1EZVX

Structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
EVKLQESGAGLVQPSQSLSLTCSVTGYSITSGYYWNWIRLFPGNKLEWVGYISNVGDNNYNPSLKDRLSITRDTSKNQFFLKLNSVTTEDTATYYCARSEYYSVTGYAMDYWGQGTTVTVSSAWRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ezvX00
2ZUUA 4J8RA 4P2RA 4K3HA 4I0PB 4JFZH 1NMBL 3BIKA 5E6ZA 4M43L 4N5UA 4BQBA 5JR1H 4G7YL 1X5ZA 2GCYB 5F9WB 4N9OB 3PHQB 1FQ9C 5H37G 5GSVA 5BS0A 5JXAH 4UBDD 5F9OH 3KLHD 1UM6H 2OTPA 3B9KB 4P2OC 5DQJB 4ZFOB 4E42A 1K3IA 3BD5A 2GK0A 2VMFA 4QHUB 2J2ZA 2X09A 2IQ9L 5C0GB 3CFIC 5DYOB 3E0GA 4GRWH 5CEXB 2IQAB 1C5DB 3AS0A 3LB6D 1QSEE 4WWKA 3V4VH 1U8IA 3DX7A 4JPWH 1UM5H 5FYJU 2Z8SA 3OQ3B 4L4VB 4I0PA 2ESVE 1B88A 4KTDH 2FX9H 4LPUA 3EJZD 4WENB 1YEGH 3U4AA 3WIHA 3OAUH 3QEQE 3GBNL 3RWEB 2GCYA 3GJFK 3PHQA 2MOVA 3MV8E 3JV0A 4OFYD 1IGIL 4LPVA 1NUNB 3B9KA 4NM8H 5DQJA 4U7SA 3K74B 4ZFOA 5GISH 3N1GC 3WHXB 4NWTL 1T89C 2IH1B 2A6DB 5CGYD 4QHUA 1JUFB 4HMCA 1NMAL 3ZE0E 5C0GA 5DYOA 5EC1B 5CEXA 1ZT1B 4XP1L 1C5DA 2K1MA 2VH5L 1MRFL 3D5OF 4NC1E 1FLRH 1MF2L 4OCYH 5J1SC 4OF5A 2Z8VC 3AC0A 4OLWH 3Q3GB 4DGVL 1UGNA 3RWEA 4KJPD 5IK3B 1W72B 3WV0A 2FCBA 4XAWH 3WHXA 4RAVB 3FHQA 3X11B 2A6DA 1JUFA 2DBJA 5F7EL 4KK9D 1FRGL 2VZUA 5EC1A 4HLZH 5CJBA 1ZT1A 2BZDA 2E9IA 3LZFH 3BE1H 4HD9A 4OZ4B 1A4KB 3OJMB 2HJFB 1TXKA 3Q3GA 4U0RC 4M5ZL 3GUTB 2EDYA 2ZUSA 4KXZH 1OGAB 1W72A 4XHQA 5LCVH 1T3FB 2O5XH 3TWCH 4NQVB 3WMSA 4EEEA 4RAVA 3X11A 1NEZB 4BYHA 4KMTH 4CU6A 4NC2B 1X5AA 3PQYD 4ENED 3MXVL 3UZEA 1MVFA 5DI8B 4OZ4A 4YE4H 1A4KA 2HJFA 4XVTH 3PXHA 1QQDB 1NL0L 3ARBB 5GRYA 3S3JA 1UZ8B 2ZUTA 4WEBH 2QQNH 1M7DB 1MWAH 4LLUA 4P2RE 1FGVH 4N9GB 2WUBL 4LOUD 4WTWA 1YY9D 1LP9B 4H8WL 4HFUH 3BSZH 3QIWD 1JGVL 3TM6A 1SBSH 4ONFL 3PABB 4JRYB 4HIXH 5T3ZD 5BS0E 4LCIH 2NY3C 4NQVA 1OP3K 4ODVL 1BBDH 1C8PA 1G7PB 1SYVA 3GIZL 1CIDA 1D9KD 4HWEL 5EBMA 3BWUC 5JW4M 1KB5H 3OKDB 4JY4B 1CXLA 1FYTB 4X6CF 4XP9H 1KB9J 5DI8A 2BNQD 1KN2L 2BSSB 1QQDA 3ARBA 2DMKA 3BRGC 1UZ8A 4N0CC 1M7DA 1WZ1L 2FGWH 2GYSA 4N9GA 4S10A 4GW1B 1LP9A 2X10A 1KLUB 2WNGA 4NFBA 1JFQL 3N0PB 2W60A 2A83B 3B8SA 5DWUL 3MROB 2XKSA 5IMLB 4G8IA 1G7PA 2WWKT 1E4KC 4U1LB 1AR1C 3OKDA 4OLXL 4JY4A 4OD3L 1FYTA 3RGVC 5I1CL 5C0AB 2BSSA 4HJJH 5M95B 1S9XB 1OTTC 4XP5H 1J9CT 4EN3C 2LVEA 4L4VE 4Q9BA 1W0WB 4GW1A 4KDTA 4HUXB 1AQKH 1KLUA 1JBJA 1HQRB 2Y72A 2X9YA 2DQHL 3K8LA 5SWZB 2A83A 3BZDA 3MROA 1BREA 3UJJL 3G6DH 3KPQB 5TQ2H 3OKYA 4KK8C 5IMLA 1OD9A 3TBSA 3K8MA 1KJ2A 4KK5C 2B20A 3FQNA 1T03L 4U1LA 1S5HB 3QUYB 9CGTA 3B83A 1F58L 2PYFB 3A6BH 5EA0H 2XY2A 32C2B 1MHHB 3DXAD 4XNUH 2D0HA 3JV4B 4ZAKD 3S36L 1WWBX 3TPKA 1S9XA 1J05B 1H0DB 1QSFB 1ZT4B 2NY0D 5F7WC 3ZDZF 1EZVY 5JHLH 2F54B 3MJ8B 2GQHA 1JRHI 3NFPB 1W0WA 4QT5B 3VG9B 4HUXA 1I9RH 1HQRA 2E6PA 1FDLL 3HUJF 4Z5RB 3ULUH 5SWZA 2BDNH 4K3DL 12E8H 3KPQA 5AD0B 2PF6A 4PS4L 5DK0B 5I1KH 3MFFB 1CLZL 4P59L 3LPFA 3MLXH 1H3GA 4NWUH 4GRMA 4QXUH 1S5HA 3QUYA 4L8SC 3QO0B 5EU5B 2PYFA 2DTML 1BIHA 4YC2B 2X4RB 32C2A 3JV4A 4JO1H 5SWSD 1J05A 1H0DA 2CDEB 1QSFA 4NN5C 1MJ7L 1ZT4A 2DQFB 4WHTB 4D9QD 1T66C 2XN9B 1UB6B 2WUCL 3MJ8A 4XCCH 3QR2A 3NFPA 4QT5A 3ZKND 4LIQH 2VE6B 4Z5RA 2VZ1A 2ZCHH 5HHOD 4LBEB 4JPVL 1OGAE 1E6JH 3TN0D 2LV4A 5AD0A 3IAPA 5DK0A 1DDHB 3JVGA 1T2XA 3MFFA 2DQIL 4X6FB 1RUKH 1S7RA 3T2OA 4GMTL 3VGAC 3QO0A 4CVUA 5EU5A 4QF1B 3CK0H 4POZD 1BVKB 2X4RA 4QKXB 4RDQG 4R7DB 3O0RL 1D3CA 4WHTA 4FTVB 2DQFA 4QOKB 2XN9A 1UB6A 2EXYD 1WFTA 2GITB 4IDJH 2VE6A 2KH2B 4LAQH 2VDPL 1LP9E 4WI8A 2HFGL 4YIQB 1DDHA 1T1YB 2AQ3A 3CDGB 2DQUH 2LU4A 4JRYE 1K8DB 4HHAB 3VG0L 1XF3A 4X6FA 4YHPB 1XR8B 4QF1A 1BVKA 1FYTE 3GHBH 1N6VA 4R7DA 4EBQH 3AXLB 4U7KA 4CU7A 4FTVA 3JTSB 2F9BT 2P5ED 1P9MA 1R24B 2FYYB 4CMMA 5D7SL 3QQ3B 2GITA 4WEUD 1EHXA 4PJBB 3SCMB 3C5JB 4IM8A 2BOBB 5T3XD 3KYAA 3LEXB 1T1YA 4FXKB 1K8DA 2R0ZL 3MBEC 4HHAA 1I9EA 3I84A 1I75A 4YHPA 3VXSD 1XR8A 2X1PA 3G5YB 3SDAB 2C1PA 1YECL 4Q0XH 2BCKB 2W9LA 1S78C 3AXLA 4PJ9D 5C0AE 4X9BA 5IBTH 1Q0YH 3JTSA 2X5PA 1YNTB 5KVMC 1R24A 2FYYA 4P4KC 3T0EC 3EJJX 3SJVD 3U4EB 2JJUA 4PJBA 3SCMA 1BF8A 2NXZC 3WFCL 1HOCB 1H3PL 3C5JA 4FQ2H 5ALCL 3IGAB 5DRWB 4GKZB 1QYGH 1T4KB 4Y89A 5SWZE 3MRPB 4FXKA 4WV1B 1WFNA 4G6AC 1ETZB 2IGFH 3MV7D 3UJTH 4G43A 3QZWB 5F96L 1LEKB 3UPRA 3G5YA 4G5ZL 5IMOB 4Y4FD 3SDAA 4ELKB 1J1PL 4NO0A 4YJZL 4OIBA 1NGPH 3QQ9C 4JQXC 3GMPA 4UMGA 1DE4A 5C2UB 3HE7D 4PJGB 1I1CA 4YDLC 5I66B 5J06A 1QSFE 1QEWB 4BFIB 1FIGH 5IW6B 1QKZL 3U4EA 1A5FH 2F54E 2GT9B 2I60L 3N06B 4ZPVB 1HOCA 1RZKH 4R9HA 3QDJB 3IGAA 5DRWA 4GKZA 1T4KA 1NGZB 4WV1A 3VH8G 3QDHA 1ETZA 4PJ7B 5EDXA 2BJML 3MA7A 4JZJB 4PJFF 3ARPA 4NHUA 3WO3B 3QZWA 4P9ML 1SM3L 1LEKA 1GC1H 4Y2DD 2XZCL 3ESUF 5DZLA 1A7OL 1SY6A 3R06B 2DRUA 1KCUL 3UDWC 4XCFH 4PJGA 4XVJL 1ORQA 5I66A 2W07A 1QEWA 4BFIA 8CGTA 3DIFB 1L0XA 3HTLX 1MEXH 4HWUA 4MCZB 4OZGB 5IW6A 2XN9E 5GGVL 5IFJB 2FH8A 1MFAH 4ZPVA 1ZA6B 3QIBB 4JKWA 5L2JB 3QDJA 1I1AC 2NW2B 1NCCH 4J4PA 4MAYB 1JGDB 5E2WH 4PJ7A 5HTSA 5DVLA 3GMNB 4JZJA 4PRID 3QUMH 1C16A 1H5BC 1DQLL 1KCKA 1A64A 4GXVL 1F2XK 4XWGH 1MCHA 4YHOH 3R06A 3VD4A 3U0PA 5A43C 4JLRB 1RMFL 2A6IB 3DGCR 3QPXL 4EI5B 1MFCL 5ITBH 4P5MA 3BKML 