4PB0H

Structure of the fab fragment of the anti-francisella tularensis groel antibody ab53
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
214
Chain Sequence
EVKLLESGGGLVQPGGSMKLSCVASGFTFSIFWMNWVRQSPEKGLEWVAEVRLKSNNYATHYAESVKGRFTISRDDSKSGVYLQMNNLRAEDTGIYYCTRGYYGSNYGEYWGQGTTLTVSSAKTTAPSVYPLAPVSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ab53 heavy chain
publication title B-Cell Epitopes in GroEL of Francisella tularensis.
pubmed doi rcsb
molecule tags Immune system
total genus 40
structure length 214
sequence length 220
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pb0H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pb0H01
1O7SA 1DCLA 4XCCL 5MHSE 4PJDB 1DQTA 1T1WA 4L4JA 5BZDA 1A1OB 2G2RB 1S7WA 3ZE0F 2MTPA 2ZG1A 3OXRA 2YN5A 4Z7WA 5C3LD 1A4KB 4AM0B 3SCMA 2ZPKL 3G6JE 4BZ2L 3GMMB 2GY7B 4PP1D 2QEJA 3QDGD 4Y5XB 3MLUL 3L95B 3QAZB 3BGMB 1JFQH 5I6XC 1DQJA 4P57B 43C9A 1KPUA 1Z0MA 1I75A 2H45A 4YH6A 2BSRB 3AREA 2HJFA 1WK0A 5TQ2L 1A7QH 1QA9B 5HGGS 1J1XH 2XZCL 4NZJA 4I13B 1BREA 1U3HC 3GKWL 1F58H 1CD8A 2NXZB 4Z7QF 2Y5EA 1FGVL 3BH9A 5E9DA 4FQCL 1QFWM 2DIJA 1UA6H 4LSSH 3UTQB 3QFJA 3T4YB 3ZKQD 4YGVB 1G7IB 5HVHC 1X6NA 5E5MA 4XNZC 5FDYA 1NCDL 1R3KA 3D9AH 3EOYG 4NQCD 2CH8A 3V7MA 3ARGB 1SBSL 5DD1H 4YHLH 1F4XL 4J6RH 4Q6YA 4Z78A 1DQQB 3OJVC 4PJAA 3T0WA 2R1WA 1MCJA 1J0JA 1WEJL 1NFDF 4XPTH 1A7OH 3ZKXB 1KLFA 3LEVH 4BKLA 1BD2A 2EE3A 3K8KA 4EEEA 5LBSL 3U2SA 5J6HA 5D7SH 4UOW1 5DQ9B 2KPNA 4E0RB 4YEEA 1KCSL 3NPSB 1HXYA 1U36A 4QEGA 3VFMA 3QEHB 2VIRB 1PBYA 1UJ3B 3UTTB 5D2LB 3JV4A 5I8EB 4MVBD 2L7UA 1UCBL 1YJDL 2BNRB 1EJ6A 5FUCE 2EO9A 2R23B 4HHAA 2Z4QA 5TDPA 1BQHB 4R9HA 5D4QA 2BVYA 1WWWX 4XAWL 2FO1A 5IMLA 4JFFD 1AP2B 4WFFD 3V52H 3ZHKA 2WSKA 3O2WL 4R97C 1ETZB 2EDFA 5TF1L 3BUYB 4U6HA 2P45B 1MAJA 1JWMB 3KYMB 4N5ED 1K2DA 5IW1B 5ANME 4EXPX 1IM9D 4ODSL 2VDKH 1FZMB 3LMJH 4MZ3A 1CDYA 1HKFA 4U7KA 3IAGC 2RIKA 1NGWA 1F3JA 3QIBB 4FQQA 1TETL 4JR9L 5AYUH 1IGFL 3GBNH 4YO0B 5T5NG 1U92A 1AD0B 1HCVA 4HWBL 4WI3A 2L4OA 3QULA 5I1JL 2HKHL 2AJUH 4K9EC 5DQDL 4U1GB 4E42B 4NKDB 3TH3T 2J8UB 3LV3A 1PKQA 3EGSA 2BJMH 5ILTL 4F9PA 4RAUA 1TVBB 4V1DD 1JHKL 1X5YA 1RULH 3CFCH 3SKMB 1CD9B 4KPHH 4EVNA 1C08A 5SWZD 3SDXE 1MH5B 3HG1E 3PDOA 4M5YH 4YBQC 1D5MA 1CDCA 3U4EB 3BPOB 1KB5L 1DSFL 3O9WB 5HDBE 1AFVL 3QDMA 1TZIB 2FGZA 4W6XB 5DZLA 2OL3B 3ARBB 2WW8A 3P30L 4X9HA 4XPHH 3MA9H 2UV3A 5TE6H 4FQ1L 3CSYA 5BV7C 2AS5M 3FN9A 3KG5A 3NFPB 2DM2A 1CWVA 5MEOA 1MCRA 1WWAX 4O5LH 4D9LH 1KIPB 4MQ7A 4NO0D 4XNXL 2A2QT 3RVXC 4PYHA 3ARUA 1NCCH 2UWEE 2ZKHH 4LCYA 1X5XA 2B39A 5AD0B 5GS1B 2PW2B 4K3GA 5L2KA 2H9GA 1OB1B 3G6JB 4PBWD 1RUQH 1P7QB 1L0YA 3STLB 2C3GA 1WBXB 4MD5A 1DQLL 2Y25A 1WWBX 1OAZL 3L3JA 1CXEA 3T0EA 5FYJH 4BSWA 4HPYL 4ETQB 4LU5H 4YLQT 2XPGB 4RISH 3KYKL 1RSFA 4OF3A 1RVFL 3BAEL 1HQRB 1LNUB 1MHPL 4C56E 1DLFH 1DE4A 4EI5D 2GQHA 2W59A 3O11B 4ALAL 1X7QA 1BZ7A 3TF7C 2LTQB 4FQXC 4GW4A 1KBGL 5GRXG 2VLJE 4I3GA 4TYUA 3OG6B 5JLZB 1RJCA 4OQTL 1KENL 4Q6IB 3BKCH 3DMMD 4Y5YA 3OAZK 5KSVA 5JOFB 5DFWH 2P8LA 3I6LE 5CHNA 3U4BH 5LCVH 5DD3H 3MRLB 4BSVA 1C8PA 5IHZB 5D70L 2R0LL 5J9PA 1VACB 3MV8A 5JPNA 1J1PL 1T83A 4RFEA 1LDPL 1TFHA 3FB5B 3N9GH 4GMSL 3C5ZB 5ABDE 1N8ZA 1UZ6F 1PSKL 2NXYC 1G9MH 1F3RB 3WS3B 1GZQB 4JO4L 3GK8H 2KH2B 4LSTH 4EDXA 4PJCE 1MUJB 4M62L 4AEHL 3UPCA 3VXMD 1RK1A 2FBOJ 3PWPD 4ZPVB 3NCCB 5J12C 3BPNB 2OP4L 1XF4B 3ZE2E 2E9WA 5DJ2A 3MOAH 5D5MF 5EC1A 4JM2C 3BUTA 1A9EB 3ARYA 2J12B 2NW2B 5JUEH 2CGRL 4K23L 2Y07L 3C60D 4RGNE 3RVWC 1LEKB 2FDBP 5EU7E 1TJHL 3B3IA 1EPFA 1KGCD 3F7RA 3LPGA 4ZO6A 4ZNEE 2J3SA 3S3JA 1CL7I 4OZ4B 3BP6A 4KZEH 1YNKL 1LO4H 1FFNA 2ATKA 1AXSA 4O2CA 1QEWA 4NRYB 3D0VA 3H3PL 5BVJB 5JHLL 3R1GH 4KKAC 4GLRH 5ANMB 1DN0B 1YPZF 3SCMD 2Z8SA 4MA1B 2DQFA 2I24N 3VRJB 3BZ4B 1CS6A 4OI7A 1QSVA 4DCQB 2XG5A 3E0GA 2OXGA 4P4KD 4ZFGL 1YEJL 2YPLA 1JWUB 4HGWA 1IGJB 1JGUL 3DURB 1FNEB 3TEUA 5HJ3A 3DX8A 5EO9A 1FYHB 5F7KC 2R29L 4D8PB 5DO2C 4J7RA 5CEYB 5KVMC 5DHXB 1CGYA 1OCWH 2FBJL 1H0DB 2BVEA 1WT5A 3P9MB 4K07A 5E9DD 2QSCH 3SDXB 4S1SL 5KAQF 3QFJD 3HG1B 4RBPK 5HDQL 5GIRA 4Y19E 5FIEA 5ACZB 2DBJA 4XPFL 4R2GC 3TBWB 5HHPA 2NLJB 4NQVA 5FYJU 1ZHKB 2HT3D 4G8EB 3U30B 2B8OT 3VWJA 2HT2C 3FT4B 2EXYC 4XP4H 4OLZL 1GOGA 4L29A 4P59L 1B88A 1Q9WB 4PJFB 3GFUA 5EUKB 4JFYA 4DQOH 3FJTA 3QXDA 1PEWA 1BD2D 1IC5L 5ALCL 2D7MA 4JHZA 2GCYA 1F13A 4KQ3H 4YBHA 1T3FB 2UWEB 5ICZB 1QLEL 1MELA 3I6KB 3PDDA 3LEXA 4PG9B 2HFEB 4FTVE 5F9JA 3Q5OA 1KOAA 5MENB 1HQ4A 4E9LA 2FR4A 4M48L 5C7XH 3IGAA 3T3PF 2LQRA 5E5RB 3TO4A 1BP3B 3SDAA 2WBJB 4WNQB 3GO1H 5E0QA 4RWYL 3EYUH 2HYMA 4OLUL 1JYXA 4LF3B 3QWRD 3DTXB 3L3GB 4X7DC 1EEZA 4C56B 1J12A 3LEYL 5GSRB 1L7TL 1IAIL 5LAXB 1Q72L 2WQ8A 1ZT7A 1YNTB 2ZCLH 3ILPB 3N0PB 1I3GL 3TGXA 1UXWA 3FQTA 5EZIH 3QNYB 4XRCB 2PXYA 3NCYP 2VLJB 3QEUB 1RUPH 5CLWA 1AGBA 5BVPH 1JGLL 3F58H 3P40A 2AJSH 5GS0C 4G6MH 3RWJA 4MZ2A 2A6KB 1XIWA 3F7PC 3ELAT 4JLRB 1JZ7A 1I7ZA 2VSCA 3HE6B 3VXOA 2I26N 2FEEL 2G5RA 5SWQB 3LB6C 2Q76A 5GGRY 5FHBH 2XZZA 2HT4C 1IQDA 1CDIA 1G1CA 1NCWH 2WWMC 1KEML 4YHNA 2CK0L 1K4DB 2XZQH 3QIUA 4PJCB 4HK3N 5KSBF 2PO6A 4Y5XC 3PWVA 3QAZC 4ONOA 1X5IA 