1EZVX

Structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
EVKLQESGAGLVQPSQSLSLTCSVTGYSITSGYYWNWIRLFPGNKLEWVGYISNVGDNNYNPSLKDRLSITRDTSKNQFFLKLNSVTTEDTATYYCARSEYYSVTGYAMDYWGQGTTVTVSSAWRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ezvX00
1C5CL 5K9KA 4MX7A 5DMGD 4Y4FA 3V8CA 2P8LB 5IF0A 3FB7B 4DQOL 3FQXB 1A7QH 4OZFB 3SOBL 4ALAL 4XCNB 3TZVB 5F9WC 1KCKA 3PP3H 3SE9L 1AGCA 4P9HL 2KQNA 3FN9A 5KS9E 1QFWH 1N6UA 3AU1A 1CFSB 2X4QB 3H9HB 3O9WD 2E9WA 1UT9A 4OCSH 1UXWA 4KMQA 5HI3C 2F74B 4JZNB 4ZAKA 4ONHA 4PJHB 1IT9H 5DMJB 4WGWB 1R24A 1Z3GH 1FC1A 1AH1A 4ZQKA 1J8HD 1U36A 4LLDB 3AREA 3T0ED 5ACLA 3E3QC 2D7MA 3AY4C 4ZSOA 1JVKA 1ROWA 2MSPA 1U6AL 3C60D 1INQB 1UYWH 2NPLX 3I85A 3G5XA 4FQ2H 5E9DB 3HR5B 5JPMB 2PKDA 3WFEH 3OJ2C 4OLEA 3V0WH 5DJ0A 3QUXC 5F96H 3G08A 3ARBC 1EXUB 2NW2B 4M7KL 3IU3B 1CDHA 5C71A 4P5TA 1J9CT 5I1JL 2M8XA 1TZIB 4NO2A 5GGRY 1S7QB 4OUUA 1FL5A 5IT2H 4YDLB 1FO0A 3LIZH 4K94L 3GMLB 2ADGB 4I9WE 4LSDA 4MB4A 1RUMH 3GIZH 4GUPB 4NO5A 3FKUS 4GG6B 4Y5YC 2FD6L 2OL3L 4P2RE 3V6FB 5FF6A 3WNKA 3BPOB 4JPKL 5C6PB 2C1PB 1JZ6A 3MXWL 1JWSA 4LBEB 2H2SD 4KKNA 3L95B 4R6UA 1AO7A 2R4SL 3NABL 4PPTA 1NJ9A 3JWDH 1LO0L 2X4RA 2OP4L 4HLJA 4N8PA 3DO7A 1E27A 1CGVA 4NUJA 4ZAKD 3P0VH 4R26H 2VDKL 3MRGA 4QHLA 1MY7A 3KYKH 4OLXL 1SEBB 2G2RB 2I25N 3QI9A 2YWYA 4ONGH 3P11L 1FNHA 4C57C 2A1WL 3GJFK 5C1MB 1UJ3A 2HJFB 4YHLL 1V7NH 3DGCR 2A83B 4BZ1H 1EDQA 4YLQT 2B20A 4RAUA 2XOTA 2CGRL 1WQVT 1WZ1H 3DVGB 4U1NB 1EZVX 2NYYD 5DO2C 1MHEB 2EXWC 4P46C 3S35L 2E27L 1MFCH 1ND0B 2BHUA 4P5TD 3NH7H 5L2KB 3KNBA 3RFZC 5KOMC 5GS1B 5F6HI 5HYQA 5JW4Q 4P2OD 3MLPA 3IDIA 1OSZA 5A16A 1NUFA 3G04A 1JHTB 4EI5C 5ENWA 3BZ4A 3F5WA 4C56A 5IHLB 4L8SC 3K2UL 2ZSWB 1JP5A 3CMOL 3E2HB 3WKML 3BSZH 2HVJA 3E3QE 2YPKB 3O41A 2IPKA 4X7DC 5FKAA 4OZIA 5IFJA 5GGUB 