3P4OB

Crystal structure of h2-kb in complex with the mutant np205-lcmv-v3a epitope ytakypnl, an 8-mer modified peptide from the lcmv
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of H2-Kb in complex with the mutant NP205-LCMV-V3A epitope YTAKYPNL, an 8-mer modified peptide from the LCMV
rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
total genus 13
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p4oB00
5FYJD 3ARED 3RUGA 1I85A 4GMSH 1VDGA 2AEQH 2OP4L 1YNLL 4DOHB 2HJFA 4OLZL 4I5BB 1DN2A 1Z9OA 5CILL 5GZNC 5MI0C 3MNZB 3EJYD 1R3JA 3RVVD 4Z18A 4D3CH 1WUNT 4NGHH 3L3OB 4D94A 1K8DB 1OSZB 3BIBX 5ICZB 4M61B 4LNRA 2DMKA 4U31A 2YD7A 2DQDH 5TDOA 3RWHA 1JF6A 3EOTH 1T7XA 1HK6A 2DQFB 1ZANH 3MLYH 3L3GA 2DLGA 1NCAL 1KYOK 5KN5B 1FFOB 4XMPH 3HZMA 3QULA 3U9UA 3BPLC 3EUUA 4JM2C 5I1KH 1A14H 5I1AA 5D70L 1DBKL 3ULUD 1NGPL 4JY6B 5C0BE 1LEIA 4POZD 1VEOA 3L3DA 3RA7H 1A6WH 3G6AA 1I75A 3PHOA 1BEYH 5C0RL 4K55A 1NBVL 1OT2A 4NWTH 3RVUD 3JWOH 3T2QA 3ELAT 4YHKL 5GGVY 4AT6B 1N0XL 3BXNA 2C9AA 4PP2B 1QSFB 2EDOA 4FQHB 3DXAD 1X3DA 1OAYH 1B90A 1KJ2B 1MJ8L 5C0AB 3LKOB 2KDGA 2LVEA 3AXLB 4XCNB 4IIQC 3ROLB 2DIJA 2YMXL 3LS5L 4X4XB 3HC4H 2J88L 2WWMC 4P2RA 1A6TB 3TWCH 2HKHL 1IC5L 2JJSA 3BQUD 1JWSB 1D5BB 3CFCH 2N7AA 4NOFA 1FVCA 5JA8B 2F19L 5FM4A 4OM1H 2CUHA 2DQJH 1QBBA 4NNPL 1BD2D 1FO0L 2BNRB 4PRPD 2ZCHL 4PRPA 4UINH 5DA0B 5TE6L 1WAAE 4XC1H 3BHBA 4NNYA 4AEIL 5HYJD 3KXFB 2HMIC 1MLBB 4H5SB 3IU4L 2Z8RA 2RCSL 3QQ9C 3I2CL 1P4LA 1R5WA 2K3TA 2Q87A 2AJYH 4MQ7A 3VFTB 1NGQL 3DUUB 4HGWB 4IHOB 2DF3A 1NUNB 3QUMH 3RWDA 3X13A 2A6DA 4FQXA 3QWOB 4CADA 1U3JA 1S9YB 5MP6H 4LLVA 3QDGA 1UACL 3QG7L 4Z8FL 2RGSA 3HG1B 3QO1B 3FHQA 4OM0L 5J12B 1KLGB 3BH8A 3ARSA 1WSST 4LQ1A 5FHBH 2BNUB 4TSBH 1IGTB 5CZXD 1PFCA 2WBJC 1FFPA 3HMXH 1AJ7H 3CSPA 2GCYA 1IAKA 3JWOL 3QQ3B 4XCFL 4I4WB 1P7KB 5HYEA 3RKDC 2ITCA 3FT2A 2GT9A 1MCNA 5CGMA 1N6QH 3PJSA 4S1RL 5EZIL 4JHAH 4HF5H 1JGDA 2AK1H 3VFWB 4O5LH 4HWZA 2FLRT 1DQTA 5E5RB 3SKJH 1BLNB 2ID5A 1JF1B 3BKML 5IMOB 1I1RA 3QPQD 3K1DA 1H8NA 5I1CH 1QSEE 1MIEL 2WIIB 5HXMA 2BDNH 4NUJB 1N3NA 4TRPL 4PD4K 1OP5H 1JNHB 1QNZH 2F58L 4RFNC 1AHWA 4Z6AT 2AXFA 3D85A 2NLJB 4K3HA 1Y18A 4KXZI 2AV7B 5FGCE 1IAII 1QUNA 3LN9A 2J5LC 3C2AH 3NCEB 1SMAA 1OOAA 2R15A 3K8MA 2DKMA 4YIQA 5HY9B 1MI5D 1Q9OB 2GYSA 2IALB 4XVUC 4Q9RH 2XTJE 3QXDB 1MRCH 3PWUB 4BK5A 1CE6B 4APQC 2NW3B 1N2RB 4WHCA 4WI6A 4HUNB 3E8UL 1FGVL 4IOIB 4PV8A 1K4DA 2AKRA 3MOBH 1JPGB 5IGXH 4JO4L 1HN1A 5CCKH 2VLRE 1J0ZA 1F4WL 5FUOH 2YRZA 4Y5YC 4LLAA 3ARXA 2F53A 3ZMRA 3WSQH 4XPGL 1B0GA 1JN6A 1NLBH 2NY1C 4P2OC 1CFVH 2DLEA 5T1DL 4N8VA 4C56A 4LRNL 1DQDH 4MSWB 2H8PA 3VRLE 3VFNA 4NNXB 4EVNB 4P2QA 5T1MA 1A64A 5I66A 3VGGA 5B3JF 1AGFA 3ILPA 2J3SA 4HQQH 1I7UB 4EUPG 1XF1A 1U3HB 4L8SB 3ARGD 1VACB 4X0KB 2EH8H 2X10A 4M9PA 5F3BA 4LSTH 3DHJA 3TBVB 4Y2DB 5FA4B 4MAUH 5GGSB 4Z7OE 2BERA 3IETA 1RZFH 4LLMB 2W60A 3OB0K 1S7SA 1J86A 3O4LD 4KQ3H 3ESUF 1C7TA 3O4LA 4ZO8A 1GL4B 4JO2H 3C6LB 4Y4FD 4J12A 4FHBD 2H3NA 2IFFH 2J2ZA 4K3EH 2PYFA 3L7EB 3W9DB 4S2SB 5EUOB 5T1KA 1IQWH 3RNKB 3F7PC 4Y7MA 4Q6IB 1F4YL 4XP9L 1AE6H 5BQ7A 2CRMA 5F93C 3P11H 4YHZH 4OFVA 4Y8AA 2XZAH 1TJGL 3E6FA 4XVTL 5FOJA 1NCDL 3D25B 4TVPD 3HI1B 1ZLVK 5K9KB 3P9MB 2GJ6B 3M1BA 1K6QH 3VMPA 4X98A 5K59F 1A4KA 2N4IA 2QSCH 1U8PA 5GS1C 4OLYH 5TE4H 3MUJA 4J3VA 4O4YL 5DC4B 4HG4J 1GGBH 2M8XA 3MGAA 3TBYA 4KY1L 1QLFB 3ULVC 3BP6A 3BGFB 2ZPKH 4WI7A 2F8VA 2JTDA 4JFEB 5CILH 4Y4FC 5I17B 4GFTB 2R8SH 1B4JL 4JZNB 3MRHB 1UXSB 32C2B 3RIFF 2ADFL 4LIQH 1CTOA 3RI5K 4QHKJ 3S5LB 3IDUA 1CG9A 1ED3B 1Q8MA 3TYFA 4HX1B 4OUUA 5EOQL 4EN3B 3VXMA 1CLYH 4QF1A 3THMH 5D1ZA 4JZJA 2GK2A 4L9LB 1UWXH 3QUYD 4WTXA 3TH2T 1NUDA 1RJYA 3B9KC 1T04B 1QRNB 4UUJA 3R8QA 3OXSB 4QRQB 5I6XC 4P5TD 3ROOA 5EUKB 3HMXA 3CVIL 15C8L 3LPFA 3KG5A 3GJFK 5H35B 4PJFE 2DQTL 1RUQH 3MV7D 1QSEA 2BOBB 1UH3A 3FFCA 3GMOB 5AZ2L 4XHJD 3WDJA 4GRLA 5FGSA 5I73C 4QXUL 2QQNH 3NFPB 4FFYH 5JW4R 1NCCH 5HHVH 4YXKL 2X4OA 2V17H 1OAZH 1FAKT 3QB7C 2VJXA 2JCCA 2BVYA 4HIEA 1MLCB 4WHTB 5I8OL 4AIXA 4GW1B 2A0LD 1AXIB 5D72L 4PJ5E 1X5KA 1BQHA 1R24B 1NAKH 5CEYB 3TCLB 3VWJB 1A9EA 4RMTA 2O5ZL 2EIDA 4NZRH 3I02B 1HIMH 3O3AA 4A6YL 2OR7A 1Q0YH 4HKJA 3O2WH 5IVXF 1NFKA 2IAMB 3BZFA 4DWHA 2Q8BH 4W6YB 4KQ4H 1RIHL 1HSBA 5DFVD 2C3WA 2A6JA 4G8EB 2G5BA 2IQ9H 4NO5A 5ESQA 3CNKA 5D7IB 3J7HA 4RAUA 2G9HB 4Z7NE 1EH9A 3VXRD 1ZWIA 4MQTB 4XCEA 4S1QH 4EUPH 3PHQB 1YUHB 3ARBA 2MJWA 4QO1A 2XG4A 5TDNA 1KEML 3Q5OA 4OT1L 1VFUA 2D4DA 3S97C 5DD5H 1DVFD 5D2NE 4NZDA 2NY6C 4DUVA 5FK9B 5JPMB 2AI0H 4M00A 2PCPB 3EJZD 2R2HA 4M93C 3MJ6A 1P2CB 2YZ1A 5D9SB 5D4QA 1M7XA 2ZP0T 1XF3A 2IAND 5GJSL 2DWDA 1KIQB 3STLB 4QRPD 5TH2B 3GKWL 3U7YH 4KGJA 3ARGC 3LVEA 4U7KA 1ZT7B 3T65A 4G3YH 3DTXA 3H9SE 4NO5B 1QRND 3W9DA 4P46D 4Y1AB 2VWEC 3FT2B 5FUCE 3MXWH 1WIOA 3FO1B 3N9GH 1KNOB 1E28A 2R0KL 1MY7A 2D0GA 4WO4D 4Y0GA 1MFEL 2L7UA 4RIRA 1BFTA 1AI1L 5CGTA 1E4XL 3HC3H 4HGKC 4NO0B 5B3JE 3N85L 1T1WB 4HS6A 5KSBA 5DJ8A 5D1XD 1GH7A 4FXGB 2AEIT 4J3UA 5DHVA 2RIKA 1SJVA 3WUWB 3M1BB 5D8JL 2CMRH 4NUJA 4HS3B 4V2CB 4HZLB 1N0LA 1EPFA 5K93A 4NBYB 3SGJA 3D87B 