3O3DB 4R7NB 3O8XA 4NPYB 2DLTA 2X4OB 1UENA 3QDMD 4G80A 2BNUB 2JCCE 2FL5A 3IFNH 4KJWC 4GRLB 4G6JL 4S0TD 5HHVH 3VWKA 2EIZB 4RGNB 1EH9A 2NXZC 4EQ3A 5H8DA 4YXHL 3VA6A 1AIFA 4ZXBA 4FQHA 1KLUB 3TYFA 3D25A 1NCNA 2MWCA 3HZKA 1T0MB 2FWOA 3K4ZA 1WQVT 1A7QL 3RJDA 3X11A 1F6AB 4OUOA 3X3GH 1DDHB 3IB4A 3CPLB 3QPQD 5T3ZD 4ZPTB 3SHSA 4OGZA 3DHMA 3GB7A 1MPAL 5FB8A 4TUOA 5L2KD 3W11D 5JPMA 3WIIL 1OLLA 1JGVH 3VFNB 3PXHA 4BFBD 3QUXB 2UZIL 3T0ED 4PJHF 4OZIA 4XC3H 1KELL 1ZOXA 3RWGA 3HUJF 4UQ3A 3MXWL 3QQNA 5IVXE 5DD1L 5T5FH 4KDWA 3NPSC 2ED7A 4N5UA 2C4FU 4OI9A 3Q6FA 3TYGH 3MLRH 3IDNA 1N64L 1UJ3C 4XPTL 1A7OL 3WMSA 2JJTA 5GRYA 1G9MC 1MRFH 12E8L 4Z76A 1OPGL 4Y19B 4M6OH 5C0IA 2ICEA 2BRQA 2FX7H 4NC1C 1JRHI 2BOBA 4KXZI 5GJTL 1DANT 5DJ0A 4PJEE 1KJMA 3O3AB 3O2DL 2XXCB 3MV8D 4HC1L 4IMLA 4P23A 3C8KA 2W0FA 5AUMB 2O61B 1M71A 1NBVH 2B20A 3FQNA 1Q38A 4M43H 4N90D 5DK3A 2DKUA 1PG7L 5C0ND 3FN3A 4NN6B 5BRZE 3SE8L 1PD6A 3BH8B 4U1KB 5FXCH 1JRHH 3HNTH 5JMOC 4I77L 3F7VB 1EFXA 2X4RB 3QIBC 3C9NA 4HQQL 3STZB 4FQJH 4QOKA 1EERB 4FTVB 3PGCA 3CLEL 4R96B 3DVFA 4XBGB 5ADOH 5EOTB 2MNUA 1KCLA 1VGKA 2NY6C 5J89A 4JFQB 1IL1B 4CGTA 4HUNB 2CJUL 3MNVB 1IEBB 4F33A 1PG7W 5FA4B 3BEVA 4WDIA 1ZT4B 2E7LA 5B3NA 5ESQA 4JFEE 4I0CC 2CDEB 4YFEA 3CFJA 1F4AA 3GBNL 3MUZ1 3SKOA 2NY3D 5KJRL 4PY7B 2NY2D 4JPKH 4NQXB 5DJXB 3LS4H 3PHQB 3DWTA 1PGRB 5E94A 3KYOB 5IVNA 3BPOC 3O4LA 3O9WC 3P0YL 3RPIB 2IQAB 3ARBC 5EIIA 4G8GE 2E8ZA 1MCWW 2R56L 3G9AB 4DN3H 4Z7VE 4KMLB 3KLAB 4WHDA 5GS0L 2QQKL 4HJGB 3H8NA 3MBEA 5C0DB 3MRMB 4P5TC 2ZP0T 1FIEA 4PRDB 3I2CL 3AROA 1A5FL 2YPLD 3HR5B 4PJGF 4FABH 3BP5B 4JQIH 4K7FB 3A6CL 2XZAL 1KNOB 2A9NL 5DC0A 3EIFA 2HMIC 3IETB 4H0GA 1ZGLA 5BMFH 4I5BA 1B0GB 1J0ZA 1OAQL 5GS1C 1S9WB 2ZOLB 5ENWB 2WZPD 5IUSA 4KJYA 1FL3B 3HMXA 1N5YL 5J1AB 1OTTD 4MXVF 5GS2H 1O7VA 4XCYA 4PJBF 3V5HB 1EAPA 2BY2A 1ZAGA 3KYNB 4AIXA 1J05B 4EBQL 1NCCL 4XZUA 2ZKHL 3W81A 5BZWA 2JCCB 5E8PA 3QISA 3U83A 2RFXA 5HYQA 3I50H 3S34L 4K94L 1KV3A 3VWJD 2BVPA 2YRPA 4QRUB 1U8OA 3S88H 4WW1A 3MJ6A 1BF2A 2AI0H 3EO9L 2C3XA 4GO6B 4LCWA 1N6VA 2VDOH 2LTQC 4P46A 4ODTH 1PLGH 4HK3J 1N3NA 1FFPA 4Q6IC 3VDBA 1Q0XL 4APQA 4OLEA 1NMAL 3JUYA 1S7RA 2GJ6E 4PJXF 4JFDA 1T1XA 2CK2A 1M6OB 3MJ9A 2HKFL 2FYYA 1DEEA 3U1SL 2VDML 4AH2B 1ZA6B 5T1KB 3TO4D 3W0WE 1FJ1A 4P2QD 3FOMA 4JFZL 4DWHA 4WTZG 5IBTH 3SDAD 3C5ZC 1J1OH 3PNWB 5D1ZA 4IRJB 5B3JF 3EDDA 3U4BL 1BVLB 1KCVH 3DI2B 5LCVL 3M8OH 5CSZB 5IVXB 4XWOC 2QSVA 1EEYA 4HUMB 2Q1EA 3BZFB 3SQOH 4UDTA 3ARPA 3VFUA 5B4MC 4Z0XA 2OTWB 4WTZA 3N9GL 3QDJA 5I66B 3BPNC 2HFGH 2XKNB 3O6FD 4WI4A 4OLWH 1G9ML 4NUGL 4XXDB 5FUCC 2DLEA 5F88A 3QI9A 4LSTL 4OKVB 4XCFH 1P5UA 5DUMH 4AMKH 2Y7QA 4X9FA 1XIWD 2P48B 5HDOA 3O81A 4X6DE 4PJEB 1QSEA 1HSBA 2NTFB 1RZJH 5IK3A 2A6IB 3HNVH 5ISZE 5C2BH 3OHXB 4MAYA 1OOAA 3L5JA 4QYOA 4PB0H 1NGZB 5BRZB 2I27N 5FKPB 4PJAF 5IG7A 3MRDB 2X1QA 2ADIA 1CR9H 4MA1C 3QIUD 5JO5B 4RGOH 4OV5A 1TDQA 3O8XD 3TNNA 5JDSA 4YPJA 3VW3H 3K74B 2ZUYA 3MRQA 3T3MF 4AT6B 1H5BA 4DN4L 3BKML 3R1GL 4RA0C 5C1MB 5BS0A 1J88A 1EXUB 2CKNA 32C2B 4XP6L 1A6VH 2XIDA 3VWKD 3RUGA 2Y1VA 2C7UA 2MCPH 3EJYD 4JFEB 1CL7L 4X6FA 5CD5C 5F7HA 2ZNWA 1EA9C 1NDMB 4PJ5A 2E5EA 4ZXBD 5I1CL 1I3RB 1P2CA 5I1AB 3FFCE 1IVLA 5CEZD 1F97A 3PWLB 4NP4H 5AAMA 3U48A 4EUPB 4HIXH 1BX2B 3P73B 4G8GB 2AJVH 3IT8D 4U1IA 2YUVA 3VRIA 4Z7VB 2EE9A 1T7WA 3RVVD 2V17H 1JL8A 3E2HB 1INQA 2IBGA 2NR6C 1XGYL 4ELME 2ADJB 1N4XH 2YD2A 5CSBA 5KSAB 4WW2B 3ZT6A 5T1MB 4KQ4H 3V5KB 4MJIE 3CAFA 4X4ME 5EOCJ 4YDJA 4PRHE 4U49A 1BVKA 4KKBD 3O6KL 1N59B 1RY7B 5D9SA 1HYSD 4KY1L 4PP2B 1S7SB 4XP4L 5EU4B 2IQ9L 4HGMA 4NNPH 5E2VL 3KHQA 2R2HB 3MLXH 3NN8A 2XI9A 4UMGA 5DRWA 5ITFB 1A22B 4KQ3L 5ETUA 3MGOB 5T5NF 2OJEB 3MRFA 1OL0A 3G08A 5DD5L 3LKRB 2VDLH 3O3EA 4MJ5B 4L8BA 3GMLA 4XC1H 4P23D 3QIWB 4H20H 4YFLF 2DAVA 4V2CB 4MDJB 3S7GA 1T2XA 1D5XA 4RIRA 4OF6A 4KDVA 5C7XL 1T5XA 2BDNH 3HRZB 2PW1A 1F4HA 4C4KO 3UMTA 4MXQC 3GO1L 4H1LG 1CIDA 3EYUL 4UILL 2VZOA 1JK8A 1UYWH 4NM4H 3S35X 4ONFH 1J8HA 4LIQE 1E28B 4L8CB 3OKKB 3WHE1 1DBJH 1OSZA 3CFKA 1URLA 5C0RH 4B0MM 1FV1A 3N1PC 3OKNB 4QOKD 1Y6NR 4ZTPH 5JOEA 2GJ6B 4D9QE 1IMHC 2F53A 1FL6A 2W0PA 3R06A 2Y72A 3HE6C 1T03L 2E9IA 4H1LA 1M05A 1ZHBB 2WUCH 4NQDD 5EZIL 5DEGA 3C87A 1NGQL 2CRZA 3DBXB 1EVUA 4ZDHB 2Q8AL 2AJSL 1BEYL 2WLYA 1JGDB 4HGKC 4LRNL 2R9HD 1RZIB 3VFOB 1XR9B 4YNYA 4GXVL 4C83A 1LO5B 2Y06H 4PTUA 3W9DB 1MHCB 5HYSG 2R0KH 1IC1A 1RJZB 1KFAH 3O4LD 2XTJD 3WO4B 1OWWA 1M7IB 3GIZH 5I1DA 4F7EB 4GRLC 2FIKA 5IM7A 1CFTA 3EYQD 2DD8H 2XZQL 4JM4H 5HYSA 4HV8A 4RGNC 1T0NA 5JOPD 3MBED 5ESAA 4TQEL 5EU7C 1FN4B 1A2YA 3L3IB 4X6DB 4F7MB 3NCEB 4K3EH 3K4AA 1QBLH 3DGGA 4RAHA 2QADD 4P4RB 5ISZB 1DJSA 3IFNL 3GMNB 5K9QI 3WXWL 3QUMA 1W72B 1JYNA 4D94A 2F58L 4PS4H 3FZUD 4WUUA 3BHBB 2A6JA 1AGEB 3DV6B 4YHPA 3UTPD 2VR4A 5I76A 3QUXC 1BHGA 3H7LA 5CMAB 1OF2A 1MLBA 3FO2B 3ARSA 1XH3A 1PYWB 3QJHB 2GJZB 5EA0L 1D6EB 2IPUG 3WFBL 1CIUA 4JHAH 4PGJA 5E8DL 4XH2B 4GJTB 1GHFH 4UIKH 5IMMA 5JNYA 4J23A 1PZUB 3CVHA 1G9NL 2Y6SD 3RL1B 2ATPA 4Y4KB 4Q0XH 4UQ2B 1ZANL 4LCWD 4P46D 2DJ4A 4HLJA 4RX4A 4XC3L 2X4NB 3RA7H 4CN6A 4LK4A 3FFCB 4OIAA 5F3BA 1YYML 2Q20A 3AAZA 2Z31D 