3MBED 1JE6A 5CUSH 4Z7WF 2CIKA 2X4SB 5J3HC 3B83A 4K8RL 2LABA 1NFDF 5E8PA 1G9EA 2Q7YB 3HNSH 5DJXA 2WP3O 4N5UA 4P2QA 5EH1A 1DSFH 1N5YH 3ZDXE 3MRQB 1F4AA 2OTWB 2D7NA 1AY1L 3KYMA 3F7YB 5KSAB 3MTRA 3QHFL 4AENA 5LQBL 3L3HB 5DT1L 5AYUH 2GQHA 1AKJD 1U3HA 2WUBL 2W0FA 3LAFA 3ARRA 4KGJA 1IARB 3IRZA 1MCOH 4E41D 3PWNA 1ZTXL 4KTDL 4NBZB 4UV7H 3O6FB 2FO4B 4HMEA 3QPQD 4LAQL 4LARL 5BVJA 2HT4D 2R0ZH 1B88A 2DTSA 1FGNL 4KMLB 3KYAA 4Z7VE 1TCRA 1IGYA 1PY9A 4JZJC 5GRZA 4HIIA 3CSPA 3DHJA 4WO4B 3G6DL 2I07B 4KKAC 4PJXB 9CGTA 3F58L 1EZVY 2CXKA 4O2EB 3QEUA 3C5JB 2RJMA 5IVXA 3SJVD 2CD0A 4ODVH 4RWYL 4CW1A 3TNNB 4K7FB 2UZIL 4ODXB 3BQUB 1JNJA 1G9MH 1DBAH 4YHOL 4LHUG 1JNNH 5JW3H 3IDMA 2D4DA 2P24A 3FQNA 2AGJL 2XICA 3IF1B 3KDMB 3KLHC 3BPNB 4R96B 3UAJD 4NN6B 4QRPA 1IGIL 3GMRA 4P2CG 4PRNA 2XTJC 5J12B 3KPSA 4Y4KA 4AZ8A 4Z7UE 3HC4L 2EIBA 1NCDH 1N5AB 5KS9F 3V5DA 3VDBA 1MAJA 3OBAA 4OD3L 1PQZB 3Q1SL 4D9QE 3V0VB 4PRHA 2Z35B 2YEZB 2VR9A 5DD1L 4CL7A 4LLQA 4JM2F 5GPRA 8FABB 4KAQH 1A5FL 4LCIH 3WFCL 3UTQA 4HMCA 4D0BA 1G7IB 3UTTB 2FWOB 5TFSL 4L5FL 4GMTH 1XF5B 3LEYH 3HNVL 2FHCA 1ZHNA 5F6IC 3PP4H 4HT1L 1RJLB 2VOTA 3QO1A 4XNZB 4LL9A 1V3LA 1IQWL 1T0MB 4S1QH 5LG1A 2K9UA 1RD6A 1NKOA 3CGTA 3BPCB 2NY1B 1NBVL 3B9VA 3BDBA 1GH7A 2OXHA 1T20B 1T22A 4HV8B 3GMMA 1IKNA 4DKDC 3ARPA 1A0QL 4U3CA 43C9A 1KN2H 3OTTA 2GY5A 3CC5A 4K3HA 4XP5H 4HPYL 3SDXB 1NFKA 5I75B 3KYNA 3VWJC 1NL0L 1CFQA 1MCQA 4MSWA 4EI6A 3VXPB 1UZ8B 1GGIH 3H2WA 3QNYA 1A6UH 3TT1L 4ZOBA 4EDXA 3O4LA 3PGDA 5HGAB 3CFDA 1IEAA 3C08L 5CEZE 5DHYB 5HPMB 1CIDA 2X7LA 3B2UC 2P8LA 3FB7A 1A7OL 1HILB 2L4OA 2EEBA 2R56L 1G6RL 3FQXA 4JR9L 4OZFA 3S36X 4DKFL 4XVUC 3N9GL 4XCNA 2IPTH 3TZVA 1EO8L 4OZGF 3FRUA 5I1CH 3O2WL 4RBPH 2BSTB 1SJEB 2FX8L 2X4QA 3H9HA 2AQ1A 3C5ZD 3EOTL 4JZNA 5DRXB 4LLMB 3MUGB 4PJHA 2EICA 1WEJH 