1BEYH 4FTVE 3DIFA 4QOKE 4HLZG 4MCZA 4OZGA 4M7KH 3K4ZA 1NFIB 3I2CL 1ZA6A 3QIBA 4KQ4H 3FONB 4UIMB 5L2JA 4S1RL 2NW2A 3OAZK 5DHYB 5E6IC 5BRZB 1EDQA 5ICZB 4WRLA 5F3BB 1JGDA 3UTPE 4R97B 1VFBA 4JJ5A 1G9ML 4MA8H 3UROR 1I3GH 4XB7A 3VWKB 5CCKL 1OAQH 2FB4L 3GM0A 2B5IB 3RIFK 4UZGA 3HA0A 4JLRA 2DMBA 4NM4L 3UYPA 3VFPB 5IKCA 4P5TB 2A6IA 2PO6C 1A6VH 1MOEA 1ZHBB 3ZTJH 5I8KH 3MLYL 4YHZL 1NFIA 3FONA 4UIMA 4PJBE 1F6AB 5DHYA 2JK5B 5BRZA 2OR9L 1KEML 5ICZA 5F3BA 1G0YR 3WJLC 3IU4H 5CD3B 1YY8B 1K5NB 2EXWD 4OIAA 2ADGB 1Y6KR 1O5DT 3H2WA 4FN0A 3SE8H 5E70A 4JB9H 4FFVC 3VWKA 1X4XA 4OJFL 1TPXB 1B90A 3WSQH 4I2XB 3VFPA 4P5TA 4XPFH 5L7XH 1ZHBA 5T5NF 5GRXG 3MODH 4ALAH 5DD3H 1Q9WA 4DJMA 4KKBC 3MRCB 1F6AA 2JK5A 2RHEA 5SX4I 5E8OB 2QADB 4FFZH 4ZD3H 4EOWL 4U49A 5CD3A 1F90H 3CD4A 4LMQE 1RSFA 1YY8A 1K5NA 4TUOB 3SN6N 2ADGA 3MYJB 2XKNB 2XQYK 1CXEA 4L8DB 2L7UA 5BS0D 5E94B 3KPPA 3NACH 4LHQB 1FSKC 4I2XA 4P99A 1A9BB 5IR1A 4PJGE 1D6EB 5GS1B 4DGYL 3MRCA 4P46B 1OVZA 2P24B 4R8WH 4WWKD 5AUMB 5LBSH 3QDJE 4ZNEA 5JOPE 2ADFH 1YEDB 1TJGH 4LSSH 4PGZA 4TUOA 3MYJA 4PJ7E 2VDLH 4OM0H 3LPWA 5DD1H 2KKQA 2XKNA 4ERSL 4L8DA 2AK1L 4XGZB 3HZYB 3B9KD 4PLKC 1XGYH 1A9BA 5CJOL 5EUOB 1OW0A 2ZJSL 3OPZH 4NBZB 4LCWD 5C2BL 1JV5B 3SY0B 1Q38A 2APVA 1NSNL 5CD5D 1VADB 1XMWA 3PL6C 5GGRY 1D6EA 4OZGE 4P3WA 4P46A 3W2DH 4L8CB 5AUMA 4M9OA 4K07A 4NNPL 1HH9A 3CVHB 3V0WH 3WKMH 2H2SD 4I3RH 2C26A 3ILPB 1E27B 3UX9B 3UPAA 1O7SA 4LSTL 2YN5A 1E6OH 5F9JB 1YEKH 1RJLB 3ARZA 1D5IH 1J1XH 1I8LC 5EUOA 4BQ8A 2FR4A 3OJ2C 5FUOH 3QP3A 1KN4L 3ZE0F 1CD0A 1OAYH 7CGTA 1C1EH 1JV5A 3SY0A 3B3IB 1VADA 5DURD 5ADPH 1GPOH 4LDLB 5EFIA 4EI6B 5EPMB 5FHAH 3O81A 4L8CA 2AK4E 3K1DA 3MLVH 2HKHL 1RK1A 4I9WE 1V5JA 5AZ2H 4KRPC 1DLFH 5BRZE 1HHIB 4KPHL 3RPKA 3CVHA 1IT9L 1MQKL 4LPTA 4YX2H 5C6WH 2E6QA 1CU4L 4R26H 3CLFH 3ILPA 3QUKB 1E27A 1H15B 3QIUA 4WJ5B 3QSKB 4ZO9A 5F9JA 2WAHA 4PGEB 2I26N 1RJLA 5JMOC 2NXYC 3D0VB 4X83A 4APQB 1X5FA 3GBLA 1UZ6E 3Q1SH 1U2CA 4M48H 2PYEB 1GIGL 5BV7B 5D7JB 3B3IA 3KYKH 2YRPA 1JP5A 3MJ9A 3S6CA 3TBTB 1NUFA 3WD5L 2Y25A 4EI6A 5EPMA 2IBZY 1ZEAL 3TA3B 1HSAA 3H9HB 1YQVL 1RVFL 1HHIA 1UH3A 4GRLB 2F58L 1OWWA 3DRQB 1X7QB 3PGFH 1XCTA 3RJQB 3WYRA 3QUKA 2DQDH 3KPTA 1H15A 4WJ5A 1Q0XL 3T0XA 2YPVH 5BZDB 1AE6H 2ZUWA 1KTRL 2BY2A 3O9WA 4JDTH 2CLVB 3RY5A 1UWXH 1S7XA 4H20L 4MAUL 4PGEA 3D0VA 3GBMH 1GXEA 3U7WH 3B5HA 1J1OL 4I2XE 2NY4C 1EMTH 2PYEA 4GBXB 4K8RH 1KV3A 5D7JA 4X7EC 3TBTA 4S1SH 4L1DA 1CTNA 5FDYA 1A14L 3H9HA 3ARBD 1QFWI 4GRLA 1BAFL 3CZJA 4QRRD 2MMXA 3DRQA 1X7QA 4ZNEE 4W4OA 5C09D 5DUMH 4DKFH 5E56A 1N64H 5BZDA 3UCRA 1MCWW 1X5LA 1T2QL 2CLVA 1IQWL 3H6JA 3MTRA 2HA1A 3WEXA 2DKMA 5LXGH 4UNVA 4GBXA 5CS7A 3DSNA 3LEVH 4GS7C 3OGCB 4GLRI 3SDXB 4JQIH 3DUHA 5HPMB 4U1SB 3C5ZC 1AFVL 5EOCH 4PBXA 1TETL 2E27H 3C6LB 5CWSB 3LKQB 3RY6A 2VKWA 4K7PY 3KS0J 1KGCE 2VC2H 3RX5A 2IAMD 1J88A 3SDCC 3W81A 3EZJB 2EDLA 4ZXBD 3AFLA 3RDTC 1P7KA 5HI4C 1RIVL 2MWCA 2FIKB 4U6TA 2ZUQC 3ZKXC 3CFCL 4PV9B 5I1DB 3R1GL 5D1QA 3QRGH 1FNGA 4P4RB 1H8OA 4JY5L 3BKJL 4U1GC 5EUOE 4LARH 2X9WA 3IFLL 3OGCA 3SDXA 1HI6B 2JJTC 4OF6A 4FNLH 5HPMA 3QXTA 3FT4B 4U1SA 4AEFA 4F33B 1TQCC 5ACZB 3C6LA 5D71L 1JMXA 3EO9H 3ULVH 1FL5B 1NKRA 1UQSB 1NGXB 2FEEI 3MLWH 3CDYA 1YPZB 1ZOXA 3LIZL 5SV4A 4NN6C 2FIKA 5CAYB 4PV9A 5I1DA 5CEZH 1I8MB 4WWID 1F6LL 4P4RA 4IS6B 4I0PC 1EHLL 3VFMB 5DJXB 4X9FA 1U91B 3BJLA 3F6LA 1FE8L 2UZIH 1Z9LA 5F9WC 1HI6A 3RWDA 1NC2B 4GQ9H 4NRYB 3FT4A 2R2CA 5E4IA 1CE1L 1H3VA 5EU3B 1QLEH 1UQSA 2NZ9C 1NGXA 5HHNB 3Q5YA 5JDSA 4M7JH 5D1XD 3EOAA 3GSNB 5IJKA 4JFHE 4JO2H 4Y4HB 2HN7B 4N1CA 4HXBL 5TPWL 1MRFH 4UT9H 1I8MA 2EDKA 4PUBL 2L4OA 1GL4B 4IS6A 1FFRA 4KRLB 3VFMA 3GK8L 4HG4K 1U91A 1YEEH 3KGRA 2PYEE 3TLRA 4EXPX 4JDVB 3DGGB 1NC2A 3TJHD 5KW9H 1A3RH 3DO7B 3TBVB 2CRYA 2W9EL 4B53A 3BPNB 4NO3B 5EU3A 4PB9L 3SKJL 4RRPG 4NQDB 5DJYB 2XRAH 5HHNA 4S1QL 4RZCB 2QSQA 3GSNA 3AROA 4Y4HA 4IIQA 2FECI 2HN7A 5C3LD 4XBEH 3A67L 2W65B 2Z91B 3L3IB 2IPKB 2IPTL 5DMJB 2WMPA 35C8H 3KPSB 5D70L 4J12A 2CR6A 3VGGA 1PLGL 3O11B 5IW3A 4YDKL 3SGEH 4M5ZH 4NRXB 4TSAL 3VFWB 3SE4C 4JDVA 1F45A 5TDNB 3DGGA 4J6RL 3DX8B 4BZYA 3BYTA 3HZMB 4G6MH 4K9EL 4CBPA 5KOVC 3T0AA 4CDHA 2KL6A 4KI5E 3ZTJG 3V4PL 4FTVD 2EECA 4NQDA 5DJYA 5FA4B 4RZCA 5E9DD 1N5YL 1XAUA 1LP9F 3P30H 3CDFA 2VAAA 2W65A 2Z91A 3L3IA 2IPKA 1I3UA 4ODXB 3KPSA 4OCLC 3O11A 2RIKA 2GY7B 4D0BA 3JZ7A 2WUBH 2H32A 4GT7A 2QSCL 3VFWA 2Q8BL 3V5DB 5TDNA 4D9RE 1KPUB 3S8WA 3SDXE 4DFIA 5DO2D 3V6ZB 4UV4H 3RAJL 5AWNL 3VXRB 3CUPB 1WCBB 1BQSA 5JW4Q 3JWDH 4YGVA 3GIZH 5FA4A 4XCNB 1HSBB 5HDOA 4XNYL 1QFHA 1MCCA 5KVGH 2AQ1A 1JNNH 2EIZB 5F1SA 2BVQB 4ODXA 4ZTPH 3IS1X 2E8ZA 2V2WA 4FP8L 2F8OA 5EO0B 1EHNA 1RURH 2A74B 4NO0D 5J8OA 1BWWA 4X8XA 2Y7QA 3V6ZA 3VXRA 3CUPA 1DBBH 4XCNA 1CS6A 4OD3H 1YPZE 4K23L 5GXBB 2BVQA 3VXQB 1OSPH 3O4OC 3FO9B 5EO0A 1FYHB 4F57H 1RIUL 3IDMA 5CHNB 3VXUD 4L3ED 3DMMD 1F4XH 4Y5XC 1XEDA 1UC6A 2A74A 2CKBH 3QDAA 5K9QI 3BH8B 3F5WB 4L3CB 1PSKH 5LQBH 3NGBB 4UV7L 1KCVH 1IAII 4XMKL 2OQJB 3MLUH 1P7QB 2EZ0C 4ZUWB 4Y4KB 3VXQA 4YFLI 1JGLL 3S36H 1ZS8B 3FO9A 3EYFB 2Q1EA 1YZZA 3K0WA 5JHDB 