3P4OB

Crystal structure of h2-kb in complex with the mutant np205-lcmv-v3a epitope ytakypnl, an 8-mer modified peptide from the lcmv
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Crystal Structure of H2-Kb in complex with the mutant NP205-LCMV-V3A epitope YTAKYPNL, an 8-mer modified peptide from the LCMV
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 13
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p4oB00
1INDH 4R0LB 3KR3L 3RKDC 3ULVL 1PKQB 4YAQA 2UUDK 3MRNA 5E9DB 2HRPL 3NPZB 4IIQC 4AIZB 3B83A 2ICCA 1PYWA 3SPVA 5LXGL 4DW2L 3CH1B 3LDBC 1QPPA 4XI5D 1A7OH 1FJ1A 2G75B 5FYKE 2F8VA 1QEWA 4CW1A 4AK1A 1MF2H 3P0YH 5JHDD 3VI3E 4TYUA 3MFFB 1I7ZA 3VA2C 1U3HA 5LBSH 1W0YT 4OZFH 1J7VR 3ULSA 1QBBA 1VFBB 4NQSA 5ICXB 4KJYB 4X6CB 1BQHB 2Q6WA 3DX7A 4CMMA 4UINH 5HYJD 3HI1A 5IB4B 3FO0L 1S3KH 2QQKH 5A2KH 4I48A 5ANME 1I8IA 3DSFL 4OZGA 5DHXB 3TIEB 5BQ7A 3HZMB 5CIPB 1XF1A 3LN5B 3V8CA 1ZOXA 3RNKA 5HPMA 1Y18A 2QQQA 4L29A 4WW2C 1RK1B 1EFXD 2KH2B 1MAJA 3EYQD 1KB5A 4Z5RA 5F97E 5ESQB 3MOQA 4WEBH 5HVHB 4JZNA 4CVXB 3LMJH 3CDFA 3B9KD 3HB3D 2YN5A 4QRSA 1ZHLA 4KVNH 4Z77B 3RL1A 3NCJH 5J56B 1BD2A 2VDKL 4LVHB 4W6YB 1NUFA 2CO7B 3EFFA 2IMMA 5I75C 1W72B 4DZBB 1L7TH 5HGDA 1EHLL 3G5XA 4MJIE 4QRPE 4JAMB 1OSPL 3P3YA 4KRLB 3QXAA 4G42B 2EYTA 5TQ2L 3SDDB 4HJGA 2AKRB 4M7LL 4XWGH 4NNPL 2PTTB 2XFXA 4G8FB 4MAYB 3AGVA 5E2JA 1A22B 1NBYA 2FGZA 1BJMA 3CCHA 1ADQL 1DFBL 5FECA 4CDGC 2FHBA 4IRJA 3PGDA 3NN8A 5GPRA 5TDOA 3TCLB 5D2LB 1DBML 1JPFA 1XT5A 4LKXB 2DQUL 4JFZL 2CXGA 2VLMD 4HLJA 5CD3B 1YEDA 5CJQL 5CEZD 1G6RB 5KZCD 4MA7H 1U8LA 7CGTA 4IRSA 4BH7B 1A02N 3KVQA 4GRWE 3TBTA 1J18A 2EDNA 3V4PL 3ZDXF 1RZ7H 5EU7E 5H94B 3NABL 3WIHA 3X3FL 5ETUA 1NMAL 1J1PL 2AK1L 1TZGL 4HW6A 4WUUB 5DRXB 5IB3B 3FKUS 1FNEB 3FQNB 4Q6IA 3O41B 2C5DC 2Z93A 3EOBB 5LCVH 5GGVY 4K7FA 4BUGA 3IDNA 3HE7A 3UC0H 4E41A 3BW9A 1BIIA 3CSGA 4KKLD 4M93B 4JRXD 1KXTB 3HS0A 2D9CA 5C0BB 1VERA 1L4IA 1QHPA 4OCWH 1XCTA 4ZFFA 4KQ3H 2PYEB 3OV6A 5CHNA 1VEOA 1INQA 1LDPL 1QQDB 1TJIH 4OLZL 5BCAA 2VSDA 2NY0D 3ZDZE 2DMBA 1D3CA 4V1DE 1OARL 2R2HA 3D39A 1CFQA 2E7HA 5FCSH 5C0RL 1VGEL 5BRZA 3SKNB 4G7YL 3U7YH 4PB0L 4Z8FH 3TIDB 1TJGL 3PWPE 3TWCH 4WFHE 3UBXB 2A9NL 4NP4H 4TSAL 4QHMB 3BSZL 1DZBA 4UTBH 1KF9B 5JXED 3T0BA 3KPRA 3CK0H 4GQPH 5EG6C 2GK2A 1SYVA 4Y4HC 1FG2A 3HUJB 1IQDB 4EJ1C 3VXMA 4OFYD 3VXSD 4H0IA 1YN6A 1I1AD 5ID0A 1QO3A 5EO0B 5D7LE 2Q3AA 2QADB 4HK3N 4JDTL 4YR6A 5E1AB 3IETA 3ARVA 5DEGB 1LHZA 1NBVL 3NFPB 3BKJL 4MAYC 4QRQB 3HE6B 3DYMA 4M7ZC 2EC9U 3S36L 5DJZA 3SDAD 4BKLB 1MRCH 1SMOA 3CXDH 4XI5C 1SM3H 3SJVB 1U42A 3RZCA 4QHUB 5FO8B 1FO0L 4Q9RH 2PR4H 1A9BB 2V2WA 4P2QA 4CDHA 4F33A 2UZYB 1TVBA 4XVSL 1P1ZB 1M05B 3BH9A 2G9HB 4KWUA 1OD9A 4JHWH 5HHOB 1W0WA 3ZYZA 4FMFA 1RU9H 2FB4H 2AJVL 3ZTNH 5DFTA 5JPMA 4P2OB 1GJIA 3FB7A 2JB5H 3MBEA 3QDGD 4GLRI 3LCYA 4H1LH 1WISA 4XT1C 5F7EL 4U1GB 2V2TA 3QPQD 5GGVL 5DJDB 3BMWA 4GQ9L 1T04A 1XR8B 2IEPA 3QQNA 1UM6L 1H3PL 4O9HH 4OUUA 1FV1B 2XZZA 5L7XH 1QSFB 2FR4A 1CVSC 2CIKA 4MA8H 1OF2B 3H9ZA 1LO4L 5ISZD 4ZFZA 3D0LA 3QO0A 3DXAA 1JF6A 2CKBB 5JW4Q 4F7CB 4X6CF 3EYQC 4P4KA 1AO7B 2NNAB 3BRGC 2J6EH 4D8PA 4XBGB 3NZHH 5EZIH 4YDJA 2R0LH 5J1AB 3KHQA 4C56D 3B9KC 2EYSA 1F6LL 2NY2D 3MV9E 3IXAA 4HS3B 2P47B 4X4XB 3U2SA 5DO2C 3BO8A 4F57H 2EIBA 3GSNA 1DQDL 3BP5A 1F4WL 3MLYL 3LRHA 4U6HA 3K1DA 3NMEA 4GRMA 4JEGB 3T65A 4L8CA 5ILTL 5F96L 4K3EH 2P5ED 4OQTH 3UBXG 2XTLA 3AXLA 1TVDA 2UY6A 4PJHE 3QYCA 1NLDH 3SE8H 3TC9A 3GZKA 3IFOB 5BW7C 2ZCKL 4JFEB 4JPKH 4QGYA 4H8WH 2QADC 4G9DA 6FABL 1OTSD 5IHBA 2PKDA 4DKEL 3EYOB 4NRXA 3SGKA 5IBTH 4LARL 2JLLA 3HLAA 4HKJB 3HE6C 4QEGA 1BQLH 1LK2A 1TNMA 2CGRL 5IB5B 5HHMD 2YKLL 4KPHL 3UJJH 1RZIB 3HPJA 4F7TA 3TCXA 4M7JL 4U3HA 4NJ9L 1S7UA 4PJFB 1MCFA 2WUBL 1OAYH 3VFUA 4GBXD 4FHBD 5J9PB 1JGLH 4H88H 1MRDH 4OGZA 3U9PH 2ENYA 2A9ML 4M7KL 1KIRA 2FIRT 1IEBB 4GUPA 2IMNA 4JFPB 4NC1C 4EBQL 4S1RL 2CRMA 2HKHL 2WK2A 3CDGB 3E2HC 3Q5TA 4GFTB 4MQ7A 4NSKA 2X9XA 5AZEH 12E8L 2MKLC 5D2LF 4YXHH 2E9JA 3OGOE 5IFAH 1L0YA 1LILA 1R3KA 1SMAA 1DSFH 4HQQL 1KGCE 2MNUA 3T77B 4PJDA 4W4OC 2D7OA 3OR7A 3MRQB 1Q94A 4I0PA 1EJOL 4KKLC 4JFYA 2VL5A 1RIUH 4ZO8A 2EECA 4X80H 3RGVC 3D6GA 4GS7B 1I3GL 5F8QC 2W0PA 3Q2CA 3P4NB 3E1F1 1KJ2A 1Q0XL 1RZJL 3SO3C 5L9DL 1U95A 4NHCL 2NY0C 1JGDB 1IM9D 1FVEA 1P4IH 2E7LC 4OF6A 2VLRA 5DT1H 3RVUC 4U1HB 3UTTE 2P44B 3G08A 1D9KA 1IL1A 1EO5A 3G6DL 1WAAE 5MI0B 1QSVA 3LV3A 1G0DA 3L1OH 4UU9A 2V17L 3OKLA 1QRNE 2Z92A 1AC0A 2LAAA 4ONFH 1IGCL 5GIRB 3MUJA 5C09B 1BEYH 5C86A 4GSDL 4WFED 3AVEA 2R2BB 4FXKB 5EU6A 4U6YB 5F7YC 5FOJA 1PG7X 2OQJA 4CADB 4YXKL 4QXTB 3PWNB 3H3KA 4KFZC 4GW5B 1FFNB 1I1AC 4Z7VA 2C3XA 5GGQL 3BGAA 1AJ7H 2FECI 4JVWA 5GRXG 1WSST 2YN3A 5JR1H 1NFDA 2V6HA 3QUML 1ODAA 3TNMA 1U91A 1JNNL 3HI6H 4K7PH 3GFUA 1AKJB 2Z9TA 1F4YL 4JPWH 2XA8H 4OTXH 5IVXE 5C07B 1U92A 4KRPB 4EI5D 2DYPD 4XCYA 4N0UE 1JN6A 1L6ZA 3WLWC 3ZHLA 3IDJB 1WTGT 2AV7B 4W6WB 5DURB 4GW1A 1UB6A 1B90A 3THMH 4H20H 4JDZB 2HG5B 3O2DA 4G6KH 4JFXA 3OZ9L 4IHOA 3NCEB 2DKUA 2VDRH 4LEOB 1N4XL 1ZVSB 1DANU 3BKCL 1N7ML 1LD9A 1JUFB 2IH1A 3CFJA 5D6CA 4N68A 3UJTL 