2DM4A 4X4ZA 2F53D 3MGTB 1NLBL 2VN4A 4HD9A 4HBCH 2ITCB 1YNLL 4L4VB 1JHLH 1YY9C 2ZNXA 1MQKL 1FH5L 1S8DB 3RIFF 3U36B 4F57L 1INQA 5HYFA 1OAQH 1V05A 4HDIB 5JPMA 2UWEF 3WNLA 2NW2A 4LMQE 4UTBH 1QBBA 1N2RB 3RZCD 1NCBH 1TZIA 3V95A 1N0XL 1S7QA 2V9QA 3OSKA 4Q2ZA 4Q6YA 4YXKH 1CDBA 1DQLL 3UTOA 5FA4B 1F42A 2ADGA 4WW2C 3MV11 5EUKB 5HDQL 5D7IB 4FQXC 4R2GD 2XZZA 3V6FA 1EAJA 3LEVH 4CN1A 3TFKD 4OQTA 3L3KB 5JXAH 2C1PA 4KK5C 3MBXL 2IAMD 1DUYB 1FAKT 4LBEA 3UEZA 2YUWA 1IC4H 2P4AB 1QO3A 4ZS7H 4IRJD 3L95A 4JFYA 4CBPA 2DOCA 3TA3B 1GHFL 3LB6D 2YPLE 4FQCH 1FORL 1YUHB 3QUMH 1GAFH 1Q72L 5F97E 2VLKD 3OG6B 2FZ3B 4HUXB 5DXWA 4ZODA 3U30C 2VUOA 4OCYL 4GW1B 5H37G 1FNEB 4WI7A 5D7KE 1NCWL 2NY0D 2DLGA 3MROB 5KZCD 2HJFA 3OAUH 3C6LB 1MELA 2A83A 5BW7A 2QKIB 4ELKB 4NWUL 2O5YL 3HNTH 2V2TB 1HXYB 5HGBA 2AJ3A 5C92A 4NZRL 5HHVH 4TTDD 3STBA 3DVGA 4M6OL 1BFVH 4HBQA 3V4VL 1XF4B 3GSNB 4OGZA 1DQML 5J57B 1ND0A 5F1SA 5L2KA 1DCLA 1HH9B 5GS1A 2IMMA 5A2JH 2FSEB 4TSAL 1U92B 4OCRH 1JHTA 4JQXC 1TJIL 4LSUH 4CVZB 2QADC 1E4JA 4Q74A 1UM5L 1ZAGA 4JPIA 2ZSWA 2R1WB 5EOQH 4YBLC 3OB0H 4BSWB 2B39A 1FBIH 5KW9H 1CE6B 5DZNA 1QOKA 4X9FA 2F54E 1RIHH 2YPKA 4IMKA 4KKCC 3GSXB 2BX5A 1XR9B 2C5DC 3EYVB 5GGUA 2PYEE 4E5XB 4HF5H 1G0YR 2X4SA 2ADFH 2BOCB 1CD0A 1O7SA 2R4RL 1U9KA 1OARL 1KTLB 5DLMH 5IB4A 2QQNH 2OL3A 4JCLA 4XPTL 3WFDL 1WWCA 4YDJB 2Q7YA 2VXTH 1X5HA 4LU5L 4WUKH 5EBLA 5IKCB 4X8JB 4KZDH 3MRQA 2OTWA 2FGZA 4QRUB 5GRUH 4U1HA 5KSAA 2IH1B 3WDIA 3RTQB 1EV2E 2WBJB 3MNVB 4JDVB 3L3HA 3X3GH 2YA0A 5SWSE 5FCUL 1OY3B 4Y0GA 2DLIA 2AEQH 3B2VL 2PYFB 1A3RL 1CXIA 1KCVL 3O6FA 2FO4A 1I1FB 3IDJA 5HHOB 4EZMA 4WEMB 4QXUL 4ZYKB 1QRNB 1C5BL 4WO4A 3O3UN 2I07A 4TVSa 2BVYA 4MAYB 4PJXA 4YWGH 2BSSB 1MIEH 2EO1A 3C5JA 2X4OB 1S5HA 3F6IA 2VLJE 2FEDC 4N0UB 5DVKA 3TNNA 4K7FA 4ODXA 3VGAB 1VSCA 