2ITCB 2IANB 2VZOA 4LCYA 3SOBL 5CJXA 5HD8C 5CHNA 1U3JA 1FDLH 2Y6SD 5L6YL 2NY2C 4KKLD 3SQOH 4K3DH 5C0JB 2OJEB 3MRGB 1FFPB 4HIHB 3F5WA 4L3CA 4POYA 1DBKH 2X7LA 3RVVC 1CLZH 4OI8A 3ARDC 2EDDA 4NQDE 4XC3L 2OQJA 1VACB 3QIBD 1P7QA 3MXWH 3EUUA 4U1MB 1HYSD 4ZUWA 4ZG1A 4Y4KA 3LMJL 3BPLC 2VLKD 3LH2L 3BKCL 2UVFA 4AEHH 1ZS8A 2CJUL 2R1WB 1KULA 3KPSE 1MJ7H 5JHDA 2IANA 2EEDA 1JPGB 3S3PA 1CFTA 4JHWH 4PRPB 5F8RC 1N5AA 1RJZB 2M2DA 3H42L 4OF7A 5C0JA 4JPVH 2OJEA 1JIBA 3MRGA 4HIHA 4JR9L 4EDWL 3OKOA 1NANH 2BY1A 3JVGC 3OR7B 2ZNWA 3DV4B 3ETBF 2Q87A 1PY9A 4O5LH 1A7RL 4U1IB 5IESL 3SDYL 4GMTH 1VACA 4UT7L 2EDQA 3HAEA 3HNTH 4I9WD 4U1MA 4YC2C 3STZA 3GRWL 1EERB 43C9B 2E8YA 3QAZB 4Q97A 2R1WA 2YMXL 5IJVB 1JPGA 3MACL 3N1QC 1JHKH 1HINL 4PRPA 1IGFL 3LS4L 1WWAX 3O6KL 2UY6A 1RJZA 1NCWH 2VDPH 1N7MH 2R29L 4F37F 4U6YB 4HSQA 4P5TD 3OR7A 1IGTB 3DV4A 3CAFA 1RZFL 1EUTA 4U1IA 5F7HA 3VXRE 3D48R 4ODBD 3K1KC 3DRTB 3KLDA 5D9SB 3KYNB 4PJBF 4FABL 3WJJC 1GAFL 1CR9H 1AKJD 3DETC 43C9A 3KLSA 1WC7A 5JW3H 3PJSB 4Z7OE 1DR9A 5JZ7C 4N68A 1GGIL 1NAMH 2GSGB 5JIKA 5IJVA 5IB5B 4LEXH 1P9MC 3CDCA 1GGBL 1CFVL 5D7SH 4LSQL 4BUGA 2UUDH 3ME0A 3BQUA 3NAAH 2B4CL 4WW2B 2UWEE 5DUPL 3ABZA 3Q0HA 4TULH 5EBWB 3C09C 1BQUA 5I1IL 1IGTA 2YS4A 3C8DA 2R23B 3CFKB 4PGDB 3DRTA 5D9SA 3KYNA 1FZMB 4ODSL 3TBYB 1ZWIB 5IG7B 1DVFC 4ZFZB 5TGBB 1ORSB 1FBIL 2FX8H 1A1NB 2APTA 2GSGA 2HT3D 4YK4B 5EO9B 5IB5A 2VDOH 3UMTA 3V52H 1F4AA 2AJXH 3GMOB 1V7ML 25C8L 3B2VH 5CJQH 1H3PH 1WLHA 4WW2A 4C4KT 3VDCA 5F8QC 2BVEA 2OXHA 4ODWB 4PJGF 5DS8B 5D93C 5TQ0L 3LD8C 2R23A 3IDYC 4PR5B 5D6DA 4PGDA 2ADIA 2VXVH 4LVNB 5F96H 1FZMA 1QFPA 4KRMB 2VXUL 1OM3L 1ZWIA 3DHJA 4F3FB 5IG7A 3SDAC 2HH0L 1QP1A 4ZFZA 5TGBA 2VUYA 1ORSA 3MRIA 1OPGL 4U2YA 5HYSG 1N0LA 4LSVH 4PJ7F 5EO9A 5HHXH 5IB2A 3WFHA 5JHDE 2EDFA 3S35X 3GMOA 2IANE 2EO9A 4DCQB 5J13B 3D9AH 5CBAB 1GZPB 2J4WH 3WUWG 1F97A 1QVOB 3VFUB 5F7YC 1JZ6A 1CDUA 3G5VA 4NSKB 5F7FA 1LE9B 2R1XB 4QRTB 4ODWA 5DS8A 1CI5A 4PR5A 1R3LB 2GTWA 4OZGF 4TNVK 4JEGB 4P9MH 1P1ZB 3B9AA 3U7YH 1QR4A 1S3KL 3EJYC 4S1DD 5I30L 2EH7L 2RB8A 3MOQA 2YA1A 2Y23A 4JM4L 2A1WH 2RBLA 2Z93B 5C6TL 5GGVH 2OL3H 3QIUD 4DCQA 5GZOD 4PRPE 5CBAA 4G8GD 4YDIL 1QOKA 3VFUA 1V7NL 4NSKA 1B4JL 1LE9A 2R1XA 4QRTA 4FZEH 4PD4K 2XWTB 4YFEA 3RX8A 4DVRL 3G6JB 3MC0A 2H3NB 4JZJC 4O4YH 3P0VL 1P1ZA 4TSCH 4MCYA 1DQLH 4YXKH 4YHNB 5HYIA 3NFSL 4KAQL 2YWZA 2VRAA 3QPXH 3U48A 5EOQH 3BKMH 2Z93A 4JZNB 3S37L 3WLWD 4WFFE 4ZUTB 1IKFL 1KELL 2EH8L 5C07B 1CD8A 3O9WD 4S1RH 5GIRA 3WNKA 3Q6GH 1UZ6F 2MJWA 1Q9LA 2A9MH 4MAYC 1AC0A 4MJ2A 1OAZH 4UBDC 1P4BL 2XWTA 2UVEA 1HYRC 3G6JA 4XBPB 3RI5K 2H3NA 1AGEA 3VD5A 4UUJB 4YBHA 3ESVF 4YHNA 5C0FB 2XOTA 1NC4D 2BHZA 4NGHL 4FQJH 3H7BB 2R9HD 2DS4A 4NM4H 2QHRH 1PDKA 1KYOK 4EI5C 3T0WA 1K9TA 1IGML 4JZNA 3KLAB 5IWLA 4LAJH 3MLYH 4ZUTA 5C07A 3MCKB 4U31A 4KK6D 5EIVA 3GJFB 3KPMA 5BCAA 2W0PA 4FXGA 4BZ1L 4HKXA 5MERA 2G2RB 1U3HB 4R97C 5HJ3B 4GBXD 4LP4A 4XBPA 3UZQA 2D0GA 3MA9L 4L4JA 4UUJA 1Y18B 5C0CD 3HLAB 3V6BR 3U9PL 1A7NH 2AEWA 2B5IC 4X7SH 5C0FA 3H7BA 3CXHJ 3NZHH 4OJFH 5DD0H 5EZIL 5I8OH 5A2LH 1JZ3A 1T22B 2JF1A 4O58L 1B9ZA 3MCKA 2ZZUT 4TVPH 3GJFA 1CD1B 3ULUD 5D1QD 4JZOB 5FYJE 3UO1L 1QLFB 4PG9B 1U3HA 4Q6IB 3MLSL 5HJ3A 2P1YA 4NKIL 4PP1C 3W5MA 4WGWB 5MEQB 3L9RB 5TE7H 1Y18A 5DJ6A 3HLAA 1HK6A 4LLDB 3RHWK 2NTSP 2VISB 2LAGB 1DQDH 3OJDA 4LNRB 3SPVB 2FBJH 3FO2B 1T22A 4LK4A 5EORH 5DJDB 2AERT 3TT3H 4MD5B 5CUSH 5F89B 1TZGH 4P9HH 4DGYH 3O45B 4C56B 5L2KB 4KHTL 1CD1A 3O2DL 2QADC 2YRLA 4JZOA 1QLFA 4PG9A 4Q6IA 5EUOF 4UI2A 3QJHB 1FJ1B 2VDML 3L9RA 2VITB 2PXYD 4K9EC 4LLDA 2VISA 4HEME 1KCSL 4ENEC 4LNRA 3SPVA 3FO2A 5CJOH 1EV2E 1OW0C 5DJDA 1CLYH 1A4JB 5C2BH 4OLUH 3MPCA 5F3HB 1NSNH 2H6PB 4NZTL 5GS1C 1BQHA 1VHPA 5F89A 4P46C 4M5YL 3QHFL 3O45A 4C56A 3QXUA 5L2KA 2UUDK 5I6XC 3AS1A 3WS6A 5CP7A 3U9UB 4E9LA 3QJHA 5MEND 4E41B 1FJ1A 1XGQB 3BD4A 3G6JE 4G6KL 5FYLE 2VITA 5EU6A 2NY1D 1P53A 1A8JH 1WIUA 3GJEB 5T33H 3T3ME 4LSTH 3MRJA 4YHLH 4JANB 2X4NB 1HWHB 4PY8I 1KN4H 3QO1B 3P0YH 4KWUA 3INUL 5F3HA 4LSUH 2H6PA 5EG6C 3HG1B 1OCWH 2X4OA 5A2FA 5C07E 3MV11 1UM4H 2OP4H 3FB7B 3U9UA 3KPNB 1WBZB 2VOTA 2D3VA 3QNYB 4ZTOL 5HHVH 4LRNL 3HS0B 5KSVB 4E41A 1HILB 1XGQA 2YD8A 1DANU 3ARYA 3GJEA 3CLEH 2AAVA 4RCAA 1SEBB 2E3VA 2X4NA 5F1OB 1WFOA 5JOEA 4QYOB 1IM9D 2D4DA 1OAUH 5INCA 3T8XB 3SO5A 5IUSA 3QO1A 2E7LA 4KY1L 4PJ5D 3L5XL 4Y5YC 3UBXB 3V6OA 2QSTA 3HG1A 1QNZL 1ZEAH 3HRPA 4KQ3H 1WBZA 3KPNA 2Y07L 3FB6A 3QNYA 3PGDB 2F58H 3HS0A 5KSVA 5HYJD 1JF5A 2V17L 4M6OL 1HILA 4S0TD 4N1EA 5DHXB 2WK2A 3N1MC 1R5IB 4DK3A 4KI5F 1S9VA 5I71C 2ZP0T 4MAUH 4GAFB 4QYOA 4PLNC 3QUZD 4APQC 4ZAKC 5D2NA 4WDIB 3C60D 3UTTD 2E9JA 5D7JC 1K85A 1WTGT 1WZLA 1WIPA 3E2HC 3UBXA 3BPCB 3F58L 4JM2B 2R56L 1CDYA 2V6HA 3QEHB 3TA3C 1DBML 5HDQH 3QI9D 5CLWA 1IGCH 1F3DH 5JW5B 2VZVA 3VXOB 4F7CB 1OAXH 4GRLC 5CGMA 4WO4B 2F8XC 3PGDA 1FZOB 3M8OL 2EE2A 1FORL 4BK5A 2ZUVA 3I3EA 1CGUA 1VA9A 3LQMA 1R5IA 4UQ2B 3GSRA 3SDXF 1AXTH 4Y19B 1T2QH 1IQWH 3X3FH 4MA7H 5IB3B 1XR9A 1A0QH 1FAKT 2OR7A 5KSAB 3WIFB 1XF5B 1LHZA 4D3CL 1Y6NR 2P46B 3NCMA 4JM2A 1RUPL 3RRQA 3THMH 4KI5C 