J2ZA 1IKNA 4YE4H 4ZTOL 2W65A 2ICWJ 3QXWA 2BOCA 4HG4J 3OB8A 2P5ED 4KRLB 4XAWH 5A2IH 5IGXL 1E4WH 2VYRE 4Q9RL 3IT8D 5I1LB 4KJQC 1KPUB 1EERB 2ESVB 3MJ9H 3GGWB 1FP5A 4R3SB 2GFBB 3RGVB 3FZUD 1UACL 1LEKB 3R0MA 4HIEA 2Y1VA 4CBPA 3HG1E 3O11A 3T3MF 3GMLB 3I2CL 1WFTA 1I7ZA 1RUAH 2K9UA 2QQKH 4ZFOA 1WIPA 5D1XD 3ZLQC 5ACZB 3IU3A 2C3WA 5HSFA 5DQDL 2J8UB 1T66D 1G0XA 5D71H 4BQ6A 2X70B 5I18L 2VOTA 3V4VL 5IROC 4R96B 2VQ1B 1KTLA 3RWEB 4XVTL 5EBMA 1JVKA 1HI6A 1MCWW 1RZJC 2MPAL 1OOAA 4R7NA 5IVOA 4I1NB 4PTTB 1QKZL 4APQA 2ZUXA 2FBOJ 1TQBC 5AZ2L 2WBJB 4HHAA 3I6LE 2NNAA 5C0BE 4JPKL 3L3OA 4DN4H 3DUSB 3B3IA 1V7NL 1A6WH 3SEPA 4PGBB 4CGTA 3BPLB 3QDGE 4JHWH 4X6CA 4Z7UE 2XNAA 5C0GB 3D5OF 3LS5H 5DD3L 4CDGC 1A02N 4YBLC 1CD0A 3CPLB 5FDYA 3HB3D 4FN0A 1UM5H 2DQJL 4UT7H 4P9MH 1KB5L 4O5LH 1QP1A 4WI8A 4X6BB 2FLRT 1W0WB 4QXUH 3JWOC 1MNUL 4ODSH 1XGQA 3BH9A 1CG9A 1INEH 2NY0C 3EIFA 3QH3B 3STZA 3WLBB 3AREA 5DUBA 4U6TA 4NN6B 4LCCA 3BEVB 5ESQA 1C08A 1OB1A 1C5BH 1B2WL 4M4RA 5E5UB 1PQZA 2I07B 5JZ7C 1I4FA 4BH8A 1ZANH 3L5XL 1MHPH 3BQUA 3AS1A 5C07E 1NMAH 1TVHB 4NUGH 3M17A 4C83A 4L3CA 2J6EL 5GQBA 3CVHL 1TTUA 4LVOB 4UQ2A 3OJ2C 3SY0B 4LSTL 4CMHB 2VLRA 2XQYK 4F2MA 4XXCA 1D5XA 3QCTH 4G8IA 1JHLL 4MA7L 5C0AE 1MJ7H 1T04B 3FRUB 3SGJA 3HR6A 1JZ8A 3EUUA 1UM6H 3CH8A 4GW1B 2BDNL 3IU4H 3JBG7 1TPXC 2CUIA 5L6YL 1FCGA 1LP9B 4HV8A 6FABL 4PJAB 4XNZC 5I15L 1IAKB 4HLJA 4LLUB 4YDKH 1N7MH 3JVGC 3JUYA 4JG0L 4M02A 2WM0A 1UWEL 3K74B 2VLKB 3PHOB 2G60L 4ZXBD 1HH6A 4YHYC 4QNPF 4W81A 3KPSE 2YD2A 3MXVH 4S11A 4LIQE 5EO1A 2XOTA 5ACLA 1BJ1J 1KCVH 2EIZA 3VRJA 3WHXA 3D39E 5DJZA 1YNKL 5A16B 4OF7A 4QNPE 2YSSA 3DMMC 3MUY1 2APTA 4P3CL 1K8IB 4Y19B 2GK2A 3C5ZD 4MD4B 1A1OA 1FN4A 1TVBB 2Z4QB 1Q94A 3QDAA 4LOUC 5CEXB 4Z7OF 2X4OA 3W9DB 5I30L 4J3WA 2NPLX 3P73A 2IAMD 2NY1C 3MV7A 3H8NA 1F6LL 3F8UB 3EHBD 4JPIA 4Z7OE 4G6FD 2R29H 1VPOL 2CIKB 3AS0A 4XMKH 3U1SH 1J9CT 3HMXA 5JQ6H 5BQ7B 1CQKA 1JJUA 3VWJB 4G6MH 2BNQE 2CO6B 3NN8B 4GOSA 2Y06H 3GEWB 4YWGL 2CLVA 1SHMA 5HHQA 5F9AC 1U8QA 1IRAY 2Q7YA 1CL7L 1MOEA 4S0SD 3VXME 5C8JA 5KVEH 3GSUA 5IV2B 3P0GB 2A38A 4OT1H 2DWDB 3LCYA 3CH1B 3A6OA 3BVNA 4KKCC 1QOKA 2HG5B 3RVWD 3SDAC 5AYUL 3RUGA 3CFJB 1MCLA 2EDYA 4MCYA 3C6LA 4AH2B 1UEMA 2BY0A 5E00B 4BZ1L 3U30C 3ULUD 3IXAB 2E27L 3CDGA 5IFAL 3GMQB 3B2UC 4HXAL 3AROA 2R23B 3X13B 4QHUB 1GSMA 3CSPA 3RZCD 2BXZA 4JJ5A 1FZMB 3MLWH 5DJ0A 3NCBB 3ROLB 4QHKI 