1I8KA 5E4EB 3BQUA 4OGYH 1I9JL 4BQ6A 2BHYA 1H9VA 4Y2OA 2X89A 2BMKB 3MYJA 3IF1A 4PR5B 5H37H 1DR9A 3GRWL 4LSTL 1QR4A 3FQTB 5D2LA 4XPHH 3HPLB 2ICES 4U6YB 3G6JF 1HYSC 4KHXH 1LP9E 1ZS8A 2AXGB 5GHWH 3MR9B 3LH2H 4ZTOH 5KSBA 1X5XA 2ICEA 4R3SB 4QCIB 2FHBA 1Z9LA 1N5AA 3HS0B 5F7NC 3TJHD 4L9LC 3EHBD 1YEEH 3RAJL 1ADQA 2BY0A 4G9DB 4U1KB 1Q9WB 2Z35A 1GRWA 1OCWH 3MRNA 1H8SA 3LQAH 3PDGA 4MS8D 2DAVA 5DTFA 4S1RL 4EOWH 1G7IA 1IKFH 3UTTA 2FWOA 1E4WL 2QL1A 1DQJA 1XF5A 1YPZF 1RUQH 3FN0H 3Q6GH 3EGSB 1IGML 4O58L 1RJYB 3U0PB 3P9WB 4H20H 3CFCL 3MA9L 3RY6C 4AG4L 4V1DD 1RJLA 2CR3A 4JN2B 1I85A 1T0MA 4S10A 5IWLA 1P9MC 2Z92B 5IB5A 4TUJA 2K7QA 3BPCA 5LCVH 5HVFB 4NQVB 1KLGA 4CN6A 1T20A 4HV8A 3O0RH 2V6HA 5B39G 5E9DE 3O3BB 3MV8E 1GC1H 4LSRH 3NGBC 4FABL 2E5EA 4P4KC 2W0KA 4GXUM 3SDXA 5M94B 4J4PC 3ULUC 4TVPH 1A9EB 4KTEL 5I9QB 4GRWE 1EEYB 3VXPA 1UZ8A 4KC3B 4G80B 4HKJB 4OD1H 4ODHH 3TBVB 5HGAA 3JWOH 1G7HB 1BFTA 2EDYA 4AQOA 2D9QB 2ED7A 5HPMA 4QGTA 1TLKA 4KTYA 1M6OB 1DJSA 1WK0A 4C4KT 5DD6B 3K8MA 5FUZH 4OJFL 3QUZA 1FVCB 1MAKA 1Z0NA 1HILA 3W2DH 1VPOH 4R90H 2B2XL 4K8RD 3Q6FB 3BHBB 3C09B 2R9HD 5C0ND 3GKZA 4M3JA 4LPCA 3DETC 1KULA 4MCZB 2F8OA 4LRIC 5D1QD 2BSTA 1SJEA 2Z8SA 4G5ZL 1WWBX 1FL6B 3RPKA 3L5XH 2ZKHL 2QV2A 4F7MB 3RWEB 5DRXA 1XGYH 4LLMA 3MUGA 3STLB 1E6OL 5JXEA 2HTKC 2QEJA 4OIBA 2C26A 3VFRB 3MGTA 2DJUA 4PJ5A 1BIIB 1HQRB 5JO5B 2ITCA 4L4VA 4L4TD 3QFJE 3SE8H 4OF5A 3F8UB 4KJQC 1WAAE 3BP4B 1U8MB 5CJOL 1VGKA 2DBJA 2NZIA 4PLOB 1QHOA 4X6EB 4G3YL 3DO3A 5ITBH 3B9KC 1A7PH 1LD9B 5GJTH 4TPRH 4U6VL 1IFHH 2NW3B 3VXSD 1DLHB 5C09B 5SWZD 1M7IB 1FFPB 3BZEB 5FA4A 4N8CL 1W0WB 2ZNWA 4ORZC 2KQMA 4YDIH 2DQJL 4M4PA 2A6JB 2LU3A 2C4FT 4S0TD 2CH8A 1OSPH 5C9JB 3OB8A 5CEZL 2CRZA 3QUZD 1G1YA 1HXMA 3L3KA 3QEQB 1DN0B 4OD2B 4BFIB 1DUYA 4LQFH 4QWWD 4XVJH 3PIQB 