3PUCA 1CFVH 3GRWA 4APQD 4F2MB 1NQBA 5GGVL 5I19L 4U1MB 5T5FL 4NDMB 3PQYA 3RIAK 5F7DA 1SEBB 4GW5A 2W07A 5CP3A 3RTQB 5CEZL 4JFDD 4XVUC 5IQ9B 4DW2H 3EO0B 1QQDA 4TRPH 1L9NA 3HR6A 4P2OB 3HI1B 2D03L 2AABH 1QSFE 2YBRA 1UACL 1W0VA 1JV5B 3NFSH 4ELMB 4NN6C 2EIBA 3V7AE 4AG4H 5I8KL 5D1ZD 5T1LB 2VZUA 4MJIB 3IFOA 4QXWA 4IS6A 1T7YA 3T2QA 1BECA 1CGVA 2JJWA 1QRKA 1OT2A 4M1GH 5E2UH 4LCUB 3B9KB 1KYOK 4P3WA 3GUTA 2BHZA 1NBVL 3EO1A 5KW9H 3DUSB 2ADGA 2YS4A 3QUKB 1I1CA 2QKIA 4WHTA 1ZVSA 3DGCR 3QDJD 2DICA 2WBKA 3VE0B 5I75B 3A0OA 4JDVA 3TN0C 3MA7B 5IF0A 1T1ZA 3RU8L 4JVWA 2LVCA 3W2DH 3U0WH 1J18A 1NAMB 3QI9D 1JRHL 4Y8AA 3O2VH 1T7VA 4HEPG 1BOGA 3ZYIA 1Y0LB 1CGWA 5SX4I 5A16B 1QSED 3QEQA 4JZNB 5E8EA 3FO1B 1YC8A 4QRSB 3H3KA 4MAYD 3C08L 3BPLB 4KZDL 3UJJH 4G6FD 5J4MA 2VH5H 1AXTH 4QY8B 2J8OA 1T20A 3DI3B 4IDJH 1R3HB 5HYEA 4TOYH 4OZFB 5M95B 1D9KA 2HWZH 1DBKH 2C1OB 4XCNB 4NZUH 3LS4L 5E8OB 3JSSA 2OTUB 3D3VB 3KXFE 2PTTA 1GSMA 2JJUA 5EWIH 5D8JH 1ULVA 1NC4A 4KRLB 5F1NB 2M26A 2X41A 1U95A 5HHOA 3IF1B 3UJIH 2EXWC 3I6GB 4WCYL 4DN3L 1HE7A 2Q87A 5BS0D 5HI4C 1LD9A 1BJ1H 3EOTH 3NPZB 3BIKB 4TVPE 3OGCB 3VXQA 1BLNA 2O5YL 3MV7E 4OIIL 4PJ5D 1KT2B 4LKCA 1JPGB 1I7RA 1L0XA 1K6QH 1MJJB 1A4JB 1Q0YH 2H6PA 2BNQE 3IDMA 5IB1A 5IB2B 1U42A 2NY4B 3V4UH 1JTOA 1RJYB 1XF3B 4XGZA 5F7EL 5BMFL 4L4VD 1K3IA 4L3EA 4XMKL 1AJ7H 4XVTH 5FO8A 2H2SD 1XGPA 3MRBB 4OFDA 1W72H 1AGFA 3Q5YA 2BY0A 4QXUH 3RDTB 1MOEA 1K5NA 1M7XA 4NHUA 2AQ2A 1FZKA 2BXYA 3V5DA 1UH2A 4GMTH 5TQ0H 5BJTB 2VE6A 2CLVB 3ARDD 1IKNC 3CFEA 4GS7C 4NM8L 2K3TA 3GKZA 1TJIL 2VLME 4DGIL 4M7ZC 4JHBA 4KTEH 3S88L 5E6IA 4MQXD 2JB5H 4J12A 2AI0L 2XWJB 2VN4A 3LRSB 3GMRB 1S9YA 1EDQA 2IPUK 2AK4A 2AEQL 3GZKA 1AGCB 1PLGL 2N56A 1N6UA 3MRRB 4PJIF 5IP4A 5C08A 1KIQA 2H32B 4CADA 4RMUA 4F7PB 1NANI 3HMXL 4S11A 1F6LL 2ICWI 1OW0A 5IJKA 4PB9H 1EGJA 3UROR 2IADA 2Z92A 4ZUTB 1OGAD 2A73B 3EDJA 3L5HA 4HMEA 5F7MC 5TGBB 5CILH 1TZGH 3QNZB 4KDTC 4I18B 1MY7A 1E27B 1A7RH 2VABB 3ALWA 3QCTL 3QWOB 5IBTL 3TVMB 1J1OL 4HEME 4NNXA 1J8HD 2G2RA 1H3PH 1KTRL 3LCYA 3GIVB 5DMKB 2VLLA 1A1MA 5B38G 1A4KA 3HTLX 4AM0A 3GMMA 3LN5B 3TJEH 2F53D 2R2EB 3N85L 3L95A 3BGMA 4YHOL 2X4SB 3BN9D 4P57A 1U8HA 1OTUC 3TBYB 4OLWL 1QSFB 3CDGB 4U2YA 2BC4A 3GSWA 2BSRA 4IMKA 4DKEH 3L3KB 1EO8H 3AU1A 1A7BA 1QA9A 1ZV5A 5DVOA 3MLSH 4X4ZA 4LLYA 4BQ9A 1U8LB 4R4ND 3MSPA 4OZIF 2DJUA 2VZ1A 1R24A 1HINL 3SGEI 3UTQA 2G9HA 4NGHH 2DLFH 4ODUB 4F7TB 4PB0L 4U1NA 3U6RB 1G7IA 2BVUA 5CINH 2VL5B 1OTSC 4ELKB 1FH5L 3LKNA 5FF6B 4CBPA 3ARGA 4MA8H 5J11C 1EZVX 1T4KB 1Z3GH 1DQQA 4LIQH 3VW3L 4UIMB 4OZFH 4P9HH 1OAKL 1K8DB 2H26B 1CN4A 3ULVD 3HNSH 1ONQB 2D31B 1XF2B 1A6VL 2Y4SA 3NIDF 4MJ6B 4WO4A 1CK0L 5DQ9A 4LCCB 4XX1G 4WUUD 4E0RA 2MCPL 4FG6D 3D69B 4HJJL 1NCTA 3E2HC 3QEHA 5K9OB 2D7PA 2VIRA 4TSBL 2P4AB 1UJ3A 4I3RH 3UTTA 1JIBA 2AJ3B 1ACYH 3KXFB 1EUTA 5I8EA 4G9FE 3TPKA 4WW2C 5KSAC 1KEGH 4JG0H 2BNRA 3GSRB 4HKZB 2AJVL 4AQ1B 4DUXA 3TJHC 2DMKA 3VRLE 3VXUA 1BQHA 1X6LA 5JW4R 3MV9E 2XQYG 4JKPH 4JZOB 3QZWB 3MV7B 4Y16A 3VFWB 2A6DB 2BVQB 4HS3B 4U3CA 4U6TA 4JN2B 4RX4D 5EUOA 4JCLA 1N4XL 4XBPB 4OTXL 1ETZA 1IGYB 2BNQB 4J4PD 4J3VA 4DGYH 3TZVB 5J7CC 3KYMA 1FVEB 1G6RB 3L7EB 3MJ8A 3PWNA 5F44A 5I1LA 5IW1A 1J0YA 3MRHB 3PQYD 4OCLC 1I9JL 1I1AB 4NNPL 4ODWA 1FC2D 4OQ1A 1VKXB 3QIWC 2RGSA 3QIBA 5FYKE 5LGHL 3D0LB 1KG0B 3MRGB 4YO0A 3E1F1 4Y2OA 1AD0A 4LVOB 1QYGL 3MNZA 3SJVE 3BDBA 5F8QC 2KZWA 1GVIA 4E42A 2VDLL 2H32H 4WTXA 1TVBA 4JJ5B 4CVXA 1LEIA 3SKMA 5M7QA 4UOW0 4G5ZH 4A6YL 4M7JL 2EC9U 5H94B 1UWXH 2BDNL 3UBXB 3NMEA 3U4EA 1T22A 4OD3H 5GRJH 3O9WA 3T1FB 2P5EE 1TZIA 3T0VA 1UYWL 1QHOA 2OL3A 1INDH 1P5VA 2DQCH 5DFVC 4MXWL 3KR3H 3G6AB 1KCRH 1DBJL 3V2AR 5C0RL 1TIUA 3JXAA 3QEQD 5MEQB 1MCQA 3NFPA 4NHCL 3OJDB 5DUPH 4K3JH 2OJZH 1SEQH 2WUCL 3UJTH 4S10A 1ZLVH 3EJZD 1KIPA 4MA7L 5AZ2H 1ZLSH 5E1AB 3ZYZA 3HFMH 4GKSA 5IFJB 2ED9A 3FHQA 2QHLA 1BZ9A 1H3GA 4WWKB 1RIHL 2EDRA 5AD0A 5GS1A 2AQ3A 3WS6A 1D9KD 1NGPH 4I9WD 1TVHB 2YD3A 1KFAL 5C92A 2DS4A 3STLA 1WBXA 3QQ9D 3BYTA 3V8OA 4M8VA 2PYFB 3RGVB 4Y2DB 4MNHA 3GIZL 1HOCA 1NC4D 2DKMA 5HHOD 1JPST 5GRUH 4ETQA 2XPGA 2OXHA 4CUCA 3HC3H 5HYJE 3NCYS 2OMNA 4Y4HB 4M6ML 1HQRA 1LNUA 1X5FA 2H1PL 5J56B 5EO1B 5ICYB 4UI2A 1NEZB 3LVEA 5E2TL 2LU4A 2UZXB 4GG6E 3O11A 3U7AA 2V6HA 1HDMB 1J0IA 5ITBH 1VPOL 3H9SA 4NN5B 4NBZB 3BSZH 4ZAKB 4LLUA 1YEGH 5JLZA 5HHXH 4NUJB 4L3ED 4N0CD 4OJFH 4G8FA 4GFTB 2ITCA 1ORQB 3MRLA 3H7BB 5IHZA 4N68A 5KVGL 4Y4KC 5CP7B 5DR5H 4EQ2A 1CLZH 3JV6A 4KROD 2EYTA 3ZE1F 4WWID 3FB5A 1S5HB 1BQLL 5I0DA 4CMHB 2J8HA 1FO0L 2C4FT 4LSDA 1JI1A 1B4JL 1GZQA 1DVFA 4UIKL 1FCCA 4TUJA 1CD1B 5E6ID 3RTQC 3PGFL 1U6AL 3F12B 1MUJA 3AM8C 1ZA3B 2AK4D 3NZ8B 4TVPH 4P2OC 3RA7L 3QUML 5IBUB 2FECI 1MFEL 2GTWB 3LKPB 1RJLA 2XQYK 2R1XB 5C08D 2EE6A 1XF4A 4UBDC 3WIFA 4G9FB 1GYAA 5HHNA 1A9EA 2NW2A 1G6RH 3QQ3B 1LEKA 1SMOA 4TRPL 4AZ8A 1YEIL 2PKDA 1XGTB 1LK2B 3L1OL 3VXTB 1VADB 3ARXA 3K0WA 4GQPH 5I75C 3H2WA 2YHGA 4AG4L 5IMKA 4YHYB 4WI6A 3RUGF 4NRYA 4IEFB 3H0TB 1P7HL 1JZ4A 3ULUD 5BVJA 2CMRL 5JW4N 5HGDB 5ANMA 4YHKH 1DN0A 2ESVA 3HZYB 5E2UL 1KN2L 4ODVL 5I1EL 1C5BH 4OGXH 1ZVYA 3TBVB 4DFIA 4PLKC 3BZ4A 2VC2H 5C07E 2X4TB 4DCQA 