4DJMA 4M3JA 4OLVH 2HH0L 2V2XA 4ALAL 4XH2A 2HTKC 3X11A 3QHZH 3H42L 1S5HA 3DI3B 4PY8I 4GW4B 1S7QB 4WU5B 5BRZD 4DKDC 1DQMH 3MR9B 4QYOB 5HI3C 4HWBH 1U8LB 4LKCA 5FA4B 2DQUL 5E8DL 3WKNA 4BKLA 3ZE2F 3QUMH 5E24E 4FMFA 5IHBA 4YXLH 2AXFB 2BVQB 4WU7B 3RPIB 3RWIA 4L4VA 2YBRB 3HUJF 4H25B 2R2CA 2OZ4A 2WBWB 2CXKA 3EYQD 1V3MA 1E4KA 4XPHL 1EX0A 1FFPA 2EDBA 4AEHL 5GPRA 4MJIA 4KJPC 5D7JD 5E4EB 1ERNA 1QLRB 1NANI 1NEZA 3QEQD 3RI5F 1BD2D 4LHUA 5T3ZD 4WO4C 1CXIA 2Y5EA 4LBEB 1AO7A 2WUCH 3MV8A 1I9IL 1KBGL 3OAUL 4P4KD 4I0PB 1G7MB 1A1MA 1R3HA 3D2UD 2YZ1A 2VNCA 3BP5B 3BZ4B 4HUXB 2QHRL 4NZRH 4YDVA 2W92A 1RUML 5ANME 1ZKAA 2DQIL 2YD5A 3VRIA 2A77H 3HMXL 3NPSB 1JHKL 1AKJB 4P5TA 2CIIA 1HWGB 3RKDC 4K3JH 3ZZ1A 3D1MC 4EBQL 5C6PB 2UVFA 4ETYA 2XKNB 5EU6E 1H3WM 1X5HA 4Y5YA 3SHSA 2X1XR 5C09A 1KJ2B 3HTLX 4MVBC 1A9EA 1XGUA 1KOAA 3TVMB 4EI5D 4TTDD 2X4TA 1HZHL 4M7ZC 2E7BA 2GSGB 2A9ML 4DGIL 4X98B 4QRRD 4UIKH 1T7WA 2EYRA 4FQCH 2EDHA 4EN3A 1F4WL 3JWDL 4XPBH 2JELH 2BHZA 3QB7C 4WHYH 3BP4A 2ATPA 4HZLA 3T04D 3VGBA 2AQ1A 3UJIL 4EZMA 3HRPA 5T3XD 3FO2A 4S1RH 2ADFH 5TGBB 1EAJA 1TXKA 4G6AC 5L8LB 4MXWL 3OZ9L 1DSFH 1A3QA 2DIBA 4PJ8A 5I1HH 3QDJD 3RY6C 1NUFA 4U3XA 3O3BB 3CSBA 4NYLA 4IRJC 2V5YA 4EDXB 1HHIB 2JK5A 4HIJA 1MCOL 1CICC 4P46C 3QI9A 4BSVB 3BPOB 2HWZH 3C09B 5IMOA 3UPCA 3GUTB 2EO9A 1HSBA 4IEFB 3WIFB 4HPOH 4NP4H 4NRZB 4R26H 4AK1A 3C60D 1JZ6A 4WRLA 5JA9A 3T0VA 3GBMH 1BQHB 4QOKB 1DQDL 3DUHA 5IB5B 1GVIA 4V1DE 4G9FD 3TCLB 2GAZB 4BSJA 1QVOA 4FQIH 3L5JA 2ZSWA 1DVFA 1HHJA 4LARL 1N5YH 12E8H 4MNQD 4GRLA 1IFHH 1QFPA 1OPGH 2NY3D 2LTQB 5EN2A 3FFCE 4OZGA 4U2ZA 4CMMA 2VDPL 4FQQA 4J3UA 1MHHB 4NKOA 1ZV5A 3G6JB 4QHLA 1S7TB 4NKMA 4JCLA 1AR1D 5GSRA 4RFNB 2IMNA 3ZKMD 3VGEA 4XCNA 3IDMB 5C92A 3RWHA 2IG2L 3DBXA 5DHYA 5FA3A 2H3NB 2P7TB 2ZOLA 4LCYA 5MEOB 3OAZK 2P5EA 4PGCB 4Z7VF 5E5RB 4I2XB 4KY1H 2E8YA 3QZWB 1YECH 1AGFA 1CDHA 4N1HB 4AJ0A 1JMXA 3KG5A 4TNVF 3VXRB 3CCHA 5HDLA 4M00A 3OSKA 1FHGA 3BJLA 3HC4L 4Z7VE 2LV4A 4N0UA 5C6TL 5IEKA 4WNQA 4Q6IA 3WNMA 4I4WB 1N3NB 1QBLL 2V17H 3O0RH 4D9RE 3OJMB 2BRRL 1DP0A 5D1XA 2KH2B 2HT2D 3TFKC 1F8TH 3FN3A 3V4UL 4MMXC 1IEAA 2IF7A 3DECA 3MCLL 5LGHH 4PRHD 3HZYB 5IB3A 5IFHL 2AXJA 2BVPB 1IAOB 5GRYA 2IAND 4HDIA 4JFXB 1KG0B 5F72S 5KTEL 2NY4D 1JV5B 5F1IB 4Y16C 3OGCB 1JYWA 2AW2A 4YHZL 5IWLC 1NMCC 4E0RA 4PB9L 2A1WL 4P2OC 4B50A 5ADOH 1VKXB 1WBXA 4UDUA 2J5LB 5CEZD 4P2QB 5I76B 