1PVHA 4L4TD 1AJ7L 4QNPE 2MQ0A 2DB8A 4C56E 5L2KE 5JW5A 4F7CA 3PDDA 4G3YH 1YQ2A 5DEZA 4WO4A 1FZOA 3RY4A 3ZHDA 1DFBH 4RX4A 4XB8A 2AKRB 4UQ2A 2VDRL 3KJ6L 3PXJA 1KPRB 5DK2B 4Y19A 1CK0L 3MLZH 3D6GA 3VRLE 5IB3A 5HVHB 5K9KB 3BEWB 1JZ7A 1JPTL 2CGRH 4OZIB 5HGBB 4JGUA 3WIFA 1T21B 3BKJH 5ICXB 5C0NC 1XF5A 5ESAB 4DAGL 5MEPB 1YPZF 3FL7A 3IFLH 5L8JB 3MBXH 5HSFA 3VH8B 2EIBA 5E8DL 3OX8A 3GHEL 4YFDB 4OZHB 5A16B 5DGRA 5TF0A 3QUXD 3HMXH 3C6LC 3JWOL 4XNZB 1KBGH 5JNYB 5FYKD 1OGTB 1LILA 4GAGH 4E41E 4FQIL 2AKRA 1LNUB 1WEJH 2NY6B 1KPRA 5DK2A 5GZNC 4HF5H 2VDQH 1NBYA 1KTLB 4N8CH 4KKCC 5K9KA 3BEWA 4OZFH 4OZIA 2G60L 5HGBA 2YD6A 4AT6B 4F58L 3OR6B 3LPGA 5ESAA 1LK3L 1FO0L 5MEPA 3P4OA 1MI5D 4MQXD 4Y16D 4KROB 4DN3H 1FE8H 5CBEA 3HRZB 3VH8A 4MA1C 3HG1E 1E4XL 1OAKH 5A16A 4ODHL 4NUJB 5B21A 4LDOB 2A38A 5IHUL 5JHDD 1T7XA 5JNYA 4XWOC 4HZLA 1A3LL 2H9GB 1OGTA 5E2UH 4OIIH 5FECB 3FB5B 3PGCB 2B4CC 4NQXB 1LNUA 1XGRB 3OF6A 3V4UH 2VXQH 4F7PA 3ARFB 1KTLA 4XTRC 4HQQL 2GTZA 4XX1G 3IJHB 1JL8A 1MHEA 1CXIA 1DBJL 4BFEA 2CH8A 2V9QA 3IDGA 3OR6A 5D7IB 5FCUL 1JTPA 1MCOH 1AR2A 4UB0H 5BW7C 3HRZA 5I2IB 1QTYT 3TCXA 4A6YB 1P84K 4NUJA 1JGUL 2ARWA 2V5SA 3R8QA 3O2VH 5IEKB 3EO1B 3ZLQC 4RGMB 4UDUB 1X5HA 3SGEI 2DM7A 1V3JA 2H9GA 4PRPD 2AJSH 5FECA 3FB5A 3PGCA 1YDPB 5CP3A 4HC1L 1ZANH 4NQXA 1XGRA 4MD4B 1RJYA 3A67H 5GGRB 3ARFA 3IJHA 4Y4FC 2WBJA 1U36A 4OCMC 3QWRA 5D7IA 1ZHKA 1RUAH 1MCFA 2J6EA 3EDDA 3MV9B 4HIEB 4YDKH 4PJXB 1D6VH 4J6RH 4OGZA 5I2IA 4PJ8D 1VFMA 5EO1B 2AJVH 4A6YA 2N4IA 4DKAA 1FL3B 3BPNC 5B38G 3EO1A 5ILTL 5IEKA 4UDUA 1UWEL 4WFFD 3BDYH 2HWZH 3BQUD 1YDPA 3S4SG 1A7QH 4XAKD 4MD4A 4ETYA 4M9PA 4KUCF 5GGRA 4X4YB 4HG4J 1IC5L 4Y19E 4PP2B 4RFEB 3SO3B 2HG5B 4XRCA 4Q2ZB 1WWCA 3UTQA 3O8XB 3TT1L 5HBBA 4TSBL 5T3ZH 1NGWA 1F4HA 2J12B 2V2XB 3MV9A 2E7HA 3OTTA 4HIEA 4DZ8B 5AYUL 4Z7OF 5KVFH 3MUGA 3CFJA 2XICA 1I7RB 1FL3A 4W68A 2FRGP 5DJ8B 3RAJH 5JA8B 4IRJD 2RFXA 2AEQL 2MHAB 2WIMA 3ZSSA 4I18A 1WT5C 3SGDH 3JUZA 3O2WH 4R7NB 4NZDA 5GGVY 1UVQB 3JUYA 2OBGA 4X4YA 3F65A 4M61B 4LF3B 1HQ4B 4PP2A 4RFEA 2HG5A 4Q2ZA 1UJ3C 3O8XA 4KVNL 4FP8H 4YHMH 3OZ9H 4OZIE 2DJUA 3AREB 3MLTB 1MNUH 4DZ8A 1SMAA 5DMGD 4O9HH 1MSPA 2CIIB 4FFYL 2W59A 3CVIL 3ES6A 5DJ8A 3RZCB 4OZHE 1UA6H 1GJIA 4QHNA 2MHAA 5J1TC 5F7KC 3C08H 1KUMA 2XA3A 1G7HB 4JPIB 4HK3J 4X8JB 4PG2C 3H3KA 4XPGL 1CL7L 1UVQA 2XA8H 3QHZH 4XPHL 3S37X 5J3HC 1X9QA 4LF3A 1HQ4A 2F74B 1NBVH 5ANMB 3QXDB 4W4NA 3RTQA 1F6FB 1OSZB 1SY6L 3AREA 3MLTA 1F00I 3H9SD 2MFNA 5CZXC 2GY5A 1NCDH 3G6AB 4OBRA 2AI0H 4HEPG 4D9LL 4OD1L 4H88H 2EKSB 2H26B 4GG8B 2CIIA 4OTXL 4PRAB 2HRPH 3QXAB 4PGCB 1MFBH 3RZCA 4PY8J 3QFJD 2RCSL 3EHBD 4QRPD 3M17A 1WCQA 5D96C 1KCLA 1G7HA 3IXAB 3PP4L 3O41B 3PWJB 4JPIA 1IBGL 1IL1B 3C9NB 1G1CA 4NZJA 2AXGB 2EXWC 1R3IH 4MJ5B 2OR8A 3WN5B 3O3AB 4RIRA 1ZLUK 2F74A 1EBAA 2YD5A 1Q8MA 3CMOL 4M62H 5HVWA 1JGLH 3QXDA 5ANMA 5ALBL 1PZUB 2P7TB 4LP5A 5ISZD 1OSZA 1XGUB 2V5YA 2FHCA 3I9GL 1Z3GH 3QNXB 1DZBA 2ED8A 1AI1L 4K8RD 3G6AA 4LCCB 5D7IE 3AGVA 3MJ7B 4JPKH 5HPOA 5L6YH 2EKSA 4GG8A 4J3XA 4PRAA 5C7XL 3QXAA 4PGCA 4PJAB 4IRSC 4QXGL 1LDPL 2EDOA 5CSBA 3IB4A 3IXAA 1I7UB 3O41A 3PWJA 4NUGH 2AXHA 1IL1A 1MPAH 3C9NA 3MRDB 2AXGA 5I17B 5IVZB 2A77L 4MJ5A 3WN5A 3O3AA 3V0AC 5D7LB 3LMJH 1NANI 3AVEA 1IMHC 3VWJA 2P7TA 2R4RL 3RL2B 2V2TB 4RQQB 4DUWA 3QNXA 1NLDL 1EVUA 2WBKA 1UCBH 2HT4C 4LCCA 4G9DB 2YOCA 3MJ7A 3MV9E 5CGTA 1M7IB 4P2OB 4JCLA 3BKYL 1PG7L 3H42H 4H0IA 1X5GA 4PJXE 5AAMA 3N9GH 4KZDH 4PJAA 3RIAF 4JR9H 5I74C 4WFEE 3U46B 2X40A 1YUHA 2EC9T 3NH7L 5B8CC 1EEUA 2D7QA 1I7UA 4WFGE 4MLIA 3MRDA 3SDYH 5C07D 5I17A 2JB5H 1KIPB 4UT7H 4JO3L 1EIBA 5D7LA 5FXCH 5JR1L 4PJCB 3DUSB 3RL2A 4B0MM 1TLKA 5KTEH 1KOAA 5JXAL 1HINH 1UM6L 2N56A 3LS4H 4G9DA 1M7IA 4WUKH 3O6KH 3QXWA 4P2OA 5EOCJ 1DL7H 5DD6B 3WLBB 3TO4B 5E0QA 4U4BA 3Q5OA 3IFPB 3DX6B 4P57B 5F1KC 3F7PC 1T6VN 3EIFA 1YC7A 3U46A 3ULVD 5ESQB 1A7PH 1RZFH 2CD0A 4TUJB 3V4VL 2NY5H 2A2QT 3QJFB 4JPWL 2BHUA 1UM5L 4ZS6C 1KIPA 2H2SC 4WW2F 4G6FB 2BXYA 4XP4H 2FX9L 4GW4A 3LN4B 3SEPA 1YEGL 2FEEL 3QAZC 4NZRL 1PKOA 3L1OH 4PJCA 5CEZD 3DUSA 3OAUL 5T3XH 4HWNA 2IFFL 4FMKA 4NM8L 4Q58C 5GISL 4ZFGH 2VZ3A 3WLBA 4YBQD 1QBAA 3DX6A 3IFPA 2IPUG 4QWWC 4LCUB 5GGUB 5ESQA 2GJ6B 3V5HB 4TUJA 5KJRH 3D18B 1CICB 3QJFA 1FLRL 4Z18A 4JFEB 4NRZB 1Z0MA 1YA5A 1OTUD 4OLEA 1LEIB 4K3JH 3TCLB 1FNHA 1TVDA 4OLWL 4U0RB 1FBIH 4N0FB 4Y8DC 3JV5A 3EYSH 1ADQA 1N4XH 1NH6A 3BPOB 5ANME 5C0BB 5DEGB 4DKEH 5HGGS 5BOZG 4Z8FH 25C8H 3E3QE 4XAWL 4AYFA 4L5FH 4WW2C 5B22A 3TNMB 4AM0B 3DVNA 5C71A 2R4SH 4LCUA 1U6AL 4PFEA 5GGUA 5TQ0H 3GMMB 3V5HA 2VB5A 3D18A 3BE1L 5D6DC 2DLFH 1J8HD 2AP2A 4JFEA 4NRZA 3ALXA 2VXUH 3TCLA 2HLFC 5L2KD 1F11B 3T1FB 4N0FA 4XMPH 1ACYH 1K8IB 3U0TB 5C0BA 1AHWB 1G7JB 2NLJA 3A0OA 3KPLB 3QRGL 1J87A 4C55A 3K80A 1T6WA 3TWCL 5EU6D 3HC0B 3GNML 2NY3B 2W92A 5HHMB 5C8JB 3TNMA 4AM0A 4OZFG 5GPRA 4KMTL 4GKSB 1YYML 4PJAE 3GO1L 3GSVB 4JY6A 3CFBA 5EZJB 4LVNC 4XVTL 3V7AG 4WU7B 3BZFB 3T0VA 2A9NH 1K3ZA 2QQNL 1F11A 2XYCA 1MWAL 2OXGA 3ECBB 4MJ4A 3T1FA 1FGVL 1S3KH 2JTDA 2IH3B 1PEZA 3U0TA 1K8IA 2VLME 3I6GA 5D7LE 2EH7H 4HFUL 1AHWA 