2V2XA 3IDYB 1C7TA 4XNYH 5A2LH 1P7KA 3BPLC 1OWRM 1H3XA 4RRPA 1PZ5B 2DTMH 3T0BA 3L3DB 5F9OL 4K3DH 3SJVB 3U0WL 3GBLA 2CRMA 1IGJA 3W2DL 4BFIB 3DURA 1FNEA 3Q3GB 2NYYD 2ZSVA 3VI4E 4H88H 3P9LB 2HTKC 4UT9H 4D8PA 3NA9L 3RKDC 2P8MB 1NKRA 4P9HC 4ZS6C 5B21A 3P9MA 1JWSA 5I71B 4OLVH 1NBZA 3SDXA 4N0UE 4LSVL 3HG1A 1HH9A 4UTBL 5EDXA 4XVJH 3UJJL 5ACZA 1FLRH 3CLFL 1AXTL 3LQMA 4XHJC 4L8DA 2P5EB 3B2VH 4YXKL 5A3IC 2NLJA 3CDYA 3FRUB 1TTUA 3SO5A 1ZHKA 3RIAF 4X4XA 3ARGD 4G8EA 4G8IB 2OZ4A 3WIHH 4TOYL 5T3XE 4NZUL 4HPOL 3MJ7B 3WFCH 1FNLA 5IWLC 1Q9WA 4PJFA 3QUZC 4M02A 5HGAB 3VJ6B 5GHWL 2Z8WC 2NY4C 5SWSE 1E4WH 1RZGB 3IDXH 4LL9A 5ICXB 4WO4D 5DMIL 3BD3A 3BDXA 5DD0H 1NMCB 1NUNB 3I6KA 1J0KA 4PG9A 3RDTC 2HFEA 3RFZC 1K6QL 3ORJA 3GBMH 3VFRB 5JR1H 3UTTD 3UPRB 5MENA 4MLSA 2GTZB 3V4UL 4P0DA 2A1WL 4HZAA 4LHUG 3AB0B 1PX4A 3OMZA 5IB3B 5BQ7A 1OAUH 3ALXA 2WBJA 4WNQA 1ZWIB 1WJ3A 4XVTL 3VXUD 4QWWD 5HYJB 1AO7E 1W72L 3LH2L 4QXTB 3DTXA 2IALB 3GSNB 4C56A 1UEYA 4Y16D 3BDYH 4HFUL 4GMTL 4LHUA 4JGMA 4GG6B 5TQ0L 5H37G 5L6YH 4I0PB 3ILPA 5EU3B 2YKLH 4OB5H 1JGEB 1HYRC 2P46B 1TXKA 3QNYA 4XRCA 3QEUA 2R69H 3QEGH 1XR8B 3K3QA 1IAOA 5E56A 1BIIB 2MQCA 3IJSB 3BX7C 1MCNA 3MV01 2C1PA 2A6KA 2KZ1B 4IOIB 1YMMA 3R0NA 4I18C 4XAKE 4JLRA 4ZOBA 4JZJC 2DN7A 3TVMC 1U8MA 3D39E 4K8RD 5SWQA 3V0AC 4YR6B 1MVUB 4K7PH 3TP4A 2V5TA 2VQ1A 4WUKL 5DJYA 5DC4B 3OQ3B 5D7IE 3VFTA 1F4YH 1WCQA 4Z77A 4HWEH 5CILL 3PG2A 2EO1A 2VQUA 4OCWL 4PJCA 3ULVF 1A7RL 3Q6GH 1YNLL 4R7NA 3O3DA 5D6DA 1CFSB 2DYPB 4LARH 5A43C 1E4KC 5E7BA 3WDJA 4JPIB 3IVKB 1H3PL 2BNUA 1OM3H 1C5CH 4WFHD 4HIEB 3DO7B 5GZOC 2IF7A 1BFOB 2DQGH 4HT1L 1XCTB 2W1NA 3HS0B 4ZNEA 4F15C 4ONHB 1EGJL 2H41A 1GL4B 1PY9A 5FYKH 4DKEL 5MHSD 1T0MA 3AMLA 4Z5RA 4G6KH 2BVOB 3J8F7 5GSVB 2GEEA 4ZFOB 3TIDB 1KPVB 3SY0B 1F6AA 3ET9F 1DDHA 4KVCH 1JNNH 3CPLA 3VGDA 1QRNE 3FCTB 5B39B 1ADQH 1GGCL 2ILLA 5C07B 1GGIH 3ULUL 3OKEB 3VXRD 4J3XA 4DJMA 2CLRB 4XMLL 5CINL 3AY4C 3D1MC 5EBMA 1GGBH 5HI3C 4KAQH 2AQ1A 1NAKH 4QHNA 4LCIH 4D3CH 2IAMD 4LCCC 5BOZG 1TJGL 1BFVL 2IH3A 1J0HA 2OR9L 1Z3GL 4P9HL 3LAFA 2AVGA 3AS0A 3TLRA 3HNSL 4N0UB 1JBJA 1X5KA 3H9SD 2VERN 3RZCC 1X5JA 2MQ0A 4G9DB 4XBEL 1R5WB 2MQ3A 2BSSB 4OCRL 3NZHL 4E41B 2AEWA 1T0PB 4RMWA 3O3AA 4R3SA 2FLBT 3OKOB 5AUMA 2AP2A 1SYVB 4HKJB 2X4UB 1LO0L 4D0CB 1EZVY 5FGCE 2IPTH 2OR7A 3TZVC 3U0TB 4P5KA 5SWSB 1FORH 4U1KA 1DVFD 3G5VA 1I1AC 4YZFF 4LSUH 4H8WL 3B9VA 3PP3H 1I9RH 3MACH 2X4RA 3STZA 4QHKJ 3GSNH 4FTVA 1S9XA 4XBGA 4LVOC 1NCAL 3UDWA 3CSPA 5EOTA 1E4XI 1AQKH 4JFQA 1IL1A 3A6BL 4GAGL 3MNVA 1IEBA 1TTGA 1UH3A 3DIFB 5FK9B 4Q74A 1Y6KR 1ZT4A 1FYTE 4WEUD 3TT3H 1AO7B 2DQUL 2CDEA 1JHTB 4X7SL 4LHJB 5AWNL 2AK1H 2GSIB 1Z9OA 2VKXA 4PY7A 3MTRA 5DJXA 3PHQA 3QH3A 5FM5M 4CJ0A 3M1BB 4YC2B 5INDA 1BF8A 3BPCB 3RPIA 1IM3B 3E8UH 3VGHA 5C0AE 2ESVD 3GMOB 1FBIH 2VSDA 4I3SL 4J8RB 4XNUH 3L7FB 3KDMB 1YN6B 2CDFB 2B1HL 4U0QB 4NJAL 5C0DA 1BJMA 1HHGA 4PRDA 4OD3L 3TNMB 1P9MA 3KJ4B 3JUZA 3HR5A 2HH0L 1INDL 3BP5A 3FONB 4K7FA 2EDOA 2X05A 2FSEA 4QRTB 3LQZB 4RCAA 3D39B 2D0HA 1W2KT 4I4WB 4BZ1H 2WIMA 4AY0A 2R0ZL 4U0RB 3J7HA 1B0GA 1CXIA 5E2WL 3MRCA 2VDPL 5D7IB 1S9WA 2ZOLA 3EYSH 4LDLB 2V7NB 5K59E 1S8DA 2OJZL 4KKLD 1LP9A 1LQSR 1DLHA 4K8RL 4L8SB 1OARH 3V5HA 1PAMA 4ISVB 3MPCA 2FB4H 3RGVC 4Y2DC 3KYNA 5KANG 4JB9H 4Q7DA 3PV6B 1MJ7H 4PUBH 2JCCA 5A2KH 1H15A 3NABL 4Y4HC 2ADFL 4FQIH 3VG9B 1NGPL 4PTTB 2NY1C 1LE5B 2VMFA 4QRUA 5ERWB 4HWNA 1P1ZB 2I60L 3QXTA 4Z9KB 4NN5C 2E7HA 4NWUH 3HPJB 5GRZA 3CU7A 5KVEL 4OGAD 2WUBH 3U9PL 1KXTB 1QPXA 2P7TB 3MUHL 4P49A 5KANI 4JKLA 1U8IB 4NJ9H 2VDRL 5INCB 3GI8L 2VNCA 1QRNB 1ZXQA 4G3YL 4UDUA 1M6OA 5MEND 4UUJB 1GH7A 3VU2A 1X3DA 3C6SB 4AH2A 1T80A 1VFBB 1MF2L 1ZA6A 3BT2H 5HHXL 5T1KA 4CMHC 4DZ8A 2WANA 1LILA 2NY7L 2WBJD 4IRJA 1CGTA 2COQA 1UM4L 3B9AA 5HGBB 3CVIL 3WFEH 5IVXA 3KWWB 4PGDA 1F2QA 2FO4B 2DQEL 1UZ6E 5DTFB 4LHUD 5DVLA 5IT2H 4KDTA 4EN3C 4D0BB 4WI8A 1KTDA 4RGMB 5T3XH 4XB8A 5I66A 1UWGH 3FT3B 4EOWL 2XKNA 2B1AH 4GXUN 4XXDA 3RVUD 1IGIH 5IW3A 1H3VA 4M03A 1IGTA 4OKVA 1CFNB 3OX8A 3I6LD 4HXBH 3CSGA 1BFSA 1YQVH 1YMMD 4R26L 4PJEA 1S7UB 3ZDYF 2NTFA 2P5WE 2ORBH 1SVZA 2A6IA 4YHYC 5L9DL 1CICC 4NFDA 5FGCB 3TCXA 3PDGA 1NGZA 2LVEA 1KJ3H 1G6RL 1JTPA 1F90L 4KKCD 5FKPA 2R4RH 2ERJB 2XICA 1L6XA 3MRDA 4L3CB 1CYGA 4YWGL 2V5MA 1FAIH 5HI5D 3S98A 5JO5A 1RZ8B 1LVEA 3M17B 3IDYC 2FECL 5IESL 1ZLUH 4YX2L 3RIFK 4JFHE 3HAEG 1RI8A 5EN2B 4AT6A 3QXWA 4QHLA 3WXVL 5IFAH 2PR4L 2OTPA 3BVNB 5C0EB 4S1DD 1RHHB 1C5BL 3GGWB 3MREB 4EUPG 2VR5A 1AH1A 4PRAB 1X5GA 5A1AA 1FYTB 3HAEA 2E3VA 1VEPA 3OR7B 2KBGA 4JFEA 4WEBH 4DOHE 5I71C 1NDMA 5FCUL 3SE9L 1PQZB 5I1AA 4YQXH 4MA3B 1FPTL 2DTML 5AAWA 3PWLA 2PYEE 3WFDL 4EUPA 4KMTH 4F7CB 2VQTA 1G7LA 4KJPC 1BX2A 3ABZA 3P73A 4G8GA 5C0AB 3WKML 5KS9E 3V6FA 3UAJC 3U0PB 5EUOF 4O2FA 3TBTA 2QR0A 4FFWC 3C6LB 1L7IL 5D1XC 3CMOL 3KLDA 4KRMB 1SQ2N 4U2ZA 4XVJL 5D7JB 3BP7B 1BFTA 2EKSB 2IJ0C 1MCDA 5JHDA 4WW2A 1LO2L 5T1MA 3V5KA 4FQ2H 1EO5A 1MIMH 4I8DA 5DURB 1CLYL 1N59A 3EAKA 4PP2A 1S7SA 5GGTH 5E1HB 3HZVB 1DFBH 1BGXL 3P11L 1B6DA 1MIEH 2YOCA 3MGOA 4TULL 2OJEA 3ISWA 2HTLD 3G5XA 4JDZB 3LKRA 1QO3A 5D2NE 3W82A 4RWHA 4DAGH 3T3PE 1U93B 