2BOCB 5F70A 3BEWA 3WJLA 2Q3ZA 1B0GB 3LHPH 3PHOB 1K3ZA 4PY7A 4XPTL 3O6LH 1UZ6F 1U8QB 2I26N 1YPZE 1UENA 3I02B 4G43A 5I2IA 3PHSA 5F88A 1CICD 4KKCC 3CLEL 4UNVA 1KXQE 4I18B 2D0FA 4RX4D 1HDMB 4LSPL 3O4LE 4MXQD 3WSQH 5DMGD 2NQCA 2BXZA 5CKGA 4YHZL 3E3QC 2VXVH 1ZEAL 1L9MA 4J3VA 5IV2A 1V7MH 4M6AA 1DLHB 5I18H 3WDIA 2ORBL 5GJTL 4E5XB 5DUBB 3DO3A 1WZ1L 2GT9A 1MWAA 2PUQT 5LGJA 1BVKB 4LSQH 1S7TB 2WIIB 4LP4A 5CIPH 3VMNA 5HHQA 1PX3A 3QRGL 1FRGL 2AEIT 4I3SH 3FONA 4PGEA 3DX9A 3PHQB 5HJ3B 2R1YA 2QHLA 3UTSE 2CLRB 5BZDB 3EDFA 4R97B 4ZOEA 5E95B 4L4TE 2YA0A 5I73C 4S0SD 4JPVL 3ZE2F 3LKPA 1OTSC 2QKIA 4MMXC 1N2RA 2O61A 3K4AA 5HYSA 2J88H 3BMVA 4CU7A 4I9WE 1A6UL 2ARJA 1CGVA 2JE8A 4M43L 4LLQA 1GOFA 4M1CC 2BNQD 3VGDA 3OMZA 5GGRB 3IFNL 4JPIA 3KYNA 4D0DB 3K2MC 1FYTD 4Q0XL 1LE9B 1Q9WA 3MNVA 1HSBA 1YMME 3MLUL 2MQCA 4GAYB 2FWOA 2WWMD 4MYWB 2FD6L 3AMKA 4HLZG 3MV7D 3TVMD 2H3NA 2VLKE 1JHTB 1MFEH 2ICWB 4HT1L 5GS3A 3L6FA 4HKXA 4MNHB 4P23B 1KUMA 5DHYA 4QRUB 5DYOB 5BXFB 3K4ZA 4U31A 4L9DA 3L3IB 4YDIH 1NAML 4PJFF 4JLRB 3C9NA 1U3ZA 4N1CA 4EN3B 5JW5B 3CUPB 1MUJA 4TUJB 3FFDA 4F7EB 2EDJA 3MA9H 4RIRA 5CMAA 3BIAX 3WFBL 1U9KA 4AM0A 4KK6D 5DMYA 4RFOL 2OJEB 1P4BH 3MYJB 4XP1H 3GBNL 4YDKH 4F58H 5I9QC 1IAKA 4I18C 1MELA 5D7KE 3WUWA 5EN2A 3WFDH 5B8CB 1VGKA 1YNKL 5F3HB 3SE3A 1S5HB 4LIQL 3T3PF 1RFDL 3ZKND 4IMKC 3PABA 2FCBA 1BGXL 4P9HH 3SOBH 2BVQA 3SGJA 1JGVL 3MJ8A 2Q7NA 4YHKL 3EBAA 1EEZB 5FA3A 4K94C 4ZFOB 1N5YH 1A6TA 2IANB 5F1IA 1TZIA 3BP7B 3ZDXE 2R56H 1LO0H 5ITFB 4N90D 4ELMA 4JO2H 5I1GL 5MEQB 2CDGB 3DLQR 1EAPA 2XXCB 4NRYB 1UJ3B 2H9GB 4PRPD 1S9YA 3KJ4C 4GXVH 2A73A 4JZOA 4XP9L 4FQ1L 5FYJH 3MZTA 4FFYH 2P45B 4Z76B 3G5YA 2KL6A 2AXFA 2XG5A 4XWOD 5AYUH 4B41A 1DBBH 3L3OB 4NZJA 2JIXD 3P4MA 5HDLA 2L7JA 2X5PA 1OM3H 4XP6L 2EXYD 4WVRA 1A7NL 1XFPA 4OD1H 3Q1SL 2DLFL 3VFOA 1MIEL 5C0CD 1I1YA 4KMQA 4D2NA 3EJJX 4L3AA 1EVTC 4ORGB 2W92A 4P2RB 4PTTB 4N9GB 5JW3H 5T1LB 4RGMB 2SEBA 4APQB 3VXRD 3AM8C 2BCKB 4PGJA 4FFZL 4P23C 4WHTB 2VRAA 3OKMB 5BZWB 3K3QA 3P0VL 4PGCB 5E2WH 5EZOL 5DF0A 5D1ZC 5IEHA 3HCVB 2P5WE 2XT1B 2VSCA 3C6LA 2J7LA 4KGJA 1CICC 4XNYL 1LEKB 5SWQA 4EN3C 2QQNH 3AS2A 3VXOA 1LP9B 3T4YA 2LVEA 1NGPL 3PIQB 3UTOA 4MDJA 3BPCB 4PUBH 3K8LA 4U6XB 5L2KD 4MA1B 1W0VA 2WSKA 3MACL 4FQXD 5EBLA 1ZLSH 4NRZA 1QLFA 4ODTH 5BV7L 1RI8A 3QNZA 1L9NA 2NZ9D 3U7WL 2D7TL 1EAJA 2NXZD 3ME0A 1CFTA 4LPVA 1F58H 4LHUA 1N0XL 4Z7NE 4IM8A 3V5DB 5CUSH 5KVDL 1AH1A 3FB8B 5TGBA 5T3ZL 1NCTA 2GSGA 4NFBA 2VXTL 4UBDD 1HHJA 4LRNH 5HYQB 3U9UA 3QISA 1DBAH 1ZT4A 4NBZB 1SYSA 3DROB 4NN5C 1BAFL 2UYLB 3P2TA 1PKQE 2BZDA 3NACH 3NVQA 4MNGB 25C8L 4S1QL 4K8RH 4ONGH 2QQLH 3BQUA 1KIQB 4JN1L 4KXZI 4ZXBB 1UJ3C 4ZTPH 5DC9B 2R23B 4NOBA 1FNSL 5D7IB 2DQEL 4YPGA 5KJRH 3ULUH 1MFDL 5T1MB 32C2A 2DI9A 2P24B 1FN4B 1GGIL 2F58H 4NN6B 5ITBL 5DJ2B 3QDMD 1AR1C 4FZ8L 4FQIL 5FOBB 4HD9A 4ACPA 2BHUA 3VG0L 3KDMA 4XH2B 3NIGF 3H42L 4QRTB 2HFGH 4OCLC 3D2UD 4WTZG 3N9GL 4DKAA 1YEJH 2WWMC 1VB9A 5AUMB 2EH7L 3TVMC 2OI9C 3NTCH 2J5LC 3F6LA 3MRLB 1HEZB 3JWOL 4RGMC 4LQ1A 4PJBB 5JLZB 4G9FE 3GMOA 1P7QB 4WU7B 2OL3B 1HXMA 2OZ4H 3DETD 4P46A 1CDUA 3MRJB 3VA6A 4Z7OE 2IQ9H 4ZNEA 3GSVA 1DEEB 5FK9A 5EUOE 1ZGLB 2HT2D 4PJAA 4NCDA 1QBLL 1A4JB 2H26B 2WW8A 5FGRA 3OAUH 1T1XB 1AQDB 4PJCB 4PGDA 4JY5H 5KSUB 1E4KA 4WWKD 5H37G 5JPNB 2ZUSA 5AWNH 5LG1A 3DVGA 1PQZB 2Y25A 1IGTB 1TMCB 1CZ8L 3RWHA 3LEVH 1FDLH 2PO6B 4MA1C 5C7XH 4RSVA 3PV6A 4DCQB 5AD0A 1BLNA 4OD2B 1P2CA 2EH8H 5E6ID 1F3JA 3WO4C 4G6MH 3IB4A 5F89A 5GGTL 1ED3A 4RAUA 1YMHA 2J8HA 3SDCD 4YHLL 5CJOH 5AG8A 1AR2A 3VJ6B 1YEKH 3MRPA 2V7NA 5T5NG 4P9ML 5IJKC 2R29L 4POZC 4IS6B 3T0AA 1CXLA 2H6PA 1MI5D 5FYLL 3SDXA 4O2FB 4LCWB 5B39B 3VFMA 5TDPB 4UUJB 1J8HB 1QACA 2EO1A 2QSCH 3GJFB 4XB8A 3UPAA 5L0QC 3VD7A 5HHXL 3V5HB 1JTOA 5D7JD 4XPAL 4MZ2A 2QR0A 1FFPA 4JQXA 2ZSVA 3BD5A 3U36B 2Z91B 1MCEA 3BZEA 1CI5A 1JZ2A 1MHPH 4PJGA 5E5UB 4N1EA 4Y2DA 3EDJA 4RFNB 3VCLB 3MREA 5H2BA 4IMLB 4FFVC 2IG2H 2OK0H 1TIUA 2Z8RA 2I5YH 6CGTA 4XPHL 4NN6C 5HDBF 4NQCB 2R2EA 4YWGH 1M7DA 4MZ3A 4EVNA 1AHWB 3QT2A 3WS3A 2APVA 1GHFL 5FM4A 3F7VB 4PLKC 3AROA 3QQ3A 4R26H 1G7IB 3C2AH 3FAXA 2B4CH 3WCYA 4TOYH 1B2WL 2I9LB 1MH5B 1AGBB 3INUL 4X6DB 2BSED 1QFWH 4BQCA 1KJVA 2ZKHL 5MEOA 4QO1A 2HH0L 2F54B 1D6VH 4PGBA 4GMTL 4TSBH 2XZAL 4XMLL 2DN7A 4PJIB 4J1UA 3FO9B 1SJVA 2PYEE 3DV6B 5DGQA 3MBXL 3C09C 2VQ1B 5TFSL 1XZ0B 2E7BA 5E2VH 1UVQA 4PBWD 3VFVB 3X3GL 2P8PB 4HLZH 2H32A 5IHZA 1UA6L 2YPLB 4GRLB 4GJTB 4NQDD 3SKOA 2FSEB 4OCXL 1F6AA 4HGKC 4YHML 3I75B 4U6VL 1BREA 5I30H 3EAKA 3BIBX 5DD0H 1D5XB 4C4KT 2AABL 3TA3C 4DFIA 4HHAA 4JFOB 2XKSA 1CBVL 2I60L 5AAMA 2IAMB 3TV3H 1FQ9C 1IC5L 2PO6C 4ZMAT 2NXZC 3TM6A 3ARBA 5A3ID 5JHDA 4LL9A 2UVEA 3CMGA 3RY5A 3BEVA 1XCQA 1IGJB 1LP9F 3DECA 1GYAA 1Y6MR 1FNGA 1FFQA 2GUOA 1IT9L 1MIMH 3TEUA 4UBDC 4XNXH 1NC4B 1YEIH 4OM0H 5HYJA 3VXNB 5K9JH 4Z78A 1U2CA 3LQMA 3OBAA 4NT6A 4F2MA 2AGJH 5EZJA 5CFHA 5FYKL 4M48H 3PWUB 4WY7H 1X7QB 2BNRB 2FLBT 5DC4B 5TF1L 5FGBA 2VLME 4EOWH 4PJEB 4Y5XA 5CEZE 3B6SB 3G6JB 5DUMH 5IG7B 3ZZ1A 1UZ6E 4PR5B 3QI9A 3BYTA 5KVGH 5FDYA 1D6EB 1SEQL 3IXTB 2H8PB 4U1NB 1EFXA 4RFNC 4Y4KB 