2ZOLA 5EBLB 1QA9B 3MBXH 2QKIA 1JRHH 3BSZL 4I0CC 1KELH 4JHWL 1WVZA 4OFPA 2ZUUA 3HNTH 4L3AA 2AV1B 1U8NB 2J6EA 1W8OA 2NY6D 2R0LH 4R4ND 1P69B 4N90E 1BFOA 3BPNB 3DUHA 5DJZB 4CMHB 4JG0H 5CUSL 4H25A 3HS0A 3GBNL 4JDTL 5CHNA 2IADA 5I75C 1J8HA 5JQ6L 3IDIB 3MRMB 2FNBA 2FX8L 4UV7H 5E7BA 4E42B 4X5XA 4F9PC 1NGYB 4XPBL 2D7PA 4KAQH 4GBXC 2VLLA 3JTTA 4XNMB 4KROB 1YZZA 3UTTD 3QNYA 2XACC 1KC5L 4PGJA 4J6RH 1KJMB 2VOTA 2NY0C 3L5WA 1RMFH 2HVJA 4HIHB 1CF8L 3MV9E 3UTQA 3C5ZD 3WXWL 4IOFD 4OZHF 4FS0A 3HTLX 4Z0BL 4NKOA 4U6YA 1RJLA 5HPOA 4RRPG 4JO1L 2OS7A 3V4PH 3EOAB 3B6SA 4PJXB 2V6HA 2OJEB 4Y4KD 2NTSP 1RVFH 3P2TA 4LCWA 4LCWD 1E4KC 1Q0YL 3V6BR 4O2EB 3NZ8B 2FO1A 1VFOA 1I1CA 5F21B 4Y5VC 1FVEA 3G5ZA 5E1AA 5IF0A 2ZCKH 5ITBL 4YWGL 1D7FA 2ZNWA 4HT1H 5HHOB 4UT9H 2DYPA 3MJ9A 5ANME 1AQKH 2XICA 5EIVA 5C0JA 3WIHL 4QY8B 2F54E 4PRHB 1A1OA 3DO3A 5FB8A 1O7VA 1NANH 3VWKA 5DI8B 3BPOB 4NQSB 4OCSL 4PRIA 1QYGH 3TZVB 1QP1A 4Z77B 2YOCA 1AR1C 4MLIA 5KVEH 3HE7D 3HI6L 4XXDB 1P2CA 5C8JA 5E2UH 4UV7L 2BC4A 3PP4H 2J12B 2WUCH 2ZWLT 3RWHB 3DURB 4MNQB 1HWGB 3BMVA 1YEHH 2QADB 3LS4L 1QFUH 3DMMC 4JRXB 4HXAL 4TVPL 5CIPH 4JM2B 1RULL 2E7CA 5KN5A 2B20A 4Z7UB 1UFUA 1A6ZB 2GHWB 1I7RB 5C0BA 4OLEA 4R9HA 5ETUA 3DGGA 4BELD 3GBML 3L3OA 4K7PL 1P7QA 3MRDB 4GAJH 4BFGA 2J4WH 1NC2A 3T2NH 2P8LA 2B4CH 1OAUH 3ULVH 2H1PH 4NYLA 1MVFA 1OL0A 3CPLB 4Y89A 2Z93A 4KK8D 2CO6B 5ACLA 2D03L 1NBYB 4KJWC 1ED3A 4IS6B 4U1MB 1RUAL 3KPMA 4MJIE 4HUMB 4X9GA 1S7UB 3HZMB 1E27A 1YECL 1CLZL 5AWNL 4XCYA 3JUYA 5C0GA 1LEIB 4HJGB 3KNBA 4K8RD 2HMID 2BFVH 3FRUB 5JHLL 2CRIA 4HKZA 1JZ6A 2HFEA 3RTQA 5HGAA 3S37X 3RAJH 2WBKA 1CZ8L 1FJ1A 5C3LD 5HPMA 3HNVL 4MNHB 3IVKA 5DRXB 3BHBB 1KBGH 4HFWA 4NNYB 3IJYA 1BZQK 4D8PA 3ZSSA 1XGUB 1KENL 1DUZA 4X4XA 4RAHA 1GYAA 3EDJA 2A83B 2EKSA 5L6YL 2YD3A 3E3QE 4O5LL 1M6OB 4O02H 1INEL 3U7YL 3OKEA 1CU4H 4M7LH 4PRDB 1LDPH 2NXZC 1JHKH 3IT8D 2I9TB 5E0QA 4HFUL 4MVBD 2WP3T 1HKFA 1N64L 5CBAA 5GS2H 2VL5B 4I3SH 3MROB 4LSRL 1T1YB 3HR6A 1KN2H 1PG7H 1ZMYA 4ONHA 1F4YH 4XP9H 3I9GH 2X4PB 5FM8A 3SJVB 5L2KE 1Z6JT 4U1NB 3KPOA 1DQML 2DTSA 3RNQA 2P5WA 1H0DB 2FX7L 4A2MA 1QACA 1QSFD 2IBGA 4Z7VA 1OTSC 1S78C 3RKDD 1RI8A 3TIDA 4OF5A 5I9QB 3GJFH 1RUMH 2D9QB 2V5RA 4MA3A 3T4AA 1IILE 3WDHA 3OKMB 3C5SA 3B6SB 1G6RB 2LU4A 1Q9LB 3SE3C 3HCVA 1FZMB 1PQZB 1MVUB 4HH8A 4AMKH 1QLFA 3KYAA 1A7PH 1JTOA 3G6JA 1YEIH 4PJIA 1ZA3B 1LEGB 2FEEL 4EI5B 1M05A 1EAPB 3STZA 3P3YA 3RTQC 1KIRA 1H8SA 2WUBH 1OARL 4D0BA 3WFBH 1BBDH 3QDMB 5AG9A 1CDYA 1YNLH 1QOKA 1VGEL 4XB7A 3STLA 1IZKA 1RIVL 1U95B 1T1XB 1KTRL 5IQ7H 4AM0A 4NO0A 4TNVK 5E8NA 2YD6A 5IT2L 4D0CA 4OZ4B 4WV1B 3ZYJA 2Y5TA 4YQXL 4PR5A 4M43H 3D1MC 2NY2D 2J7LA 2HT4D 4I2XE 3K2MC 3ZE1E 1BBJA 1EDQA 3DXAB 1Y6NR 2CH8A 1WFNA 1NDGB 4KTEH 3MA7A 3U4BL 1Q9LA 2EC9T 3HI6H 1NAMA 2D3VA 4HIXH 4M4RA 3EOTL 5IMLA 3F12A 4MCZA 3UZQA 5JORA 1I9IH 5GJTH 4O51A 3IXAA 5MEPA 2FJFA 5DMJB 3V8CA 4KTDH 1A14L 3C2SA 3P4MB 4Q74A 5ALBH 4XMPL 2FHFA 2YPLD 3SKOB 5DVNA 5EZOH 3TT1L 3KPPA 3TA3D 5T3XL 3SEPA 4R2GC 4WEMB 1QFOA 4P4KA 5L0QC 2ZCKL 5ITBH 3RVWC 1Q9KA 5BV7H 3SE3A 2GFBB 2R0WH 1JZ5A 1BMGA 1MIEH 2YK1H 1PY4A 4YNYB 3ARDC 5CSZB 2ICWI 1HWHB 5BV7C 2VERN 3O3DB 3RRQA 4LU5H 1KPRA 2VE6A 5TE4L 2VYRE 4LVOC 4XCYB 4H8WL 4CUCA 3BGFC 1KIUA 4P4RB 2DDQL 2D7QA 3PV6A 1YEEL 1YN7A 4GAJL 3BJLA 5DHYB 2WWMD 4GKSA 4FTVA 3VFPA 3TNMA 4XC1L 1EO8H 5LXGH 1AGFB 1CS6A 3SY0B 3P73B 4R7NB 4HV8B 4GXUM 2ZUSA 1KBGL 1MJUH 4UIKL 2I07B 1A9BA 2XZQH 3OAUL 4JDZB 2P24A 5BMFH 5AZEL 3LKSB 1UM6H 3D3VD 1WBYB 4J3XA 1VPOL 3RWEA 4R7DA 1MFAH 1T5WA 3CFJA 3GM0A 3MNWA 3DMMA 3DVFA 3WFHB 3CXHK 4UQ2B 4OQ1A 5IR1A 3MYJB 1T20A 3FT3B 3WEXB 4HHAB 1FAIL 4U2ZA 1C5DB 4K94H 4F3FB 5C0CA 4P4RA 1XGRA 2BNRE 1NSNH 2DL9A 5DQJA 3DROA 3NN8B 1HE7A 2H2PD 2YD2A 3FQXB 1KCRH 3MV01 5L9DH 2Y7QA 4AY0A 3OKDB 3WIFA 3MPCA 4JZJC 5DI8A 3I50H 5E8OA 3RJQB 1KV3A 3B9KA 3G08B 5IK3B 5EU5A 4M1DL 4TQEL 4EN3A 4MNQD 2OXHA 4WI9A 3IF1B 1EBPA 4GMTH 5EC2B 1PBYA 1SY6L 3TBTB 5EORL 1ZLWH 3I6LD 1A22B 4YBLB 3VU2A 1MCKA 3NMEA 4ZOEA 3X17A 4BZYA 4RMWA 3IS1X 3CFJB 2DQDL 4HZLA 1NC4A 2E7BA 5I6XB 3QIBC 4OZFH 1OLLA 4ZUSA 5F7EL 4M3KB 5DJYB 1BJMA 1MWAB 4Y4HC 5TE7L 2UZYB 2H6PA 5C07A 2VZVA 5SWQA 3OKNB 4KDWA 5J11C 1MAMH 5IIEB 5DTFB 3TJEH 5BS0A 4TOYH 4EDWH 3RQ3A 5E5MB 3QI9A 3QI9D 3BQUC 3MRJB 3QIUB 4HULB 1XH3A 5ENWB 5I18L 2ARJA 3BVNB 3BUYA 5I74C 4P9HH 4IIQA 4LSSH 3OTTA 4GAFB 4PV9B 2Y5EA 4JVPA 3RDTA 3G9AB 4J4PD 4WFFD 4Y16D 3OR7B 3V5DB 3KS0J 4ZTPH 3WFBL 1KLUB 4ZFZA 3KDMB 1RHHA 1BX2B 3ZE2F 5DVLA 1U8JA 4NCC2 2MHAB 4N1HB 1MPAH 4KK9D 4IRSC 5ISZB 4FQXB 1Z0NA 1V3MA 4XCCL 5FGCB 5FO7A 5SX5H 5EC1A 4ETQB 4XWGH 2YUXA 2X05A 1WWBX 2DN7A 3ALXA 3LDBC 4U1LB 2CUMA 2A6KA 1D6EA 1OP9A 1VADB 2VLKB 3UTZB 1U92A 3V0VA 2VZ1A 2ZG1A 1UXWB 3A67H 3RIFK 5M7QA 2XN9B 1TFHA 4HD9A 2F53E 4OLUL 3VFVB 3WNKA 5C92A 1SJEA 2B0SH 3BDBA 3LY6A 3L9RA 3T8XB 1HH6B 2JJTC 3MJ8A 4GRWE 2PN5A 1IL1B 4XP1H 1WLHA 4MYWB 4ZD3L 3DVGA 7FABL 1DDHB 1BJ8A 4U1NA 4DGYL 1XCTB 5E6IB 5HHPA 2F8XC 4B7IA 2MHAA 4OLWL 4FABH 3LN4A 5TGBA 3ZHDA 4P48A 3V95A 2GY7B 4MJ2A 3BJ91 2EH8L 3U30C 3C9NA 3KPQB 2MQ0A 4JPWL 1OGTA 2PCPA 3HUJE 4U1LA 