4JANB 4PYHA 1OAZL 3BPNC 4RISL 4JM4H 4WFHD 4JO4H 2EDFA 4Z5RB 2PYEB 5LVEA 4K94H 4MA8H 3RVVC 5JPMA 5IVZB 3L3DA 2PXYB 1BD2E 1J0HA 3DJ9A 4NQDA 1G6RL 4IBLT 1RK0A 2V5SA 2DMKA 4F58H 2AJSL 2IC2A 1OM3H 1I3VA 1OT1A 1YY9D 3EOAB 4X9BA 5DVLA 3VXNA 3VMNA 3E8UL 4KVNH 4Z78A 3E6FB 1N8ZB 4MS8C 1QSED 3JV4A 1T1XB 4PRID 3C6SA 3HS0B 3HLAB 4RAUA 5A2JH 3ILPB 4XPFL 4HIHB 2GT9B 1BVLB 1H3PL 4GMTH 5LBSH 4HS8L 5B38G 4H88L 3WXVL 2VXUL 1L6ZA 1ZHKA 3NVQA 5F89A 4X4YA 4NSKA 5I1CH 1QSVA 3PL6D 1IGYB 5HYQB 4RNRB 3W5NA 4GAYB 5DS8B 3L3IB 1GAFH 3AB0B 4X83A 4OLEA 4I18B 3KJ4C 3TIDB 4HMCA 2NY6B 1U95A 1X5GA 3IAQA 4X9GA 5DURB 5FYKH 5IT2L 2DYPD 4OCXH 1OGAE 2VZTA 4WW2F 1N6QL 4OTXH 4JFOA 4U1SA 3Q1SL 5EOTB 4IDJH 2XPGB 5ENWA 3VWKC 1JPFB 4BQBA 2BC4B 3ARWA 2Z8WC 1NCNA 2NTFB 2V9QA 4WFGD 1XIWB 4MZ3A 5DZOA 1XGTA 3SJVB 2AV7A 5F3HA 2OZ4H 3GI8H 5FM5M 3PQYD 3ARDD 1MCWM 3NTCH 3KPQB 2BNRD 2CLRB 3RX7A 4OV5A 3CMOH 1ZGLP 3S37X 1AHWC 3QDJE 1OSZA 5IHZA 4CAGA 5E70A 3SE3A 1BX2A 2DQGL 4X7CC 1SM3L 3IJHB 4ERSH 4MXVE 3ULVF 1LEGA 1PSKL 1KXTB 1DN0A 4ZDHB 1OSPL 1JN6A 1XF4B 5F7WC 1IC1A 4NZUH 5HGDB 1XF5A 3RNQA 4JZOA 4P3WA 4NQSA 5DD6A 3ULVE 3GMRA 2H45A 3TA3C 1JWSA 2PW1B 5F93C 3T1FA 5E03A 5GGVH 5F1SA 4P5KA 1MQKL 2MFNA 3P30L 3C5SB 5EFIB 4J12A 3F7RA 2DBLH 5C0RL 2ARJB 1U2CA 2DQDL 1YMMD 1O0VA 2BXYA 2IAMA 3P9WB 4R97C 3W39A 4JJHA 5DJ2B 3GK8H 5D1ZD 3O6ML 1AC6A 2FD6H 3MA7A 4YGAB 5T33H 1F3JA 2UUDK 1QRKA 1KLUB 3BKJH 4RAVA 1W2KT 3WYRA 3ARVA 4GS7B 4XWGL 4NKDB 4BFBD 1UJ3B 3QUYB 2I26N 4ODUA 4TOYL 2ITDA 1NH6A 5EIQA 5EU5B 3TYFA 1NGQH 1XGPB 4IIQB 1U8HB 1N5AB 3ZKQD 1FYTB 1NFDF 1BVKA 2XZZA 4PJIA 4QGTA 1BM3L 5JOPE 4OLXL 1I75A 2DLFH 3QPQD 1QRND 5AZEL 4G6KH 2EDDA 4U1JB 1BQSA 1LD9A 2C3XA 1NGWA 1CGVA 4HKZA 1NFDE 1X9QA 3FN0L 3D69B 2UUDH 3MA9H 5L2KE 4OJFH 4YFDB 1DQLH 4WW2C 2XICA 4J7RA 3MNWA 2F5AL 4NM8L 1VSCA 2W38A 1FO0A 1IM9B 5JW5A 4TVPD 3L3KA 3TT3L 3QIUD 4AEFA 1JZ2A 1U8IB 3VA2C 5D7KD 4D0DA 3RZCA 1U3JA 3V6OE 5JMOC 4BFGA 4NQUA 5L9DH 1E6JH 3GSXA 1OQOA 2JTDA 2NXZC 1F90H 3LEYH 1UA6L 1EHLH 1D9KB 3LEVH 1NL0H 1BOGB 1Q72H 5IQ9B 3VD4A 4H1LB 4Y89A 1X44A 1DN2A 1PFCA 2CGRL 2VC2L 3AUVA 5LWYL 3DVIA 3I6GA 3O8XC 4H8WH 1C12A 3BSZH 3VXSB 5BRZA 1I1RA 4ZUTB 1EVUA 1DBJL 3LIZL 5BZWA 5E2WH 1GL4B 3LKOB 4KK8C 4ZUVB 2COQA 1L7IH 4ENED 1T89A 3ARGB 5T5FH 3TZVC 3SDDD 2UYLB 4GRWF 3WO4B 2H2PD 3G5YB 2X9WA 2GCYB 1T22B 2YA0A 4HKJA 3V79C 5KOVC 5C0ND 4IHOB 5BVJA 