5ESVB 2AAVA 4L8SB 1VSCA 2D03H 4HX1B 4LEXH 1A3RL 4ZUSB 4JO3L 1RJYA 3H3PH 3I3DA 5DJAB 1M71B 4NC1E 2DMKA 1NANH 4NQED 4H8WC 1G9MH 1K6QL 3KPSB 5EU5A 4QT5A 3QUXA 3T04D 1F4HA 5SWSA 3MLZL 3W9EB 5MP6H 2AS5M 1IGFL 1QNZH 4HZLB 2Q7YB 1UCBH 4Y8AA 5D7IF 3MRRB 1GAFL 1JK8B 3NCYS 4ENEC 1HKFA 1LNUA 4XBPB 1YN7A 2DAVA 4N8PA 1F00I 4HCRH 4LKCA 3VRIA 1RULH 3FQRB 3ISWA 4M9OA 4PRAB 8CGTA 1V3LA 3K80A 4O51B 3DETC 2CDFB 1KTKE 1AO7E 4OAWA 2JELH 4UILL 1CLYH 5FF6B 4NDMB 2EYRA 5IF0B 1MCRA 3PG2A 3K8MA 1NDGB 5DJ0A 4BH8A 1R5VB 4PYHA 2BNUB 2IGFH 1JHLH 1UC6A 3RP1A 5C8JA 1M7XA 4PJXE 1IE5A 4HFUH 1GZPB 2R4RH 3BH8B 3ZE2E 3VFRA 1A14L 3O6FD 4JRWA 4PJBF 3SCMB 5DQJB 1H3WM 1BF8A 4ALAL 3CFCH 3QDHA 1NMBL 3MV8B 3HRZA 1HSAB 2IAMC 3DUHA 3VXSE 2EKSB 2B20A 2HKFL 4DN3L 1EERB 2YMXH 3B8SA 5EO1B 4LLVB 2J4WL 4PJCF 3FQXB 3X14B 4JFEE 1GCFA 3DUSB 1KT2A 3OKNB 1IRAY 5HHVL 3FJTA 3OSKA 4MMZC 3OKOB 3UPRB 4KJWC 2C1PB 3WXWH 3P9LB 1Z2KA 4Y5VB 4QOKD 1IBGL 2NY3B 1KBGH 2VYRE 1BX2B 3F5WA 4GAGH 1FNLA 5DFVC 5D72L 4JRXA 4LNRB 4PJFE 4QHNA 1DQML 5E8NB 4JG0L 4F7PB 4RNRB 1CFSA 1EXUB 2PXYB 4XPFL 2DWEA 2VXQH 5EORL 2B0SL 1Q9KB 3LIZL 2Z31A 4PLNC 4JO4L 4HIXH 4XHJC 2CH8A 1OCWH 2P8LA 1IEAB 2VZTA 1G6VK 4LU5L 4L3CB 3PQYD 1YUHB 5FYJD 3V0VB 1FL6A 2W60B 2VXUH 3GJEA 4Y19A 4DGVH 3RTQB 4NZTL 2GW5A 2FGWL 2D4DA 1S7VA 1NBQA 2R39A 5EBWA 2Y5TB 5JXEA 4QRRD 3PDDA 4KK5D 1ZA3A 2BVOB 4DGIH 2R0WH 3HC3H 1NGXA 4L8BA 5GISL 4OF5A 1H9VA 4OFYA 3EW3B 3QIUB 1DN2A 1K9TA 5IVZA 4C56E 4F7MA 5B38B 3E3QE 1D5BB 2X6MA 4HUWB 1SJHA 2ZUWA 3K2UH 3FCTB 1MHCA 4X6DF 4CU6A 1Z3GH 3VFPA 4M6ML 1FIGH 4NWTH 5HGAA 3O45B 2VOTA 2HJKB 1YEEL 4PJIF 2EE3A 2BRRL 3SDAA 1IAII 3SCMC 4PJ8A 4UT6H 4Y16B 4AEFA 3WN5C 4YEFA 3TZVD 3IF1B 3GSRB 5JIHA 4HDIB 1CGXA 4G8GB 5L6YL 4X9HA 5GS0H 4N0YL 5T1KD 4M6OL 3TO4A 5I15H 5DD3H 2ICEA 3QPXL 5ALCH 2JK5B 4H5SB 4NKDB 5E2UL 1FO0B 3IJYA 5E03A 5JOFA 4PRIB 1YC8A 5DHVA 3REVB 4TVPH 1QLRB 3A67L 3QDGA 3KPLB 4LDLB 3Q6FB 2Z8SA 4OSUH 3I6GA 1YQVL 1AXSB 4TULL 4RISH 5LVEA 3ZYIA 5HHME 3ULVF 2BVUA 2XZCL 1B6UA 4Y5VC 1IQWL 1MNUL 4XRCA 3G9VA 5KVMC 3Q6GL 2DQJL 1T6WA 5E5MB 5ISZA 3FQWB 1FGVH 1AE6H 3VU2A 3D25B 4YDVA 1FFRA 5HDQH 4FQPA 4NYLB 3MMEB 3FO2B 3LQZA 2PXYC 4K8RD 3DARA 1T0MA 1C5DA 5KS9B 2VZ3A 2VDNH 2YUWA 5DWUH 1AD0A 4EXPX 3HZYB 3PGFL 3T2NL 3ULUD 1IKNC 3AS0A 4YNYB 3PWLA 1J05B 3X17A 3TBVB 4NJAL 3T2PA 3V9FA 4A6YB 3RTQC 1KCSL 1JMXA 1MRFL 2A6KB 5C2BL 1U8KB 3D0VB 5BS0B 1BZ9B 1B4JL 2W91A 3DNKA 3V8OA 4MHHI 4N9OB 3EYUL 1X44A 4X6EA 4CL7A 1S9WB 1EEQA 2M26A 4FS0A 4X4MA 1HKLH 3EFDH 1OTTD 3DI3B 3QIUC 4BSJA 2DQDH 2NW2B 2RB8A 2IPUG 3MJ7A 4MNQD 2BC4B 5CS7A 5D6DA 2APFA 3VGAB 5B38G 3QO1A 3WKNA 4R7DA 4LSTH 4HS8L 3E6FB 4ZD3L 4WFEE 3QFJE 4HGWB 1OPGH 4JGMA 1RMFL 2P7TB 2J2ZA 4QNPF 7FABH 1OVZA 4X5WA 2JB6A 5EOCL 1DBJH 2W9DL 4KKBC 2N7AA 3HG1B 2GJ6B 4ISVA 4IRZL 5F7DA 1RJLB 4ZPTB 1DN0B 2X42A 3NIGE 3ORJA 3B43A 4GBXA 3H6JA 4JY6B 5EU4B 3SE4C 3U0TB 4EQ2A 1R5IA 3BHBA 1L7IH 4KJPC 5I1JH 1NLBL 4NO0D 1KCUL 2VN7A 4PG9B 1I8KA 4UV4H 1K4CA 3HFMH 3PUCA 3EYSH 4GG6B 2CUIA 1AIFA 4NQVA 2OXGA 2X4NB 4XVUC 5EZLB 3FT3A 5JIKA 4XNUL 1WBXB 1OAQL 4X99A 3T8XB 1H5BA 3C2SA 4R4NC 2X70B 3ETBF 4JM2D 4HWBL 4R2GD 3VW3H 4NNYA 4P4RA 1IM9A 1GH7A 1UWEH 4PP1D 5DEFA 3C5ZB 3DX6A 4U7SA 2P48B 1IAOA 1U8HA 4LFHG 4ZS7H 5FB8A 3ZL4L 3RVTC 1LWRA 1I7RB 1P7KB 4CVWA 3MRBB 1J1XH 1NFIB 2ESVA 2VDQH 3LN4A 4TSCH 4F80A 2QV2A 4QHLB 3PL6B 2HVJA 3L5JA 3PF2A 5FO7A 3MA7A 3FT4A 5D71H 2BY0A 5JIIA 1G1CA 4I3GA 4KK5C 1JGUH 5E08H 3IAQA 1CXIA 4RWYH 4HUXA 2VDOL 1KFAH 1AGFB 3D3VB 1JZ5A 1M7IB 3JUZA 3VXUB 3O11B 1T66C 1F8TH 3L7FB 1INEH 2CR6A 4MAUH 3TNNB 1T03H 3BIKB 3ILPB 3EKCA 5AZ2L 3WNKA 4AEHL 2Z4QB 4I2XE 2X4SA 4DN4H 2QJDA 1IGIL 1TETH 1VEPA 1Q38A 5EIIB 2OX5A 1T80A 2VC2L 5M7QA 5IHUL 1IM3B 5I66B 5SX4H 2A6IA 5F3BA 4OV5B 4JFQB 2FBJL 1H3UA 4EI5A 5J6HA 4BFGA 3KPPA 1FP5A 1HHGB 2X7LB 3QUMB 2NX5D 3S35H 3VGAC 2UY7A 2NXYB 2VE6B 1Q72L 2XTJD 2DQCH 1U8JA 2OP4L 5HDBE 5C0EB 4UOJA 3ARDB 2WAHA 1JNHA 5HD8C 4FG6D 1CT8B 1HI6B 4P0DA 4M02A 4NKIL 5I1CH 1VDGA 4KUCD 2NW3A 5ICYA 1NAKH 5HHNA 1ZWIB 2FX8H 1VKXB 4NNXA 3V7MA 3PNWB 3VWKD 3ZDYF 5E5RB 3DIFB 4OGXH 1BQSA 4WI3A 5CJ8A 2QSQA 1IFHL 4G6AD 3JTSA 1G7PA 2B2XH 2DD8L 2NPLX 4GAJH 1JTTA 5KW9L 3VE0B 1QA9B 1RK0B 3O4OC 5JORA 2VLJB 2F53B 4NCC2 2A83B 1GIGL 4Y5YA 3QDAA 1KN4L 4Y2OA 3KR3H 1MHEB 3GI9L 3KPNA 4FQQA 4HPYL 3MV7E 2NY4B 3QEUB 3QJHA 4RX4A 2HRPH 1LE5A 1UG9A 2EKJA 2YSSB 4KROB 5LXGH 3X13B 5CGYD 1LQSR 4P2RE 5D96B 3O9WB 4DW2H 3QIBA 2DL2A 2MQ0A 1G9NL 2LTQB 3RPIA 1PVHA 1T21A 2YWZA 3ULUC 1U8OB 4F37F 4O4YL 1BFSA 2B1HL 2Y06L 1DQLH 2DBLL 2ZPKL 3MRFB 1QRKA 2B8OT 4BUHA 4PP2B 1K8DA 3OB0K 2DDQL 1YJDL 3PL6C 1UJTA 1OWRM 3GMLB 1GPOH 5F21B 3WHXB 1CLZL 4L3ED 4ODVH 2D0HA 4C58B 1RAMA 3OGCB 3QAZC 5KS9F 4AMKL 4JE4B 1WV7T 4Q9QL 3WFEL 3DURB 2FIKB 4Q9CA 5AG9A 1CIUA 3TO2A 4LPXA 5TDNB 1CE6B 3MLRH 1I4FB 1RUMH 3MCLL 3QIWA 4UAOB 3BP4B 1K5NB 1KPRB 4FZEL 5EB9A 4XMPL 3V6FA 4WI2A 5C3LD 1TTGA 2BNQA 2NXYC 4P5MB 2GFBA 4N8CL 4WDIB 3MLTB 5IP4A 1IAIL 4GH7B 3KGRA 4C54A 4HBCL 3QXTA 3ARDC 1A47A 5IW1A 4UB0H 1JNLL 2GAZB 1CXEA 2BXYA 4PJ5D 1QD0A 3ZKXC 1Z5LA 5H35A 4LLWB 