3D18B 1QR4A 4MDJA 4PJ8C 3QDGE 4NOBA 3HRZA 2OZ4L 3FTGB 4FOMA 2VL4A 4MDIB 4FNLH 1OAUL 4Z7UE 1KCKA 2Z91B 1B4RA 1Z2KA 2FD6L 4RSVA 2WBWB 4NT6B 3S37H 3EDEA 4L8CA 5JW4Q 5CZVL 1FGNH 3OKKA 4HLZH 4ENED 5C3TA 5CGYC 4IRSB 1DN2A 1EEUA 5L6YL 2GJ6A 1Q94B 2O93L 1E0OB 3BW9B 4TUKL 5L2JB 4ONGH 1ZHBA 3LIZL 4L1HA 4JO1L 1WITA 3DSNA 3QEGL 3DBXA 4ZO7A 4ZDHA 2W38A 2GFBB 4JKKA 4HW6A 3ZTJG 1JGDA 5I30H 3SDDB 1CDBA 1W0WB 2Q3ZA 4NQCE 1RZIA 4ZUVB 3VD4A 1R5IB 2OLDA 1LO5A 1MHCA 1IAMA 1RJZA 2YA1A 4X98B 1CXHA 1GC1C 2F74A 4DGVL 4AEFA 4CN4A 4U1SB 1YYLH 4WRLA 5KSBE 4LVHB 3F5WB 1M7IA 2NZ9C 4X83A 4F7EA 1MCSA 3VXPB 1IQWH 2A9ML 4KHTH 1F4YL 1JJUA 2NY0B 4HUUB 5AZEH 3ZKMD 4HWEL 1YUHB 4XWGH 3CFDB 1JNHA 2RR3A 1I85C 4PGBB 5D1QB 2D0FA 3L3IA 1TVDA 4X6DA 3FT2A 4F7MA 4I2XE 2FJHA 2P5WB 1T04B 4TPRH 5IOPB 5ISZA 5SX5K 4BH8A 1OM3L 3RP1A 5FAAA 3GMNA 1AR2A 4OLYL 2YA0A 3T2PA 3OAYK 1AGEA 3ILQC 3WHE0 1R3IH 1MHHB 2EH8H 2UZYB 4JFFE 1J5OH 3FB7B 3ESUF 5CMAA 3GHEH 1MCHA 4G6KL 2EH7H 3OWEA 3FO2A 1PYWA 3QJHA 4Y1AA 4WU5B 1D6EA 2VLRA 2VRAA 1N26A 2BCKB 2I5YL 4XH2A 5DSCB 4PJHE 1VERA 2Z8RA 4M1DL 2CIKB 1UB6B 4WV1C 4B7IA 2HVKA 4Y4KA 1CFBA 4DOHB 3BO8B 4UQ2A 3WNOA 3ES6B 4M7LH 3V0WL 3FFCA 4NRXB 4NC2B 1NAKL 2PYEB 2VDNH 1NJ9A 4F2MA 4U1MA 4NO5B 5F7UA 1N0XH 1AHWA 2EDKA 1CT8A 2IG2H 2YRZA 2FJGB 3MOBH 5GGUB 5J8OA 5KS9B 1SEBA 1U41A 4V1DE 5IQ9A 3AM8A 3MUGB 1KB5B 2ZUTA 1KCUH 5TDOB 3JVGC 5DMJB 3EO0A 3GSVB 4MS8C 5SWZE 3HI1A 4XCCH 1MFAH 1Z5LA 5T1KD 1KYOJ 4JRWA 3TA3A 1F5WA 1JV5A 2ZSWB 4IOFC 4NFBA 4GQ9L 1N2RB 1YY9D 1Z6JT 4IRJD 5T1LA 3GJFB 2JJSA 4MJIA 2K7QA 5FDWB 4BZ2H 3B9KA 4UT7L 3MLUH 1N0LA 3E6FB 3IKKA 4NBXB 2V2WA 3QUKA 4IIQA 1UVQB 2CSPA 2QQNL 3LDBB 4QRPA 3VE0A 3RWEB 4FP8H 4PJ9A 3I02A 2XWTB 3F7YB 1FORL 2W9EL 5F3HB 1C12A 3L9RB 4J1UB 1NAMA 2XZCH 2D9QB 4LSUL 2EE2A 4ZO9A 5D2NB 1FGVH 4CVUA 3JWDH 5A16A 4HIJB 4XCEA 4FQCH 1QZ1A 1NBYB 3VH8B 4JY4A 3SDCC 1NGYB 3FO1A 4L4TA 4QRSA 3QDGB 3B4NA 3DX6B 3SGJC 3AMKA 3LRHA 4ZSOE 3WYRA 2ARJA 4FFYL 1MAML 2LE9A 1NCDH 4QY8A 4Z7UB 5DJDB 3CDFA 1U3HB 1ERNA 3IDIB 1R3HA 4PJFF 5DLML 2AK1L 4HZLB 2QV2A 2C1OA 4XCNA 3DUHA 1WEJH 5E8OA 2OTUA 3F8UB 3O41B 1E4XL 3D3VA 2CXGA 5EU6E 1UH4A 1EHNA 5F1NA 5LBSH 3HB3C 3IF1A 1KJ2B 3I6GA 1FBIL 4U0RC 2X7LB 3QG6B 3RWFB 2VLKA 3BIKA 3S97C 4JFED 1EVTC 4NQCB 1JPGA 3D2UA 1MI5A 5IWLA 1DEDA 2PTUA 4G7YH 3BEWB 3CCHB 1UCBH 5IB2A 4NO2B 1GC1L 3FQXB 1HH6B 4MB3A 2XNAA 1XF3A 5KSBB 4ODHL 2KDGA 3JV0A 4MXVE 4PJBE 1H9VA 4GAJH 3EYSL 4M3KB 3WSQL 1VFMA 3AUVA 2VITA 3CSBA 5DJZB 3DX9B 5E4IA 4TTGA 2X89A 1U8NB 4EZMA 4KTDH 3O2WH 4X5LA 5GS3A 2FHCA 5TF1H 4I2XB 3RZWA 2X2YA 2F19L 5JHDD 5BJTA 3VXME 3PWPE 4U1JA 2CLVA 4ODSH 3NAAL 5L7XL 4BJLA 2XN9E 3LN9A 1F11B 2ICCA 1A6WL 3EW3B 5EU5B 1TETH 4W4OA 1IGFH 2XWJA 4R97B 3BXNB 4HMDA 1ND0B 1KGCE 2WV3A 4HWBH 4R6UA 1QG3A 3UYOD 1A6TA 1KB9K 5I1JH 1QR1B 3ZKNC 1CFQB 2HKHH 2DIAA 4JFFB 4E5XA 2DQDH 3MRNB 5DQDH 4Z0BH 4PJXE 2APWA 2WUBL 4F7PA 1M4KA 4JAMB 5ILTH 1MY5A 4XVSL 4PJCF 3BIAX 1KC5H 3AVEA 4NJ9L 4DK6A 2EIDA 2RHEA 4ZUTA 2X9YA 4IJ3B 4PJHB 4PREA 3P4OB 5GZNC 3VFVB 5TGBA 4FS0A 2K7PA 3T2OA 3W5NA 5B3JE 1CBVL 1E27A 2VABA 4RGMC 1KB5H 1DSFH 3SBWC 3ZE2F 5KVFL 3QWOA 1AFVH 1WWCA 3TVMA 4MB5A 4NOFA 3P30H 4N8CL 4PFEA 2MMXA 4BFEA 1WV7T 5IMOA 4FQ1H 3DETC 1HCFX 5DMKA 3M45A 5IJVA 3GJFH 2ZCHL 3QXVA 1U58B 2WINA 3LN5A 2GJ6D 4FZEL 4JQXC 4V1DB 4BUGA 5FFLA 2VZ3A 5DI8B 2KL6A 1ZT1B 5E9DE 2CIIB 5JXEC 2X4SA 3HN3A 5SWZB 4XNXH 3DVGB 2Y36L 1TCRB 3QFJE 3ARFA 4JREC 3CDGA 3MRKA 1UXSB 5DWUL 3L3KA 2JK5B 1FRGL 1XMWA 2ERJC 4AK1A 2JKXA 1AD9B 1OGTB 3KPMB 3OKYA 4AIOA 4GUPB 4U33A 1HXMB 1I3UA 3BMWA 3NCFB 4FFZL 2ORBL 4DK3A 1DQLH 1EX0A 4N9GB 1OAZH 4ZO8A 5EBLA 1I8LC 1NFIB 2NMSA 4L9LA 4M1CD 3U6RA 1KJ3L 2XWBB 4PRNB 1CGXA 1JE6A 4ELKA 1A6ZB 4NO0B 1UT9A 2YSSB 1RVFH 5DHVB 4LLVB 2HVJB 1MHPH 4EI6A 5FF6A 1FAIL 5KG9A 2I9TB 1TZHA 4NKOB 1MCIA 3PHOB 1T4KA 5DFTA 4M8QB 4ALAH 1MJ8H 3NTCH 4R4FL 4UIMA 3BISA 3IJYA 4NQSB 1KBGH 2H26A 3VD7A 1TTFA 4GRMB 1YA5A 2A0LD 5A2IH 1KENH 5IFAL 4ZSOB 3OJMB 1S7TB 3PWJB 4MSWB 5BW7A 4OF0A 2VKWA 2GUOA 2V2TB 3PP4L 1KJ2H 4BELD 4J2XA 4WEBL 4YHIB 5D70H 2R0LH 5GRVK 3C6LC 3D69A 3RPKA 5HPMA 2GW5A 4FQXB 1LDPH 4HJ0C 2DWDB 4YHZL 2BERA 1WZKA 1V8HA 3O0RL 4X8JB 3QZWG 2CPCA 2EDDA 2AJ3A 1A64A 4GMSH 3QG7H 2ZWLT 3I84A 5CGMA 4Y1AD 3GSRA 5EU6B 4HKZA 2VLRD 3HE7C 2R15A 1QLRB 3PL6C 3DMMB 4M62H 2F8OA 2SEBB 4JZOA 4AEHH 1MCOL 3QZWA 3MV7A 2A6DA 2BVQA 5ESVB 3TPUA 2OP4H 3WLBA 3WLWC 2A38A 1ZS8A 4LRIA 1IGYA 3WUWG 4U6XB 1JZ6A 1I7TB 2C3VB 5IVZB 3L7EA 2W9LA 2JF1A 4D9RD 1QBAA 2CGRH 4K23H 5JW5A 3BRGC 5ELIA 2Y07H 4HUKB 5ALBL 3MRHA 2Q86B 4PJBB 1T2JA 1D3CA 1PKQE 4RMSA 5GGTL 1K8IB 1I1AA 1SY6H 1TJHH 2O5XL 5LJYH 1I7UB 2EZ0C 2DDQH 1CDUA 1VKXA 3RIFF 1YNKH 1DFBL 1T2QL 3TA3D 3WJJC 2BY1A 1KLGB 3VXMB 1MREL 3PWPB 5JHLH 3QDME 4MQTB 4MJID 3DARA 4RZCA 3JWDC 2JIXD 1FNFA 4U6YB 4ZODA 4ORGB 1JPFA 5JZ7D 3PGDB 4JJ5A 2B7DT 2XN9B 3B9KD 5GQBA 4NNYA 1T66C 4L3AA 3C60B 4ZFGH 4QRPD 4M7KL 4WJ5B 1YEJH 4PJ9D 4PRPE 3T1FA 1A3LH 4K2UL 4PJXB 5CKGA 1YMHB 1R6VA 2R29H 3MNWA 4URTB 1LP9F 1PKOA 5BZDB 2QQLL 3G6AA 3SDDC 2FBJH 1HNFA 2JLLA 1L9MA 3RY4A 1S7WB 3RX5A 1A3RL 3U7YH 5K9KB 5T3ZE 4S1SH 5IB4A 