1Q1JH 4PV9B 5E6ZA 5I6XB 4NWTL 3P9LB 3O3UN 4C56D 3GMNB 1B3JA 3BIAX 3FONA 3OKNA 2A6DB 4R2GB 3DROA 3MRPA 4GRWE 5D7JA 1CLCA 2FCBA 4ACPA 1KIUA 1UWGH 4GMSH 4HZAA 3S3PA 3QEQA 5T1KD 1QFHA 1U8PB 4NCC1 4PB0H 4KROB 3TGXA 4P4KA 3IFLL 5DVOA 4C57C 3D2UA 3LAFA 1UGNA 1G9MC 2APXA 4PLOB 1WITA 3QDME 3B4NA 2J8OA 3K0WA 3DETC 4UNUA 2ZUVA 4XP6H 3GFUA 4LCWB 1QPPA 4G8EB 3QEHB 4L9LC 3FAXA 1Q8MA 3ARYA 3H0TA 4GG6A 3WUWG 3QUXC 1ES0A 3AXLB 5EC2B 4BK4A 1G7LA 2E5EA 5B3JF 4TSBH 5TFSL 2PCPA 5BV7H 5IJVB 3NA9L 4OD3H 5FK9B 5DHVB 5SWZD 4JQVA 4WWKC 3DX8B 2HJLB 4NO5B 4YDLC 2V2WB 5F7EH 4QRRA 3T0WA 1KIQB 5GSVB 5DT1L 1TETH 2BOBA 5IBTL 5L7XL 3PWLA 4JRXE 1QSZA 4JKMA 3EJZC 2F53B 5IB4B 1X5AA 3C5JB 5JTWA 5GISH 5ESVB 4MQ7B 1MIMH 1OD9A 2HJKB 3MRLB 2NR6D 5DFVC 5F3BA 1AXSB 4HWNA 3HZMB 2VUOA 1JGEA 5EZJA 1HXYA 1RMFH 3KXFD 1S5IL 4X9FA 4YHLL 5C08B 4HD9A 1OAQH 1J7VR 3B9EA 3HAEG 4CDHA 1P6FA 3ARBC 2WAHA 1KXQE 2Z31B 5DWUL 3V0AC 1KIPB 1NLDL 2FJHB 1CDUA 2P46B 1MAJA 3GMOA 2OP4L 4JRYE 4KJYB 1S3KH 3C60A 5JHLH 4FFZH 1I3RA 1G7PB 4XHQA 4LHQB 3UBXA 4G3YL 3FB6A 4G9FA 2VO5A 2R1WB 5DA4A 1RSFA 3RGHA 2IQAA 5HVWA 1T4KB 4K23L 4I3RH 2NZ9D 1UM4H 3IDIB 1MI5D 4MNQA 3G04A 4LCIL 4MLIA 5IBLD 5C9JA 2OSLA 1BP3B 4ORZC 5DTFA 4W6WB 1AD9A 1F97A 1JYVA 3FQXA 1R0AH 2ZZUT 4Z95H 3QO0B 3UMTA 1ZHBB 3UDWA 1YQVH 4PBVC 2R0LH 2BRQA 1R3JA 2ATKA 2NY2C 1LO3L 2X6MA 1T5XB 4MMZC 4EIGB 1NCWH 2Y9RT 1KYOJ 2YA1A 5D7KE 4M43L 4DCQB 3VXOB 1JRHL 3OJVC 4JLRB 1ZT4A 2MWCA 4P59L 3K7UA 5DF0A 4JN2A 3BP7B 4PJBF 3T0EB 1UCBL 1QYGL 4MXQC 3D18A 2FLBT 1F11A 2CKBL 3OF6D 1KN2H 5TPWH 1SVCP 1E0OB 3MRKB 4PRHA 4TQEH 4PRPE 1UH3A 3IJSB 4FNLH 4ODVH 1OF2B 4LOUD 3CFEB 1OTTC 2IANA 3KYAA 4HKXB 3U46B 2A6IB 3IF1B 1RURL 4FFWD 3SDCC 2V5RA 1XZ0B 3CDCA 3WFCL 4YUEH 5FYLE 2VQUA 1RUQL 1OP3H 3DXAB 4HJJH 1FG2A 4WW1B 1WCBA 2RFXB 2NTSP 3WN5B 5C0EB 5DMKB 1U58B 1EHNA 5DJ6B 4XMPL 1P4BL 2MKWA 3S36H 3H3KA 3VXQA 5D2LB 1WWWX 4JVPA 1K3IA 2O5YH 5CIPB 3MXWL 2FNBA 5B8CA 3QBTB 1I1AD 3T0DA 1HIML 1QSEA 4ZFZA 3W2DL 1DQQA 3U2SB 5ABDE 4PRIA 4JG1L 2ED8A 3ULVL 1W72A 2C1PB 4RA3A 2YPKB 4CKVX 8FABA 1WQVT 4Y8AA 4XP5H 4WFFD 3SDAD 1FO0H 3DV6B 4PFEA 5FYJU 3O3EA 2HRPH 3MJ6A 2XACC 3FFDA 3X3FH 4PJCA 1UQSB 4GW5B 5IVXF 4YPGB 3SDYH 1G9NH 5GJSL 2A9NH 5F1NA 2SEBA 5JPNA 4KPHL 4K55A 4LASH 4F57L 4XP9L 4J1UA 2X1PA 4MCZB 4HKBB 3HFMH 4JY6A 3UTQA 1B88A 3L3GA 3QQ3B 5IVXE 3RWDA 2L7UA 3N9GL 2DYPA 1ZXQA 4URTB 