2VABA 2VDKH 4JZJB 1URLA 5D7IE 3MXVL 3P0GB 1IZKA 1SY6L 4BSWA 2B1AL 4NPYB 1EHLH 1YYLL 2EZ0C 3TPUA 3Q3GB 4LOUD 2V5YA 1OSPH 2BFVL 3RL2A 3MQIA 5TQ2H 1CFNB 2VH5L 4PJ7B 4BYHA 4E0RB 4WFGD 3KPTA 3D85D 1ZANL 1U58B 1DFBH 1NAMB 3QG6B 4JM2C 4R2GC 4DZ8A 3U0WH 1R3IH 2VIRB 4LVEA 5C0CE 4MA3A 4H0GA 2FZ3B 2AK4D 2H45A 3OJDA 4WI9A 4AYFA 1J5OL 3UDWA 2AJSL 4PB9L 1IJ9A 4OD3H 1BECA 1TDQA 3CNKA 4PRDB 2DQUH 3RFZC 4GG6F 4JFZH 3DVIA 4LVOC 4YX2L 3RY6A 1IKFL 5TQ0L 1UKTA 4PJBE 3AY4C 1LEGB 1KTLA 5MENA 3UBXI 2LTQC 5CLWA 2IBBA 3WL9A 4RQQA 3V4PH 3T0ED 4X4YA 3NOIA 3KYKL 3RNQA 2UWEA 3NABH 3QXVA 3X3FH 4TTGA 1F3DH 1RZKH 3ALXA 3UTZA 4N0UA 1J1PH 4KAQL 1TZGH 1ZT1B 4ZS6D 1G7HA 3EYVA 2B4CC 2YD1A 4QCIA 3DMMB 3U6RA 1I1RA 1UGNA 3QCVL 3HI5H 3F8UB 1FNAA 1EUUA 4HKZB 4HJJL 5CBAB 3IJHB 4MD0B 3G6AB 4KI5C 5GGUB 2IBZY 1ZSDA 1LDPH 2XQBL 4OLZH 1MHHB 2XKNA 4M9PA 3NFNA 4X5XA 3QCUL 2YPVL 4P2CG 4PTUA 3A6CL 2JIXA 1VGEH 4U1IA 4G7YH 4PB0H 1TJGH 5IK3A 3QULA 1HH9B 3BSZH 4M7LT 4OZHA 3E0GA 1I85C 3QH3B 4PY8J 5I8KL 2D7NA 2BJML 1BBJA 4O02H 1J88A 5IW6A 2HVKB 3LS5L 2NY1D 3ARXA 2V9TA 1CE1L 3BN3B 4MB4A 1A6WH 4YHYC 5DTFB 1KEGL 1FAIL 1QVOB 1VESA 4YH6A 1KV3A 1T5XB 3NZ8A 3QQ4A 4JZJC 3VXRA 3I6KB 3C8KB 5KSAA 1O7SA 1XF4A 3CMOL 3UROR 2CIIA 4Y1AB 3RX8A 1VPOH 5GS0D 4JDTH 4F9PC 3QHZH 5DRZA 3VMPA 1NBVH 4XVTL 5JOEA 1BFVL 1IGYB 2GI7A 4TVPD 3WDJA 4CRPA 4DEPB 4Z7QF 4IBLT 2JJSA 3S36H 5L2KA 4X6DE 1VFUA 1KN2H 4RMUA 1YNTB 4LLYB 4R3SA 3TBWB 4FQXA 2YD5A 1XIWD 4KVCL 5CGYC 2VDLL 5CP3H 3F58L 2F54E 3JWDH 1FNHA 3MOBL 3GSQB 3RIAF 3NH7L 5JTWA 5EIQA 4PJIE 3O3BA 4X8JB 4LDOB 1JV5B 4XVSH 1BQUA 3C60B 4P5TB 5I1AA 4HIHA 3U46B 2J6EA 2AJVH 1VACA 3TJHC 1TJHL 4PG2C 1NUDA 3I85A 1WIPA 3V6BR 1SY6A 3BZFB 1BOGA 2HLAB 3GB7B 3JUYA 4K3DL 3FRPG 5GSVA 5LGKA 4GQ9H 2R1XB 3P77A 5D8JL 3CVHL 1UM6H 5GS1A 1YMMA 2Q76A 4EUPA 2R69L 2C1OB 2FX9L 5DZLA 5IR1B 3D18B 1OGAB 5F9JB 5CSZA 1N3NA 3CFDB 4TUOA 4NQUA 1SVCP 4AL8L 2X1QA 4L9LA 2N56A 3QDMA 3S34L 3V6ZB 3MUY1 3DWTA 2HP4A 5D2NA 5JDSA 2IPUK 2YD3A 3LN9A 1A1NA 1M4KA 3W0WD 3D2UA 4GO6B 1CXHA 5K9KA 1MEXL 1DQDH 3T4AA 1F4WH 4KI5F 5IB1B 2DQTL 3W2DL 4K23L 4U1MA 2CQVA 4YBQD 1TCRA 4WI7A 4J3OC 4O2EA 3E8UL 5EU3A 1X6NA 4YO0B 3SO5A 5BVJA 2YEZB 4XCEB 4HFWB 1U3HD 2CLZA 5SWZB 4W4NA 5ACLA 6FABH 2PTUA 3K46A 3KPSE 4FXGA 3VWJB 2MFNA 4TTDD 4LARH 4HIJB 3L3DB 5I1LB 4WWKA 3WLBB 4PV8A 4DEPC 3B8YA 1KJMA 5E8PB 5EUKA 2YKLH 1N5AA 1ND0A 5DJYA 1RUAH 4M7JH 5BJTB 3EDKA 5D1XB 5E6IA 4M61A 3B3IA 4PJ7F 1YEFL 2X4TA 3MJGX 3L7EB 3SDCA 4U2YA 1UQSB 3ARRA 4QNPE 1FL3A 5HSFA 1Z9LA 2A9MH 4M7KH 4AH2A 3C60C 1NMCB 4P5TC 2H2PC 3MLWL 4S1RH 2HKHH 2R15A 1MI5A 2VLLA 5F7FA 1ETZB 1RZ8A 4ZS6C 5IOPB 1HHIA 2AJXH 2BMKA 1DQQB 4HQQH 3UTQB 1J8HD 2IFFH 4P5KB 4HK0A 5D7JA 1W72L 3GHEL 1VEMA 1BD2D 3MV8E 2AV1A 2ADJA 3QZWG 2MKWA 3HMXA 1J0KA 4JRYB 1RZJH 2VXSL 1KLGA 4NHCH 4GW4B 4UIMB 1YECH 4YLQT 2XV6B 2HWZL 4YPJA 2EDFA 5KVFL 4QY8A 4WNQA 4JKLA 2HT3D 3O3AB 5DQDL 1CGSL 5HBBA 3WKML 4YAQB 1F90L 4IRJD 3PDGA 1G6RL 3GIVA 1EEUA 1JHKH 2V17H 1S8DB 5D5ME 1IGCH 3GIZL 3X12A 3WYRA 4CW1B 4PRNA 3WD5L 3GSXA 1I7ZB 2WP3T 4MXWH 3B9VA 4WU5B 4NO5A 1UXSB 2O5XL 4YXKH 4NM8H 1WZMA 4IRSD 2XN9B 3LQAH 1FYHB 4ELKA 1A7QL 1VFAA 3F7YA 4ZOBA 1UWGL 1JNNH 3HMWL 3TBSA 4JFHE 4ONHB 3PGCA 4NQDA 3G04B 4I48B 3ZYOA 4HIEB 4G7VH 3E6HB 4EZMA 4S1DD 1RPQA 3D69B 4GRLD 3IU4L 5KSVB 5EC2A 2ZP0T 3GI8H 1UQSA 2X2YA 4JVPA 5TE4L 4R0LA 5DUPH 4LCCB 1XIWC 3IDMB 1OAUL 1ZK9A 5KANG 2X4PB 5E9DA 3HE7D 5HPMB 3OPZL 5DQ9A 4E41D 3MGOB 4AIZA 4L29B 3TN0C 2G5RA 3OZ9H 1JRHL 2HTKD 3CH1A 2DKMA 1N4XH 3QBTB 1IMHC 3CLFH 4CN6A 4Z5RB 5CKAA 1F11B 3ALWA 2DJUA 3PP4L 1N7MH 2R1WB 1JP5A 2HFTA 4HUUA 3D1MC 1NMCC 3M1BB 5BRZD 4HKBB 5ICXA 1DL7H 1EPFA 4DFHA 5IMMB 4KJYA 4NOFA 4QRSB 4X6CA 4QXWA 4OM1H 3RL1B 3ZDYE 4JDVB 4HV8B 4Q7DA 1CR9L 2QL1A 3P11L 1M1SA 1BWMA 4GAFB 2BNRD 3TIEA 2BSSB 3EFFB 5CIPA 4WEUD 3LN5A 3NCFB 4KZEH 5HGDB 3QDJD 3NCMA 4Z7WF 3U48A 4KQ4L 4KK9D 4G8GE 3LH2L 3QXAB 1A6VL 3RI5F 2LV4A 3VGEA 4HJGB 1JNJA 4QHKJ 1RK1A 1T83A 2HTLC 4XPBL 1KLUB 4NQEA 3L5XL 3QA3B 1NUGA 1Y0LB 5ESQA 4HWEH 5FECB 5MEPA 4CVXA 5CEZL 2HMID 2EDXA 5TDOB 5ANMB 4H25B 3UCRA 5GJTH 4R90L 5C0NC 1RURL 1WZ1H 2BOBA 3F65A 2ICWI 3PWJB 1BBDL 4QF1A 3VFNB 1RSFA 4TVSa 4Z0BL 3Q48A 3H9SD 4Z77A 1AGDB 4XC3L 1ACYH 4MSWB 3V0AC 3L3JB 1DVFD 1U3HC 4P2QD 1CD9B 3GO1L 5FA4B 3UZEA 2CR3A 4DZBA 2A6DB 3PQYE 3B5HA 4JAMA 3SDDA 3VRLE 2AKRA 4TTDC 2PTTA 4XAWL 2V5TA 5E4IA 3VI4F 2BX5A 1PG7W 1A6UH 4K7FB 3O6FA 4M43H 3W0WA 3HC0B 2HFEA 3BW9B 3L3KB 3SBWA 4LLUA 4JGUA 3HNTL 3TCLA 1LEIA 1OD7A 4WFFD 3V0WL 4Q0XH 4JB9L 5KAQF 5D2LA 3DXAD 4LKXA 2FD6H 3BVNB 4JG1H 1IC7H 5C0AB 2YD8A 4P4KD 4MJIB 1A3LL 1G0XA 4RRPG 2R2HB 3D39B 3ZE1E 3VFSB 4GKNB 4BH7A 1MVUA 4LSUH 2GTWA 3NCCB 3WIFA 2R0ZH 5ERWA 5H94A 1FLRH 4YHNB 3BP6B 1NCWH 1FE8H 1XF5A 4GLRH 1NAMH 3KLAB 1G1YA 1QG3A 3SKMB 3BUYB 4WUUA 1NCAL 4QOKA 1CLCA 1U93B 2F9BT 5DRXA 5IB3A 3FQNA 1FNEA 2BVEA 4RBPH 3AS1A 4OFKA 3O41A 1SYVB 2VERN 3EOBA 2W65B 2NY3D 1R24B 5C08D 4RFOH 3QXDB 3VXMB 4HF5L 4B0MM 3HG1E 4ZSOE 4FQLL 3BZ4A 5C0BA 5DMIL 3GKZA 4FP8H 5KOMC 1YY9D 5IJVB 1QQDA 1QSEB 2HT3C 4JY4A 4O5LL 5J13B 1EFQA 5CWSB 