5F7MC 2H26A 3WN5B 2P1YA 1HHIA 1XFPA 1U36A 3HCVB 3IS0X 3SQOL 4PB9L 3KWWA 1NFDE 3TV3L 1J88A 2AEQL 5GISL 5H8DA 1EFXA 4R6UA 4XPAL 1C5CH 1XZ0B 2VLJD 1T2JA 2VDQL 1J0HA 1W2KT 4PG2C 4CVXB 3PWJA 2PO6B 4X7DC 3ZKSD 4P2OB 4UT7L 3O8XB 4ZAKC 5EA0H 3DGGB 5AG8A 4L4JA 4ISVA 4GRLC 2ZOLB 1RK1B 3S37L 3KAAA 2BOCA 1V7NH 4YDJB 5FV2A 2ZG3A 2K9UA 5DZOA 3IDMA 3MXVL 1T66C 1JMZA 2NY5H 3RVUC 4LSPL 3O2DL 2D03H 1G1CA 2E6JA 4RMVA 3I50L 1CFSA 4ODSH 1K4DB 2AKRB 4RZCB 4K23H 4POYA 1OP3H 5IEHB 4XNQB 1W0WA 4Q9BA 1A1NA 3VD7A 1QRKA 4LCYB 1NAMB 2HRLA 4OLZH 5I1KL 4I2XB 5I15L 1JPFB 5GIRA 3VXQB 2BSTA 4PGEA 1J12A 3RUGE 4KZEL 2DOCA 5EN2B 2DQFA 3MRCA 4KJPD 4BKLA 4M5YH 1DVFB 3O3EA 3PWJB 4JFHE 3HNSL 4RGNC 3DX8A 4MD4A 4MJIB 2AJVH 5DQDL 3TT3H 4MNHA 3IVKB 1BIIB 4IRSB 2BJML 5IKCB 3FN9A 2HN7A 4I13B 5ACZA 4CVUA 1T0MB 3CCHB 4WUUD 2R4SH 4R26H 1DE4B 3PHOB 1MFEH 2NW2A 2QQNL 2NZ9D 1Y0LA 3MV9A 5FA3A 5C6TL 4QRRB 5IBUG 3IB4A 3BN3B 2OX5A 1VGKA 4OCSH 1UENA 5F7FA 1GC1H 4MNGA 3MUZ1 5GISH 2D7OA 2YKLH 3FHAA 5GSRA 1S9WA 4YDLB 4QF1B 2DJUA 2IAMD 3RIAF 1LMKA 4CN4A 4WWID 2ZUQC 4C59B 4N9GB 4MJ5A 4GG6A 1MRDL 3CC5B 5HSFA 1FFQA 2AK4B 1MUJB 1NEUA 1XGPB 3QZWG 1V3JA 3OZ9H 4HAFA 5F7DB 1HOCB 4S1SH 3QJFB 1MLBA 4H5SA 5IW3A 1JZ7A 1N4XL 3BD5A 4KV5E 4MB3A 4PRHA 5FA3B 3I84A 4GKSB 2BRRL 5LGHH 4EI6B 4HS8H 1SHMA 1FBIH 1MEXH 3MRLB 5I16A 5C0ND 2MOVA 4DW2L 4WENB 1WISA 2XN9E 4HGMA 4F7TB 3WNNA 4FFWC 4H26B 5J6GA 5GS1A 1A9BB 4G43B 1EVUA 4PREB 2X4UB 3QQ4B 4EDWL 2VL4A 4U33A 4WW2C 5CEXB 5D71H 2OL3B 3MODH 4RFEA 1T5WB 2YBRB 5KS9E 4RISL 2OXGA 4GXVH 1U42A 1EXUB 4ZAKB 4BFIB 2QADD 2P44B 4XAWL 4Z7QF 3SGJC 5CWSB 5ECJE 4Z5RA 4DN3L 3KYOB 4DEPB 5FECA 4C55A 2AJZB 1G0XA 4JPVL 3PP3K 3VMOA 2W59A 2Z8SA 3C9NB 3W39B 5GGVL 2J8UE 4N90D 1Q0XH 5IFHH 1ETZB 4YHML 2Y72A 1IGCL 4GAYB 3DXAA 2EDHA 3HUJA 5EOTB 3GMLA 3TN0D 5IM7B 3OAZK 2X4TB 2VQUA 5IEKB 2X4NB 2GIYA 3RA7L 3JTSB 5LQBH 5JMOC 1A7BA 4QHLA 5DJXB 4LLUA 5DK0B 1DSFH 4UU9A 6CGTA 3LSOA 3ZYZA 2H6PB 8FABB 1N6QL 1OWRM 5IFAL 4HKXB 4WO4A 5AD0B 4WVRA 5D7IF 1FZOA 5AYUH 1JIBA 4ZUSB 4GBXA 4P5MB 1QQDB 1UWEH 2FRGP 4PLKC 2Y07L 4PB0H 2WINB 4UDTB 1IARB 4TTDD 4TULH 4IMKA 4XWOC 5INDA 3NPSB 3PQYD 4P9HL 5D1QA 4YPGB 5DUBB 4I0PB 1BD2E 2XWTA 4PJ5A 4P23B 4G7YH 3RY6A 2MMXA 1K8IB 3FFDA 1GCFA 3C5ZB 4TOYL 2EDXA 1NLBL 4KI5D 1TETL 3CUPA 3MJGX 5JXAL 2V5YA 2OLDA 2ZSVB 3ILQD 2Z31C 5EPMA 5L8KB 2DM2A 1YUHA 3C2AL 5CBAB 3QEQD 4Y5VA 3MNVB 4KU1A 3UJJH 1S9XA 4OZHA 4K7FA 5MEND 1EHXA 3D0LB 1JHLL 3WBDA 1YYLL 4JPKH 1U91A 4K9EH 2FHCA 1FNSH 4OZFA 4Z7NF 1UM6L 2A6KB 1D6EB 2B8OT 3PNWA 5DHXB 2OK0L 3OV6A 3H42H 2YUZA 4XPAH 4MB4A 3GSXB 3ZDYE 4Z7WB 2AEPH 1HDMB 1CZ8H 4LCUA 4EQ3A 1FIEA 5KOMC 1JPGA 5CP7B 5D71L 3MRPB 2L4OA 3Q2CA 4M6OH 2HT4C 4NFCA 3FQTA 1MI5B 1JRHI 1X7QA 2QLVB 3SPVA 1EERB 4WW1A 1FYTD 4GAGH 4Y4HA 4OCYL 1UCTA 4FQQB 4NKQB 4Y4HD 1U6AH 3OWEA 4YHKH 5FUZL 5GRXG 3QIBD 4KRMB 3RVXC 1F11B 1CLOL 3SDXA 3P30H 1J8KA 5I74B 1CVSC 5C2UB 1CR9H 2BSSB 3OHXB 3FOMA 2OJZH 4R2GB 1DBKH 1H3WM 3C6SB 1QEWA 3MRQA 3HA0A 4K7PH 2YS4A 5D2LA 4LKXB 1CE1H 1FL5A 3E3QC 2JB6A 3EYFA 2DIAA 4LHQB 1TETH 3ARDB 4L3ED 4XCFH 4JFHD 5DMYA 5JIIA 5BXFA 2GTZA 4QHMB 1DUYA 1KIPB 1MFDL 5EIIA 2ZCLH 3UYRH 1P1ZB 1WQVT 2JIXB 4XHQA 4CN6A 4GUPA 3QO1A 4YEEA 4GQPH 1DN0A 3FQRB 4S1DC 4TULL 5IMLB 2ATKA 5KS9A 1V3KA 3QH3A 1EFXB 5J1SC 2DQUL 3ZE2E 3HNTL 1OP3K 1NPUA 1P7KA 4NRZB 1F11A 5D70H 3NCYP 3B5GA 3R06A 3B9DA 3EO0B 1W72B 3JBG7 1W0VB 1AGCB 2NX5B 3ZTJG 3UPRB 1EIBA 5IB5A 3B2UC 3UCRA 1A4KB 5I71B 3AS0A 5A3IC 4HWZB 5GIRB 4KHXH 5JW5B 1FL5B 3O6KH 1MHEA 1YQVL 1UKQA 1T04A 3IU3B 3JV6B 1SEBB 1X5FA 4OZFG 4Y19D 4OKVB 5F9WC 2BMKB 2ADIA 3U0WH 3L5WB 5EWIH 3AB0C 2HG5A 4JRXE 5DJ0A 1VFAB 5I1AB 4ONGH 4JPVH 1KJ2L 1IE5A 3OPZH 1T2XA 3LKOA 1YNTB 4FQ1L 1NMAL 4JZJB 2G60H 1LO0H 4OSUH 3GI9H 2HLFD 1FV1A 3AU1A 4U7MA 4IDLA 2PTUA 5IMMB 1CXFA 4NRZA 3I9GL 2CLVA 3IDYB 4D9LL 4YQXH 2DJ4A 2R1XA 1BD2B 4KKBD 2BNQD 5IROA 1ZANL 1T0NA 5TPWL 4RQQA 5JW4N 5ADPL 2XKNB 1SY6H 3S36X 3S36L 2XV6B 1E4KA 3ZKXB 1IJ9A 4LHUG 4GAGL 5JW5A 1NQBA 3G04B 3L9RB 1YEDB 1A6TA 2DYPB 3C5ZA 4GKNB 1RUML 4PJBF 4L4VD 4ZUVA 2GTWB 1VGKB 1INEH 2CIIB 3PL6C 4KZDL 2GJ6D 5EZLB 5BOPA 2I60L 3LKNA 4FTVB 4M5ZH 2CR6A 5E2WL 1RJZA 5J11B 2IGFL 1ZA6A 3QDJD 4PRIB 1NKRA 5C0CB 3V5KB 5A3ID 4GRWB 2VMFA 1EUUA 1EGJH 1DBJL 4G8GD 5L6YH 3V4UH 4OZGE 1A4JB 1FNSL 4PGCB 1OQOA 3L3KB 3P0VL 2AVGA 5SX5K 3RJDA 4JFFB 3G6JF 3RZCA 1IM9B 1CGWA 4AIZB 3ILPB 2XA8L 5L8JB 4Q2ZB 1WTGT 1QSFE 2A73A 3LIZH 3CFDA 3CZFB 2R2EA 3GSNB 4XBEH 3AC0A 4G8FA 3PDOA 5E6YA 3PP3H 2DB8A 3AFLA 2PUQT 1GXEA 4PJHA 2J8HA 1S7XB 4CVXA 1ONQA 5SWZB 2W60B 1AR1D 4WWKA 2Q6WB 5EBWA 5IUSA 4IEFB 1E4WH 5IV2B 1F8TL 2W0FB 5ESAA 4XMKL 4F57H 3NOIA 3LKQB 4E0RB 4LHUB 4K07A 4NUGH 2XQBL 3PXHA 2KZ1B 2BX5A 3GBMH 1IRAY 3HPLB 1RAMA 4UBDC 3SGDH 4IS6A 4ONHB 3ARFC 4L5FH 5IROC 1E28B 1VPOH 2P5WB 3L1OH 1SJHA 3TPUA 1YEGH 3ULVD 1OB1B 4QT5B 2GK0A 1KIQA 4GS7B 3H9SD 5I19H 5I1HH 1X6LA 2APTA 4Z7VB 1R3HB 5TDPA 4N5ED 5FAAA 1VSCA 3V2AR 1XF5B 4ERSL 2IH3A 3E6HA 3RZWA 5DRWA 3V6ZB 4Y1AA 4O2FA 1U58A 6FABL 4G7VH 1MVUA 4MHHG 4ZG1A 1EEZA 2VISB 3KDMA 3MO1B 5BO1H 1CL7H 4K8RH 5C71A 