3W82A 1JWUA 2DJUA 1SYSA 3LRGA 1VGEL 4A6YB 1F13A 2EDEA 4PREB 3VXUB 1A3LH 4MX7A 1CE1H 3CFCL 5J9PA 2Y7QB 2X4QA 3U4EB 2AJXH 4PJ7A 3BE1H 4LEXL 4WUKH 3MRRA 1MAMH 4LF3B 1OW0A 1QA9B 5HI3D 1I1FA 1J05A 3ARDA 3PQYA 4LEOB 4ZSOA 1ITBB 2BNRA 1LK2A 2EC8A 3ALWA 3MX0A 2YPLB 3P4NB 3MROA 5E8PA 4MZ2A 3QIBB 1IC5L 1F45A 5C71A 4R0LA 1UT9A 3OKKA 5IB1B 5C7XH 4XT1C 4GRMA 2VQTA 4NQVA 3HZKB 1CR9H 1NUNB 4IOFC 5HVFB 1KIRA 2P44B 3WJJC 5I8OL 2EKJA 3D0VB 5CZKA 2EYTA 4PGDA 1FL3A 2APWA 2FWOB 1FGNL 1R5WB 5J6HB 1H9VA 1ORSA 1AD0A 5GRWA 3ZYIA 1EJOH 4K2UL 4WDIB 1YMMA 5I1EH 2X09A 3MJ7A 3GIZL 4HT1L 4LSVH 4XPTH 1JNLL 2DD8H 43C9B 4RA0C 3X3GH 4OIAA 3CLFH 3FKUS 5D1ZA 2CK2A 1NGPL 5D72H 4U6HA 2YRPA 3KLDA 4UT9L 3L7EB 4O02H 3D9AL 4JZJA 1Z9MA 4N0FA 1VEMA 3NIDF 5I1KL 2BFVL 1T0PB 5DRXB 4GBXC 4HQQH 5K9JH 4Y2DC 3UXFA 3VFSA 5TE7H 3SGKC 4ONFL 3NIDE 4Z9KB 4FZEL 5T3XH 5ITFB 5DLML 4S1SL 3E2HB 5D2NE 4Z7WA 4WWID 4HK3J 1QRNA 1T7VA 1HHKA 2DN7A 3T2PA 3MRIB 4OI7A 4NQCD 5E6IC 5D1QD 5KSBA 5BOPA 4ORGA 2AK1L 2X4RB 4OCLC 4WV1A 1SEBA 2O5XL 1Y18A 3IFPB 2PO6C 3VD9A 4PJFA 1MJJA 4NZJA 4YBQC 4IMKA 3V6FA 3QIUA 5EZLB 2Y72A 4OLUL 2M1KA 4KJWC 2ZWLT 3RTQC 5GZNC 5D7SH 4NKIH 3P0YH 1NCDH 2ESVE 5ID0A 4PG2C 4OCYL 4CU8A 4OBRA 4P46D 4JR9L 4QRPB 3ZE1F 3NZ8B 1RUPL 2VXTL 3ZSTA 2CK0H 5JOFA 2F74A 1T21A 5A2FA 3W9EB 5J1AB 1E27A 1JF6A 4J3XA 3ZE0F 2E9IA 3ZE1E 2HTLC 5ERWB 4MDIB 4OZFB 2J8UE 4J8RA 1S7XA 4HH8A 1FL6B 1YNTB 4P57A 2ERJB 2AABL 2PW2A 3NCYS 3WS6A 4IRSC 2XQBL 4HFUL 4JFHD 5GGTL 3SDDA 5KVGL 5D93C 1RIUH 3ZE0E 4LPCA 4K3GA 4GLRH 1F4XH 3BW9B 3LSOB 1G7HA 3BT2H 5DRZB 4C56A 3Q6GL 1YEHH 1AQDA 3GHEH 5JR1L 3SKMA 5E99H 4WFFE 3EAKA 1X4YA 4JY4A 1F3RB 1HE7A 1C7SA 5T1KA 2P8LB 2C3HA 2GY7B 2NX5D 2Q8AH 2QSVA 3E6HA 4UV4H 3TBVA 3NFNA 4NHCL 4WCYH 3ZYOA 1DDHB 5AWNL 3DVGB 2Z92A 3PWPD 4DW2L 5BOZG 2Q6WA 2D0GA 3U4BH 1A5FH 4R4ND 3EOYG 3QXAB 1CFQA 2W0FB 1A7OH 4S1DD 4EVNA 4ODTL 3GIVA 2ZCKL 2GITA 5IMKA 3RBGA 1F6AA 1NBZB 3QUKA 1DEEA 2AJUL 4FQ1L 1GOFA 5DK2B 3QQ4B 4MD0A 1NKRA 1GOGA 3T65B 2NY7L 2WIIB 3FT2B 1MFAH 3P40A 4HGWA 1RHHA 1DUZB 1UXWA 3FQUB 1IBGH 4CVXB 3R0NA 2P4AB 3K81A 5SWZA 1VB9A 4U1MB 4DGYH 3BP6A 1FV1B 4Q9CA 3MRFB 1SQ2N 5EOQH 1KTKE 1Q0YH 1HQRB 4FXGB 3H6JA 2VKWA 1OCWH 1MCBA 2QBWA 5C0JB 4UB0L 3I75B 4HX1A 1PG7H 1UACH 4TUOB 4XMLH 1G9EA 1Z0NA 2WSKA 6CGTA 1SJXA 3PABA 4U1HA 1QR1A 1LP9F 4ZS6D 4RMQA 4TVPL 3SO5A 1SJEA 1I8KA 3JV6A 1X5ZA 1W72H 