4FQ2L 1C12B 5DJZB 5C3TA 1JGVH 3MODH 1KLFA 1WT5A 4YHKH 3TIDA 1N64L 3UBXA 2DMCA 4QHMA 3RZCB 5L8JB 3MGAA 3S35X 5GGSY 4OFPA 1PSKH 1P6AB 3ESVF 2V2WB 2ZUTA 2IBGA 3CH8A 3VG9C 3BH9B 1QP1A 4IRSC 5CZKA 1X5HA 1BOYA 3HUJA 2Z0BA 2MPAL 5FEBA 1U6AL 5JPMB 1UT9A 3RA7L 3H0TB 3MBEB 3B2VL 4V1DB 4FQ1H 5AYQA 3ULUE 2HJLB 5EO0A 4WWID 5E1AA 5DEGA 4K2UL 4S1DC 3PWPB 3NFPA 4YFDB 5D7SL 4Q6IC 4DKFL 5D70L 4QRQA 3M45A 4Z95L 3RIFK 2CIKB 3HE7C 4I0PD 3QUYB 4OLYL 3D3VE 4UTAL 4BKLA 1JZ3A 4XP6H 3VXUE 2HTKC 3GNML 3Q1SH 4QXUH 3SJVA 1MIEH 5FO8A 4WHDA 4ESKA 1H15B 1JBJA 2EYSB 2VAAB 2VLRD 1P1ZA 1M05A 3IXAB 4FFZH 5HHOA 4MD4A 3BOVA 3LVEA 1FZOB 4U2ZA 2CMRH 3W39B 1T3FB 4P2OA 4PRID 5KN5A 3ZKSD 4P99A 1JF1B 4RBPK 1T6VN 3C5SA 3EDDA 4XNYH 4TUKL 5J11B 5KSBA 1XR8A 3AXLB 1NGPH 5DJ6B 1FV1A 2FLRT 1QSFA 4JFDD 3HAEB 4BJLA 4YK4B 1FNFA 5D93B 5K33A 2ZCHL 3MACH 3O8XB 2CKBA 5BV7H 4G9DB 3STLA 2ZCLL 4OZ4B 3U7WH 2FL5B 2D7TH 1AO7A 4Z7QE 2NNAA 1J10A 1D7FA 4XBGA 5JO5B 3B9DA 5J1AA 3HLAB 3VXPB 2HMIC 1N0XH 4MCYA 5KVDH 2BY3A 4HXBL 1CDHA 1W8NA 4D0BB 1P84J 2A0LC 2ZSWB 3FZUD 4HS3A 3C08L 4KTEL 1OL0A 4MVBC 4G6FB 4I5BA 3IVKB 1T0NA 5FYJU 1FZMA 3RZCC 4YFLF 1S78D 5BS0D 3VFUB 1BAFH 2RCSH 3I3EA 4QTIH 5FXCH 3SN6N 4Z0XB 1F3DJ 3V4VL 4GUPB 4NQTA 4JN1H 4U7MA 5INDB 5ESAB 3CC5B 1FNSH 1OLZA 2CRIA 1MFDH 3MBEC 3BDYH 1E27B 3MV9B 4WV1A 1CD8A 4UV7H 1OP5H 4MNQA 1GGIH 4UIKL 3O3EA 1RJZB 4HZAA 2FJFB 1I3RB 4PREA 4PJDB 3EYOA 2OZ4A 3HRPA 4FZ8H 4HWZB 4FQIH 3KNBB 4HKJA 1HILA 1ZA6A 4H26A 3H42H 4U1KA 5IB5A 1KJ2B 4OIBA 4FMKA 3O2WL 1RZIA 4JFFB 4R4BB 1U95B 3WFCH 4PJHB 1EHNA 1FVEB 4P4KC 4PJFA 2MHAA 1X3DA 2GJ6D 3ESUF 1KPVB 4IDJL 1QYGL 1A7RL 5J9PA 5EDXA 1OAZL 4NO0A 3IGAB 1V3MA 4K94L 4KI5E 1IEBA 1T1ZB 4JFPA 2E6PA 3RVXC 2NX5E 3CDGA 1FBIL 4LCIL 4CAGA 1U41A 4XZUB 3ARYA 5SX5H 1QBLH 1T2QL 3K8KA 4PJ9D 1NEZB 4X8XA 5ACZB 3S6CA 4I3RH 1MFCH 5EU6B 3DVNA 3T77A 2BSRA 1RZKC 1V7NL 2CJUL 2GCYB 4OFVA 1XGPA 2IPKB 2NMSA 5DVMA 4N5UA 1T22B 4AIXA 4JHAL 3N06B 3PJSB 1RUKH 1NGQL 4NO3B 3P4NA 5D93C 1YYML 1YY9C 3S97C 2ADGB 1TVHB 1NGWB 2DF3A 3S4SA 4D9RE 15C8L 1JGDA 3LD8C 1I9RH 3FB6A 1QFUH 3SGKC 4XCYB 4U1HA 4YHLH 3HAEG 3LS4L 2O5ZL 4QXGH 1KYOK 1JN6B 1INDL 1S7XA 5F9AC 4PJ7E 2EIEA 2VUYA 5GRVL 3K74B 5FYLH 3QSKB 5E1HB 4IHOB 5L88H 5FDWB 1A7OL 5C09A 1KC5H 1OAXL 3P0YL 5E2TL 4ETQB 2R2BA 1T1YA 4FXKA 4ERSL 4XPAH 3CFJB 5LBSL 4CADA 5CCKL 3ET9F 4QXTA 3PWNA 3BEWB 3GSOA 5EPMB 4GW5A 1FFNA 2IF7A 3ARFD 2BERA 3JZ7A 3UTTB 2DQGH 5J0BA 4UINL 1FIEA 4XXDB 5I2IB 1EMTL 1YC7A 4XPHH 5F88B 1Z9MA 1Z9SA 2EDEA 4LPYA 5C07A 4L3EE 1DEDA 4I0PC 3DX8B 4HH9B 4NC0B 4WCYL 3AREB 4LMQI 1GGBH 1NCUA 3OG4B 2VMFA 5A40E 2AV7A 2IALB 2N4IA 1XGRB 3STZA 3KWWA 1S7WB 1WCBB 4JDZA 2HG5A 2ZKHH 4B5EA 2HH0H 3GK8L 1ORSB 2EDHA 4GMTH 5F9OH 5GSRB 5CJXA 3JWDC 2V9RA 3VWKA 2D31B 4WGWB 1JUFA 4RFEB 4HMCA 4OB5L 1D9KC 2O26U 2BOCA 3GUTA 1P5VA 4P3WA 1EH9A 5IVXB 4HJ0C 2WIMA 5SX5K 1MWAB 1B0GA 3UP1A 3PHOA 5HHQB 1CDYA 1UA6H 2EDOA 4PGEB 4WI6A 3WXVL 2E9WA 4OCXH 4OCSL 2R1YB 4ODUB 1YY8A 4KU1A 4HSQA 1RY7B 4PJ5E 3Q0HA 1AGEA 4ZDHB 2F5BH 5F6HI 2F8OA 5E99H 3VD9A 4G80A 1HDMA 1NEZG 2E8ZA 3WNLA 1RHFA 2QKIB 3IRZA 3WEXA 3S5LB 2O61B 4KROD 3NA9H 4XWGL 4XNZB 3NIDF 1ZVHA 4MDIB 4OT1H 1KXVC 3BGFC 4LLQB 2PCPB 1IT9H 1YPZB 5IMOA 3O2VH 4JPIB 3KYNB 3WIIH 5HVGB 1ZLUH 2EC8A 1HSBB 3MOAL 5DUBA 1HIMH 1BVKA 2AK4E 1S7TA 1U8MB 4MA7L 2H3NB 3NFSL 2WBJD 1I7TB 3L6FB 4HXAL 5BZDA 1RZ7L 5D1QB 4RGND 4HCRA 1FSKC 3WJLC 1SEQH 3LKNA 1F4XH 1A3RH 4JO3H 5CZXD 1J0HA 3FFDB 3FFCD 5LCVL 4Z7WE 4GT7A 3C6LD 3ARGB 4AM0B 1K6QH 4POYA 4OBSA 3MLZH 4X7TB 5T3ZE 4ZQKA 3KYOA 5CEXB 5J3HC 1IGFH 5EN2B 4Q74A 5GGRA 4E42B 5IBLC 4D0DA 3UPCA 1U8NB 5IMKB 1LE9A 3UTSB 3ROOB 4KQ3L 4GAYA 5J1SC 1MLCB 1TJIL 4L4TB 1BFTA 1X4ZA 1SBSH 1GXEA 5DHVH 4PJDF 1JYXA 4RA3A 4XNQB 2YD4A 1JHTA 2Z8WC 3PABB 1AC6A 1JPGA 2BVQB 1NSNH 4MNHA 1P4LB 4LHUD 3U7YL 4Z8FL 3TWCL 3T2QA 4UILH 4AENA 3KXFD 4NP4L 5DYOA 1JI2A 2IADA 43C9B 5BXFA 1MQKL 2NLJB 1A6TB 5F1IB 5B22A 1TZIB 3L3IA 3HZVB 2DI7A 2X1PA 4JLRA 4U33A 3DBXB 2YUVA 3D85A 4BM7A 1ONQB 1E4XL 3DTXB 4TUJA 1XAUA 4M62H 1XGYH 1A14H 1NL0L 1S9YB 3C8DA 1CTOA 3BQUD 2IQAB 5ALBH 2A73B 5C2UB 2AW2A 4PFEA 4OF0A 1J0ZA 4U0QB 3VI4E 3MJ9A 1GGTA 5B8CA 5F3HA 2HKFH 2AXFB 3H9HB 4XNZC 2RJMA 2YK1H 1S5HA 2J4WH 1CLOH 3SQOL 5SWZE 3T0EA 4KHXL 1I9JL 2P8MA 2UV3A 1ZLUK 3S5LG 5HHVH 4TNVF 3JTTA 2K9UA 1MRCL 3A6BL 5I1DB 4J8RB 4ZFOA 1AGCA 4CJ1A 1SM3L 2XQYG 2IANA 3UAJC 1I1YB 3QEQD 3BP7A 4HUVB 2I07B 1BHGA 5ITFA 4ZUVB 1AFVL 2X9WA 3MX0A 1OP3H 4GRWH 2EEAA 1X9QA 5MEQA 2CDGA 4WO4B 2H9GA 4KXZH 1RU9L 4LQFL 4JG0H 4PRHB 5IEHB 3AAZB 4XPFH 1R3LB 3T0VA 3LQAC 4WTZA 5SWQB 2EDWA 3LIZH 2RFXA 1KIPA 4JO4H 1OT2A 3T4YB 2FJGB 3L5IA 4LU5H 5L7XL 4MDJB 3FQTB 3HHRB 2Y36L 4HEPG 2Y07L 1W0VB 4PIRF 4IIQB 3O3DA 1QLFB 2WUCL 2UUDH 2ITCB 5JQHC 1IZJA 1OSZB 3LDBB 3SE3C 1F13A 3N85H 5B21A 3VXTB 2R8SH 1OQXA 4JRYE 4ORGA 5F71A 3VGHA 4O00A 1ORQB 4PTTA 4N9GA 1CS6A 1TLKA 4APQA 2BCKA 3AUVA 3SGJC 3EOTH 4WHTA 3HR5A 3S88L 4TPRL 3OKMA 2J8UA 3U9UB 4F57L 4Y1AD 1ZT4B 3W0WE 3G9AB 3HCVA 1WWAX 3UZVB 4BQ9A 1LEKA 5HI5C 2EXWD 1ITCA 1LP9A 2XKUA 3PIQA 5ENWA 3BPCA 1BPVA 5IVXF 1FVDB 