1G7JA 1SBSL 3KPLA 3G6JF 4GH7B 4WI6A 3EFFA 5I73B 2JIXB 2PETA 1OHQA 3C87A 5J13C 3T3MF 5B4MC 3BIBX 4LCIL 5C8JA 2DKSA 1V7NH 1KB5L 1B4JH 4M6NH 3GSVA 4M02A 4XP9L 3VXNB 3RGVB 4BSWA 5EZJA 3FRPG 2IAMC 3P0VH 3BZFA 4WU7A 4ZXBC 1AXIB 3BGMB 5FIEA 1L9MA 3EDKA 4M7LL 2IH3A 3L5JA 3LKRB 1V3MA 1G7MB 4PJCE 2JIXA 2VQTA 3CCHB 2F5AH 2Q20A 1IKFH 4U6HB 1KELH 4MGXA 3ZSTA 2EH8H 3LKPB 5A3IC 1KACB 1U92B 1S8DB 1E4KA 3L3KB 2NYYC 5C3TA 2O26U 3T3PE 4FFWC 3HE6B 1RY7B 1P4BH 3GEWB 3DARA 1DN2A 2ZNXA 3RGVA 4Y2OA 4HJJL 3K3QA 4FG6D 3NIFE 4MNGB 3BGMA 5DC0A 4EN3A 2Z8WC 3JWOC 3SDDD 1AQKL 4X7FC 1G7MA 3TH4T 5JIPA 1IGMH 1U8MB 3G6DL 3CCHA 5TH2B 5TQ2L 3B5GA 1H3XA 3BDXA 4U6HA 3LKPA 4PD4J 4XCYB 1U92A 5I1AB 1S8DA 4ONHB 3Q5TA 3L3KA 3FMGL 2A6KB 2DM3A 3HE6A 2XZAH 3A6BL 3EYQC 1J0YA 4XNUL 1FLTX 4BUHA 2GJ6E 3MA9H 1KENL 4LLQB 2D03H 3O4LB 4EQ2A 3OAYK 4MNGA 1MFNA 4JFEE 4KKAD 3U36B 1G6RH 3H3BC 5JHLL 3VD9A 4MJIB 1SYSB 1EZVX 4RMVA 1I9RL 3F7VA 3OKKB 3NCEB 3WBDA 1HXYB 3ULUL 2BDNL 5C0BE 12E8L 4RX4D 2IJ0C 2AJYH 4J3VA 2Y36H 5I1KL 3T2PA 2B2XH 2XWJB 4XCYA 5I1AA 5DFVC 4ONHA 4Y19D 3MLXL 1AP2B 4HAFA 4NWUL 4QXUL 1U3HC 1I1YB 1YMMD 2R2EB 2JJSC 4M8QB 3M07A 4HPYH 5T1KB 3D3VD 4JO1L 4LLQA 5LGKA 3O4LA 4QNPF 1KYOJ 2VTFA 4XCCL 4MJIA 1SYSA 1MRCL 4LIQL 3OKKA 1G84A 4NBXB 1HXYA 5GGSY 1FAIH 5GGTL 1EO7A 2XWJA 3VRLF 4UINH 1AP2A 5HHME 1RUKL 1RUQL 4PYGA 3WIHH 1WVZA 3ORJA 2R2EA 2JELH 3CK0L 2G5RA 3AMLA 2DDQL 1CGWA 1DEDA 2EE3A 4M8QA 5T1KA 4HULB 4I4WB 2WIIB 5I18H 2OI9B 4X6BB 2N7AA 3MR9B 1FH5H 3MFGB 5TJWK 1KCSH 1NGYB 4IDJL 4LAQL 5F9DC 1Y6MR 3CXDH 3Q2CA 2DQUL 4NZTH 4MJ6B 3MBEB 2NY6D 1BF2A 3OF6D 3QHFH 4XI5C 3L95B 1G6VK 3WS6C 4WFHD 1EEYB 5DO2C 3UAJD 5E1AB 3DJ9A 4EBQL 1T5XB 1QRNB 5JW4N 5JPNB 3EOBB 1GZQB 5DRXB 4X6BA 3MR9A 1NGYA 5DA4A 3T0EB 3IYLW 4YXHH 2NXZB 2XTJD 3CNKA 2XY1A 3J8F7 1WQVT 4OCNC 3GMLB 1BZ7B 4Z7NE 4MJ6A 3MBEA 1SHMA 3L95A 3FHAA 4TOYH 3MSPA 4EUPG 4DQOH 3RVTC 1I9IH 5IFAL 5FGCB 2WBJD 3CX2A 1W72H 3EOYG 3IDNB 3QBTB 1EEYA 4LRNH 5E1AA 4JFFA 1O7VA 1ROWA 2GJJA 4Q0XL 1T5XA 1QRNA 5JPNA 3EOBA 5DRXA 2BVUA 2W91A 3E6FB 2DQEL 1Q0YL 5IBTL 3BW9A 4MNGE 1E4WL 2YXFA 4P4KA 4CU8A 3T0EA 3D2UA 3CSYA 3H8NA 3UTSA 1I1RA 1DLHB 4PB0H 4FQ2L 1YN6B 4RGOH 3GMLA 3MOAH 1BZ7A 2F53D 3L5XH 3ARGB 4XNQA 3S88H 2IGFL 3D39B 1QNZH 4MA3B 4OLVL 3UJTL 4N8PA 1JPST 5SV3A 4ZPTA 2Y07H 4KV5E 3IDNA 2IALB 1XT5A 3GSUB 3MV9D 4RGNB 1DUYB 4JQXA 3AB0C 1CDCA 4JM2F 3E6FA 5DT1H 2ZOKA 4F7TA 3O4LE 4RMSA 1FIGL 3D87B 1A5FL 2JCCB 1DLHA 1A6UH 4K7FB 2MQ3A 4MJIE 1RZKL 1YN6A 3U6RB 2HMID 4PPTA 5J1AB 1I1AB 4JQVA 5LAXB 2AV7B 3TH3T 3JTTB 3ARGA 1ZTXH 3D39A 4MA3A 2E7BA 4CADB 1VB9A 1EO5A 3VCLB 3QDGD 5M7QA 2NY7L 1H5BB 5INDB 2IALA 2R0LH 3GSUA 4JO4H 3S5LB 5BOPA 3ZO0A 1DUYA 1ZA3B 3FFCA 1YNLH 5IVNA 4XCFL 4RMWA 1G7QB 2ZOLB 2HTLD 1MEXL 2I5YL 2J8UB 1FNAA 1HYSC 5I76B 2JCCA 4C54A 1MFAL 3U6RA 1JWSB 1OT2A 4Q74A 1I1AA 5LAXA 2AV7A 1NCCL 1NLBL 3I6LE 5T5NG 3JTTA 2OM5A 3O3EA 4E5XB 1T7WA 1RUPH 4RMTA 1Q94A 5ADOH 3VCLA 3RTQD 1ZE3C 1IAKB 2OSLB 3QUML 4OZIF 1H5BA 3QEGH 1M71B 3L5WB 5INDA 2YWYA 3S5LA 1DQMH 4XWGL 2XKUA 4YHOL 1OB1A 1KJ2H 3QQNA 2VDRH 2PO6B 2Z31D 1G7QA 3LOWA 4JKPH 2ZOLA 1A2YB 3GZKA 1TENA 3PDOB 4OZHF 3JWNC 1CK0H 4OLYH 3MGAA 2J8UA 4M7KL 1JPTH 1VPOH 3R0NA 4P23B 4KQ4L 5KSAC 1JI2A 1JWSA 4NQEB 4DAGH 5E6IA 3WUWB 4NNXB 4J3WA 4E5XA 5KVEH 4LLVB 5FYKL 4G8EB 5DR5H 4MA8L 1IAKA 1INEH 2OSLA 1I3GL 1M71A 1HHGB 1OAQL 3ARXA 3QEUA 3RUGB 3VXTB 5IVOA 5FM5M 2FLRT 4WY7H 4FQIH 3EAKA 1MRDL 2PO6A 1QRNE 1A6VL 3WXWH 1A2YA 4MXQC 5ELIA 3PDOA 5I8KL 1BFOA 3BX7C 2QL1A 3T0EE 4P23A 2G60H 3WDJA 4YHYC 4P3CH 4NQEA 1AXSB 4Y1AD 1MELA 3P3YA 1U8NB 4NNXA 1JWMB 4ZUVB 2Q8AH 4U05A 3IU4L 4LLVA 3LKSB 1C08A 3VWJD 2CUIA 4JB9L 1S9WB 3TVMB 5D7IF 2FDBP 4W81A 5FGCE 3UC0H 1CFSA 3RUGA 1A47A 3GSWB 3UTZB 3VXTA 1ULVA 2P5WE 1F4WH 3WSQL 1CYGA 3KR3H 4OGAD 1R6VA 4XPFL 1URLA 5ID1B 3NPZB 4R3SB 4LLMB 3MODL 1UACH 4IMLB 5CLTA 4ALAL 5DD3L 1DBJH 2YUXA 1VGKB 5EULV 4CN1A 1AXSA 4F15B 4QXWA 3IAGC 2EICA 3IETB 1U8NA 5LWYH 3FN0L 4ZD3L 2LU7A 4ZUVA 1VEPA 4AG4H 1F90L 4C58B 5KZCD 3LKSA 1XGPB 3FQXB 4MXVE 5D7LD 3VXMB 3D39E 1JGUH 3P9LB 4HH8A 4N8VG 5A40E 4DKDC 1S9WA 3UTZA 4RFOL 3GSWA 3TO2B 3G9VA 1RZ7H 4YHIA 4L8BB 4RGNE 1JNHB 3I50H 5E8NB 1X6LA 4HC1H 4PJXF 4X0KB 4HUMB 5DMKB 1J10A 3ARFC 5ID1A 2LTQC 4R3SA 1KIRA 4LLMA 4IMLA 5ABDE 2M26A 5F44A 1CF8H 3TP4A 3QB7C 1ZGLP 2JCCE 2ZUXA 5LBSL 3IETA 3PG2A 4OKVB 3IJSB 5JO5B 2ADFL 1PQZB 1TJGL 4YR6B 3FQXA 3W5NA 4LSSL 1GGCH 3VXMA 2VDLL 3P9LA 4OM0L 5DD1L 1CN4A 5ILTH 1AO7A 4RGMC 4WTZG 3TO2A 3GIVB 1BZ9B 2W9DH 4L8BA 1JNHA 5E8NA 5EZOH 1XGYL 4X0KA 5FEBA 1I85C 5DMKA 3OPZL 5IBUG 4XHJC 4PRBB 2GFBA 1VKXB 4HMDA 1CXKA 4MDJB 3PL6A 2J8UE 3W2DL 4TSBH 2KUTA 1P84J 4OKVA 4KRPB 5AYUH 3IJSA 5JO5A 5HHPB 5BMFH 1NMCC 2B7DT 4G6FD 15C8H 1PQZA 2MSPA 4YR6A 3V0WL 1UWGH 1G7IB 3N50A 5E99L 1LK2B 3RWFB 4B7LA 3MRQB 1V05A 1SJEB 1RHFA 4I3RL 4WUUB 3OXRB 2VL5B 1AY1H 2WZPD 2DI7A 5HGDA 3GIVA 1BZ9A 3NCCB 1D5IL 1J1XL 1I8LA 1QSVA 3ZTNH 4NPYB 5FUOL 1OAYL 2V5RA 4PRBA 3H0TB 3QEQB 2CRZA 1VKXA 4HK3N 1GHFL 4MDJA 4PLJC 3SO3C 3W0WB 5ADPL 4LDEB 3O8XC 4OGYL 1T83A 2D0FA 