2IBBA 3TVMD 5E1HB 3T2QA 3OHXA 3OR6B 1LP9E 4MS8D 3KXFA 3KLAA 3FHQA 3LN5B 4LVEA 3IAGC 1AP2A 4KMQA 2BJML 3VFGH 1BQUA 2VLKE 2HFGL 3VFTB 2EIEA 5IMMB 5KJRL 1UYWH 5D7IA 3LQZB 3VDCA 4ZQKA 5CJXC 5B38A 4NRXA 1KB5B 4XNYH 4CVZB 2R4SL 4L4TB 2B4CL 2QADB 3LB6C 4U7KA 4ZAKB 2CJUL 3WFZA 3BGMB 2Q8BH 2D7NA 3MRNB 1A9BA 3BPLC 1QSFD 5INDB 4Y19E 1FNGA 3ZDXF 2ZCHH 5GGSB 1H8OA 4BZ2L 1MI5A 1FRGH 4LLAA 4DOHB 4ZNEE 1MNUH 3QCUH 1TJIL 1FNLA 1MJ8L 3F12B 3ZDXE 3W0WD 1J5OH 4IOIA 4K3HA 3BDYH 1FL5B 4HPYH 5F88A 4XVSL 5E5MB 4UNVA 3RWFA 1G7IB 1JPGB 5HDBF 1DCLA 2P43B 3NACL 4MAYC 1KTRL 3T8XB 3WKMH 3REWB 2GSIA 2IJ0C 2YXFA 3L5XH 2W65B 2H2SD 2BOCB 2D31A 4BJLA 1VGKB 2X5PA 4K7FA 5TQ2H 5HDBE 4FHBD 7FABH 4F33A 4G6JL 2YXMA 3SPVA 1LE9A 1GHFL 2ZUYA 1QBML 4HIEB 2FEEI 2QLVB 3O11B 5EH1A 4MA7H 3OF6A 4NJAH 2VDKH 1I7ZB 4ZFOB 4PRAA 4YHKH 2NZIA 3TPUA 3TA3D 4JFDB 2FX9L 1UKTA 2X1OA 3IU3B 3QR2A 3CD4A 5JLZA 5L6YH 1B4JH 1A7QL 1MCJA 3C8DA 4JDVA 5I15H 4RCAA 1KTLB 5DGRA 5EBMB 3VXRD 1HI6B 4DN3L 3KYKL 1GPOH 3OR7A 4NCC2 4OUUB 1TJHL 4R7NB 5A40E 3EJYD 4RBPK 4M1DL 2ZUSA 4APQB 1KCSH 4HK0A 3VG0H 3PJSA 4HHAB 2NNAB 1QR4A 1WEJL 2DL9A 5GS1A 2EDOA 3L3OB 3LMJH 3QHFH 1CTOA 1YNKH 3B3IB 2EZ0C 5HYJB 1QNZH 4X6CB 5FXCH 1GXEA 2XNAB 3A6BL 4AL8H 1I1AA 1UFUA 4YHIA 4MAUL 1D6VL 3CAFA 1V8HA 3QG6A 4K9EC 5I30H 1X5IA 5MP6L 3CFKB 2OYPA 1KCUH 3MLSL 1XGQB 3BH9B 1CG9B 3SDAA 4RBPH 4XBEL 5JIKA 4PY8J 3STZB 3AREB 4CL7A 5DUBB 3JTTA 1JMZA 3NAAL 4LCCB 1RUKL 4FA8A 5ESQB 5C0GA 1C08B 1OB1B 4N8CL 1NJ9A 3VWJC 1PQZB 5IKCA 3UC0H 1I4FB 4BH8B 1W0WA 3BQUB 1KJ3H 2NXZD 4HF5H 1FH5H 3M17B 4FZ8H 4NZTL 5JHDD 1RJZA 4C83B 1E6OL 2MCG1 2VXVL 4UQ2B 4JGUA 3SKJL 2BSRA 4KVCL 4OZIA 4FQLH 2VLRB 4YAQA 4F2MB 2CRYA 1D5XB 3EFDL 4G8IB 4KRPB 4OFYA 3HPLA 4XTRD 2AJYH 1C8PA 1J86A 1ZLSL 3ZHDA 2E6PA 2E27H 4MNGA 2ITCA 5IFAH 4OD1H 4HXAH 2NY6D 4HV8B 4WI4A 5DURD 3V52L 5GGRA 2C1OB 2CR3A 2F9BT 4O2FA 2QKIA 1A7RL 2V9TA 2R0ZL 1HH6B 3GSQA 4JFED 5KVDL 1ACYL 1D5MA 4F7MA 1QLEL 1U41A 1BFVL 2W9LA 3BUYA 4JQIH 4TSAH 5DO2D 5EO1B 5DJXA 2EIZB 4X5LA 3VRJB 4K8RC 5DJZB 5JXEC 2QSCL 4HCRA 2V7HA 2YSSB 2DQUH 4PJAA 1KCRH 4X99A 4N5EC 2H26A 1A1OB 1FN4B 2PTUA 2O5ZL 2X4OB 5IW1A 2EXYC 2YHGA 1ZLVK 1AFVH 3DETD 3B8YA 5ISZD 4I0CC 3QNZA 1MCHA 4TSCH 4OM1L 1HQ4A 1F3DJ 4JKPH 4N0YH 4J3TA 3P73B 3N85H 3MV7B 3BKCL 3F58L 4JPIB 2ARJQ 1RZJH 5DRWA 5F70A 2FATL 3QUXD 4KXZH 1WZ1L 2DM4A 1LDPL 4YLQT 1VERA 3WUWA 2XRAH 