4YIQB 5HY9A 3TO2A 4WGVB 3UZEA 2P4AB 4YXHL 1S7QB 2X1PA 2A83A 1MREH 5INDB 4QRUA 4BZ1H 2DQTH 1T1WA 4HS6B 2AV7A 3EYOA 1CGSL 3ARBD 1FG2A 1MWAL 3U6RB 3T2OA 2X7LA 3QEGL 2VDPL 2A6IA 3D0VA 4ZXBD 2IBZY 3O4OB 4O4YH 1VFMA 4QT5A 3QXDA 4M48H 4NC1E 2WAHA 2WMPA 4NP4L 4F37K 3UROR 3TV3H 3EAKA 1UXWA 1DBAL 2CXKA 4WWKC 3B83A 3KYMA 4LARL 3NFNA 1J5OH 3BPLB 3VFRA 5HBBA 5ALBL 3NABL 3RFZC 2H45A 4MA8H 1BQLH 3GM8A 1UT9A 4ELKB 2OJZL 1Q9WB 5E70A 3KXFA 5DYOA 1H15B 2B4CC 4J7RA 4EDXA 4W68A 2ZOKA 2Q8AH 2B1AL 2NY4B 2AJ3A 2QSVA 1GIGL 3QUXB 5T1LA 5T1LD 3EDFA 3TH4T 4MS8C 1F5WA 3ARBC 2A1WH 4DTGL 4XVJL 3ZDZE 4ODBD 3F6IA 5CEZE 5JOPE 4ODHH 2D7TL 1QRNE 1U91B 4LPTA 1J8HE 3QDGB 5KVFH 1QBML 1BVLB 5TPWH 3WFEL 5ERWA 1ADQA 2F54D 1NFDA 1L0QA 1LGVA 1KC5H 2E6PA 4PBXA 3G04A 5C3TA 1EZVX 3K4DA 5F6HJ 1FP5A 4JFXB 3FB8B 4N1CA 3IAPA 2VZUA 5HHPB 4QCIB 3MRPA 5EO1A 2APXA 4E5XB 2MFNA 2AJVL 3K0WA 3MGTB 1YMMD 2VDMH 4PTUA 1TCRA 1HILB 5I8CA 4L4VE 1A5FL 4KFZC 4UZGA 2VDLL 3QFDA 1T3FA 4EUPA 1RZFL 1GGTA 4P23C 5C2BL 5C09A 1BLNA 1C1EH 5IB3B 1MHCB 1EJ6A 4CMMB 4TUJB 2B39A 3ECBA 3NZ8A 5CAYB 1I8KB 2EEAA 1S9VA 1QBLL 4HWBL 3OG6B 2CLRA 2I9LB 5CJXA 5MENE 3MXWL 5A1AA 5J12C 4LSSL 4DFIA 2MPAL 1DN0B 1DCLA 3OKLB 3P4NA 1UJ3B 1CG9B 4JCLA 3TBYB 1KCVL 4DVBB 2YN5A 4IRJC 3NA9L 4HC1L 3CFCL 5GRVL 1KIPA 1A1MA 4UV4H 4C4KO 4C83A 5IJKA 2YUVA 1TJGH 2ESVD 3FKUS 4PP2A 4HWBA 1W0WB 4U0QB 4HPOL 2ATKB 4BSVB 1I9JL 4XXDA 3V52L 5CSGA 3LD8C 3IDXH 2I5YH 5MHSD 2ZUTA 3EDEA 3U4EB 1E4WL 4PB9H 2Z93B 4R8WL 3CUPB 1QO3B 3RIAK 2ZPKL 1B4RA 1QR4A 1YN7B 3RGVD 4LF3B 4MNGB 5FGBA 1TLKA 1AO7D 5EN2A 1JWMB 3MTRA 1KT2B 3CFKA 1AGCA 3WUWG 3KS0H 4QRTB 4NQUA 3UYPA 4BUHA 2J4WL 4RDQG 4P2OD 2BNRD 4PRPB 5EU6D 4KVNL 3V6ZA 3SE9L 3RBSA 3CCHA 1LWRA 4HJ0C 1A2YA 1AH1A 5DJYA 3VXNA 3NCCB 1KTDA 3ZKNC 1AC0A 1FSKC 2R23B 3FRPG 3V6OA 5E4EC 4Z7WA 4MVBC 3VWKD 2P5EB 2NPLX 1BJ1H 2QHRL 3GJFB 1T7ZA 3IFPA 4NGHL 1XGUA 3T3PF 5JOFB 4WU5B 2QTEA 5CJXC 3N06B 1YJDH 2W38A 4S1RH 4WW2A 4P99A 1OD9A 1S7SB 2AJSL 5T3ZH 1T7VA 5E08H 5DRZB 3O0RL 1NGWB 4FQCH 5HD8D 3GSRB 4Y5YB 1WFUA 2GKIA 1J5OL 5DUML 3RWCB 3NH7H 4XCCH 1A5FH 3B9VA 4RGNE 4JO1H 4S2SA 3AAZA 4FNLH 1BVZA 3SDCD 4J3WA 2ORBH 5F7LB 3W2DL 3OJDA 3S4SG 1CK0L 1OY3B 2IANE 1X5JA 4XP1L 2X4PA 5FO8B 1RHHB 3D6GA 1BQHG 4XNYL 3BE1L 1JPTL 2EDDA 4N0UB 3C08H 2O5YH 3E6FB 5JQ6H 5EFIA 1CFBA 1JNLH 3L3IB 4LVNC 1N6UA 1U8HB 3K1KC 4G8GA 1ETZA 4OD2A 4WTWA 5SV3A 3T65B 1AQDA 4OLVH 5F9WB 2QR0A 3C60A 1WWAX 3KVQA 2WW8A 3TO4B 4WY7L 3TBWB 3DV4B 5FXCH 3G6JB 1ZLVH 4O9HH 1EJOH 4CU7A 3UMTA 3GSNL 5I30L 4YDIL 3BKCL 4KRNA 3MCLL 3HN3A 1GJIA 5C07E 5AAWA 2YXMA 1LO2L 4KMTL 4WI2A 1KJ3H 1YEKL 2MWCA 5DJ6B 1CXKA 2DM3A 3CMOH 1NMCC 4JO3H 1NGXB 2F5BL 2JJUA 1RJYB 1IEBB 3GK8L 5DMIL 5L7XH 2HFGH 1CE6A 5C08A 2PKDA 2Y5TB 1UB5A 4HUXB 2IJ0C 1TZIA 3SDCC 1G9NL 2R4RL 1TDQA 5EWIL 1KPVB 3FQWB 3PWPD 4L8SC 1YMMA 1HINL 4P2QD 5F96H 2X9WA 3FRPA 4N0CD 5B4MC 2P48B 4G7VL 4WU7B 4WI3A 2DJSA 2IBZX 1OSPL 4JJHA 5AEAA 3VG0H 4KQ3L 3NA9H 1QVOA 1E4XH 3HC3L 5JDSB 1HCVA 1R3JB 3LQAH 4DKAA 3VG9C 3C08L 2W07A 5DWUL 4CGTA 1ERNA 4L9LC 4JREB 1TTFA 4ZQKB 4AEEA 3O81A 3MLSL 3NACL 4HKJB 1NCTA 4D0DA 1N5AB 5MEQB 1A0QH 4HH9A 4HBCH 4OQTA 4GKNA 4WY7H 4Q7DA 1MQ8A 2DDQH 1QO3A 4K7PX 4HS8L 4XI5C 1NCDH 5JUEH 2ESVE 1A1NB 4JO2L 2DTMH 1UA6L 2UY7A 4ONFH 5J13C 1EO8L 3U9PL 2XG5A 4ZMAT 1PYWA 5DHYA 1XF2A 2JJWA 2H26B 2AABH 4S1DD 1NGZA 1GHFH 1IKNA 4HKBB 2EDQA 3QG6B 4LCCA 3RZCB 4JZOA 5D7JB 5FOBB 4FQHA 1KEGL 3RBGA 4LU5L 3BP7B 4LSRH 1CD8A 1JMXA 5CSZA 3DNKA 1OGAD 1KXTB 5HHNB 3C6SA 3MRQB 4KJYA 1U8PB 1N5AA 5MEQA 4KVNH 4HIIB 3UJIH 1IAIL 5IQ9B 3IFNL 3LRSA 3MJ7B 4JKKA 4RWHA 4K71C 4CJ1A 1MI5A 1X7QB 4BSWA 1D5BA 3C09B 4H0GA 5C0JB 3BP6B 4X4YA 3L3JA 2Q20A 5GSRB 3CFBA 1TCMA 1BVLA 3FN3A 4S0SD 5CCKL 1SEQH 4V1DD 5DZLA 1H9VA 4V1DA 3JWDL 4NQCD 1WCBA 1TPXB 5EO0B 5EOCL 4P5TA 4WEUD 3FQXA 3HUJF 2AK4A 3JSSA 4OFDA 3GSQA 4FQ1H 5HDQL 3UC0L 1ZHKB 4L9LA 1TQBC 2W0PA 2WBJD 2VXVL 2V2XB 4WFHD 5FGBC 3LH2H 3ES6A 4UUJB 3L95A 1GOFA 2WUBL 3G5XB 1PY9A 4ZPVB 5JUEL 3BISA 1R3IL 5HYSA 4P0DA 3GZKA 3QSKB 3SDCB 2VDKL 4M6NH 4MXQD 5EU3B 5C09D 1ORQB 5T1DH 1FZMA 1AGEB 1J05B 1YMHA 3LV3A 1AD0A 3U9PH 3X3FH 3X3GL 1LO3H 2NW2B 2IG2L 1S7TA 3AB0B 2HH0H 3QUZD 4NSKB 1OAZL 1S7QA 4O9HL 4YZFF 4CVWA 5HVFB 2CLZA 1IKNC 1HSAA 3T1FB 4H88H 5GGVH 4ZDHA 1FG2B 5F9JA 4W6XB 1A0QL 4K7PY 4NJAL 1PLGL 2APVA 5FF6B 3IDYC 4O58H 3WXVL 1MH5B 5KSBE 3CDGB 3N1QC 1GOGA 3A6BH 4JG1L 2XWBB 1OF2B 2OP4H 4LLWA 1QR1B 2D7MA 5E2VH 2XZAL 4WUUA 1MWAA 3BGAA 3PABB 2RAMA 4X5XB 3MA7B 4YHNA 3TT1H 1UADC 5K9OB 1A6PA 2QSCL 5ESQB 1G6RH 3F62A 1A7QH 3CMOL 3GHBH 4LF3A 1DUZB 3P0GB 5HHQB 1B4JH 2NXYD 5DQ9A 3P11L 4YHZL 2R23A 1FNFA 4JY5H 4ODHL 1YEIL 2KL6A 1OTTC 5IOPA 2HT2D 2RBLA 3ZKQD 4KJWD 1M7IA 2FL5B 2EYRA 1DQMH 2OK0H 4HW6A 4LK4A 1F90L 1UCBL 1VCAA 4GT7A 4ZS6D 4Q2ZA 1F6AB 2CIIA 3LB6D 4P2YA 1E6OL 5GZOD 2XN9A 1U8JB 1BEYL 1UEYA 1LEKA 3H9ZA 3KYOA 4WIQA 3B2UD 1ZT7A 5K9OA 2P42B 2XZQL 3FB5B 4K3DH 3GMOA 3MROA 5KSVA 4M4PA 2LTQC 4JM4H 3AY4A 5H37H 1ADQL 4HUKB 3BAEL 2WP3O 4U0RB 3TIDB 3MA9H 4J1UA 2KBGA 2HJKA 2HA1A 2W91A 4JR9L 5D2LF 1IGFL 2ARJQ 1A7RH 2VUYA 