5KOMC 3MLVL 3S35H 3TZVB 5AZ2L 3B2UC 4NQEE 1DLFL 4PJIB 5DVOA 1G7IA 1LK2A 3RWFA 3RIFF 3VGEA 4U1KB 1HNGA 1SJEA 4Z76B 4R26L 4WUUA 3CLFL 4MDIA 3OXRA 4HUKB 3BZEB 2VL5A 1I9JH 4LRIC 3RUGE 1CL7H 2P49B 3FO1B 4IMKC 4NPYA 3Q1SL 2NY4B 3IAQA 3REVB 3H0TA 4Z95L 3QEQA 3KYKL 3W0WA 5DTFB 3P2TA 2EC9U 4ZDHB 1SY6H 5HDLA 3TZVA 4YFLF 3K2MC 1QRKA 2C3VB 2W38A 1VFAB 3TBWB 2NX5E 4PJIA 4D9LH 2DQCH 4PRHB 4OD1H 2V9RA 3PGFL 1INQB 4U1KA 1JE6A 3ZKMD 2DQDL 2ZCKH 3SHSA 3BZEA 2YPVL 1AE6L 4JDTL 3HZVB 1D5XB 4NQSB 2NY3D 4PBVC 1JYXA 3GBML 2SEBB 3U7WL 3FO1A 4LHUB 4M4PA 1EMTL 3REVA 2DYPB 4PJAF 4K8RL 5T1LB 4QHKI 2E9WA 4HT1L 1FV1B 4S1SL 4GS7B 3FQWB 4ZDHA 3RBSA 1JK8B 3E3QC 4MNQD 2C3VA 3DVGA 1VFAA 1LO2H 2IG2H 3TBWA 4N0CD 4LQFL 3VA2C 4KMQA 3OWEA 1INQA 3VJ6B 1CDBA 4LSDA 5DUML 5C0EA 1FFNB 1FIEA 3RDTB 5KAQF 3QHTC 3VXME 4DKFL 1N64L 1LDPH 1X5YA 2JIXD 3HZVA 2ZUQB 4Q9CA 3ZE1E 1D5XA 4NQSA 3RKPA 4LHUA 3WN5C 5DQDH 2DYPA 4U1GB 4AMKH 4JHBA 5T1LA 1XIWB 3LEVL 2BOCB 5GRJH 1S5IH 3UYOD 1AGDB 1UCTA 1FV1A 2R4RH 4ZSOB 3FQWA 1MCJA 1UEMA 4JQIL 3RGVD 3OB8A 5CILL 1OTTD 2EEBA 2J1KA 4NCC1 5CMAB 3AUVA 3Q48A 3P0GB 3BKYH 4F7EA 2VC2L 3FFDB 1F3DJ 1PG7H 3GB7A 4EN3D 3VJ6A 5TFSH 1FFNA 4PJCF 1PFCA 3RDTA 4WU5B 3DLQR 1UEYA 3KHOA 4DWHA 3NH7H 2LE9A 4NN6B 3BMWA 4KK8D 3B9VA 1F4YH 1MJJB 1RUML 2OK0H 4KK5D 4JO3H 4LARL 2XZZA 4OFDA 3T3PF 2PXYC 1XIWA 2BOCA 1U8JB 1AGDA 5GJSH 5J56B 4KC3B 5K33A 2JJTA 1HEZB 5JUEL 3LRGA 4FNLL 4NQCD 2DQGH 3NIFF 4O2EB 4P2QB 1MAKA 4M8VA 3EO9L 3ULVL 1U95B 5E5UB 1B0WA 2VUOA 4V1DB 5F72S 1EEZB 5GGQH 3CSPA 4N90E 4FQCH 2YC1B 3MLWL 3MOBL 2ORBL 2AJUH 3MMEB 1Q9KB 4WU5A 4WUUE 2VYRE 5CEZL 4CVWA 1MJJA 2BSRB 4ORZC 2NY1C 1MCEA 3C2SA 1YEIL 1U8JA 4NZRH 4XVUD 3U30C 2UZIL 1S7UB 4GQ9L 1HEZA 5FOJA 3W0WE 1CDGA 2IFFH 5HVFB 4O2EA 4K3EL 4P2QA 3LKNB 1U95A 1ONQB 5ITFB 4BQ9A 4V1DA 1QLEL 4JVUA 1EEZA 1T66D 4PJIE 3TO4C 1FZJB 2QSVA 2YC1A 3ZMRA 4M7JL 2FO4B 3MMEA 4JO2L 1Q9KA 5DRNB 2IQAA 3VMPA 1IC4L 4UT9L 2HVJB 3W82A 4MZ3A 2BSRA 4L4VA 3FTGB 1J0IA 5F6HI 1YEEL 4Z7VB 3U7AA 3FO0H 2ARJQ 5KW9L 1A3RL 2NCMA 4CGTA 3LKNA 1ONQA 5ITFA 3RL1B 2IH1A 4FRWA 1FZJA 2V7HB 2XRAL 3IS0X 4PRHE 5FUZH 2ITDB 2FO4A 3RWHB 5JXEA 1U6AH 4XBEL 5E7FA 4UT6H 1CICC 3T65B 4HJGB 35C8L 4J1UB 1MAJA 1WWWX 2YD1A 3FTGA 4P2CG 3IJYB 5FKPB 4Z7VA 2GHWB 4RMRA 4J3OC 2O5YH 3SE4A 3BPOC 4KGJA 5IK3A 1OF2B 4G6ML 2X4PB 2OMBA 1QUNA 2GUOB 3H3PL 3EFDH 3VW3H 3GNMH 1SVCP 3RL1A 3ZL4H 2V7HA 4HKZB 4ODUB 2ITDA 1YYMH 3U79A 1RZKC 3P30L 3GO1H 3RWHA 3QI9C 1MCIA 2GIYA 3A6OA 3T65A 4HJGA 2Y9RT 4J1UA 3CVHH 3FKUS 1NBZB 5FM5O 3V8CA 2N1KA 5FKPA 1CWVA 4QTHB 3GUTA 2HJKB 1GC1C 1MCDA 1OGAA 1AHWC 4JFFD 4NCDA 1S9YB 1OF2A 4ZSOE 5LGJB 2X4PA 1CBVL 2GUOA 1T3FA 4UV4L 1X5JA 3JWDL 4CDGC 1BECA 1NEZA 2VLRD 4P4KD 4HKZA 3T0ED 3C5SB 3D2UD 4ODUA 3RU8H 3H9ZA 3UTSD 2XQBL 2NXZD 1U8KB 5KVGL 1EH9A 1JNNL 4TTGA 3PV6B 2DLGA 2FATH 5CZKA 4FQXD 2QJDA 4ZTPL 5DHVB 3O4OB 4G6AD 1YMHB 2YUZA 5F7LB 3VA6A 3MCLL 5EH1A 5I9QB 4NKOB 4I8DA 4M7LH 1RURL 4G9FD 4W6XB 4QTHA 2HJKA 2BVOB 1Q9OB 4I48B 3WCYA 4Y5XB 1C5CH 1S9YA 5LGJA 3DX9B 5F88B 5I73C 3QQ9D 5DK3A 3PABA 4JRYA 3IDXH 1FZKB 1TQBB 5B38B 4P2QE 4EIZC 5BV7H 4V1DE 1DBBL 2FO1A 3C5SA 5HHQB 1U8KA 1ES0B 3QUXC 3PV6A 1LMKA 3BUYB 4MXWL 3OB0K 2HT2C 5DHVA 1OSPL 5DVMA 1YMHA 1EFXD 4F9PA 2BY0A 1H8SA 1QFUH 4F57L 4NKOA 4KV5F 1Q9OA 1F4XL 2APWA 4Y5XA 2QBWA 2NY2B 2QHLA 1B2WH 2YZ1A 2CKBL 3DX9A 5F88A 3MUZ1 4W6YB 2DIAA 2P8PB 3FFCD 5I19H 3V9FA 4ZOEA 4X4XB 1MH5B 1FZKA 2RGSA 1PSKL 5B38A 3BN9C 5LQBL 5DJZB 3FZUD 3ARDB 1PJ9A 1KCVL 4OCXH 1H3WM 3FMGH 3MLUL 4HPOH 4OF0A 4WW1B 3HE6C 2N7BA 1CLCA 5HHQA 4RBPH 1ES0A 3RZWA 4B5EA 5E5MB 1IFHH 4F9LC 3BUYA 3MJ6A 5C0AA 5I75C 1KENH 3BPLB 4QCIB 4HUUB 3SE9L 4U6VH 3EOTH 4ZOAA 3L3GB 4JFDD 4Z7VE 3SQOL 2XWBB 4AIXA 4KGLA 4X4XA 5H8DA 1MH5A 1JI1A 4IRZL 1DBKL 1NFDB 2ZKHH 1R3KB 5DJZA 2Q6WB 3ARDA 3IVKB 5KSBB 4WW1A 1U0QA 3MXWL 2AV1B 1NDGB 5E6ID 5IB1B 5E5MA 1YJDH 1MHHA 2VABB 4AEHL 4HUUA 2ZCLL 4M7ZC 1SVZA 5D6CB 3VE0B 4MB3A 2F54A 5DJ0B 3R8BB 3MUHL 4JHWL 1PX3A 1MRCH 3L3GA 3KPRB 2XWBA 5GGTH 1KJ3H 3QZWG 2PO6D 1NFDA 3LCYA 3H9YA 4O5LL 1R3KA 2Q6WA 4AQOA 4EDXB 4QHKJ 4ZQKB 3IVKA 5KSBA 3D85D 1RUQH 4F8QA 2PR4L 5FM8A 2R0KH 3ALPA 5F1IB 3HNTL 1NDGA 2KPNA 5IB1A 2DDQH 2VABA 5EU7C 4PRDB 4HLJA 4J2XA 2HKFL 4HWBA 2CDEA 4XX1E 1BHGA 4TTDD 5D6CA 3VE0A 5DJ0A 3UEZA 1JHKL 8FABB 1BVLB 1BOGB 3FQTB 4FFVD 1NCWL 4LBEA 5BJTB 1IC7H 3KPRA 1N7ML 1CGSH 2L7JA 4O2FB 2YN3A 1VDGA 4N5EC 3C09B 4G7VL 3HNSH 2JJVA 4EDXA 1NCAH 4ZQKA 3GSOB 5F1IA 3WJJA 5DLML 1CR9L 4HS8H 2I9LB 4JHAL 1DVFB 5JW3L 3DUUB 2Z0BA 2R69H 4PRDA 1IM3B 2OI9C 1NAML 4RISH 4QOKA 1BM3L 4LEXL 2H8PB 1EGJL 1WZKA 8FABA 1BVLA 3NAAL 1BOGA 3FQTA 2GAZB 1JYVA 5BJTA 3BP6B 4YIQA 4TULL 3CDGA 2AABH 5D93B 3LD8B 3IDYB 2B0SL 1QBLH 3GSOA 4NJ9H 5IFAH 2CLZB 4U1HB 1UYWH 2I9LA 2C4FU 3LHPL 1DVFA 1AQDB 3DUUA 3DI3B 2FX8L 1IM3A 4MXVF 2DQEH 4RMUA 2VDOL 2VDKH 2X89D 2H8PA 3KAAA 3V52L 1E4WH 2AJXL 3OG4B 3QQ3A 4IOFC 1AO7D 2VERN 5E24E 3B2VL 2GAZA 5CJQL 2BOBA 4RMQA 1ODAA 3BP6A 4FMFA 4H1LB 5FDWB 3KYOB 3LEXA 4PLKD 4MS8C 1A22B 2H32H 4OLVH 3PWPD 4S0SD 3FT3B 3HPLB 2VXVL 4AEIH 3PL6D 