3KLHD 5L2KE 3SCMB 2EDWA 1V7ML 3SE4C 4L4TD 4ONGL 2JCCF 1ZEAL 3V8CA 1ES0B 2ZCKL 4XPFH 3RRQA 43C9B 4P4KB 1KPUB 4LVHC 3T0EE 3WIHA 5IFJA 5I30L 2NY0C 4WWKA 1AQDB 5F72S 3REWA 15C8L 1AE6L 1AKJB 1WC7B 4OLZH 5F7NC 5D1QC 4D2NA 1TVHA 4Q9BA 2X1WL 4PV9A 3VDAA 3D3VD 5E9DB 4JQVA 4H25B 1YYLL 2PYFA 1IC5H 5ALCH 3QFJB 3RGHA 4NC1E 1JMXA 5AZEL 5LQBH 3EHBD 1QLEH 2VLKD 2FX8L 5E5MB 3CC5B 1R3KB 4OAWB 3HCVB 5ICYA 1NEZA 3D2UD 1MI5D 3WL9B 4ERSH 3A6OA 3MV8E 4M48H 2E6QA 1GRWA 1HDMA 5E95B 5TPWL 2AXFB 2GAZA 1CGUA 4OCSH 5DGQA 4ZAKA 3RWIB 5IVXF 3SE3C 4WY7H 3P4NB 3LEYH 1ORQA 2W0KA 4GAYA 1L7TH 1IAIH 3UX9B 1Q72H 2X89D 1SJHB 2VAAB 2BFVH 3H7BA 2KUTA 1II4E 5CP7A 4H26A 2EH8L 1HXYB 3GHEL 4LSQH 5BXFA 1S5HA 4NFCA 1S5IL 3JV4B 4PJEF 4YPGB 3T4AB 1T1YB 4W4NA 4HHAB 1P4BL 1U9KA 4R7DA 1ZA3A 3I9GH 3NZ8A 3MBXH 2HAZA 5IMLB 2W92A 4R8WL 4U1LB 1MRCL 4H5SB 1J11A 3LKPA 4ZNCD 2X5PA 2R1XA 2VDNL 5FECA 1M7DB 2UY7A 3B8SA 4TVSa 4OFYD 4U6HB 4FXKA 3DPBA 2DM3A 2IG2L 3MOBL 1KEMH 2CK0H 3QYCA 4DKDC 3JBG7 2WQRA 5JQHC 5DC9B 1I1YB 2EDYA 1JN6A 1YECL 1MFAL 1NGWB 1F3JB 1LK2A 3LDBC 3VXTA 3UZEA 1VADA 1UEMA 1U92B 3MLTA 4N0RA 4PLJC 1XT5A 3K2MC 2Z35B 3H0TA 2XYCA 4HMCA 4G6JH 1U8KA 3EYOA 5HGDA 1HHHB 5EOCL 5D2NC 3LV3B 1PKQB 3EGSB 2CR3A 4YXHH 3EFDL 4OGYH 2X4TA 1B0RB 1C08B 4FP8L 1HZHH 4PP1C 3ARFD 2KQNA 5CJ5A 3L3DA 2ZUQC 4NCC2 1Q9LB 3QA3B 3QDMB 4OBSA 2FHFA 3JWDL 1JZ2A 1MPAH 1P4IH 2P8MA 3IAPA 3WIIH 4N8VB 2DWEB 2XRAH 1MJUL 4WW2F 3G6DH 4OFVA 2UZIH 3KPTA 1H8OA 5CJXA 1IAIM 1KELH 3S36X 5MEOB 1BWMA 3FAWA 3K81A 3MXWH 4PRPB 2P5EA 4KI1A 4M6AA 3ULSB 2XKUA 4G8IA 2YPVH 1I4FA 3OR6B 1RHFA 2GK0A 5C2UB 4ZG1A 1N64H 4NCC1 5L2KB 2H9GB 4CKVX 5D71H 4LGSB 1WTGT 12E8H 5HGAA 3WNLA 5GXBB 3VDCA 2YC1A 1OPGH 4WI2A 3CK0H 3U46B 3KPRA 3L3JB 1OAYL 3C8HA 5D72L 3T0EB 4P2QE 1RZGA 3RY5A 1MCPL 5ICXA 5GJTH 3QCUL 4LVNC 2AKRB 5F7LB 3O2DH 1T6VN 3V0VB 5IHLB 4HC1H 2YD7A 2CO7B 3VFRA 4G7YL 3UPRA 1PG7H 2EYRA 2EDHA 4Y4FA 1HIML 4F9LC 3SE8H 1QHPA 4LLWA 5IB3A 4GAJL 4MVBC 1IBGL 3FRPG 3OAUL 4PR5B 3M07A 3BQUD 3KAAA 3ME0A 4Y5YB 4WFGE 4I77H 5HYJA 4HDIB 2IALA 3GSNA 4HQQH 3MV7D 4PD4K 2B5IB 1UADC 4KTDL 4M4PA 5CUSL 3CLEH 4CMMB 1NKOA 4DFHA 4I0PA 4GKZA 3MV8B 5JPNB 4EDWL 3RX7A 2F8XC 3OAZH 3FRPA 2CJUH 5EH1A 2CO6B 2G75B 1NLDL 1DQDL 1BOYA 4KJQD 4N5EC 2YK1L 3DNKA 3P0VL 4IJ3C 4PJIE 4POZD 3UEZA 4JE4B 2APXA 1EHXA 5KJRH 2Q8BL 3MLVL 4HCRA 2NY6B 5DHYA 2DQDL 4Z0BL 5L88L 2FIRT 3P0YH 5TDNB 2BY3A 2BOCB 4CU7A 3CUPB 4R0LC 1G84A 1MVUA 1KC5L 2R56H 3NIGE 1AC0A 4HUXA 5GS0H 4MNGA 2QQKH 1WBZA 5MP6L 1HHJB 3WE6B 3AS2A 4X5WB 3B3IB 3I2CH 5T1DH 1A5FH 2DYPA 5IIEA 2NY3B 3BP6B 3A6CH 2XZAH 1LEGB 1OHQA 2A9NH 5CEZE 2GT9B 3IVKA 6FABL 1FQ9C 4R90L 1OAQH 3D0VB 4HIEA 3DO7A 1KULA 4NZRH 3OF6A 3QNXB 1WFUA 4YFLI 4P5TB 1BFOA 1N5YH 1I3VA 3HS0A 4MB4A 4EBQH 3KJ6H 5MERB 4OZIE 2BVOA 5DQJB 3TIDA 1KPVA 3SY0A 1N7MH 4WWKD 4ODBD 1SMAA 2R39A 3S34H 4K94H 5EO9B 3PIQA 4KK8D 3FQUA 3LKSA 1SJVA 3FCTA 3MLYL 3EO9H 5DVMA 5L8LB 4MD4B 5C07A 3WNNA 3OKEA 1NGXA 2CLRA 3ZDXE 2A77H 3MLWH 3D87B 1Q0XH 3RNQB 3TFKD 1MCWM 3CXHK 2DTSA 1WZLA 5HHPB 5FM8A 1NMAH 1ODAA 4NQVB 4ACPA 2YD9A 1MJ8L 3NTCL 1MLCA 5E2JA 4RBPH 3ZMRA 2HKFH 4EI5C 3NIDE 3VWJB 1FG2A 3U1SH 2G5BB 1G0XA 2VDMH 4X6EA 4JFZH 4OUUA 5EORL 5T3ZH 4ZAKD 3IDGA 1S7XA 4JFYB 4G9DA 3QHZL 1NMBL 1IT9L 5DA0B 1KJ2L 2GCYB 3NACL 5A2FA 3DMMC 4KI5D 3DXAA 4E41A 4QRQA 3OKOA 3A67L 2EDEA 1SYVA 1DTUA 4QOKE 1GGTA 3QG7L 4HKJA 1Q1JL 5F9JB 5IV2A 5DMGD 4LASL 1D6VL 4PY8J 2FX9L 2J88L 2YD5A 4NUGH 5HYIA 2MHAA 4NQDE 3PP3K 3EOBA 4U1HA 3U0TA 3RWHB 5SWSA 4P2QB 1VEMA 2IMNA 5KOVC 4I1NB 1ZHLA 1RAMA 3O6LH 4P2YA 5AEAA 3MRPB 2VAJA 3QUYA 4UTAL 2QBWA 4QRRE 1S7QB 3V6OA 3SKNB 4GBXA 3INUL 2XTJE 3FQTB 5I2IB 1G1YA 3DIFA 3O6FB 3QO1B 3B2UD 4C54A 5FK9A 3SGDI 1SY6L 3V95A 1AGBB 2DDQL 2EEBA 3RWJB 3C60C 5JOPE 2GSIA 1A02N 4KRPD 4FA8A 1GGYA 4EKXA 4DN4H 3SGJA 3RVTD 3BKMH 1ZLWK 4LSPL 5DD6B 1IM3A 1VFOA 4XP6H 3GMOA 2VZTA 3C5SB 1CL7H 3KDMA 4PJIB 1FVDA 2CDFA 2J1KA 3VMPA 5I1CH 4LDEB 3SCMC 2OBGA 3BZDA 1UQSA 3ARED 3VG0L 4LNRA 3TNMA 5T33L 1A3LL 4MX7A 4TTDD 4P4KC 4BQ6A 1KPRA 1J87A 4JFOA 4QRTA 4UV7L 1MWAA 3D39A 3LN4B 4PRBA 4TSAL 2APBA 3U7YL 5D7IA 2V7NA 5ID0A 5IBLD 3VWKB 3CZFA 4L8SA 1ITBB 4FHBD 1XGYH 3BZEB 4YBLC 1DUZB 4ISVA 5DDHB 4LCWE 3GNML 3FOLA 4PBXA 3KHOA 4FQHB 3HLAB 2P5ED 2FWOB 3KPPA 5IFHL 3O6KH 5TF0A 2D3VA 3WJLA 2X1XR 4KY1H 5I8CA 2IQ9H 1XCQA 3BKJH 2CDGA 2HN7B 5E2VH 2YWZA 3H9HB 4FQPA 3BD5A 1LE5A 2HT3C 2W91A 2DL2A 1EJOL 1P1ZA 1T5WA 3CH8A 4XNMA 1X5ZA 2DQTL 5JPMB 1F02I 3P2TA 5C0FB 3KPRD 4U4BA 4LSRL 1GGUA 3HPJA 5I16A 5LQBL 4OM1L 5DD5H 4XI5D 1BPVA 2IMMA 5JIPA 2P7TA 4CU6A 1MFNA 4JGJA 4K7PX 1FDLL 5INCA 3VXSE 4ERSL 2X4QB 1QRNA 4UV4L 5LWYL 5TE7L 1CE6B 2CKBA 5TH2A 4UUJA 3T04D 2J6EA 4Y4FD 3C6SA 1X4XA 4OCSL 1VFBA 4UILH 4UB0L 4S1RL 4WY7L 4Z76B 1NUFA 5HYJD 4GRWE 2ICEB 5HGBA 2P43B 2DJSA 2E27L 1D5IH 4NN7B 3KWWA 4HAGA 5HD8D 2BFVL 2FO4A 3P77A 2HRLA 4X0KB 4OM0L 5DTFA 5E8NA 1T03H 1QSEE 4LSQL 4I0PD 4IMLB 5J13C 1NGQH 4P23B 3SBWA 3FT3A 1M71B 5KVDL 1U3JA 1OP9A 3FQNB 4UT6L 3L3HA 4O02L 3C5JA 2Q8AH 1BEYH 5CD3B 1UM6L 4LRNH 4OFKA 1IE5A 3OKLB 1F8TH 4JFXB 2Q6WB 3I9GL 4GXVH 4YAQB 3MBXL 4X6BA 1IC4L 