2J88H 4Z7OF 2X5PA 4RIRB 1H0DA 5D7LE 1IBGH 3RL1B 3DO7B 5IEKA 4NN7B 4PJIB 1S8DB 3P30L 4ALAL 4PJHB 4L1DA 1H3GA 1CK0H 3S7GA 3B9AA 2QADC 3DMMB 3ZE0E 4OCYH 2P47B 4PJ9A 2DBLH 3REVB 4GRMA 43C9B 3BRDA 1JRHL 2E8ZA 2G5BB 4MB5A 1N7MH 1T22A 1A3RH 3D2UD 4F3FA 3GMPB 5DFWH 4QTIH 4PRAB 4XMLH 5DR5L 2QSQA 1QNZL 1IGMH 1XT5A 4PJ5B 5H94B 5IESL 5TQ0H 4RGOL 1JYNA 4OF8A 3JVGA 3MJ9H 4NOBA 3CPLA 5D1QC 4JFDD 2CGRH 4X80L 4NKDB 1C12B 2YWZA 2Q86A 4NUGL 4L4TD 2R29L 5DGQA 1R3HA 5TDPB 2UVFA 4P3DA 3T3PE 4ZOBA 1KGCD 4FQIH 2XWJB 4L4TB 4ZXBC 5EU3A 4P2CG 3QQNA 5B21A 2NY0D 3CGTA 4ZUUA 1YEGL 1TZHB 2R2BB 5JHDD 2FZ3A 1MJ7L 4X8XA 1T4KB 2IPKA 5KSBF 1FJ1B 4B53A 4WHDA 4ODVL 5DC9B 4CDHA 5I2IB 1TJHL 4X4ZA 5HI3D 4M43L 1WJ3A 3H9HB 4KKAC 4GMSL 2B2XH 3KPPB 4ETYA 1FRGH 4LPWA 2XI9A 1I1AB 4XVUD 1BWWA 2L0DA 1QPPA 5GGRY 4D3CL 1IGJB 1AGBA 5DD6A 3WFDL 1NMBH 3UTPD 3ARYA 3VXUA 5JZ7D 2V2WA 2VL5A 4DK3A 1OW0C 1JN6B 3NZHH 5JW3L 1WTLA 3V0WH 4OI8A 2P43B 2NY4D 2ZOKB 1BOGA 1DANT 4K2UH 2I07A 3WFCL 3OR6A 1JL8A 3Q6FB 4L8CA 1G7LA 4D2NA 4JFEE 4LARH 2HTKD 3KJ6L 1UGNA 3JV5A 1L7TH 2IGFH 1AP2B 3EGSB 3BH9A 3M45A 8CGTA 1H3XA 4ELME 1WIUA 5C09E 7FABH 1ULVA 1V7ML 1I1AA 1CD1A 1DQLL 1I7TB 1PAMA 1U9KA 1ZLUK 5FKPB 2IC2A 5IHLB 2XA3A 4ODXB 3CAFA 1RQ5A 2F74A 5DEFA 4TSAL 1S7RA 3OZ9L 5JIHA 3UTTB 1KACB 1NGQH 4L8SA 3O9WD 3T3ME 4QXTB 2NQCA 4EOWH 2KH2B 1FVDA 3GO1H 1KXQE 3FB5A 4YLQT 2Z92A 1IC7H 4ODVH 5B38B 3TP4A 2XTJD 3WO3B 4WDIB 2PTTB 4GSDH 1TJIL 4OM0H 1LP9B 2VABA 3HRZB 1I1FB 4PUBL 5GXBB 4XP4L 4YE4H 2DQHL 2FGWL 1D5MA 4OD1L 3GGWB 3FCTA 3WD5H 3ES6B 5E2TH 4G6MH 4TUJA 4NQDE 5M94B 3HI1A 1GPOH 1MHPL 2HT3C 3AM8A 4TUKL 4UTBH 4X6EA 4LP4A 5SWSA 1PKQE 4DVRL 4OKVA 4X99B 1CLZH 1XR8B 2D9CA 5AWNH 3ZTNH 2UUDH 3GSQB 4L5FL 3TNNB 3GHBL 1N8ZA 4HXBH 3OBAA 2YPLE 1YMHB 4GRLD 2BJMH 4MJ4A 4NBZB 3HZYA 4FXLA 4WHYG 3CFDB 3SOBH 1SM3L 1D5XB 4KMLB 1M7DA 2Q7YB 4QKXB 2C5DC 4K23L 4DEPC 3B4NA 3QEQE 1JHTA 2P8MB 4JY6A 4HKXA 2MNUA 1K5NB 1T0NB 2XNAB 1UC6A 3U0TA 3UZVB 4U6HB 1K6QL 4R97B 1N5YL 4H0IA 1ES0B 5BO1L 1IKFH 3GMLB 5LQBL 5F1SA 4ZS6C 5HVHB 3BOVA 2A9NH 1MAJA 3OJVC 1JWMA 3T0AA 4L4TE 4KHTL 5TE7H 4QOKD 5D1ZB 4P46B 4Y1AD 2C1OB 5E2UL 4FXKB 4M8QA 1TVBA 1TMCB 1L7IL 5HHMD 3BN9C 1T1YA 1JZ3A 5DRZA 1CD0A 2GITA 1G1YA 4JHWH 2CR3A 1P5UA 5I1DB 4XNXH 1MHHB 3MREA 1F3RB 4OD1H 2ESVB 2P8MA 1J10A 3HC0B 4J8RA 3NPSC 4L29A 5JA9A 2F53D 3GJFA 1GGIH 1AXSB 1CWVA 1F4AA 4X5WA 2O61A 1U93B 5DFTA 5DK2B 4OD3H 4AEHL 3DARA 4ZFOA 3AS1A 3F58L 4MGXA 2W65B 3K2UH 4L3CB 4A6YB 4XGZB 1WZ1H 4ZO6A 3WO4B 3JV4A 5EBWB 3MYZA 4QXUH 3UJJL 2PXYD 1VKXB 2PXYA 5DD5L 3IDJA 3C5JB 2BHUA 2LU3A 4L3EE 4M7KH 4H0HB 3HRPA 4HIJB 4U1IA 3ISWA 1S5HB 2Z91B 3FQUB 2LABA 1NCNA 4MD0B 1ND0B 3V7AG 1SYVB 3GMQB 4F7EB 4ZFOL 1KB9J 2FDBP 4JO4H 4NFBA 3EO9L 4P3WA 3RP1A 1MUJA 4EXKA 5JHLH 1T83C 2VDNL 1R6VA 2AEWA 1SBBA 4H1LG 3QPXH 5D6DC 3S35L 1E6OH 4YFLI 1JHLH 4XPGH 4JRYB 2BSSA 4YBLC 4XZUA 3WFEH 1I8MB 4KHTH 1G7QA 4HMEA 3VFWA 3SE4A 1HQRB 2BVPB 2DQGH 2X4SA 3NCBB 3DPBA 4QYOB 3UTTE 5J1AB 1KB9K 4F7TA 4PJCF 4FQ2H 2NX5D 4B0MM 2EE9A 4Y4HB 4G42B 4HWBH 4LEXL 2EEBA 3G5ZB 5E1AB 5CEZH 3N1PC 1TQCB 4B41A 4U1IB 1P84K 5JTWA 4Y88A 4P4KD 5BS0E 4JB9H 5HHOA 3QEQA 3PWNA 5HI5C 3REWB 2BDNL 2EDWA 1JFQL 1JGLL 4KV5F 3FB8A 3EHBD 1MF2L 1BZ7A 3BZEA 2AGJL 4K3JL 2DI9A 4YR6B 2N56A 1Q9KB 1G7HA 2GEEA 5BXFB 2GTZB 2UZIL 3H2WA 4PTUB 2ADFH 4NBXB 3RPKA 2Y9RT 5H94A 1JGVL 3B2VH 5SWSE 3VXMD 4PJGE 4WFEE 4LAQH 2X89A 3MODL 5GGUB 3VXRE 4R2GD 4XBGB 4LDEB 2HN7B 1PZ5B 2VH5L 5ACZB 5F6IB 1U8LA 3LCYA 3S3JA 5I30H 4XP4H 1WBZA 2HTKC 1ZK9A 4TTDC 5DQ9B 1DVFA 5L2KB 5J13B 2QQQA 3LKRA 3S96B 4N0FA 1I7RA 2UWEA 2F8OA 4LCCC 4KK5C 1YDPA 2J8UF 1NJ9B 3EIFA 1MCBA 1GGBL 3KXFE 1GIGH 5DMKB 1I8IB 4OLXL 2ZKHL 4C56B 1KJ3L 1YEKH 1KCRL 2BZDA 4M93B 4DAGL 1RIVH 4AMKL 4GXVL 4LASH 1UZ8A 2H9GA 1QKZH 2WQRA 3MLPA 4WNQB 4W81A 3U48A 2WM0A 2YSSB 4JFXA 1J7VR 2NY3B 4CAGA 1GGYA 5E94A 1LEKB 4L3EA 1VFBB 2HJLB 3ULUH 2C1OA 4H1LA 2A6JB 1K8IA 3L5IA 4XHJC 4YUEL 3KPRD 3B3IA 4ENEC 1HCFX 1IQWL 4IRJB 3FAXA 2PNDA 1UM4L 1ZHLA 3O4LB 2P46B 2XFXA 2WK2A 3D9AL 3EBAA 3QULB 1PG7X 4V1DE 5J8OA 4U6XA 1C08B 4U1SB 1C5BH 1LVEA 5J4MA 4N0CC 3MR9A 4Y2DD 5B4MD 5C6WH 1CQKA 5DDHB 2IQ9L 3TPKA 4FQPA 5HVWA 3E1F1 4KJYB 5DVKA 5ID1A 1HHJA 5BJTA 5T3XH 3ARVA 3QZWB 2XTJC 1CU4L 2JLLA 1CFTA 4ZS7L 3K2UL 1S7RB 4AL8H 4UMGA 2UV3A 5TH2A 3PL6B 1S78D 5J6HA 5HYSB 1HIML 4H8WC 4FP8H 5C0BD 5DJAB 2WUCL 3GHEL 5EO0A 3R1GL 2QQKL 4ODXA 4H8WH 5CZXC 3BW9A 3IAQA 1MY5A 2W9DL 1ZHKA 3NGBB 4Y16A 3ALPA 3MRJA 3QIUA 3WJLA 5E03A 4X80H 2VQ1A 4LVEA 4IOFC 4FTVD 4PLOB 1ZLWK 4IIQB 3T0EC 5FO8A 3BT2H 4G9FD 4JN1L 4PB0L 5ID1B 2VABB 2MQ3A 3V4UL 5JXEA 3G5YA 4UT9L 3HE6A 3OXRB 3DURA 1NCCL 4PJ7F 1IT9L 1KN4L 4AG4L 3RTQD 2W0LA 3GI9L 4M02A 5H35A 3BP5B 1MPAL 1YY8A 5GRUH 2ZKHH 5IG7B 3WNLA 3NCMA 3P40A 4ONOA 5HGDB 5JXAH 4UTAH 2FATL 4YPGA 3VRJB 2UWEE 2DTML 3DX9A 5JOFA 5ALCH 2FLBT 3K4AA 1M7DB 2Q7YA 5KW9L 3LHPH 4H25B 2X1OA 4NN7C 3LB6C 3T0WA 1EHLH 3R06B 1AD9A 1ZHBB 1XIWD 5EOQH 1P53A 1MOEA 2GT9B 4I3RH 4JJ5A 2R9HD 2YEZB 1NCWL 2P8LB 4WRLA 5FO9B 4OSUL 3GRWH 4PJGA 3DVIA 3BZ4B 5C9KA 4PGBA 2OTWA 4OGYH 4X9IA 4CW1A 