2JCCF 4U1HA 5J11C 3T0BA 4TVPE 2BCKA 3NCJL 4BK4A 2YPLD 4UTBH 4LSVL 1X5IA 5JPMB 5HHXL 1YNTA 3MREB 2H41A 2DWEB 5JQHC 3BGFB 1NJ9B 1LO4H 3D9AL 5H2BB 2VLJD 4YNYB 1F3JB 4JQVC 2J4WL 3GI9L 4O02H 4H1LA 5FDWA 3KYOA 1R3JB 3ARGC 3MRPA 3F7YB 2HTKD 4K8RC 5F6HJ 3QDMB 1NFDE 1ZVSB 3HPLA 2J8UF 2WQ8A 2NY7H 3NPSB 5KSBE 3NABH 3B43A 2X1XR 5IMOA 3U7YL 5CKGA 4ELKA 1H3UA 4RGNC 1LE5B 1QFOA 1FGNL 1X5XA 4R2GC 4TNWK 1KEGH 5D1ZB 4ESKA 5E00B 2CMRH 5CIPB 5JPMA 1P4IH 1TMCB 2A1WL 1JPFB 3MREA 3ISWA 2I5YH 2OL3L 1NJ9A 1D5MB 1QSED 2GT9A 5H2BA 3B9EA 4YNYA 1F3JA 2FIRT 1NLBH 1I3VA 3DVFA 2ESVD 1NGZA 1R3JA 2NXYD 3KPRE 3F7YA 4FZEL 3VMOA 2EDNA 3QDMA 1ZVSA 3QEQD 3P9MB 4O4YL 4MQTB 4TSCL 2A6JB 4CVXB 3MV8D 3EYOB 4YXKL 1IAMA 5IQ7H 2AVGA 3B9DA 1LE5A 1N6QH 1ZHLB 2DWDB 1OLLA 5D1ZA 3VDAA 5E00A 4JG0L 5CIPA 5EOQL 4AL8H 1JPFA 3G04B 3AS2A 5IFJA 1EAJA 2APBA 3CXHK 3DYMA 2BFVL 2AK4B 1J0JA 1B3JA 4XPTH 3RUGF 1HH6B 4H0GA 3CMGA 3Q6GL 4OZFB 4R6UA 2A9ML 4MAYA 1OAZL 5FYKH 1RZJL 3GMNA 3V7MA 3P9MA 3M45A 4ETQB 2YUVA 4CVXA 1VGEH 4YXLH 3EYOA 2D7MA 4WVRA 1ZHLA 2DWDA 4C83B 4FQJL 4HS6B 4QLRA 2QHRL 1MRDH 4EI5A 1E4XI 3MUJA 2CDGB 4HZAA 2AK4A 4P23C 3SKNB 3V6FB 1JRHH 1HH6A 2EDBA 3X12B 1CVSC 1FC1A 2CUMA 4S11A 4Y8AA 4L9LB 4OFYA 3HI6L 1QPXA 4CJ0A 1YNKH 2C3HA 5AG9A 5IBLC 2V9TA 1A7NL 4X7SL 1JF1B 2OZ4L 3C5ZD 4C83A 3NZHL 3MRNB 5GGSB 4HS6A 5DD0L 5I8OL 2FLBT 3NBNA 3SDCD 4X6EB 1YC8A 4XNXH 3HAEH 5HI4D 2LAAA 3SKNA 4TVPL 3ZE1F 3X12A 2P4AB 3FN0H 4P2RD 5IFHH 4L9LA 3LDBC 5TE7L 2LQRA 3TVMC 3FRPA 4XCEB 3I02B 1D5ZB 1CD9B 4RFOH 1DQDL 3PQYB 5GGSA 1VERA 2FBJL 1II4E 5EORL 2VLLB 2BNUB 4X6EA 4XT1C 3UXFA 4I3SH 1J0HA 1I4FB 5C9KA 5GRUH 1F02I 3TT3L 3ROOB 5CUSL 1JNLH 1TZGL 4P9HL 3E8UH 3MGOB 4F15C 3I75B 5E8OA 5I6XB 1G9NH 4TNVF 3QIWB 2PW2B 3VMNA 4H5SB 4I0PD 1N3NB 5A2KH 2WM0A 3QDME 1IKNC 5GJTH 1WAAE 3I02A 1D5ZA 1MCBA 5CZVL 4HUNB 1ZKAA 5E94A 4DEPC 3PQYA 4X5XB 4YDVB 1X3DA 1HZHH 3L6FB 2VLLA 2BNUA 2E6JA 1CLYL 2NZ9D 2DBLH 4OLUL 1I4FA 3ROOA 5JDJA 5GS1A 4QY8B 3MGOA 3HC3H 2P24A 1H3TA 3I75A 2Q7NA 3PF2A 1RULL 3QIWA 4BZ2L 1BJ1H 4H5SA 4L4VD 4HDIB 1N3NA 2DAVA 1YEDA 5E99H 3REWB 4YQXH 3P73B 1MIEH 4H8WC 2WWMC 1LVEA 4G80B 2CR3A 4K3GA 5J6GB 5T33L 1SMOA 4XGZA 4YHLL 3HZYA 5L9DH 1X44A 3QCTH 5DSCB 3QWQB 5IROC 4X5XA 3JWDC 4PJIF 4YDVA 2XACC 3L6FA 4NP4H 3P0YL 4TN9A 3V0VB 2RQ8A 1IZJA 1QACA 5E6YA 1RQ5A 4LSUL 3F7RA 1GHFH 3MZGB 4Y5YB 3VRIB 1OCWL 4QY8A 1T83C 1VESA 4OGYH 4X4MA 1W8OA 1UM4L 4YGAB 5ERWB 3RI5F 4HMEA 3U0WH 1CL7I 1JHLL 2OP4L 4OQ1A 2COQA 4HDIA 1F8TL 4BQCA 5HHVL 3ZDYE 2OTWB 5DVKA 2BY3A 3P73A 3U4BL 4G80A 3TYFB 6CGTA 1MLCB 5FYJH 1FP5A 3CLEL 5J6GA 6FABH 4OAWB 5I71B 3BUTA 3ZDXE 5DSCA 1QG3A 4QGTA 1TNMA 3GKWH 1OAUL 3DXAB 4KVCH 4FG6C 4ZAKB 3V0VA 3HB3C 4Z95H 3VRIA 4Y5YA 3DYOA 3E2HB 4KJWD 3KS0H 3TZVC 1N8ZB 4KQ3L 1WK0A 3CC5B 3NCFB 1IEHA 4YO0B 3JV6B 1OGAD 1MLCA 3TYFA 1HXMB 2J7LA 4OAWA 4OI7A 5JIHA 5D7KE 1UENA 1C7TA 4K94H 4APQA 3DXAA 2I27N 4ZAKA 2OYPA 5SWSB 4TRPH 1C5BH 2B8OT 1TTUA 4KKAC 4AIZB 4H25B 4HT1H 4AJ0A 4D8PB 3QG7H 5BO1L 1QBMH 3TA3A 5L8KB 1N8ZA 5HDQL 5JTWA 1IGCL 5HHOB 1CFNB 1OAXL 3BMVA 4LQFH 3CC5A 4EZMA 3RHWF 4G42B 3WL9B 1WBXB 1HHHB 3S36X 2WBWB 4YO0A 2BMKB 1FG9C 3JV6A 1HXMA 4P3DB 1UH4A 3RWJB 2ICCA 1AXTL 1MCKA 4JRYD 3X3FL 4Y88A 4MA7L 1IGYB 1M6OB 1A0QL 3EW3B 3PQYE 5FYLH 5SWSA 1UADC 2AQ2A 5BVJB 4AIZA 4H25A 1FYTD 1MJUL 4D8PA 1DANT 4JRXB 3THML 5DUBB 2Q3AA 3VGHA 4YBLB 3VFOB 5HHOA 1CFNA 2BRRH 4G3YL 5CILH 1VCAA 4GMSH 3WL9A 1DFBL 1WBXA 1HHHA 5T3ZE 1A6AB 3LN9A 2BMKA 1Z9OA 2WINB 4P3DA 5DMIH 3RWJA 4U3XA 4LEOB 3RVWD 3MLZL 1DBAL 1SEQH 4PIRF 4GG6B 1IGYA 2CGRL 1RUMH 3OGOE 4MD0B 5EUKB 4BFGA 1KTDB 1XIWC 1I1FB 3MBXL 3IRZA 5BVJA 4HH9B 1J11A 1GCFA 1MJ8L 2P5EB 3IU3B 3GRWA 4JRXA 2EZ0D 4OB5L 1JTOA 2PW1B 3BESR 5JUEH 5DUBA 4MA1B 5C0AD 2VR5A 4X4ME 3HMXL 4CKVX 3R4DA 5CWSA 3VFOA 3LKQA 5FOBB 5CEYB 1KBGL 3MRFB 5HD8D 3MOBH 4GAGL 2ORBH 2WINA 3ALWA 4J3TA 3GJFH 1T0PB 1WEJL 4BJLA 2NY2D 4LFHD 5SWZD 4HF5L 4LEOA 2VDQL 4N8CL 2FD6L 5J4MA 5EUKA 3LQAH 3RVVD 4LLAA 5GS0H 1KTDA 4PJ9B 1YEIH 3QUYD 2ILLA 4HH9A 4GXUM 3NTCH 4IHOB 4DN3L 2VXTL 2P5EA 5I8EB 2PW1A 1IJ9A 3SJVB 2P45B 1T2JA 4KUZH 1OAKL 5IHLB 4F33A 5ACZA 2XTJC 1NDMB 4K3EH 1AGFB 4JN1L 5FOBA 1QSFD 1FL5A 5CEYA 5SX4H 4JFYB 1RV6X 2F54D 2X41A 3MRFA 4MLSA 5E2UL 1YPZA 4Z7VF 3L7EB 4OIIL 1YEHH 3V4UL 2VXQL 3CX5K 1IC4H 3KNBB 4R96B 5HYEA 4Y4FB 3DXAE 3A6CH 4PJ9A 3TV3L 5DJXA 3ZT5A 3K4DA 4IHOA 1MCOL 4UB0L 5BW7A 2PTUA 3SJVA 1EA9C 4NRYA 1QO3B 1NDMA 2R2BB 1AGFA 1LQSR 3O2VL 1QLRB 4Z0BH 3FN9A 2J88L 1EJ6A 2XN9D 4JFYA 2G5BB 4JKLA 4YPJA 1CLOH 4GFTB 5E5RB 2AJSL 3L7EA 5DFWH 3ZZ1A 4KXZI 1ZANL 5JXEC 1WISA 2BVTA 3KNBA 4NQUA 4WI2A 3HC4H 4R96A 2KQMA 2XV6B 4Y4FA 4M00A 1RUAL 1IC1A 3HI5H 5SWSE 4HFWB 1Z9SA 3WDHA 5KVDH 2EDRA 1D6VL 4D9QE 1F5WA 3DETD 4YHKH 1QO3A 2AJVL 3I3BA 3S3SA 3OMZA 3TBVA 2R2BA 3H3PH 5JZ7D 1EO8H 3DO7A 4NO3A 1QLRA 1T0NB 4QOKD 4NKQB 5I1HH 5HHOE 5IMKB 3BDYL 1UH2A 4OF8A 3NOIA 2HWZL 2XG4A 3T4AB 5C9JB 1A7QL 2P8MB 2ZG3A 4HJ0C 4PRIB 1FPTH 4M1DH 3BAEH 3UTPD 1FVDB 5KSUB 2ED9A 1OP3H 1UJ3B 5A2IH 3ARWA 4R4NC 5T3ZL 3N1FC 4NRXA 4HFWA 2FH6A 3DX8A 1DVFD 3HZMA 