1PLGL 3OAUH 4QOKE 2AEIT 3MGTA 1GC1L 3KWWA 5DC4B 4I0PC 4NWUL 5CJOL 2GHWB 4WI7A 2QHRH 3V4PL 2CLVB 1B6DA 1RZIA 1DJSA 1ZLVH 5HHQB 5CZVL 4NCDA 3N50A 4YC2B 3I50L 1U8QB 3BEWA 2Q87A 1MREL 1R24A 1SBSL 2Q7YB 4GKZA 2OTUA 3S35X 1YEDA 3GSUB 3RFZC 3EJZD 3NPSC 3BVNB 2MKLC 4NQCA 3G6JE 5D5MF 1K8DA 1P84J 3Q5YA 2E7MA 5D1QA 3JWOH 4DVBA 3RUGB 3G6DL 4MCYB 3C6LB 4PJDA 3CDFA 5HI4C 4ZOBA 3CDGB 4AG4L 4QHMA 2MCPL 5DFWH 3MODH 4LMQE 3REVA 3HMWL 3HAEA 4OGAC 4P46A 3VXRE 1AY1L 2JKXA 4JJ5B 2P45B 3NCFB 4E5XA 4CADA 5DJ0B 5AYQA 1MLCA 5ADPH 4JO1L 4U0RB 5HD8C 3O2WL 1S7WA 3HUJA 2OX5A 2AAVA 2V2XB 4FABL 4XH2B 2B1HH 4QXGL 3X11B 4JFZL 3L3JA 1S5HB 5GGQL 5KW9L 5HPOA 2OJEA 2VUYA 4GAGL 4LKCB 5GRUH 3KPMA 4BKLB 5FHBH 4OF8A 4WI2A 3RWIB 1DFBL 1I7UA 2F8VA 4L4VB 5TF1H 3G5VA 2ZUTA 4HWEL 5FOBA 2HKFH 2EEDA 5FYJE 3RHWK 4GAFB 4P2QE 4G8GD 3QO1A 3QCVL 1FGVH 1FFPB 3BPOC 2FGZA 2NX5A 3NH7H 3P11L 2PYEE 3GRWL 4MJIB 4EXKA 4QYOA 1NEZB 1VFUA 3ZTNL 1S9YA 4LHUB 4WFEE 1DQDH 5DQ9B 1AO7B 1L7TL 3BD4A 3MV8B 3PWPA 4GXVL 3S3SA 3EDKA 1A1MB 3WXWH 3WV0A 1FLRL 4NO2A 4UILL 2FECI 1A7PH 3ECBA 3RX5A 3A6CL 1CT8A 1INQA 3JZ7A 4MJ4A 4LVNB 3VRIB 3S9DB 2OI9C 4K71B 1M7IA 4MXQD 2LTQC 1LMKA 4P5TB 2R56L 2CIIB 4R2GD 2UZIH 2IFFH 2XG4A 4LPTA 1AXIB 4KHXH 4K9EL 4NM4H 3M07A 5BW7C 3TP4A 5GRVL 5IJKA 4KROD 4P2RD 4LSRL 5CEYA 1OTTD 4RFNC 4NC2B 3CXHK 4TN9A 3CJJA 1MFNA 1A9EB 1QFOA 1XGUB 3IDUA 5D96B 3V0VA 2X4TB 3SDCD 5IWLA 4QCIA 5CBEA 3ULSA 4P2OA 5E8NA 2ED9A 4M5ZL 4D9LL 4G80A 5C0DA 1MLBA 2NY5L 3PWNA 3I85A 2NQCA 2EYRB 3HC4H 1ADQA 4EN3B 4QRQB 3UTOA 5DJCA 3PGDA 5I9QC 3BP4B 4HZLB 1CGSH 5JDJA 1HYSC 3SJVE 2GW5A 3FO2B 3CXDL 1KYOK 1R3LB 3C08L 3PV6A 1YPZA 1G6VK 4L8BA 3CU1A 4ONOA 2E7LC 4PJ8B 5KTEH 5E2UL 5E2TH 3V5HA 2HYMA 3U36A 4O58H 1JIBA 3VFRB 4LVHB 1EHXA 2QSTA 3DLQR 4NYLB 2EXWC 3WFBL 4QXTA 2YUXA 3CX5J 2JK5B 1OAXL 4HIJB 4RFEA 4X7EC 5EC1A 3QI9B 1OAZH 4RISH 3ARXA 5IMOB 2AJVH 4I77L 1HSBB 4G5ZH 5DI8A 4TPRH 2I5YL 4JCMA 3H7BA 4KUCD 4NO0A 1HHGA 1BIIA 1SY6A 5CZXD 3DTXB 3UZQA 3CFBA 2ZP0T 3DNKA 1QSFA 43CAA 5FGRA 3ELAT 1OVZA 2PXYC 5DMGD 2WQ8A 1RPQA 4YIQA 1QVOB 4LIQH 3O3BA 5BVPL 2ZSWB 1DVFB 4RMTA 4EDXA 1HHJB 2B39A 2IGFL 4LRNL 3AS3A 3IDGA 3ZKSD 4GRLB 2HLFC 4HIXL 1J1XL 3W0WA 2JB5L 5EN2B 1B6UA 4OZGB 4CMMB 4N0CC 1H3PH 4FQQB 1KPRA 1BF2A 4HS8H 1T1WA 4XWOD 2KDGA 4NKOB 2Q76A 4H88H 4NQXA 4QHLB 1RVFH 3G9AB 4NKMB 2Z91A 5GSRB 3GHBL 2KPNA 1E4XH 5DQJA 4XCNB 