2DBLL 2ZG2A 3KPMB 2EDJA 4K3JH 5H2BB 4JFZH 5B8CC 2LTQB 5CJOH 2BSRB 2NNAA 2ENYA 2R9HC 1OAYL 4UINL 5DTFA 5TE6H 1YN6B 3MRRA 3PDDA 3DRTB 1S9YA 3QNZB 1SEQL 3VWJA 2OZ4L 3JWDH 4EI6A 1I9RH 3TFKD 1MQKH 5HGHB 4QHNA 1WGOA 4RBPH 4LP5A 1AO7E 5ACMA 1ORSB 2E27H 2GFBA 3SBWC 1IGTA 3Q6GL 1AXSA 1OAXL 3QHZL 1BF2A 4RNRA 3ARDD 4L3EB 1ZGLM 2Z91A 4PJ8D 2DIBA 3UJIL 2PO6A 2E9JA 2PO6D 4XVSL 3IU4H 3W0WB 4F7EA 5ICXA 1VKXA 1N6VA 4QRPA 5D7KE 5T1LB 1KENH 2EDFA 4MAYD 2VDNH 1I3RB 2E5EA 1GSMA 3F6LA 4PJ7A 1IC1A 1U3HC 4LASL 1DQQA 4NQSA 3WL9B 3SY0A 4KKLD 1DUYB 1IC5H 1BAFH 4Z8FH 4NO3B 5EG6C 3OGCA 1XMWA 4ONGL 4HUVA 1ZVYA 4FZ8H 4APQB 4F9LC 1G7MB 1B6UA 4NZTH 2DQJL 2XY2A 4NCDA 3GRWL 4ZXBA 1C12A 1MIMH 3KPLB 2ICWJ 4PFEA 1ZV5A 3PWVA 4O58L 5TFSL 1K9TA 1G9NH 4LAJH 1RUAH 4NQCA 3NIDF 1XGQB 3O3EB 4PTTA 4DGVL 1HH6A 1T89A 5D5MB 5CJOL 1KYOJ 2JF1A 1EX0A 3LMJH 3QIWD 5I76A 1A21A 2DMBA 4F58L 2FWOB 1W0VA 2NX5A 3UDWC 2RJMA 1XCQB 2HJFB 2X4RB 3TA3A 3PP4L 2HH0L 1CQYA 1Q9OA 1RZJH 2BHZA 1JV5A 2L7JA 4KVCH 3GRWA 2WLZA 3LQAL 1F3DH 2C3VB 3LRHA 2EIZA 4XBPB 1Y6MR 2VQ1B 4LOUC 1RZJC 4YPJA 1NCWH 4HEME 2Q76A 3QEQB 1SEBA 4JFFE 5E9DB 1A6AB 2ZSWB 5D7SH 2KUTA 2ENSA 2VDKH 4M6NL 3HB3C 3HC4L 5GSVB 1LNUB 4PBVC 4WI4A 1HHIB 4F15B 1RPQA 4P57A 1TVBB 2BVEA 1ZVSA 5ITFA 3LEVH 2CUIA 2OQJB 4OZ4A 4WV1A 4MHHI 1X5LA 2FJHB 2P5WD 2WWKO 3QCUL 4I8DA 1FDLL 4I5BA 5D8JH 2FJFB 1BBJB 2A77L 1FN4A 2X89D 2EDBA 2UWEB 4G9FA 5I2IA 3VXME 1A3RL 4X6DA 3B43A 4JQXC 1HZHL 2VWEE 3G6AB 4PIRF 4K3GA 1V7NL 3SKUD 4JFEA 3RVWD 3TBVA 4DKEH 1TXKA 4AL8L 3UEZA 5KVGH 3U1SH 4C56E 3GSXA 2HWZL 3MGOB 1DJSA 1T80A 2V5TA 5CHNB 2R1WB 1BD2A 5GZOC 2BSED 4NZUH 4PJFA 1LD9A 1AGBB 5DD6B 3ARWA 4QRTA 3SE4C 5FF6A 5IFHL 5I1GH 4HLZG 4Q0XL 3SCMD 3H9YA 1ZLUH 1RZIA 2Z31B 5FHBL 1B9ZA 1RZGA 3GSRA 1MAKA 1T1ZB 4OZHE 1PD6A 4OZIB 3O3UN 5GGRB 3S88H 2AJZA 1ZSDA 2G75B 1XGTB 3D18A 5EZJB 5IBUB 4G6FD 5D5MF 1NCUA 2DQIL 3MLUL 5FYLD 1KJVB 3QCVH 1CGUA 1UQSB 1CICC 3GEWB 2JCCB 4GRWF 4OFYA 4OFYD 4K8RC 5IM7A 2XXMB 2X1WL 4KTDL 1IEAA 1YYMH 4OLUH 5HYJE 1NL0H 2QQLL 5KSAC 4L8BA 4Y5YA 3MOAH 3Q6GH 3V4PL 1C5BL 2VLME 2YD1A 2JJSC 4F7MB 5DEZA 5SWZA 2APWA 2IAMA 5KVDL 2PR4H 1I9RL 2OTPA 3BPCB 4UQ2A 5LWYH 3V5HB 4OKDA 5E00A 4HCRL 2FSEB 3MCKA 4I3SL 5F7DA 4H1LH 5GRJL 2HRPL 4WEBL 3V4VH 5L0QB 5IVZA 4NRYA 4MWFB 1MJ8H 3CH8A 2VITB 3O6FB 4QRSB 2AXGB 4LLVB 1UVQA 3EYQD 4Y19B 4GXUN 4OGYL 4HJJH 1FBIL 4LSQL 3MUGA 4X5LA 1SJHB 2V9TA 2VKXA 1G7MA 1C7SA 2VNCA 5LCVH 3OXRA 4NKIH 2VLKE 4I0KA 5I1LA 2H1PL 3VXSB 3X12A 1P4IL 3QWRA 4HIEB 1EHNA 2R29H 5IP4A 5DJ2A 1CDJA 3V52H 4HXBL 4ZTPL 3KNBB 1WT5A 5CD5C 1YA5A 4BSJA 1A9EB 4ELMF 2GITB 4PJDE 5DJCA 5BRZB 1TVHA 4I9WE 5D7LD 4OFKA 3O3BA 5HD8C 4FZ8L 3VW3H 4DUWA 1NMCB 2ZJSL 2R1XB 1ZHBA 5DURB 1OARH 3RHWF 1F4HA 4HFWB 3TCXA 5FV1L 4CDGC 4DN4H 5BOZG 1UACH 1JPST 3FO1A 3D2UB 3O6ML 2CMRL 4H1LB 1FNGB 3U4EA 5LGJB 1SM3H 1FGNL 2B5IC 4Z76A 3QFJB 4XNYH 3UTSB 3L3GB 1QVOB 3HNSH 3FT4A 4JQVA 3QBTB 1ZA6B 1JGEB 2MCG1 5GRJH 5D6DA 5CZVH 4MD0A 1ND0A 3CLEH 4GRWH 4X5WB 4M6MH 4JR9H 4CW1B 3O2WL 3UBXB 5E8PA 4M9OA 4ZQKA 2Y23A 3KHOA 4QRRA 2AJXH 2MSPA 5A2KH 1QSFA 5BZDA 3P4OB 3IDJB 5E9DD 3C5JA 2RHEA 3DRTA 3GSNH 4JAMB 3QDMD 3RHWK 4HHAA 2VLRA 4JANA 5DJAA 3OAZH 5T33L 4HCRH 4R3SB 4NPYB 1AY1L 1SYVA 3GMQA 3DYPA 3AS2A 4LIQE 4OT1H 3OQ3B 3QIWB 1S5IL 5KBNC 4D9RE 2YD4A 3QRGL 3DECA 5F6HI 3HPLA 1F58L 1IZJA 3DVGB 2Z9TA 4WFFE 2MCPL 3S37H 5C9JB 4UB0H 4F33B 3F58H 2PYED 3DVNA 1IM3B 4FFVC 3WV0A 1YQVH 4XPFH 4ZUUB 5FIEA 3VGDA 4PR5B 4CL7A 1ZA3A 1E6JH 4G80B 2OTUA 1OGTB 4M03A 2BNQE 3DSNA 1FC1A 1NDGA 4U05A 1YY8B 3EO1B 5J06A 4ORGA 2FWOA 3ZKXC 5AZ2H 2HWZH 1TPXC 2R69H 3W0WD 1NC4D 4NJAH 2FO4B 1BZ7B 2VSCA 2AK4E 2VXSH 4WFHE 4NQCB 3IGAB 3SO5A 1H3VA 3VWKC 3LEYH 1MCIA 2P49B 4WI5A 3O4OC 4ISVB 3QT2A 4YHMH 4WDIA 5GSVA 5BS0D 3BEWA 3ARTA 4PJEB 4LKXA 5C08B 3MLXH 3UTSD 5HHVL 4YXKH 43CAA 5BVJB 2DD8L 1KLFA 4XB8A 4X6EB 3ARGA 4KK8C 4LFHD 1G7PA 3H3KA 1O0VA 1I8LC 3GB7A 3QUMA 5D7JD 5KSAD 2FR4A 5HGGS 4Z0XA 4ZFFA 3D39B 8FABA 4HIXL 3QUXC 3BKYH 1HNFA 4TTGA 4MDJA 5JO5A 3BKJL 4HJJL 3QHFL 1QZ1A 3MRKA 1ZHLB 2ICWA 1JGLH 1VB9A 1WBXA 3T08A 4WU5A 3NIFF 3VXNB 3BPOC 4F57L 3O2DA 4WWKD 3BESR 2A1WL 2NY0B 2XQYK 3MRGB 3CSYB 3WHXA 1OF2A 4OCXH 1Q94B 3N1FC 2DM4A 3OGOE 4OLYL 5KVFL 4F9LA 2AI0L 1OQXA 3ARFB 1VESA 5L2JB 3O3AB 5IBLC 3GFUA 4R0LC 2CIKB 1N2RA 3ZDXF 1ITBB 4WWKB 2J6EH 1T5XB 2BRQA 3NFPA 1CT8B 1Z3GL 2PTTA 4LGPB 4TYUA 2VXVH 4HK3J 3E2HC 4LDOB 1JGUL 3LN4B 3QIWC 4G8EA 5MP6L 3KLSA 1ZSDB 2G75A 1AR2A 2Z0BA 4OZHB 5EZJA 3MBED 1HOCA 1ZOXA 1DQQB 3QWOA 4JG0L 4NWUL 3TA3C 4F80A 1RZGB 3EO9H 1YQ2A 3H0TB 3OPZL 3ARBB 1GGCH 4PJBA 3SCMB 3G5VA 5T3ZL 4MJ6B 5IVOA 3F5WB 5I66B 3DV4A 2EYSA 3BZFB 2A6DB 1UWXK 3T0BA 1YYML 1D9KD 4L8DB 5TQ2H 5FYLL 3BAEH 3OAUH 3QEGH 4LLDA 2BNQA 4ZPTB 3KPRB 3TGXA 2AS5M 4I48B 3TH3T 1TNMA 2DWDB 4DVBA 3GSUB 3J8F7 2VB5A 3MRDA 3MV9D 4PRDA 5DD3L 3WKNA 4GRMB 1EEUA 4XRCB 1ES0A 1YEHL 2YKLL 1QSED 1CFQA 1R3IH 4MQXD 2AW2A 4L9DA 4M7JH 2ICEB 4Y5XC 5JQHC 4LOUD 3WS3B 5FDWA 5EU5B 1TZIB 1S8DA 4R90H 3LD8B 4BJLA 3VD5A 3B8YA 1UA6H 4DUXA 4ZODA 1MF2H 1MFCL 3D39D 1IEBA 3WKMH 1R0AL 2NXZB 5JDJA 4EIZC 