1EMTH 4MCZA 2B2XH 4QOKB 3TESA 3DSFH 4O4YH 4QHKI 4Z18A 1LDSA 4NQDB 2AGJL 3WHXB 3T77A 5IHBA 1VGKB 4LMQI 3X3FL 2EDJA 3GJEB 4F9PC 5E7FA 2I25N 3RUGE 3DYMA 3BEVB 4TQEH 3FO0L 3X14A 5ID1B 5ESQB 4RNRB 1UCTA 3SKOB 4QRRB 1K9TA 2VUYA 2MCG1 1NLBH 4KK9D 1QKZL 2IH1B 5E94B 4K94C 3WXWH 1I8MB 3NCJL 3IKCB 2XTJB 4PJ7E 5E00B 5C0EA 2HA1A 2F58H 5EIIB 2E7MA 3GGWA 3OF6D 4L4VE 2VWEE 4M3JA 4PRAA 4JY6A 2VB5A 4OGYL 3SDYH 1HZHL 5CBEA 1RUAL 3IYLW 3MBEB 4MA3A 4OLXL 1FVCB 2IPKA 5EA0H 1IEAB 3C2AL 4X6CF 3WFBH 5B8CB 2QADB 1QBML 5E8DH 3KPLB 3QXAA 3MFGB 2APTA 1P4IL 5C0AA 4QO1A 3U0PA 5L8JB 2V9QA 1DR9A 3OJ2C 1G9NH 1V3KA 2XRAL 5I1GH 2VN7A 3QPQC 4K71B 3G6DL 1ZANH 2D7TL 1QNZL 1DL7H 3W11C 5E70A 1YYMH 5D7JA 3BP7A 1RU9L 1EAPB 1MCKA 4OT1H 2ARWA 3UYRL 5GGVH 5I19H 1OY3B 3T0EC 5JW4M 1SM3L 5DJ6B 1A21A 4XZUB 1YEDB 5IROA 2YPVL 5CEZH 3ZTNL 5E8PB 5EC2A 5HYQB 2LAAA 2RFXB 1OGAE 2D03H 1RUML 1FIGL 5D71L 5EO0A 7FABH 5CJBA 1U8OB 1UACH 3HZVA 3BRFA 3CK0L 5I8KH 4LCWB 1RZKL 3KYAA 4LVEA 4WGWB 5IEHA 4N8PA 5JQ6H 4JDZA 2Z31B 1CXFA 2VZVA 4Y5YC 3DXAD 3MCKA 4E41D 1R5VA 1U93A 5IKCA 4XPAH 2B5IC 3IXTA 4WFEE 2EDQA 1AR1D 3FFDA 4UINL 2F53E 1T1XB 5BCAA 4MHHG 3K1DA 1MFDL 1T83C 2FYYB 1DEEB 5JIHA 3RU8H 2HLFD 3L5IA 4BZYA 2XA8L 5SWSD 3W5MA 4KXZH 1FJ1B 5C0NC 2FEDD 4NT6A 3EBAA 1CQYA 4LPWA 3EYFA 4M5ZL 4M6NL 3N50A 3QUYD 4IRSA 1EEYB 3VXSB 1PW3A 1Q94A 3TN0B 4OZGA 3BOVA 3BW9A 5HVWA 3C08H 4LEOA 5L2JA 3S5LB 3VFUB 4KZDH 3F6LA 4Z0XB 4GBXD 1K4CB 5FO9A 4C59B 2PUQT 2DQIL 2RBLA 3SDDA 3WUZA 4GRWB 3TBSA 2E8YA 1W0WA 1KN4L 4ZUVA 4N0YL 2Y7QB 1R5IA 3SE4A 4F58L 2UY6A 4Z7OF 1QSEB 3DO3A 2D7NA 1HSBB 2NY3C 2NY2C 5IK3B 4U1SA 1WSST 4QF1B 4WCYH 35C8L 3F5WA 4J3WA 3ULVE 4LQFL 1WF5A 3VXPA 4KK5D 1JNLH 3KLSA 2O5YH 4OIIH 1YUHA 3QHTC 4JKWA 1WVZA 4KV5E 4WUUE 4LLDB 5D1QA 5T1DL 2DI9A 4AL8H 5C09A 2P5WA 1T04A 4F57L 1CVSC 5IOPA 1IFHH 5F7EH 2XTLA 4KI5F 4OF5A 4XMKH 4NZRL 5JW3L 4ZYKB 4Q9RH 4QTHB 1YZZA 3WDIA 3UO1L 1EIBA 2R4SL 3OB0K 4FRWA 1MHEB 3RUGB 1RK0A 4LPTA 1WT5C 2VZSA 3KJ6L 4V2BA 3FB7A 1OTTC 4XMPL 3MLPA 5CIPB 1N7ML 4DKFL 1IRAY 4JVPA 4WU5A 4KHXL 4XTRD 4G6AD 4LPCA 4NM8H 1TENA 4GOSA 1TJIH 2BCKA 4PJ7B 5DSCA 4OKDA 4DGIH 2CIKA 3PQYE 4NKMA 4L4VB 2QHRL 4HWBA 3VRIB 2AEQH 1ZHNB 2EEDA 3VWJC 3BO8A 3NGBB 4UU9A 3T8XA 1MFBL 1TNNA 4L5FL 2A77L 3ES6A 4MJ2A 3MLWL 4HXAL 3VFGL 1IC7L 5K93A 4GS7B 4F8QA 4ORZC 3HMXH 3UXFA 1A3QA 4W68A 4M7ZB 4A6YB 3ARDB 2FJGA 5GGUA 4OI8A 1XF1A 5KS9A 2D2OA 1RUKL 1CDHA 1QRND 3LOWA 4BH7B 5TDOA 5I0ZA 1MQKL 5MI0C 1ORSA 4GH7B 2X4PA 3F7QA 3GSVA 3QCTH 3DROA 5EPMB 5T3ZL 3RY6A 4Z7WF 3OSKA 2ZSWA 1HKLH 1LO3L 5DJAA 1WAAA 2LU7A 4QLRA 1AI1L 3TO4C 1WZMA 2PN5A 3SDAC 5FDWA 3MRFB 3E6HB 3VI3E 5C8JB 5CZXD 1A1NB 3G08B 2Z0BA 3O3EB 3E6FA 3N85H 4YHOH 2DOCA 4X9IA 1OGAB 1UVQA 2PXYD 1CVRA 3QQ4B 3TWCH 3GSQB 4LLQB 4ZFFA 4ZQKB 4MD0A 1T5XB 2CUIA 2NY5H 2XWTA 4ZUSB 5J3HD 5F3HA 4PRIA 3L9RA 4J1UA 3O6FC 2X70B 4B53A 3O6LL 5D2NA 3I75B 3DLQR 5IQ7L 3WN5B 2YD8A 1JYWA 4HIJA 4DUVA 3KNBA 5CEXB 1JZ8A 3T1WA 1HINH 3S3PA 1NGYA 1SYSB 4JPWL 4I9WE 1XIWC 1FV1B 2QTEA 2OK0L 3DX7A 2F53B 3IRPX 4MCYB 3DX6A 4H1LB 2GHWB 1M05B 1ZSDA 3CH1B 4R4BB 5DEGB 5CLTA 1HHKB 3P3YA 1FH5H 2BXZA 2DMCA 4FFVD 4Z7UA 5DJDA 5HHOE 1U3HA 2MFNA 2PO6D 2AXJA 5C6WH 2VXSL 4GRWH 4HZLA 5FUOL 1OAKH 3QIUC 4OQTA 3EFFB 5FKAA 3O41A 3HMWL 2ZNXA 3BD4A 4BSJA 1R0AL 3O8XC 5EZJA 2ID5A 5DRZB 5LGJB 2BVTA 1CK0H 3BMVA 1G9NC 1XGQB 2X7LA 5J11B 3RWFA 5I1DB 1WCBB 2DM4A 2YD6A 1HEZB 2H8PB 4HJJH 2FIKB 4WHYG 1CFTB 5IM7B 3G5YB 3EZJB 3VWKC 4TSBH 5EULV 2P24A 4NQCA 1T0NB 3JV5A 4JN1L 5CJQH 3GSOA 4WHCA 5FGBC 1FO0B 3EJYC 1A2YB 3NFNA 1A14H 3BEWA 4ZXBC 2GIYA 3V4VL 3DGGB 3BJLA 1HH6A 2VXTL 3WNMA 5C0AD 4G42A 1DBAH 4OD2A 1CLOL 3CNKA 3QUMB 3FN0L 5F21B 1EHAA 5DJZA 3DX9A 1P53A 4JPVL 3S37X 1LK3L 3WFZA 4WUUB 2H2PD 1U8NA 1KXQE 3O45A 4OTXH 3RVVC 2AK4E 4YHPB 5F6IB 5D7JD 2QQQA 4QTIL 2LABA 1V3LA 4DZBB 1I8IB 1G7PA 4AEIH 5GGSA 1XH3B 1KB9J 1I9JH 3BKJL 5CIPH 1VGEL 3KPOB 2X9WA 2CLZB 5CCKL 2EDBA 4KKBC 3ZKSD 3DRQB 5LGHH 1HSAB 1HYSC 3BXNA 5IMMB 1MWAL 1L4IA 5JNYB 3MRJA 4P9MH 1ND0A 4LGPB 2XQBL 1QYGH 1QR1A 3GSXB 1MCBA 5JORA 4JFFA 3MRNA 1S78D 4W70A 2JJTC 2FRGP 2IFFH 4HIIA 4CDHA 3D5OF 4FQLH 4OIBA 3KPQB 3Q0HA 1BBDL 3ULUE 4B7LA 4L1DA 4NN7C 5K9JL 3PQYB 4A6YH 4JRXE 4LGRB 4M7JH 4GW5B 1JPTL 5EFIB 5TJWK 4P23C 1QQDB 5F1IA 2Z93A 2YN3A 1QD0A 1IARB 2PNDA 4XP5L 2YA2A 4MXWH 1D5IL 1EFXD 1VB9A 1A6UL 1OAXL 4IS6B 4NHCH 4KK6D 2O26U 1U58A 4IRSD 4V1DA 1UM5L 1JHLH 5DI8A 4C4KT 2CIIA 3EO1B 5IR1A 1JUFB 4K7PY 4MA7H 2QKIB 3DVGA 4P5MA 5SWZA 3W0WB 1TCRA 4ZTOL 3HPLA 4X80H 4JDVB 5TE4L 3UC0H 1UXSA 2JK5A 1F8TL 1RIHH 4ZUWB 2J6EL 1AD9A 3KPMA 1VFAA 4GUPA 5GPRA 1HXMA 2E7LC 5HY9B 2R9HC 1EMTL 1CG9B 1VHPA 4M00A 2B2XL 4N9GA 3DSFL 2OQJB 4O4YL 3MCLL 1KACB 3BP4B 1NFIA 1RIUL 2XWBA 4S1QL 4NO0A 2VYRE 2XTJC 4H1LH 1MQ8A 4LLVA 4M6MH 4MNQE 4YE4L 5DHVA 1JTTA 2HVJA 2H1PH 3O6ML 2I9TA 4NKOA 3ZHDA 1T20B 3PHOA 5E2TH 3ZDZE 3EYQC 5DK2B 2IGFH 5C09D 4FXGA 5E6ZA 2K1MA 1D9KB 3MBEC 4NKIL 5AG9A 1I8KB 1NLBL 1VPOH 4W81A 3H9ZA 4GRMA 1I1RA 4O9HL 2ENYA 1J7VR 4GXUM 3T09A 4MSWA 5B8CC 2QADC 4XX1E 4LBEB 3JWOH 5FYLD 1NC4B 4XNQB 1U95B 1IZJA 1XFPA 4NWTH 2CQVA 2WM0A 3VXUE 