3IU3B 3DRQB 1C1EH 32C2B 4WW2B 5HY9B 4H8WL 4Y2DD 4MQXD 1Q9OB 3F7QA 3MV01 5F6IC 3R1GL 5L6YH 5IBTL 3QPXH 4WGVB 3V5DA 1O7VA 5FKPA 4HUMB 2P5WB 3ZHKA 3FB8A 2F74A 4OCRH 4OZGE 3MRHB 1YQVH 1PEZA 4TULH 4YDLB 4KKNA 4UOW1 1NPUA 4GG8A 3DROA 1XEDA 1IQWH 1OAYL 2UYLA 4CJ0A 3H9YA 4MNGA 4FOMA 1H3TA 1RD6A 3Q6GH 2DQJH 3OTTA 3U9PL 3DUUA 3GMOB 4RGNC 4NHUB 3EO0B 4FTVD 5I75B 1YPZF 1HXMB 4O2CB 4P46B 4ZXBA 3CVHB 4YGVB 2XXMB 1N6QL 3GSVB 5AZEL 4YXHL 1OGAD 2AJ3A 5T1MA 1EGJL 5IFAL 4PJAB 1DSFL 4WUKH 1PY9A 1WGOA 2P24A 1FN4A 1V3KA 1EK3A 2Y1VA 2Y9RT 4FRWA 3PGFH 3T2NH 5FOBA 2GHWB 3GM8A 4CVZA 3MTRA 1QFHA 3DVGB 4URTB 4NJAH 1WFUA 1NEUA 4QRTA 5GZND 3BE1L 1BD2E 1XGUB 1XGTA 2AJZB 4JJ5B 1MRFH 2Z8VC 5C2BH 4OI8A 1BLNB 1LMKA 1P2CB 1FZKA 2NY6B 5LKNA 1B4JH 2KPNA 3OKKA 3MUHL 1XF3B 5DFWH 2FATL 3ARBD 1ED3B 4DTGL 1YQ2A 1RUPL 3RKPA 5CZVL 1BP3B 1HEZA 4JANB 2X10A 1ZGLM 5JLZA 2V7NB 4WIQA 2OL3A 4NBXB 2H6PB 5E6ZA 4R8WH 3MRJA 5IWLA 1DEEA 5IESL 2I9TB 1ZGLA 1BEYL 5I76A 1A4JA 4NZUH 3RWCB 4N0CC 1GZQB 1T1XA 4J4PD 4ZOCA 4PJCA 1PLGL 1FFPB 1RIVL 3BZEB 1RMFH 1WCQA 1AJ7L 1D5MB 3QXWA 1IGTA 5H2BB 2X1OA 3QI9D 4L4VD 5EOCH 5JR1L 2W9DH 3KAAA 4DCQA 3HI6L 4OD2A 4G9FB 4IRZH 5JUEL 3V5KB 1UACL 4JPWL 2XA8L 3CX2A 1MJJA 2R2EB 3RVWD 3MGTB 4EVNB 1NLBH 1YZZA 4TNWF 5EUOB 1MPAL 3VJ6A 5C0JB 5F44A 3QUXD 1C7SA 1OLLA 2VZSA 4IS6A 5SWSD 4MCZA 3THML 1XF2B 4O2FA 1KJVB 4LCWA 4YDLC 5TDPA 3ZT6A 1J8HA 4KV5E 4P59L 3GJFA 4M4RA 3P73A 4LAQL 1FL5B 3V5HA 3U0PA 3MRIB 2FHFA 4J1UB 4Y4HB 5FYLD 4XGZB 1GRWA 5JNYB 5IKCA 1LK3H 4Y89A 4HWBH 2Z91A 3BD4A 4P46C 5C0AE 1UVQB 4HK3J 5E4EB 3UJIH 3FMGH 3D39E 2H32B 2K7QA 1MCSA 2V2XB 1X4XA 5BRZE 4LF3B 3ZL4H 4OLWL 1VFOA 3SKOB 4G5ZL 2DJSA 1ZHBB 4M7ZB 4NQCA 4ZAKD 2CK2A 3RJQB 1AHWA 1E4KC 1V05A 3GMMA 5HPOA 2ZOLB 1M6OB 5JQ6L 3F7VA 3KPRE 1G7IA 1JPSL 1MH5A 3WSQL 3OKDB 4GKZB 2XZQL 2NY6C 5JHDB 1TTFA 3SQBA 5I6XC 4FNLH 3VXME 2H2SD 2VZOA 5LGHL 3BEVB 2W1NA 1XCQB 2VXVL 2WNGA 2LE9A 4OBRA 4ZUWB 4NO2B 2GSIB 1V7ML 3TH3T 5F1NB 3DV6A 5I18L 4AEHH 2VQ1A 1IGIH 1QSEE 5HYJB 4Z78B 3VFVA 2AEQL 3FRUB 3JV4B 2P8PA 2NY5C 4LSQL 2ED8A 4O58L 5L8KB 3EGSB 2XY1A 4I3SL 2YPLA 4GRLA 3U4EA 4PPTA 2C7UB 3QUKB 4ZTOL 2QSVA 2DBJA 5DS8B 4FN0A 3KPOB 4JQXC 3I75A 1KENH 1JWUB 1D5XA 1WICA 4PV9B 2OP4H 1BQHG 4JFOA 2W38A 1SJEA 4P2QE 4Y2DC 4HH8A 4PBXA 2FYYB 4ZUTA 4M00A 3RHWF 2IAMA 4ODWB 1JZ4A 4C59B 3MRMB 5JZ7C 4NKIH 4UMGA 2J88L 1I8LA 1IGJA 3KPQA 2Z31D 5IM7B 5BV7C 3B9KB 1MVFA 5TPWH 4AG4H 1NC4A 1ZTXL 4OQ1A 5I8CB 4Y19D 4WW2F 5KW9H 4JO1H 1LNUB 4RAHA 1YN7B 2NCMA 3I6LE 4G8IB 2B5IC 3MLXL 3VRIB 1HWGB 3PWUA 3DXAE 5IGXH 1MFEL 2BNRA 5CGTA 3F7RA 1B88A 4PJEA 5HVFB 3B6SA 3G6JA 3QCTL 3LB6D 4XAKE 3TYGL 3QDJA 5IG7A 4OAWB 1WTLA 5IEKB 3RJDA 5JA9A 4PR5A 1A7PL 3MV11 5DJ0B 5TF0A 3IXTA 4LVNC 2H8PA 5ABDE 4U1NA 4YDIL 5E4EC 4Y4KA 5ESVA 5C8JB 4L8SA 1F42A 4HX1A 2FEDD 4ZUSA 2NR6D 2XY2A 4U1SB 4QTHA 3MA9L 2F15A 4U0RB 5FGCB 2OS7A 2DBLH 3NAAL 4MD5A 3SHSA 4XB7A 1YJDH 2XWBB 3NIDE 5LJYH 3LPGA 3W9EA 4F58L 5FM5M 4HZLA 4PJ8D 5C0DB 1CLZH 4Z7NF 3WFDL 2PTVA 3FT2B 1S7RA 4LHJB 3P9MB 1JK8A 5KZCB 5EOQH 3ARBC 4PJAF 1N8ZA 3H9SA 1I1CA 4LRIA 3TT3L 4AMKH 5D9SA 4EDXA 4Q9QH 3WFEH 1DVFA 3FQRA 3L3GB 4YJZL 1K2DB 4PRAA 1E4WL 3BT2L 3TO4D 5JXAL 4O51A 4LSVH 3SOBL 5IMLB 5BVPH 2YR3A 1ZV5A 3E2HB 5FF6A 4NDMA 5I1IL 5IF0A 1ACZA 5BO1H 3I2CH 1NDGA 2PW1B 1HXYA 1X5XA 2BNUA 4ZPVA 5C9KA 1G7JA 4XMPH 4JO2L 5T1DH 5I8OL 5FGBC 4Y5XC 3BH8A 4JRXB 3RGVB 1CFVL 3WNOA 5TJWK 2BSTA 1IAIH 5DQJA 1WC7B 2L4OA 3ES6A 1BFOA 4WI8A 3QI9C 3LEYH 1EUTA 3SO3B 1ADQA 4WHCA 4HBCH 1F45A 3D48R 5TH2A 1ZGLP 5D4QA 4CUCA 4FFYL 1DP0A 2DWEB 2NY0B 3CSYB 1JNLH 3B9EA 1QR4A 2EKSA 3RVWC 5EFIB 3DOSA 2P8LB 3HKFA 5AYUL 5EO1A 5J89A 4LLVA 4QRPD 4A6YL 1DBBL 4PRBB 1SY6H 3FQXA 3MXVH 3QUXC 3X14A 3DUSA 2B1AH 4PJXB 1X6LA 4PJGF 3HB3C 2BFVH 2FX7H 4PJDE 4K3JL 3I3BA 4EUPH 4OD1L 4MWFA 5I1EL 5INCB 2C1PA 3P9LA 4DVBB 4XVJL 4YHIA 1NGXB 4D3CL 3H7BB 4Y8DC 2LFGA 2FHCA 3GSWB 1BX2A 5C08A 4Z7OF 5JW3L 4JFFE 4AY0A 2OSLB 2C3WA 3VXSB 5EUOF 2PF6A 3O6MH 1I1AB 1B0WA 2XQYK 1J5OH 5E8NA 2AJSH 2ZWLT 4PB9H 4LP5A 4F7PA 1WBZB 1EXUA 3BDXA 1IKFH 5TQ0H 5HGAB 3QHFH 4J3XA 3LRGA 1E6JH 1TENA 3MUGA 5JOPD 4KDTA 3SDAB 4L3CA 4U0RC 3TJEL 3BWAB 1YUHA 3V0VA 1UKQA 5DRNB 1PGRB 1T20B 5EU6E 1ZHKB 2Y5TA 2H2SC 3NGBC 1YNLL 4TRPH 5FHAL 2CLVA 2BVOA 4Z7VE 1LDSA 1F58L 1N59B 3CVIH 4ODHH 4KKAD 4YUEL 2BP3A 5BOPA 1AD9B 1K8IB 5I8EB 3QR2A 4AJ0A 3QDGB 4KTDH 5B38A 3GSUA 3DGGB 3I6GB 1D5BA 4HUWA 2A6JA 1DBAL 2P42B 2XQBH 3CSBA 1F4AA 1DR9A 2YPVH 4F8TA 4DOHB 3PWPD 3NACL 4WFHD 3O45A 3A6CH 3UYRL 4ONGL 4LPTA 3UX9B 2QQLL 2FO4B 1A4KB 5ISZB 3QP3A 1N0LA 1HH6B 3UYOD 4GXUN 4JHZA 4Y16A 3CZFA 5KJRL 4LLMA 3ULUL 5I8KH 3EJZD 3GSRA 1S7SA 3LS5H 4HDIA 4C56B 2Z31C 5J4MA 1AD0B 3T3ME 5CP3A 2NY2B 3LPFA 4KHTH 3CPLA 2W9EH 4NUJA 5D7LD 2JK5A 2ESVD 4H5SA 1FO0A 5K59F 4XBEL 4PRIA 1EO8L 2OR9L 1FZJB 3KPLA 4DUXA 4OFIA 3Q6FA 1YEJL 5JXEC 1AXSA 3DV4B 2YOCA 4WTWA 2P5EB 2XWTA 4XPGH 3LRSA 4R4FH 1U8PB 3HMXH 4G3YL 2D4FA 3MNWA 4X6EB 2E3VA 1JYNA 1DDHB 1WFNA 3RDTD 5E5MA 4JFDA 2VDMH 3FQWA 2VDLH 5I73B 3O3UN 3F58H 3D25A 3MJ7B 1JI1A 3MOBH 1FG9C 2DTMH 4NYLA 3NH7H 2WINB 3FO2A 