1ZGLB 1WZLA 5DUPH 5IVZB 3NCJH 1EVTC 2FCBA 4MMXC 4JJ5B 4AENB 1C16B 1RULH 1AQKL 4J4PA 4ZUWB 4LL9A 4EQ2A 4MJIA 1M4KA 4MD4B 4E41D 4HUUA 3R1GH 4HC1A 1TZHA 2R2BA 3HLAA 1WITA 2UYLA 1C5CL 1LEGA 4QGYA 1IT9H 4JZNA 1UXSA 3V6OE 5E8DL 4NN5C 1L9NA 5JDSA 4GH7B 4UNVA 4Q9QL 5C6PB 3FOLA 1A3QA 4X6CA 2H2SD 1AFVL 5FDWB 2HT2C 3QNZA 2YEZA 5DJCB 2AJYL 4Y4KB 1NLDH 2E6QA 4PJEA 1FLRH 5CIPA 3MJ9L 1QTYT 2F15A 3HZVA 5IHUH 5JOEA 2BCKA 4XMKH 3TVMA 2IG2H 3OF6A 3K3QA 3TM6A 1UWEL 1C16A 1BGXL 1KPUA 2BVOB 5ILTH 2IANA 2YC1B 1U8IA 5IVXB 1PW3A 4XNMA 2M2DA 4XZUB 5CINL 1T83A 1RVFL 3PNWB 3WIHH 1N59B 1MELA 2HVJB 4HIHA 4NO0D 3QUYC 5C0DA 3WHE1 1JHKL 4I18A 4IRZL 4P4KC 1JNJA 4NQEE 3SKOA 4FZEL 5ADPH 4XH2B 4Z7VE 5FHAH 3RVVC 1PG7W 4OZFB 4E42A 4KI5F 4DK6A 3QDAA 3I6LE 2GY5A 3MFFA 1AE6L 1N4XH 5DURD 1OD7A 2VXQL 2VLLB 5T1KB 1UEMA 2WBJB 3BYYA 4YHLL 1BFVH 1DDHA 1MCWW 1KELL 1GHFL 3WJJA 4G6KL 4WFGE 4LGRB 5IB1A 1KPUB 2BVOA 1WT5C 4NT6B 1DLHA 3G5XA 1RK1A 1L0YA 1NFDF 4GJTB 1VGEH 5F1IA 4ZO9A 1RZ8B 3WFCH 4APQA 4F33A 4JO3L 3CZJA 4HFUH 3ZDYF 3JVGC 4I77L 5I1JL 5K9JH 1H5BA 4LCIH 3NCYS 4XVJH 2Q76B 1FSKB 1PZUB 2EXWC 1P4IH 1S7TB 5IEHA 3FJTA 4JPIA 3FMGH 5EU6B 4UU9B 4PLNC 1LNUA 1DBBH 4X6CF 5FYKE 3EJZC 3S5LG 3QNXA 4ZUTA 5HHMB 4AH2B 1ADQH 2BP3A 4M62H 5E99H 3L6FA 2Q6WA 1NBQA 3DGCR 4YHIA 3MRFB 3VCLA 3D85B 3CK0L 4LSVH 1G7IA 2J5LB 3DTXB 1T2QL 5CGYD 2CLZB 1P4BL 2E8YA 3F65A 3SDDA 1UYWH 3C87A 2XNAA 3INUH 5J0BA 3Q1SL 1NC2B 3AMLA 2ZCLL 3UYRL 3HE6D 1NMAH 3K4ZA 1HXMB 4PUBH 3QIBB 3X3FL 3X3GH 1WWWX 5ADOH 1BVKB 1KTKE 4N8CL 1TZGH 4Z76B 2AK1L 4X4MA 4U1MA 3ZL4L 1ODAA 3SBWA 3IF1A 3TBTA 3GB7B 3QUMB 2HG5B 3CLFH 5GS0L 3M8OL 5FYKU 1CR9L 3PABA 1FZJB 3QDJA 2LAGB 5IKCA 43CAB 2IPTL 4LVOB 5BVJA 4HCRA 3QHFH 1R24A 1RZKC 3FRUA 3WYRA 1DQLH 3MV9B 3QXVA 3QQ9D 3FQNB 3H3PH 2CDEB 1DBML 2IMMA 4PP1C 1NFIA 3MRGA 2ICCA 2XTLA 3QUYB 1FIGH 4K3EL 4FG6C 2NY2C 3VRJA 3ULUC 1XR9A 2ARWA 3LAFA 3W9EB 4EN3D 5E5MA 5IR1B 2XKNA 3SGDI 4ZFOB 3FONA 2VLRB 4HIIA 5D1ZC 2X1XR 1T03L 5CD3B 5MENB 4F8QA 4JE4B 2VRAA 1QLRA 1ACYH 3I3DA 2JB5H 3MACL 4MJ5B 3IFNH 1HI6A 1Z0MA 4JLRA 4LRIC 3TFKC 3C6LC 4QHUA 4F2MA 5I1IL 4HIJA 3U9UB 4U49A 4X6BA 3E8UH 1U3YA 2B7DT 5IVXE 3MBEB 4ELKA 2YUWA 5CSBA 2WANA 3L3DB 1RURL 4KAQL 3T3MF 4UB0L 3WJLC 4DJMA 3S98A 1JPSL 1MFBL 3WIIH 1JK8B 1JP5A 2HLAA 1D5ZB 3CU1A 3RL1A 5FKAB 1VERA 4FFWD 3DO7A 3ARFD 3ARDA 1CFNA 1VEMA 4UIMA 4H20L 1GOHA 1CBVL 3VG9B 1F3JB 5D93C 3SOBL 2XT1B 1X5GA 3EDDA 3W81A 2CSPA 4NQEA 2JIXA 1BWMA 3WE6A 5ERWB 4LCWB 4NWUH 1QLRB 2M26A 5L8LB 1MCPL 2JJTA 2O93L 5DEGB 3VG0L 2AAVA 1O7SA 2Y07H 3TVMC 5B8CB 4PJ7E 4EI5A 1SJXA 4LKCB 5JOPD 5EO1B 2ZUYA 1GAFH 5HYIA 3JV0A 2VC2H 3LEXA 1T22B 4WI8A 4ACPA 1AXTH 1B0RA 3RX7A 4DOHE 4J3SA 4MWFA 3U36A 3F7VA 1LO4H 4OGAC 3DOSA 1EEQA 3ZDXE 5JIPA 4L4VA 5D1XA 4ELMB 1OB1A 3DX6A 2HYMA 3VMNA 4R0LB 4D9LH 5B38G 5HYQA 3WS3A 1RUQL 3GSVA 2VDRH 3WS6C 1QSEB 3HHRB 2IQAB 3E6HB 3TO4D 2V9RA 3D39A 3KLHC 4ZUTB 4AH2A 3B9EA 1OAKL 3GNML 1YPZF 3P9LB 2CDGB 4G7YL 4GG8B 1U95A 4PRBA 4HG4K 3O41A 5KS9F 4QRUB 5J1TC 3CK0H 3OAYH 4PJFF 5FHAL 3H8NA 5A2FA 3QUML 1NCBL 4PJ8B 35C8L 2NY7H 1IGJA 2VISA 1NUGA 3WCYA 3GI8H 2VH5H 3I02A 2BOCB 2Z4QA 4K9EC 2CKBB 4NKIL 5GGSA 3W11D 2R2CA 3I6GB 3HZVB 5I8KL 5JW4M 4PGZA 3VI4E 1QPXA 2W9LA 5HDBF 2AK4D 3IRZA 5JORB 2AXJA 4GW5B 3VFGL 4U7SA 3MNVA 1AKJD 4GW4A 3N50A 3O8XC 1GPOL 1MHPH 4OCLC 2EDEA 4HLJA 1U8IB 4KY1H 4O2CB 1X5IA 4NKOB 1U8QA 4LQFL 1KTLA 4OBRA 3H3BC 4PGCA 3L3KA 4U3XA 1ZGLP 4LGSB 4U2YA 4GS7C 5ICYA 1XZ0A 3CDFA 3CDCA 1WAAF 5I1GL 5HGBB 1XF3B 4WCYH 3VXPB 1HHKB 3OKEB 1RZKL 1J05A 4LFHG 3TWCL 1IGYA 3FO9B 5D7IE 3VD9A 3CD4A 2FB4L 2FYYB 5C0FA 4X8JB 5EH1A 1AO7B 1LP9A 3MOAL 4M7LT 1DQJA 4JDTH 4DCQB 1REIA 5DXWA 4E0RA 1BIHA 4RFOH 1HSAB 3SDXB 3RVTD 3ALWA 5B38A 4M1CC 5CJBA 5C0NC 5E8EA 3BKYL 4X99A 4OD3L 4AEHH 4N0YH 3DI2B 3IDNB 2Y7QB 4M5ZL 5MERA 1QFWM 4M8VA 4NCC1 2BK8A 1A02N 4QOKB 2FJHA 1NL0L 4N9OB 5LKNA 4YDVA 3FB6A 4AG4H 4JFYA 5IGXL 2O5ZH 4JFPA 4NZRL 2VDPH 3FT3A 4YFEA 3KXFD 1EEYA 5EA0L 4D9QD 3OKLA 3P4NB 1HHKA 2DMCA 4P59L 3GBNH 3L5HA 5EU4A 4PGDB 3JV6A 1NCBH 3C6LA 3H9SA 4KPHH 4G43A 3EKCA 4PREA 2GCYB 1FGNH 1IAKB 1KIRB 4OJFL 4WHTA 3HAEA 5FYKD 2OL3A 3RDTD 1VA9A 3QCTL 5F72S 5IBTL 4KK5D 3K81A 5T3XE 4HSQA 4DKEL 4JFQB 4OF0A 2BXYA 2V2XA 3H7LA 3UC0H 1FRGL 2CK0H 3I3BA 4LPXA 3MV7B 3CC5A 4N0UE 2KKQA 4HAGA 5LAXA 2VITA 3O6FD 2FECL 3PV7A 4KI1A 4TUOB 1AJ7L 1MHHA 4EEEA 4M8QB 1ORQA 2YR3A 4XAKD 1F45A 1JWUB 3ILQC 3BWAB 1L0XA 5KSUB 4PRNA 3O11B 3RWGB 3VDCA 1LO4L 4D8PB 5EZIH 4P5KA 1RFDL 3VXSA 1WBXB 3Q3GA 3DETD 3QR2A 3IXAB 5MEPB 1P9MC 3GMNB 4OIIL 5F1NA 2ADGA 3R0MA 4XNZC 3WLBB 4I0PC 2VLJB 1KCSH 5T5NG 3V5KA 1YN6A 2UUDK 5FYJE 4Q9CA 4ALAH 2C4FT 2OZ4A 2NZIA 4JPWH 3RPIA 4PJAB 1S5HA 3SCMC 1F00I 1FO0A 3TIEA 5D9SA 1MH5A 4FP8L 1A8JH 1I7TA 4PLKD 1PDKA 3Q0HA 2EH7H 3O6LH 2DBJA 1M71B 2PYEE 3O2VH 5SX4I 1FVCB 3BPCA 5DUBA 4YWGH 1Z9SA 3RDTC 4AJ0A 4L8DA 4F2MB 1XGYL 4CKVX 5E2VL 1II4E 2ADJA 1B0GB 3GMPA 1G9MC 3KLHD 2F54A 2E9WA 3O45A 1KN2L 4CVZA 3RUGF 3QAZC 1MCDA 3H0TA 1RUKH 2V2TB 1XEDA 1G7QB 3IFLL 5JLZA 4Q6YA 1MLCA 3I6KA 1JK8A 2EE3A 1PJ9A 3DX7B 2VLRD 1Q72H 4HDIA 