4Y5VB 3IXAA 5KVGH 3SDYL 1QFWI 4K71C 4HFWB 3FZUC 5DF0A 4JHWL 4FQXA 2DWDA 1VA9A 5EUOE 1BQLH 1I1FA 1LMKA 3QO0B 3S35L 1FO0H 5KZCD 4WEMB 5EU6A 4QT5A 1B4JH 1BBJA 3UTZA 1PFCA 3PGFH 1QLRA 1U6AH 3ULVH 5I1GL 1LWRA 2SEBA 1MNUH 5FO8B 1BAFH 3QUMH 1DL7L 4KVNL 1MFEH 3LS5H 2Y6SC 3GSUB 4PYGA 3EKCA 4OT1L 4U6XA 4P46C 3U79A 4BQBA 1I7TA 4KROB 2C3VA 4WVRA 3OBAA 3LKOB 5E08L 3T0DA 1RZFH 3CFEB 2Z31C 1XGRA 5EBWB 3IS1X 3ESVF 4APQC 1K8IA 1D5ZA 4X4YB 1YEIH 1T21B 3IU4L 7FABL 4OZHA 3L1OH 1H3TA 5E6IB 2NY5C 1BM3L 2ICWB 4PG2C 2AK4B 2JE8A 2WK2A 1KLGA 4JM2A 4WTWA 3VXMA 3P4MA 5D7LA 4PRHB 1A8JH 1Z9LA 2CMRH 3B5TA 5JQ6L 5CAYB 1KN2H 3LY6A 4U6YA 4CADB 1SBBA 4LOUD 4ODVH 5D1ZC 2Y5TA 1S7VB 5I1EH 4XPAL 2XN9A 1A7PL 3WEXB 5E24E 3UZVB 2Z92B 4ZUUB 1UB5B 2JB6B 4WJ5A 2VISA 5F9OH 4EXKA 4PRID 5D7IF 1NCUA 1Z9MA 1YMHA 3NA9H 4ZD3L 4NNXB 3FMGL 25C8L 3QI9C 3TV3L 3EOAB 2VLLB 3MMEB 1A1MB 2DL9A 5K9KA 5HHQA 4JRXB 4NZDA 3BE1L 4LSVH 2YMXL 2DKSA 4UTBH 1S9KC 1MRDL 4O51B 1LHZA 3FHAA 1ES0A 3QBTB 3CLFH 4QNPE 3VXRE 1U8HB 4P4KA 4P3CL 4YXKH 3T2NL 4MAYC 2F5BL 1QP1A 2XACC 4OCXH 5SX4H 2BC4B 1U3HD 3GSWB 4CW1A 2ENSA 5B38B 1AQDA 3AU1B 4AEEA 4GSDH 1QOKA 4HPOH 1AKJA 1WC7A 4HUVA 1U91B 2X42A 1HI6B 4LLYB 2WIIB 3MXVH 2UUDK 4UNUA 2HRPL 5GHWH 3H42H 1R24B 3HC0B 2APVA 4H25A 4MLIA 5HTSA 2G9HB 4OD1H 3H9SE 4GG8B 5DMIH 3R4DA 4U1NB 1JNLL 1H5BC 4LEXL 2G60H 3O2DA 4RQQA 4HC1A 2O5ZL 4HH9B 3CC5A 3DOSA 4OAWA 3HCVA 5C0JB 3LKNB 1V3JA 1S9VB 1HILA 3BWAB 3QUZB 4AL8L 3WL9A 1NPUA 3OGOE 4Z7NE 2A1WH 1IFHL 2DQJL 2AXFA 2OX5A 3RWIA 4AENB 5I15H 3TIEA 1W0YT 5FO7B 1YY8B 4Q9RL 3LH2H 1KXVC 4MNQB 4YDVB 1E4JA 1H8SA 3P4NA 2UVEA 4WO4B 2VWEC 1A7NH 4HFUH 1N5AB 1SJHA 2VAAA 1YEEL 2H2SC 3NGBC 1RIVL 4JRYA 4O58H 3VCLB 5AYQA 3H6JA 3Q2CA 3U9UA 1M1SA 4U6VL 1ZE3C 2FH8A 5D7KD 3ARDC 4YPGA 3T4AA 5F97E 1T1YA 4WI7A 3D85B 3T0XA 3VXUB 1NC2A 3QWRA 3AXLA 4MQXC 4Y16B 5FYLL 4G43B 4AIZB 4U1LA 5EUOB 5DYOA 4H5SA 4P2RE 1E6OL 1M7DA 4WUKH 1CLCA 1Q9KB 3MJ8B 3PWNB 1WBYA 2V5SA 5IVOA 5I1LB 5FOBB 2ESVE 1D7FA 4OCWH 4JZJB 4ODWB 1YNLH 1I1YA 1YN7A 1WZ1L 4PJDA 3CX5J 1NANH 1HKLL 4UOJA 3THML 1A1OA 3MNZB 1BMGA 3MZGB 4HULB 2Z35A 5EOQH 5DS8B 1TPXB 1HHHA 4FMFA 4LFHG 2YR3A 4HT1H 4Y5XA 2HFFB 3WN5C 4YBQD 2P8PB 3ARQA 4IM8A 1ZMYA 5EZOL 8CGTA 4CVXB 1LEIB 2ZJSH 3TWCL 1B0RA 3VGBA 1EGJH 5BO1L 3MGAA 4N8VG 2NY5L 2NX5E 3BN9C 3MJ9L 1NCBL 3S4SB 4YHML 1T22B 4NBYB 1TLKA 1Q9LA 3QA3A 1GGCH 1S3KL 3Q5TA 1NSNH 4N8VA 4F15B 2DWEA 5DT1L 3T4YA 1OSPL 3ULUH 3FB8B 4YGVA 4R4NC 4XMLH 3RVXD 4PJFE 3JWOC 1CU4L 3RBGA 4PRPA 4RFOL 4KH2A 5K59F 4GKSB 3ULSA 1TJGH 1BFVH 3PABB 2OR9H 2IBZX 1BZ9B 3OR6A 4DUWA 3SGEH 5DJCB 3BIBX 1VSCA 5MENE 3T65B 3AFLA 2ARJQ 4DVBB 4YDIL 3U46A 4XBEH 3VXRB 1CGSL 3SOBH 4MNHB 3ULVC 1HOCB 4OCRH 3NZHH 3F6IA 4Q9QL 1HWGB 4JFPB 2AKRA 1OD9A 1BQHG 3V0VA 2IAMB 5CJQL 5D2LA 4FQXD 1LO0H 3L6FB 3NCMA 4FG6C 1A14L 1WTLA 5F6IC 3RZCB 2JELH 1QFUH 2J4WL 2IANE 4PD4J 5C0BE 1G7HB 5EU6D 2R23A 2E9BA 3H9SB 3KGRA 1DBAL 4LLUB 2P44B 4PR5A 1IKFL 4OZGF 4H8WH 4HDIA 1Y18B 4G8FB 3GMPB 1AP2A 3LSOB 2FATH 2AJYL 2ITCB 1Z0NA 4CMMA 1YMME 3BUYA 3BESR 1JWMA 1NCAH 3R8QA 4WU7B 2NNAB 3QHFH 3PWUB 2NXYD 2D9CA 3JV6B 1GOFA 3A6BH 4GAGH 1TNMA 2EYTB 4AEIL 3R0MA 1FZMA 3E3QE 3GMQB 1YDPB 2G75A 4J4PC 2HJLB 3DHJA 3HA0A 1IGCL 1T7ZA 3KPSE 2DQUH 4X7SH 4P99A 1DVFB 2OI9B 5AWNH 2IBBA 4TUJB 4P9ML 3UZQA 3ETBF 3W39B 2OMBA 3K2UL 1QFPA 4JM2D 4NKDA 5TDNA 2IFFL 2J8UA 5I73B 4FQLL 2BOCA 5D7LD 2ICES 1ZTXL 2WWKO 3CUPA 5ACMA 1RJLB 2N7AA 3RVWD 1UGNA 4ZFZB 3V6BR 3WIFB 3QPXH 2Q7YB 4I0KA 4TSCH 4B41A 4I3SH 1V7NH 2XN9D 2V9TA 5HHNB 1C16B 3MR9B 4GLRI 1MH5A 2B1HH 1HHJA 4NJAH 3WE6A 2CRIA 4X5WA 4BK4A 4PLNC 2HH0H 3IDJB 3ARBA 3STBA 2DQHH 4KKAD 2WWKT 1LEGA 4P2RB 5IMKB 5F6HJ 2GT9A 2LFGA 5JA8B 2R0ZH 3SKJH 4DVRH 2X6MA 3ZLQC 5E2WH 2VDPH 2QSTA 3O4OB 3QNXA 2ESVB 4P5TA 3IS0X 4K8RH 1JHLL 4P48A 2QLVB 1INEL 1DBBL 4X80L 2HLAB 2V2XB 1YEHL 3UC0L 5MERA 5DO2D 1P7KB 3EJZC 3VD5A 1KTKE 5DQJA 3QFDB 3NABH 3TO2B 2PW2A 2ADFH 43CAB 5C71A 1RFDH 4K9EL 3G6JA 1OB1A 2ZSVB 3MROB 1AKJD 2X40A 5JXAH 1ROWA 1JPSH 1P7QA 3W9EB 2OL3H 2I60H 3QR2A 3CXHJ 1F6FB 1MEXL 5KTEL 2WAHA 4MD4A 1D9KC 3G9VA 1JWSB 1MFCL 1NBZB 4R2GD 2J5LB 1JCKA 5J6GB 5KVEH 2B0SL 5DMYA 4LAQH 3QQ9C 1HH9B 2NX5B 3U9PH 5KS9F 5FUZL 2R1YB 3RNQA 3D48R 4L8DB 2HT2D 5I74B 2EXYD 2NY1B 2VDRH 3K46A 3GI8H 3MX0A 4Y5VC 1X44A 2IGFL 4X4XB 4G3YH 1JF6A 5DGRA 3RWDB 4PGEB 3CU1A 3B43A 1WAAF 2G5BA 5BV7L 1MF2H 4Q6IA 2NY7H 2DI8A 4PGCB 3JWOL 4PIRF 1UM4H 5JOFA 3CVIH 4MGXA 4NWTL 3CD4A 1HK6A 2XT1B 5TFSH 1KTLB 1VACA 2DQEH 3QB7C 4N0CC 4AYFA 3GHBL 5HHMD 1B90A 3X12B 3JWNC 4JRYD 2WNGA 4EOWH 4KTYA 4HX1B 3C5ZA 2Z8VC 4KUCD 4KROC 5IB5B 3QCVH 3WS3A 1O5DT 2FZ3B 3R8BB 4XP9L 3RWHA 1WGOA 4P2QA 4NZTL 5BQ7B 3ULVL 1MNUL 1QFWL 4R26H 4EN3B 1NC2D 3MLZH 1BAFL 2BMKB 4ZPVA 3BRDA 3IJHB 4X7TB 3MRPA 5E6IC 3LS5L 1K3ZA 4CDGC 1RURH 1S7QA 1XZ0B 5F7FA 5L9DH 1KIRB 4Z7UF 4LHUB 3SKNA 1IEHA 2IANB 5C0BB 4N1EA 5GS0D 1F90H 3S96B 1RZFL 5I8OL 1YEFL 5I2IA 2UVFA 3OPZH 3QO1A 3O6FA 1GXEA 3MV9B 4YWGH 1IAOB 1OW0C 3QRGL 5IJKC 4OZ4A 1RD6A 4QHMB 4UAOB 5IESH 4YX2H 2C1PB 1JP5A 1YMMB 1CICB 3CVHL 1I9IH 3LB6D 9CGTA 5HXMA 3K1KC 2HT4D 3WXVH 4RRPG 5FA3B 2PR4H