1WZMA 5KVFL 1CBVH 5B39B 4JRXE 1MREL 5FUCC 2VQUA 4N8VB 1BFVH 1T0NA 3HAEG 1WT5A 3O2WL 3T4AA 3SCMD 2XQBH 4NDMB 2P8MA 2QQQA 2V7NB 4PRIA 4KZEH 1LWRA 1W0YT 1WIOA 4Y5VC 4HKBB 1DN0B 1FVDA 5KSUA 1JPSH 4GG6E 4HCRL 1UJ3A 3S34L 1O0VA 4YHML 3MCLH 1BBJB 3OZ9L 3L3HB 3WNLA 1MNUL 4H0HB 1ZLVH 3TJEH 3V5DA 4O9HL 4OD2B 2UWEB 3SDAD 1KPUA 5HGHB 2P5EE 3O6LH 5B39A 4FQQB 4W70A 5HI5D 3ET9F 1UA6L 4JFOB 1WCBA 3T4YB 5T3XE 3C08L 2EYRB 4FQLL 5D96B 4HIIB 3IF1B 1HSBA 1Z0NA 4PG2A 3BT2H 4HBCL 2ZSVB 3QPQC 4NDMA 2W0FB 2XA8L 2EIZA 2V7NA 3QHZL 4MXWH 1NBVL 3VXSE 4Q7DA 1UWXK 1G9MC 2QV2A 4F9PC 3L3HA 4HWZB 5I9QC 1BQLH 1NCDL 2AI0L 5EWIH 3RWGB 2UWEA 4H88L 5HGHA 2VO5A 2HRPL 4FQQA 3EJYD 1HHKB 3SJVE 1MFBL 1RK0B 4IRSB 4QTIH 3N1PC 1TQBC 3GI8H 2ARJB 2HYMA 3LRSB 5HI3D 3T4YA 2EYRA 2IBBA 1QFWH 4HIIA 3IF1A 4RAUB 1WBYB 4MMZC 2ZSVA 1VEMA 1R3IL 2W0FA 3QDJD 1GYAA 1CDHA 2ATPB 3EKCA 5ICYB 3X3GH 5JOPD 4J4PD 4M62L 2F19L 1NFDF 4LNVA 3SE9H 1BWMA 4MWFB 1Z3GL 4HWZA 3IDUA 4OGAC 5KSBF 2AW2A 3MRMB 2DL2A 2GK0B 4DGIL 3MRKB 3RWGA 1T0MB 4JPKL 4NN7B 4MZ2A 4KHXL 1FNFA 2NTFB 5FM4A 1HHKA 4IRSA 3BH8A 4WWKB 2BRQA 4IRZH 2ARJA 5I74B 1RJCA 3KPOB 4C57C 3LRSA 5TDPB 4RAUA 1NCNA 5B8CB 4NUGL 1WBYA 1MPAL 4NJAL 2PTVA 2ATPA 2X1QA 2Z4QB 5ICYA 3EDJA 3K2UH 3MQIA 4MAYD 2UV3A 5D8JH 2ZCLH 3EYFA 4MWFA 4TPRH 2XTLA 5BVPH 4XZUB 2ITCA 4NYLB 2WANA 1UCBL 4I3GA 4ONGH 3MRMA 3ZYZA 2WV3A 3MRKA 2YA2A 1T0MA 2QTEA 4LCWB 4ZS7L 5IB4B 2NTFA 3N9GL 4KZDL 1FFPA 3UZVB 3BH9B 5F1NB 3QQ4B 3KPOA 4EI5D 3VRJB 3LEYL 3SGJC 5TDPA 5B8CA 5IGXH 2PR4H 3I6KB 4P9HC 2AK4D 3RX7A 2JB5L 3P4MB 5D72H 4IOSD 1NGQL 3SKUD 2Z4QA 3O2DA 1LO0H 5BRZD 2ADJB 1HCVA 1WTLA 4PRIE 2EEAA 2HKFH 1NCTA 4OCWH 1R5VB 5KTEL 4XZUA 4NYLA 2LU3A 2AEIT 5JORB 1TITA 4WUKL 3VWKD 4LCWA 5IB4A 1ZGLB 1DL7L 3HFML 5DURB 2C3GA 1YEFH 3BH9A 5F1NA 3QQ4A 4AZ8A 3P4LA 5GS3A 4G7VH 3TYGH 3VRJA 1A7PL 1J12A 2QQLH 5E7BA 2NY5L 4ZOCA 3I6KA 4KJQC 3P4MA 2C1OB 3I3DA 5DLMH 4XP4L 4JHAH 4LSPL 5L88H 2ADJA 3L1OL 1IAIM 4MVBD 5T3XL 4D2NA 1R5VA 4FOMA 4PP1D 1BM3H 1EGJH 5CP3H 5JORA 4JG1H 3WNPA 1WFUA 2H2PC 4ZFGL 1ZGLA 2A0LC 2NR6C 5D7KD 3BDBA 1RIHH 2VN4A 3PUCA 4U6YA 2Z9TA 2VXSH 5A2JH 2J6EH 5KJRL 1QHPA 1K4CB 2B0SH 5DC9B 2FNBA 4LLUB 4UOW0 2C1OA 4L1HA 4K3JL 2OX5A 4A6YH 1ZV5A 3LHPH 4LPCA 2QADD 1FNLA 3PJSA 1BFTA 3EYSL 4DOHB 1N4XL 1E4JA 4P48A 1A1MB 5LGHH 5I1GL 2R0WL 2V5TA 2E7CA 1NEUA 4DKEL 1KSRA 1P69B 4Z8FL 1SYVB 3BVNB 2PCPB 5EBMB 4OM1H 4L5FL 1P6FA 5FO7B 1L7IL 4ODTH 4XMLH 4DN4L 5FHBH 5EBWA 2R4SL 4I77L 1FFOB 4CJ1A 5JIIA 2DLFL 3CFKA 1K4CA 2APFA 4U0QB 5LKNA 4QRRB 1GGYA 2XG5A 1DCLA 4P46D 3TBYA 2X2YA 1IGJB 2AEPH 5IW1B 5C09B 3ZKMC 4G6JL 3U1SL 3BHBB 3NCJH 5EOTB 1KGCD 4XMPL 2EYSB 1A1NA 1ACYL 2W60B 4M1CC 1T7VA 4JREB 2DI9A 3L5HA 3RVXD 4I0KA 1A1MA 1I7TB 2MCPL 4G8IB 1WAAF 1OY3B 1KFAL 1GGTA 3BVNA 3K7UA 2PCPA 5DGQA 2B1HL 3RA7H 5FO7A 3D0LB 3GI9H 4URTB 2FZ3B 5K9OB 1FFOA 2OJZL 5J12C 4QRRA 2IAMB 2A9NL 4F3FA 1IGJA 5IW1A 4ZXBB 5C09A 3SE3C 5CFHA 3BHBA 1FGNH 5EOTA 1YEJH 2ERJB 3ARVA 2EYSA 3UJIH 3TGXA 3DTXB 2EDTA 1T7ZA 3D69B 1GGUA 1I7TA 1L0YA 3O6FC 3TBSB 1KJ2B 3BGFC 4CL7A 3FQNB 3ZT7A 1OTSC 3WDIA 5C0RH 3KG5A 3U83A 3D0LA 1ZLVK 1GZPA 2DICA 4LCWE 1NBQA 1QVOA 4PJDB 5D4QA 1ZLSH 2FZ3A 5K9OA 3NA9H 5DEFB 5K9JH 4M6NL 1XF2B 2YD4A 3C6SB 1JWUB 3ARUA 3SBWC 3TFKD 1R3LA 2E7MA 3NPSC 2IAMA 3T2NH 1U3YA 1L6XA 4ZXBA 1T5WB 3OAZH 1HIML 2XXMB 4LU5H 1BGXH 7FABL 5D1ZC 5EC2B 1S7TB 3DTXA 3ZDYF 4JG0H 1Q1JL 3D69A 1BQHG 4Z9KB 4I1NB 1OD7A 4JFHD 1WF5A 5E8PB 2F5AL 1K2DB 2BFVH 4QO1A 4GRMB 3ZDXF 5I15H 4PJDA 5DEFA 4APQD 1JF6A 1XF2A 3KLHC 1GVIA 3C6SA 1JWUA 1FO0B 2PYED 1RZJH 2HFFB 5D7JD 1MFDH 4RA3A 3O3BB 2VSCA 2D9CA 2Y5EA 1REIA 1T5WA 3TA3D 1IAIH 3HKFA 3PDGA 5D1XB 5EC2A 1NQBA 1S7TA 3LB6C 4GRLD 2FX7H 4UTAH 1KC5H 1MLBB 4J7RA 1N2RB 5GRZA 5E8PA 2O5ZL 1K2DA 2D2OA 3EJZC 1S7RB 3C2AH 4XVUC 1HDMB 2Y06L 2VDNL 1WSST 5T5FH 4K7PH 1IVLA 2XZAL 1FO0A 3HI6H 2HFFA 4X9GA 2RAMA 2BSTB 4M93B 2D03L 1A7BA 3O3BA 5CGYC 4KI5D 1G6RL 5D1XA 2OZ4H 1I3RB 4IDLA 3S7GA 1J5OL 4PLOB 5TE6H 1X4ZA 4X80H 4DOHE 4O00A 1MLBA 1N2RA 3KLAA 2AJZB 2C5DC 2AJYL 2Y36L 1XF3B 2B2XL 4HGMA 1HDMA 2KZWA 2PN5A 4KJPC 4R0LC 2G2RA 5J0BA 4L9LC 5E4EB 2UZXB 5F97E 2JJSA 5C0ND 5F6IB 3EBAA 4ACPA 1A6WH 4HPYL 4D9RD 2BSTA 2B1AL 1LD9B 4CMMB 4JRXD 4QRRE 5E9DB 2YUWA 2FEDD 4KK9C 5I0DA 1I3RA 4BM7A 5C09E 3C6LD 4KMLB 1N0XL 2FWOB 2YA0A 3UBXG 3CJJA 1EHAA 1MFEH 2C4XA 3W11D 3HR5B 1FAIL 2AJZA 3WFBH 4HC1A 2MPAH 4AEEA 5GZND 4UINL 4MSWB 2W0KA 4KKCD 3WIHL 3KWWB 2C1PB 4BH7B 2JELL 2GKIA 3AM8A 3PWVB 3WHE0 5MEQA 2OMNA 1UJTA 1LD9A 5DD5H 4ZFOL 3B5TA 1CFQB 5I18L 5CZVH 5E9DA 1NUDA 1FH5L 3HN3A 1GOHA 1LO5B 4DW2L 2FWOA 3CXDL 4O2CB 2IBGA 4XWOD 3HR5A 1SJXA 5HYFA 1QD0A 4RA0C 5FCSH 4MD5A 3UP1A 1NAKH 1TJHH 4G43B 1FL6B 1GSMA 4LOUC 4MSWA 4XTRD 1YY9C 3UPRB 1ADQH 1Z6JT 3K8KA 3KWWA 3QIWC 1RULH 3HZKB 4PJDE 5GQBA 3UYRH 4BZ2H 4NO0B 4ZO7A 2H1PH 4JN2B 4BH7A 2WW8A 3GMPB 3E1F1 1R3HB 2DQJH 3PWVA 1DE4B 1CFQA 1D9KC 1EAPB 1NC2D 1Z5LB 2PKDA 1WJ3A 4OQTA 1ERNA 1LO5A 1CFBA 4YXHL 4LVOB 4DTGH 4FQXC 4HGKC 4O2CA 5T1DH 1A4JA 4YUEH 3BZ4B 5DMYA 4GOSA 2EIEA 4Y4HD 1DSFH 2YPKB 3MA7B 1FL6A