2AEQH 3RWHB 1AHWA 4GG8A 4MLSA 4IMLA 5DHYB 5FA3B 4HUWA 2VDOH 2AJZA 2ZOLB 4LCYB 5EU7C 2P5EB 1Q0XL 2X42A 3UPAA 1FYTE 1AGFB 2XZQH 2Z8VC 3VD3A 2E8ZA 1MQ8A 3CCHB 3MBXH 3HI1A 4IOFD 4K3DH 1UC6A 5HYSB 4N0UB 5IEKB 4WNQB 3K3QA 4Q6IB 5I1AA 3TA3A 5EUOA 2IPKA 2P24A 4AT6A 5D6CA 1XIWC 5J57B 1IEAB 5J3HC 4BQ8A 3QFJD 4XBGA 5IB3B 32C2A 1WV7T 3PUCA 3VFPA 4NOFA 1GGBL 4HDIB 3MOBL 1U9KA 1D7FA 3S3JA 1BQLL 3S88H 3TJHD 4E0RB 3GSOA 4ZUWA 1KJ2L 4Y88A 1OSPH 1WBXB 1YEIH 4JQXA 4HEPG 4UDUB 2VSDA 4M7LL 3MFFA 2UWEA 3QIWC 1OD7A 2YK1H 3VXSE 3OXRA 3MLUL 2VITA 5JPMB 1YN6A 4HXBH 1Z5LA 3L3DB 4NQDB 1MCPL 1RK0B 5F1IA 3P30H 1KJMA 1K6QL 2A73A 5DK3A 4Z78B 1OTSC 4N8VG 4ELKA 4XGZA 2DQDH 1CXEA 3JV4B 1YYLH 2DTSA 2C26A 3C6SB 4O4YH 2EIBA 4RAUB 3SOBH 4DKFH 3L95A 4XP1L 1CF8L 2DQEH 3K2UH 3KPOA 5F7LB 4QTIL 3RI5K 5FECA 1ZHKB 3HAEH 5F89B 1FORH 2L7JA 3QXVA 4X4YB 4NSKB 1J0KA 5HHOD 3B9DA 3RVUD 1KN4L 4OV6F 5EUKA 3QUYC 4JAMA 1JCKA 3LOWA 4JHZA 3MYJA 3UAJC 5DVNA 4W6YB 5JHDA 1U95B 5IVNA 4C4KO 5I1JH 3IAPA 1YEJH 4JFOB 4U1SB 5EORH 4AM0A 3MREA 3O2DH 5LQBL 4LCWE 3ZHLA 5ENWB 4ONGH 3BX7C 3PWVA 1VADA 5A2KH 1U6AL 2I9LA 4X4MA 1XGTB 5DS8A 3IRPX 4JDTH 2AV7B 5F3HB 4YPJA 1U36A 2VDNL 2NLJA 2P48B 4ODBD 4LPWA 3IDXL 3P77A 4IRSD 3TZVA 4M93C 4OV5B 1IGTA 3WLWD 4RFOH 3TT3H 3CDYA 3U0TA 4KC3B 2OR8A 1OSZB 5IHZB 4WHDA 4WY7L 1BX2B 3WE6A 3VXUD 4JFEA 3MLPA 3QJFA 3MGAA 2OQJA 4ZS7H 1IJ9A 1JN6B 1D9KC 4D94A 2CGRH 3ZKXB 4JN1L 2F53E 4E9LA 1XF5B 3RNQB 5CGYC 4JZOB 3GBNH 4NQSB 5CUSL 5DD6B 3HI5L 2DLGA 2Z9TA 3GMRB 5MI0B 1DBJH 4F80A 1I3UA 1CU4L 1URLA 1JWSB 3T1FB 4KGJA 2YPLD 4F7TA 2C4FU 3QIBD 4P5KB 4PYGA 3ZDZF 1VDGA 3D25A 3JTSA 5ISZA 5DD0L 5C08E 4JO3L 1YJDC 3R1GL 5HDOA 3U9PH 2EDLA 1XAUA 3FO0L 1M05B 3P0VL 4L9LA 3W39B 3ZDZE 5I8KL 3B9KC 5CP7A 1U8MA 1KPVA 5A3IC 1YQ2A 3MLYL 3MA7B 3QUXA 5CINL 3TESA 3LEXA 1F3JB 1NCTA 4RAVB 1ETZA 1CI5A 1MJUH 4OM0L 1T83C 1FVDA 2NXYC 5HDQL 1H3UA 4ODUB 5FYJL 2ITDB 1ADQH 3SGEH 2ARJA 2EE3A 3JV0A 1Z9SA 4GQ9L 3TYFB 3PWUA 4OI8A 3RJQB 5GS2H 3O3DA 1BVKB 4IOSD 3RP1A 2Y6SC 2W07A 1P9MC 1V3KA 3V0WL 5DJYB 1LHZA 1LD9B 4P49A 1NGWB 4HKZB 3QDHA 1UJ3A 4JFYA 4Z77A 3QWOA 3SCMC 2YRZA 2AERT 4YHOL 3MNWB 5T1DL 1X4XA 1FO0B 3GJFK 3NA9H 5IR1A 5JW5B 5C0CD 1JPTL 3L3KB 3ARBA 1T7YA 4D0DB 5F9WC 3RZCB 1SY6H 3GSXB 5DT1H 4KTDH 1XR8A 3BGAA 5LG1A 5L7XH 4OQTA 3T0EE 4FQJL 5C6WH 1TZHA 1FIGL 2V5MA 1BIHA 3I6GB 4KAQH 1HH9B 1YDPA 1C12B 4J6RH 1A4KA