4LVHC 3CX5K 3REWB 4B5EA 5DD0L 3S34L 3MCLH 3TA3A 4P46B 1YUHA 5JW4R 4JFHE 4J8RA 5DC9B 4PG9B 1RMFH 5E24E 5B22A 4WUUA 2FZ3A 3OG4B 3SDYL 1W2KT 5B38G 1T3FA 3LKRB 3D39E 4HS3B 4GW1A 4EI5B 1FNEA 1G6RA 1Z9MA 2DQTL 1YEFL 4PJ5D 3I6GB 5KG9A 4XNUH 5L8KB 3MROA 1IL1B 4L4JA 4Z8FH 4NPYB 3C6LA 3WJJA 3QPXH 4BZYA 2QKIA 3V9FA 4ELKA 4N8VA 1I9IH 4P3CH 1HXYA 2V2TA 5TF1H 4K07A 5IV2B 5D72L 3HUJE 3QXDB 4RX4A 5GS2H 2EDHA 4JFPB 3W11D 3CSGA 4CVWA 1XF4A 3GSNA 3F12B 4MNQE 4RRPA 2EEAA 1MCBA 1QSFD 3QXWA 2Y5TB 1XF2B 3T3PE 1D5ZB 1QBLH 2P8PB 2AQ2A 4YZFE 1HHKB 1GGCH 1HH9A 1KJVB 2FSEA 4MAUH 4KI5F 5EWIL 3NPSB 4CVZA 1YMME 5L6YH 3TVMD 2R1WA 4JHWH 4BSWA 1NMCB 1PD6A 3BE1L 1NEZG 4HZAA 1CE6A 3RRQA 4JFZL 5AD0B 3LKNA 2BY1A 1I3GH 3GSXA 1LP9F 3EYVA 1HDMB 4KVCH 5C0CD 5FHBL 1ZEAH 2IADB 1Q9LA 5D7JC 1T03H 3DX9B 4J3VA 2BOCA 4PYGA 5JDSB 3RVXD 4XHJD 1C12A 3VRIB 4JZJB 4UAOB 4X6DB 1KB5B 4YDJA 5GS0D 4WUUD 5EIQA 5IKCA 3ZMRA 1CZ8L 4XTRC 4QRUA 5EBWB 1JZ7A 2IH1A 2Q8BL 2AK1L 1MCEA 1U3JA 4X6FB 3MNVA 5DYOA 1K85A 1IAOB 4YHKH 5DZLA 3A6CL 5I73C 2CR6A 3I6KB 3OF6A 5SV4A 1HSAB 4PJHF 1BQHG 4RDQG 2PYFA 2C3GA 1KJ2L 4K7PX 2R29L 1BVKB 3BKJH 1I1FA 4MMXC 4O5LH 5HHOA 4NM8H 4NJAL 4X98B 4BQCA 5LBSL 2Z4QB 1QRNA 1FYTD 3LZFH 5HGGS 3UO1L 2APFA 1EK3A 1NLDL 3O2VH 4MAYA 2CK2A 4GO6B 1RQ5A 3QDMB 1OPGH 2DKMA 2XTJB 3FO0L 3WJLC 2CJUL 2VL5B 4GQPH 2VDPH 2X4OA 3HC0B 3KPMB 4N0UA 5CJXA 2WW8A 1XGUA 3TBYA 1AIFB 1D6EB 4L1DA 2BNRD 4LP4A 1NUGA 4OFIA 1RZFH 4RGNC 2OLDA 4YHPB 3BEWA 3RWIA 4GG6F 3M45A 3OPZL 1TNNA 3RHWF 1MCPL 2BMKA 3O6KL 3FQTA 4Q0XH 4BELD 2XKUA 4MD4B 3HPLA 5IBLD 3QQ3B 1RUPL 4I4WB 2OXGA 4OB5L 3HI1B 3O8XC 4W4OA 2XPGB 3NZHH 4RMSA 2UVEA 1EA9C 4QRTB 4R3SA 1HN1A 3CUPB 2XYCA 4JB9L 1KC5L 3D2UD 1NAMB 3LRGA 1IILE 4U1KA 4G9DA 1Q9WA 3WD5L 4XP4L 4PLJC 1LO5B 5HI5D 4LOUD 4KK6D 1XR8A 5E2WL 1J11A 