4BZYA 2VKWA 3DRTB 3RUGA 5KS9A 3K0WA 2Q8AH 4JY5L 4R7DB 1JZ7A 5HHMB 3JVGA 3SDAC 3BN9D 1J05A 3TBVA 1JJUA 1HQRB 1TJHH 2QHRL 3IKCA 2JB6B 4F3FB 5JHLL 3LEVL 5C7XL 2AP2A 1TQCB 1U8KA 3D0VA 5BS0A 1T7ZA 4LLAA 1BZ9A 4K3DH 4GBXB 5EOTB 1GC1C 4G6ML 3BHBB 5GGSB 1T5WB 3TO4C 1S9WA 4XTRD 3IT8D 2FX9H 5KANI 1YEKL 1K4CB 3NCBB 5A2IH 2DIAA 3EYFB 2AXHA 1U36A 2DQIL 3MXWH 5GHWH 4AL8H 3QPQC 2XA3A 3D87B 3FT3B 2BC4A 4CMHB 5K93A 1H5BB 5IROA 2D9QB 3E6FA 4HGWA 3RVVD 5MHSE 1MHPL 1JFQH 5I9QB 4X9IA 2P7TA 2OTPA 4HS6A 5DEFB 3DX6B 3T2OA 2DQTH 3W2DH 1IAOB 1U8HB 2IG2L 2OK0L 2YD9A 2GJ6A 1RJLA 4ZPTA 1G7LB 3GMPB 3QIBD 5DK2A 3U0TA 1HZHH 4JY6A 3MO1A 3G5VA 2C4FT 4ZYKB 4YWGL 2NY2C 3MJ6A 1A6ZA 1RVFH 4HAGA 1PY4A 2XWJB 4YBHA 2AJYL 1H3VA 3MA7B 4XP4L 43CAB 2ZJSH 4PG9A 3JV6A 4TOYL 2B4CL 1WQVT 2ARJQ 4GG6A 2GK0B 3EO1A 3QUZD 1QFWL 2KQMA 4PJ9A 3SKJL 3V6OA 3QFJB 2X4NA 4MX7A 5EZLA 4XCNB 5LAXB 1D6VL 1Q9LA 4TSBL 2Y7QB 5ECJE 5E8DL 1WBXA 2GY5A 1YEGH 4OIAA 4AIOA 3KJ4B 2X70A 1CGYA 4PJXF 4FQHB 5E2VL 3DYOA 1E0OB 4HC1L 3HC4H 5E8EB 4G6JH 5CLTA 3LKRB 3C5ZA 4JVUA 1ZLWK 4EI5B 3QIWD 2DYPB 4AQ1B 4N1HB 5D6DC 1GGYA 1I7RA 1QTYT 4S1SH 4YHOL 5FV2A 2Q8BL 5J12C 1R3JA 5I30L 1DE4B 35C8H 3MLWH 4QHLA 3MLVL 2DIJA 3MCKA 4C55A 1KGCD 3O0RH 4ELME 4FXLA 4OLXH 1NBZB 3TV3L 1MCWM 1TQCC 3OX8A 2DLEA 2WWKO 3ZKMD 3HNSL 2CK0H 3D3VA 1TCMA 4GBXC 1M7IA 2KDGA 2PYFB 3VXUA 1W72H 3GHEH 1OGTB 4NNXB 4KY1L 3L7FA 1NQBA 5DMKA 2NTFA 3TNNA 4Y4FD 1MIML 4M4PA 3ARFA 3ILPA 4XNXL 3KJ6H 2IJ0C 1YEIL 4LCYB 4OM0L 1KEML 4U1JA 3JTSB 1S9VB 5D1ZB 1EV2E 3NPSC 4OZFB 3UTTD 5EIIA 4BA8A 3M8OH 5DDHA 2HWZH 1IM3A 5I66A 5JORB 4JFQA 1CICB 3ZTJG 5KVFH 5BOZG 2OR8A 1HHGA 2X7LA 1CGSH 3MLSH 3QUMA 4X6BB 5DQDH 4CMHC 4CVUA 1QRND 1H5BC 5DUML 1F90H 5DD6B 2IFGA 2X9YA 2ADFH 5K9QG 2VE6A 1LE5B 3ARED 1G6RH 4M1DH 3NBNA 1J1OL 5C0EA 2QBWA 2D03L 4RGNE 1XH3B 1KCLA 4DUVA 1CT8A 1HI6A 1Q0YL 1SBBA 2OM5A 5EBGA 4I2XB 3T1FA 3WD5H 1MCPL 4BSVA 4PRHE 1ZWIA 2O5XH 5MEND 1VKXA 3PNWA 1C5BL 3CDCA 1ZS8A 3QWOB 3ZLQC 2XIDA 3BISA 5MP6L 1QNZL 1HHKB 1UWGH 1H0DB 2X4OB 3HMWH 4RMVA 5KG9A 1QA9A 1RK0A 4M3KB 1WEJL 4NN5B 2VLJA 2F53A 3IU4H 4LSDA 2A83A 1KTRL 5A16A 5TE4H 1UEMA 3FTGA 1MHEA 3TO2B 1MCQA 4YFLI 4X98A 3OPZH 3QQ9D 2YSSA 2IPTL 5HGBB 1YEHL 2AERT 3AMLA 4KUZL 3X13A 3O9WA 4ETYA 2X4UA 4MS8D 2MTPA 2BY1A 2C3GA 4WW1B 4EI5C 3M07A 2UVFA 2RAMA 2R4RL 3BN9C 2BNQB 5GZOD 5L8LB 5EOCJ 2QSTA 3MRFA 1NC2D 2H1PL 4PP2A 1FYTB 4NC2B 3L5WB 3WHXA 2M1KA 3MV7B 4D0CB 3TVMB 1Z5LB 2VABB 3SDYL 2OI9B 1CR9H 1GSMA 2WBJA 4XTRC 3OGCA 2J5LB 2YMXL 3BXNB 3JBG7 5J6GB 3DURA 3O4LD 4L5FL 2FIKA 5A2JH 3CFEB 5JDJA 1AXTH 3TPUB 5D1QD 5KSAD 5JW4N 3NA4A 1A6VH 5TDNA 1CE6A 1A1MA 4G8EA 3I84A 5F9DC 1K5NA 1KPRA 3FFCA 3AFLA 4MQSB 1KBGL 2BVPA 3I50H 4GAGL 3BD3A 4Y5YC 2XYCA 2AXJA 2X09A 2YRLA 4P5MA 4OZFG 3OJDB 4R90H 4MXQC 2HRLA 1R3HB 5CILH 2DL9A 1BBDH 5DJXA 5DMGC 1LGVA 4FFWD 3QIBC 5AAWA 4HUNB 2VXQL 2GAZA 4JREB 3WO4B 4LLWA 4XC3H 1OCWL 2RR3A 1R0AL 4B7LA 3GO1H 4ZNEE 1MFAL 3KXFA 2Z35B 4PJAE 4RGOH 4HGMA 1XGQA 4DGVL 3RU8L 8FABA 3Q3GA 3ARZA 4I9WD 1OW0A 1FORH 1CFNA 3ARTA 3H7LA 4PJ7A 1G7HB 1CL7I 4OCYL 5L0QB 2HLFD 1D5ZB 3MYZA 3HC3L 4PRPB 1U58A 1NAMA 3QG6A 2CKBH 1YMMD 3J8F7 2VIRA 4XNMB 3HNTH 3X11B 2FZ3A 5JA8B 3QEGL 3UMTA 3V0WH 1CGWA 4J3UA 4JB9H 1C08A 2ITDB 2VLKD 1ZSDB 4PRDA 3QIWC 3EHBD 1A3LH 5I71B 1FIGL 1LEGA 4IJ3C 4FQCH 2JIXB 3SDXE 4XMKH 3FRPA 4KC3B 2VQTA 5C0FA 3QULB 4U05A 3QFDB 4UT6L 3OL2A 3T0DA 4X4ZA 5C0CB 3QEQA 2DLTA 4OZIB 1C16A 1NCAH 2AEPH 1ZT1A 2F19H 5EO9B 1E28B 5ADPL 1ZHNB 3MRKA 4UNUA 3NZ8B 3VXRB 3F12A 4PJGE 5I15L 5D7KD 3DMMA 2DICA 2CXKA 4P57B 1NCDL 3C09B 1K85A 4R9HA 4X7CC 5DRWB 4OSUL 4HKZA 3IJHA 3G6AA 5DRZB 5E24E 4RISL 4F9LA 4HAFA 3JXAA 4O5LH 2LU7A 1EBPA 1II4E 4H1LB 1DBKH 4KK6C 4X0KB 1FGVL 1EZVY 2YC1A 4FQXB 3TA3B 1JGEA 3RKDD 5ADOH 3HNVH 1HH9A 4DUWA 5HDQL 3UDWC 1JWSB 2RIKA 3HPLA 3TLRA 3QH3A 4LSSL 2NXZB 3RY6C 4ODXB 2VITA 1AP2B 3VGBA 4JREC 2XG4A 3IFPB 4MJ6A 5DTFA 3ZKNC 1QVOA 3OJVC 1T5XA 1LO5B 5T3XE 3LKSB 1U6AH 3C8KA 1VACB 5T5FL 1CD0A 1CF8L 4I1NB 4JKPH 3VXQB 4K9EH 4Y1AA 3VRJB 1MLBB 1BOGB 5CJBA 1T7VA 1BM3L 5D7SH 1TZHB 4DVRL 5ICZA 1IGYA 4DKFH 5D70H 5FO9B 4W70A 1HKLL 1S7QB 3L95A 2G5BA 5F1KC 3QNXB 4OLYH 2HYMA 3C6SB 4LLYA 5JHDE 4UTAH 3TBWA 3MRGA 4OIIH 5CSZB 1N3NB 3GNMH 5IHLB 4MS8C 3ARPA 3GSQA 1J11A 4WJ5B 4M5ZL 1HCVA 4XWOC 3QG7L 3QJFB 5I71C 5D2NB 3RBGA 3IDIA 4LHQB 4LBEA 1JV5A 1HYRC 5HYJE 5DSCA 3D2UB 3ZE0E 4U1LB 1OPGL 5LQBL 3DYPA 2EXYC 3T4AB 3QZWA 2ERJC 1DBJL 4U1MB 5E56A 3SY0B 2HLAA 3GB7A 4TUKH 3IDGA 5K59E 2DWDB 5EU3B 2R1XA 4GKOA 1NGYA 1UH3A 4ZG1A 1L7IL 4FTVA 1AY1L 1UKSA 4X6FB 4AZ8A 5KSAC 5GRZA 4UV4L 4JR9L 3CAFA 2APWA 3HFML 3U1SH 1OGAA 5F9JA 3EYSL 4C83B 2ZCLH 3CFDA 5ID1B 1QOKA 1T2XA 1T89A 1MJ8L 2YUZA 5SWSE 1FFOB 2MOVA 1GOHA 3MLPA 1VENA 3V6ZA 1CIDA 3FAWA 3IDUA 2JJSC 1D5IL 4FQXC 3C08H 1KB5L 4FFWC 4MJ5A 2CUMA 5E9DD 5E6IB 4IEFB 2NZ9C 1UWEL 4M61B 2XNAB 3ZTJH 1DUYB 5IB1A 4H1LG 3RWFB 4ZS7L 3SDCB 2VWEC 1S5IL 3OR6B 1DCLA 1FL3B 4ZO7A 1CQKA 4TSCL 4YO0A 3V4VH 1WVZA 4XCEA 4BK5A 1KCRH 4HFWA 3FOMA 3JV0A 3SEPA 1MI5B 2YPKB 1RZ8B 5SWZA 5DD1H 1JGUL 5E08L 1B3JA 2HLFC 4UIKH 5FGCE 