1RMFL 4QHLB 2OCFD 1HHGB 3GSWB 4K94C 5J9PA 3BD4A 4BK4A 2PW1B 4UTAL 3CXDH 1ZTXL 5BRZD 1F2XK 4FQJH 1F90H 2GJ6E 4ODTL 5ANMB 2YD5A 1F3JA 1P6AB 1EHLL 1U8HA 4G8GB 1JYVA 1OAXH 9CGTA 1QKZL 3IKCA 3SDXE 3MNZA 2EKJA 2H3NB 4Y1AE 3IJSB 3O8XA 1V5JA 3KPQA 5HHME 1PX3A 4I0PA 3SPVB 3JXAA 3EOBA 3EFFA 5DMGC 1B88A 4LLQA 1JTTA 1D9KC 2ZUWA 4M61A 4Y16B 4M48L 3GIVA 4MAUL 1J87A 1I9IL 3BZDA 4FG6D 1BVKA 1GRWA 1VEPA 1NBYA 1NMBL 5I0DA 3U6RA 5CS7A 3S3SA 1OTUD 4X9FA 4O51B 5DF0A 2I24N 3RGHA 2Z35B 2IQAA 1CGSH 4CBPA 2DKUA 1WIPA 3F7RA 3B8SA 3IFOB 5HDOA 1EAJA 4UOW0 2OZ4H 3PDGA 4R0LA 2QJDA 3MO1A 2EDRA 4I9WD 2DD8H 2OTUB 5BVPL 3VXSE 32C2A 4MZ2A 5ISZE 1DBAH 3LS4H 2FJGA 5IB4A 3IJYB 3V8OA 2FHBA 4PJAF 4EDXB 2OSLB 2ZSWA 1YDPB 7CGTA 1HXYA 3PIQB 4CNIA 1AHWB 3VGAC 4JAMA 4RGOH 4EN3C 3WKML 3O41B 4NQTA 4Y2OA 1HEZA 2BSTB 4PGEB 1N64H 2CK2A 3LPGA 1U41A 5IB5B 3P4LA 3RDTB 4KRPC 1VFBA 2F53B 2HJLA 2QSTA 3RWCA 5HI4D 1DL7L 2VE6B 4TNWF 2AERT 2VIRB 3BIKA 4LQFH 5ALCL 4IOIA 1Z3GH 5BJTB 4IRSD 4P2QB 1FCGA 1QHPA 5T1MB 2AV1A 5F1NB 4N68A 2HKFH 3L5XL 3VE0A 1LD9B 4YDKL 3QJFA 4G80A 5FUCC 2VLMD 1S9WB 5JZ7C 4M6OL 5EIIB 4XH2A 5HHNA 4PJXE 3M17B 1NGZB 2MQCA 4BZ2L 1FO0B 1BM3H 2PYEB 5ESVB 4C54A 4QHNB 4OQTL 3HG1A 1PQZA 3MLRL 1FYTE 3BRFA 4DGIL 4JZOB 3NN8A 3JWOC 5HYSG 5KS9B 3ESVF 1QBMH 1FL3A 1D5XA 2A9NL 4MXQC 4M7LL 3PL6A 3KLDA 5J6HB 3NFSH 5HHOE 4KJPC 3M8OH 1WCBB 4IBLT 1A3LH 5IK3A 5CINH 1XGRB 1ZAGA 2F54B 1ACZA 2VKWA 3UPRA 2FYYA 3BFOA 2FBJH 5C0FB 1XCTA 4NM4L 5E6IA 5GJTL 4QTHA 3CFBB 2I5YL 1I9EA 4JREC 1G7IB 4LHJB 3H3PL 2DM7A 3QYCA 4XNXL 1NC4B 3CVHA 1XGYH 1HNGA 1KB5B 1QG3A 3DJ9A 3F8UB 3S34L 2X6MA 1R3KB 1UVQB 3OX8B 1UH2A 2DICA 1G9ML 4FFYL 5IFAH 3X11B 5F7YC 2JKXA 3VGEA 5IIEA 5C0GB 3QXTA 2X4NA 4F9PA 5KVMC 3O6KL 5KZCB 3UO1H 1YNTA 4FQJL 1P9MA 1A47A 2R0LL 1I8LA 2GJ6A 1JZ8A 4J6RL 3ET9F 3ARZA 2CD0A 4PTTB 1D5IL 4MX7A 1F42A 4P2OA 5I1EL 3FB7A 1J11A 1Z5LB 3SGEH 3BGMB 4G8IB 4X7TB 2AXGA 1J1PH 2FH8A 4PJEF 5DT1L 3IDMB 4KHXL 1INDL 1U2HA 2GSGB 5GJSH 3QUYA 3WDIA 4K71B 1D6VH 4RZCA 3DIFA 5E2TL 1KJ2A 4NQDD 3X12B 4UQ3A 4U6TA 3O8XD 4PV9A 4TUOA 4P2RE 4I0PD 3S88L 1DBBL 5EUOF 2FATH 3VFUA 1K2DB 5F6IC 2LFGA 4PJCB 1HI6B 3KJ4B 3GK8H 5DMIH 3BP4B 2O5XH 4KTEL 4UOW1 1U6AL 2ZNXA 1QQDA 4FQ2L 5EUKA 1UJTA 3WD5L 1GC1C 5F96L 4LCCB 4X6DB 3O0RH 5GGTH 4AYFA 4YBQD 4CN1A 2XWTB 4KKCD 3JUZA 4OIAA 2P24B 5TF1H 4KMQA 4IMKC 3QHTC 2PF6A 2IPUK 1CE1L 2CRZA 1RZKH 4OGXH 1F6AA 2IADB 2EEDA 1NCAH 4XRCA 5EPMB 4NQXA 2X7LB 3RX8A 2V7HB 4LEXH 1BGXH 2XPGA 5CZVL 3R4DA 1JNLL 1YJDL 5B39G 3RL2B 5F71A 1GZPB 3AAZB 4PY7B 1NGYA 1MCRA 2Y4SA 4KH2A 1SY6A 1D9KA 5CMAB 4V2BA 4X83A 3DI3B 4KROC 1I3RA 1RHFA 4PYGA 5TGBB 1K4CB 4RX4D 3D18B 4LPYA 4LBEB 3PF2A 1IGIH 3ARQA 5FYKH 1I3VA 1KUMA 3BEVB 5F8RC 4OD2B 3VXTA 4XPBH 1N59A 4XP6H 3D5OF 3UTOA 1AGDA 1GZQA 3IAGC 4AK1A 4N5UA 2C4FU 3MLWL 1SBSH 3TO2B 2WIIA 2HP4A 1KEGH 4PJ5D 4XPTL 5CGYC 3BP5A 5HDLA 2YRLA 3OKNA 4F7PA 3LKRB 1EBAA 5DS8B 1CFSB 3SDYH 4ZDHB 3CLFL 5GS0H 5ANMA 4U1KA 5DJ6A 1CYGA 4FQLL 3V7MA 5C9JA 4PLJC 2VR9A 1I1FA 1XH3B 2A77H 5ENWA 1K4CA 1IAOB 2C3VA 2MKWA 2EYTA 3U0WL 2P5EE 1HH9A 5JHDB 1Q0XL 1ZLSH 1J1XL 5F1IB 4MA7H 3ULVF 2Z4QB 4FMFA 1NEZB 1AGDB 3EW3B 1GZQB 5SX4H 4KJQD 2H2PC 2ZZUT 5CP3H 4R4BA 5DR5H 2DLTA 3V9FA 1FQ9C 3R0NA 3SKNB 4JPIB 1R5IB 5GGTL 3N85H 2XRAL 2OMNA 5L88L 1A7NH 5F7UA 5E56A 3DBXA 4HUWB 1UJ3A 1AXTL 5KVEL 3SE8H 4JHAL 1TQBB 2EYRB 2Q8AL 2W9EL 5ADOL 4D0DB 4I18C 1HHJB 3IDXL 1WBYA 4JKPL 4YR6A 5EO9B 2R0ZH 3UX9B 3KLAA 3UAJD 4XVTH 4BQ9A 3IRPX 2D2OA 1RUPH 3QDJE 4S1SL 4XPTH 4OCRH 5CLTA 4PJCE 1JNNH 1NDMB 1MCWM 1MI5E 5LGJA 5D7IA 4KWUA 2C1PB 3ZYOA 4HJGA 5E6IC 3ZKMC 1OT1A 4N8VB 5HVGB 1FLTX 5D1ZD 3MRMA 4OAWA 1T3FB 4PPTA 4UILH 4R96A 1HKLL 4HKBA 2R8SL 3PGCB 5L2KA 1RD6A 3U30B 5MI0B 3GO1L 3JWDC 1T21B 4H26A 5J6GB 2I9LA 2VZTA 1A7QL 2IH1B 1JJUA 4HJ0D 2PW1A 5T3ZD 4M7ZB 4L3CA 5C2BH 5D1XC 4C56D 5J56B 3BQUB 1SYSB 3SO3C 1T5XA 2R56L 3G9VA 4K2UL 1NUFA 5F88B 4NNPH 4X8JA 4ZNEA 4DVRH 1CN4A 2ITDB 4HPYH 3AXLA 2D0FA 5GRUL 1A7OH 2ICES 3IKCB 4LLDB 3EOAA 4JANB 1G84A 2B2XL 3HNVH 1AGEA 1CDUA 1IAIM 4OLXH 2HFFB 3CLEL 1NBZA 3K8LA 1PLGH 1MCFA 4BSVA 4Y19A 3SJVA 4XNZB 5BQ7B 3VGAB 4PJBB 2DRUA 5E4EB 4PY8I 3NA4A 2P5WE 3HMWH 2ICEA 4PG9A 4YDVB 5D2NB 1KT2A 3CFKB 1YJDC 2GJZB 3LKSA 4QTIL 4I2XA 1JPFA 2JB6B 3EYFB 4LNVA 3GSUA 2I26N 5GGQH 4AQOA 3VXRA 3KPSE 5JW4Q 4YXHH 3BSZH 5A2JH 2H32H 2AJUH 2CDEA 4MX7B 4QNPF 5HTSA 2EXYD 3DX8B 2VDOL 3GUTA 5DRWB 5EDXA 2WIMA 3O11A 2C26A 4XCNA 3ROLA 3NCFB 4P23A 4P23D 4XP6L 1SMOA 4M3JA 3IGAA 4NP4H 5DJZA 5AZEH 4AM0B 3SN6N 1NLDL 5HGHA 1HEZB 4Z7VF 3SKMB 4CU8A 3NAAL 3LIZL 4LEOA 3NTCL 1KSRA 1U8OB 3MLWH 2EDKA 2Y25A 1K5NA 3RWFA 2W92A 4WJ5B 3OB0H 3U0TB 2WNGA 4XMLL 1W8NA 4F15C 2A6IB 3D0VB 1XIWB 1ZE3C 4YHNB 3I75A 3QXUA 3T8XA 3G5YB 1E0OB 3RZCD 1KCUL 4U6VL 5GRZA 4XI5D 3MLVL 1JUFA 5DUPL 3HLAB 2XN9D 3LKPA 2YD9A 3GSVB 3NFNB 5IJKC 3WNMA 2APBA 4KZEH 5C7XH 5IG7A 4M1GH 4AEIH 3D0LA 5D7LB 4YDKH 5BMFL 1JNHA 4NM8L 1WAAA 4WO4C 5BZWB 1XF4B 4YHPA 1RY7B 1YNKL 1LILA 4NZTL 2W65A 4RBPK 4PJDB 1M6OA 1FE8L 1CD1B 3RY5A 4N0YL 3WHXB 1IGFH 4NC0B 5DD3H 2NXYC 3ZLQC 4FQQA 2DQCH 3SDYL 3OSKA