3LZFH 4NGHH 1Z9OA 4HK0B 3VWJA 5D7JB 5EBMB 4J4PA 2AXGB 4HIJA 5GS1C 1F8TL 2FBOJ 3L3DA 5I1LA 2C3HA 5E70A 3WLBA 1INEL 5SV3A 4MAUL 1JE6A 4YE4L 1T03L 3WNPA 5E8PA 3O2WH 3RWJB 5C71A 5B39G 1KLGB 4L4VA 3EHBC 3VD5A 5BJTA 5D1XA 1UM5H 4L9LC 5DR5H 4KMTL 3OAYH 1OAZH 5D2NC 4K94H 1JPTL 1IC4L 4M5YH 3BPOB 5I0DA 4W68A 5F7UA 1U8IA 5EA0H 5IIEB 2DQCL 5GGTA 2G60H 3H2WA 4V2BA 5M94B 3J7HA 5IOPA 1I3UA 1DQQA 1T2QH 3UTQA 4JRXE 2DRUA 2AI0L 4P5KA 2CJUH 1NAKL 3WIHL 1CG9B 1FPTH 2FX8L 5E7FA 4JHAH 1VADB 1MJUH 4OGXL 1X5ZA 4ELKB 4OLVL 1VFAB 2HFFA 1NGQH 1FHGA 1YYMH 3HZKA 3BAEH 4OZHF 2I25N 2B2XL 3UO1L 15C8H 2HT2C 2ATKB 2DQHL 4UIMA 4OZIF 3SDDD 4Y19E 4MAYD 4ZAKA 4CN1A 3S37X 2O5ZH 4E9LA 4WWKC 3U7AA 3O3AA 4LLDB 4KRMB 5CBEB 4P3DA 2JJTA 3VFTB 3QHTC 3TYFB 5DQ9B 1MFBL 4I77L 4RMTA 3WN5B 1S8DA 2MSPA 1RHHB 1NCCL 4M8QA 5E6IC 1OAXH 5E2TH 4JQVA 3SDCC 1MREL 4ERSH 4OF3A 4HUUB 4YXLL 2ID5A 4WU5A 5CCKH 1UXSA 5DLMH 1DQLL 3N0PB 2XN9A 5DJ8B 3AS3A 3UZQA 5DVLA 1G7MB 1GPOL 1RZFL 5J7CC 2DS4A 5F1SA 2OTWB 4HWNA 2V5RA 4ODVL 4ONHA 1EMTH 1CD1B 3G04A 4HIEA 2G2RB 1CL7L 3E6HA 3RWDA 1QBAA 4WUUD 2YXFA 1A2YB 5D7JC 3D69A 4DGYL 4FABH 5D5MB 5KSVA 1BVLA 2VDPH 4WCYH 3MJ9H 2P43B 4RRPA 4LCCA 3IDMA 2X4PA 5C6TH 4NFCA 3MGOA 3MLRL 3AB0B 5DVNA 5DJCB 1RUML 5C0BD 4A2MA 3IDYB 3GK8H 3OAYK 1ES0B 2PYED 4NQEB 1F11A 3QDGE 5MEPB 4NKOB 2R1WA 4DAGL 4OB5H 5DA0B 3BPOC 1NGZB 5FUCC 3M1BA 4HKBA 1MAML 5I19H 2BOBB 4DOHE 1J0JA 5IMMA 5DO2D 4QF1B 4ZFGH 1CGUA 2OR7A 4UB0L 5ISZE 1KNOB 3WXVH 4JDVA 4HV8A 4OCSH 3OQ3B 3LEXB 3EOYG 1AQKL 2YRPA 3CD4A 1F97A 2BSSA 1J12A 4J3WA 2V5MA 1UZ8A 3EOAB 1UYWL 3FN0L 4XXCA 4UQ3B 2Q1EA 2QADD 1QR1B 5F9WC 4NZRH 1KLUA 1KG0B 3O6FB 3QA3A 1Y0LA 2IBZX 2HFEB 5GRVK 3U0WL 1R3IL 4LLUB 3NCYP 3MCG1 3HE6D 4K71B 4R0LC 5DC0A 1LEIB 5ANMA 1UM4L 4H25A 4P3CH 2P5EE 4X9BA 3GGWB 1VFMA 3MOAH 3T0XA 4OD3L 5EWIH 4QYOB 3BGMB 4X4ME 2MWCA 2OTUB 3PWJA 1EA9C 3VH8B 5A3IC 3VFNA 3NFSH 3SJVD 1AGDA 4HXAH 2Q86B 1MVUB 4HEME 4MSWA 2AQ2A 3N50A 3L3JA 1OAKH 3GSNL 2GTWB 5H37H 5C9JB 5J06A 3LKOB 3WIFB 4H0HB 5ERWB 2DKSA 5FA4A 4J6RL 3P4LA 5HHOD 1XF5B 5JOPE 2A6DA 1J86A 1RZKL 2P1YA 3SGEI 4P2OD 4YHPB 4QOKB 3N1MC 4GKSB 4N0FA 2ADIB 5C0IA 5DK0B 5L2JB 3FL7A 5A2LH 1HOCB 2YBRB 3HC0A 4NKMB 3OF6D 2F8XC 1YA5A 3HI5L 4JN2B 3L3KA 1X5FA 3RGVD 3VFWB 1JMZA 1QSFD 3BZ4B 3REWB 1MCOH 4X7SH 3AB0C 1RQ5A 4RZCB 1T83C 3BVNA 5C0AA 4JY4B 3IDYC 4MJIA 1AO7D 4QRPA 3SGDI 3PQYB 5DVOA 4CNIB 1ZAGA 4GKNA 3RVUD 3VFSA 4EI6B 5HVHC 5GS2H 3V4UH 2V5SA 2YXMA 3ZSSA 4YHNA 3BP6A 1MQKH 4QRRB 4Y0GA 2AJUH 3KLAA 1K4DB 2CPCA 4O02L 3SKMA 3WHE0 3BUYA 5I16B 1U93A 1E4XH 1A6WL 4DK3A 2AEWA 1ZT7B 4MB3A 1MCJA 2W65A 4LVHC 1R24A 1NL0H 4F8QA 3QXDA 1KCVH 2EDTA 1I9EA 1LO2L 2UZIH 1WBYB 1Q1JH 5HHPB 1VPOL 3VDCA 5E00B 2ESVE 2M2DA 3QHZL 3TGXA 3SDDC 3MNZB 1I8MB 4L8DA 4Q58C 4JFED 3W9DB 1CU4H 3IAGC 5IJVA 3OXRA 4N8VB 1QSEA 5FYKU 1I9IH 1KJ2L 1DUZA 1GGUA 3SQOH 2JCCB 3G5ZB 3WJJA 3O6FC 4KHXH 5CWSA 1I9JH 4GMSH 1C12A 3SBWC 1KN2L 1FVCA 4K71C 1UADC 3WLWD 3TZVB 2YA2A 4AT6B 3A6BH 3JWDL 2Y23A 2WBKA 1EHXA 4NUGH 4ZSOB 1A9EB 5T1KB 4XCCH 1AFVH 2OL3H 4WTXA 2YD2A 4X7FC 4MD4B 2YHGA 2OJZL 2EDBA 4LQFH 2NYYD 5KN5B 3VH8G 3H0TA 4V1DA 4LNVA 3C5SB 2HJLA 2YD6A 5FCUL 4P9HC 3O4OB 1BIHA 5KSBB 3PWPA 4JM4H 5T33L 2FH6A 2Y36H 4X7EC 2Y07H 4ONOA 1FLTX 5I1HL 3QUYA 4M93C 4KKCD 1KPUA 3V2AR 4I13B 2WUCH 3M17B 3STLB 1SEBA 3CIQA 2WLZA 1HHHB 2EDQA 2FEEL 2ZUYA 4MCYB 1H15A 2VAAA 5D7LA 3HR6A 1E6OL 5D5MF 2VR5A 3O2DL 4LPUA 3S88H 1FZOA 3D9AL 1WT5C 3L3HB 4TPRH 3GJFH 1QHOA 5HGGS 3W39A 1T3FA 2QLVB 5JW4M 5J1TC 4I5BB 4MLIA 3OB0H 1T0NB 1FZMB 1JF1A 3IFLL 5K9OB 3QAZB 1I1FB 1T1WA 5C09D 4ODSH 3RDTA 1BZ7B 5DJ6A 3GMNB 4JCLA 3IDXL 1FC1A 1PZUB 3C5JB 5I17A 5HXMA 3HAEA 4WHYG 4B50A 1UCTA 1N6UA 3O8XA 4WV1B 2X4RA 4NQXA 4MNQB 3O3EB 4FQJL 1UXWB 5CP7B 4OZ4A 2FL5A 4PREB 3R1GH 5IFJB 5F1OB 1AKJD 2R0KL 4HWUA 3WHE1 5JO5A 3VXPA 1HILB 4QKXB 1ZA6B 4H26B 4U1KB 4NM4H 5C07D 4KRPD 4D0BA 2ZSWA 4M1CD 3TT1L 3BJLA 1RUAL 2B7DT 3TZVC 4N8VG 3OHXA 3S96B 2MHAB 5DURD 1HK6A 1ZMYA 3IVKA 4Q2ZB 3ZKXB 1VA9A 3FB5B 3P4OA 4I4WA 4NO0B 1FGNH 3OWEA 1A5FL 4ZUUA 4Z0XA 2X40A 5GJSH 1MWAL 3I9GL 5INDA 1BF2A 3BZDA 1NJ9B 5ESAA 3CC5A 4P2OC 1N6QH 2EE9A 1DQJA 1KELL 1EGJH 2AJXL 1E27A 3MV9A 2DI8A 2XI9A 2BNQE 4U1GC 3DVNB 1RJZA 2BSRB 5LWYL 2IFFL 2FJFA 1I3RA 4J2XA 1FYTE 1XGPB 4JQIH 4HWZA 1WZLA 3AU1B 3U4BL 3KNBA 4JM2B 4OUOA 4R2GB 4RMRA 5HVWA 1B0RA 1MCWW 3GBML 3ULVH 3BE1H 1EDQA 4OGYL 2XPGB 2DM7A 4JFFA 4R4BA 3BKYL 3S4SB 4K8RC 5E8OA 4RAVB 4PJHA 4YBLB 1YECL 4LVOB 3FB6B 4R7NB 2FATH 4NCC1 4DTGH 5A2FA 1A64A 5ACMA 1KPVA 1RUPH 4BFBD 5CZVH 1S7XB 3IGAA 3GJFK 5BMFL 5DA4A 1T1ZA 3EDEA 1JHKL 2ATPB 3QUZA 3FO1B 5GRYA 4XZUA 5IESH 1X5AA 3FO0H 1NEZA 3QFJD 5ACZA 2EIZB 1T1YB 3DSFH 4MXWL 2GCYA 1PLGH 1RIVH 2IPKA 2BDNL 4NM8L 3VRLF 1OTTC 1T22A 3GSOB 2VR9A 3LQAL 3FN3A 1J87A 3PJSA 2AQ1A 4NO3A 2VZVA 5MENE 3RRQA 2ADGA 4XP5L 1TVHA 1NGWA 4WV1C 5JUEH 1UACH 4Z7UB 1NFKA 4HWBA 2W0FA 4G7VL 1OB1B 2UWEE 2NX5B 3V7AE 4RA0C 2A1WL 3GI8L 2APXA 3A6OA 4UQ2B 2XTJB 3HUJF 1MPAH 5DUPL 3WS6A 4KH2A 4BFIB 1CDGA 4N90E 3GHBL 3STZB 3KWWB 4P2YA 3ZE1F 1LVEA 2A74B 4U3CA 1I3VA 4PRPE 3CFBB