1F58H 2XI9A 2FO1A 3TT3H 4I8DA 3K46A 3IS1X 1IC7H 1OQOA 3O6ML 3EGSA 4R97B 2W59A 2AJVL 3EJZD 3GIVB 5DD3L 3U0PA 2WUCH 2XA8L 5DR5L 4LLAA 1RJZB 5CGYC 1PX4A 4XMPL 1OAUL 2AJXL 4XMKH 4HJ0C 2Z92A 1KJ2B 1EH9A 4LLWB 5DK2A 3AS3A 1U93B 2BCKB 4N0RA 1BVZA 2HN7B 3O3BA 5IB3B 4LDOB 3MLXL 1CDYA 3AROA 1OLZA 3ARDC 1NGWA 4ODBD 1A9EA 4UILH 4ZNEE 1EEYA 4G80A 4HKJA 3TBVA 3NCYP 3EFFA 4I9WD 3MLRL 1G7HA 1I7TB 1MJUH 3BWAA 1DZBA 5CIPB 5D7IE 3VW3L 4P2RD 3I3EA 3KR3H 4L29B 5DD6A 1RZIA 1B0WA 3AY4A 3ZE1E 1X5LA 3TYFB 1KT2B 5I1KL 1NGQH 3Q6FA 3BHBA 1BZ9B 3PXJA 1YC7A 1P7KB 4Y16D 4ZFGL 3GBNL 3QUXA 4MCZA 4KROC 2ZUTA 2IALB 3RU8L 3LKSB 5T1LD 2YUXA 15C8H 1FL6A 3NA9L 2AJYL 2FHFA 4H8WH 1ITBB 5CD3A 4F7MA 3RWEA 3S35X 3SDAD 1NGZA 2VUYA 1EEUA 3H9SE 3EZ8A 5F1IB 2ADJB 2NY2C 4J3OC 1BEYL 3VFRA 1BBDH 1BIIA 4WW2B 1HQRA 4Y5YA 5JO5A 3C8DA 1S9YB 2UZXB 3BP4A 5F3BB 4YZFF 4K2UL 2C7UA 5KVDL 1PKQE 5EOCH 4PJXF 3WFZA 2EZ0D 4Z7OE 3OKEB 4HIXH 1TQCC 2MPAL 2F5AH 2VLME 1SY6H 3QDJE 1JYXA 1PFCA 1LD9A 3VD3A 3NFSL 3HMWH 4M61B 2NW3A 1I4FB 3RVUC 3EYSL 2F15A 2GTWB 4Z0BH 5IFHL 4LASL 5HI3D 2A9NL 2ZJSH 1U58B 2FEEI 4Y2DB 3U30B 1K6QL 1IZKA 5CEYA 1Q1JL 1RVFH 3LKOB 1X5YA 2A6JA 2BFVH 2AV7B 2RQ8A 2ICCA 1FNSH 2V5YA 4U4BA 5C9JA 4PTTB 5F9JB 1F02I 3BZDA 4NGHL 2EH8H 3AFLA 1DN0A 4BFIA 1KBGL 4CRPA 4WFHE 2AEPL 2X9WA 2F19H 2AAVA 5DF0A 3REWA 3NCYS 4QLRA 4GOSA 4GS7B 4P46A 2J8UB 3ARBD 4YBQC 3CPLB 5DHXB 1OWWA 3QZWG 4PG9A 1NMBH 5T1MB 4RWHA 3TO4C 4XWGL 4X9IA 4DUXA 2F58L 3RJDA 3DYOA 4GBXD 3W9DB 4HS3A 5EU3B 1GGBH 4EI5A 3BKYH 4KXZI 1MUJB 5E2JA 5EIVA 2BHZA 3I6GA 5D93C 1RU9L 4V2CB 5I1HH 4OZHE 4IS6B 2ATPB 2R15A 3QBTB 2EYRB 3T2QA 4OZ4B 5DMYA 1HEZA 4HUUB 3RY5A 1UCBH 4OGAC 1V7ML 1F11B 4EXKA 2BDNH 3LN4B 3QXDA 1ZWIB 2I60H 4JFPA 5AWNH 2DM7A 4P3DB 3QNZB 4TULL 3GSVB 3KPTA 3RX8A 2Y5TA 2V2WB 1XF2A 1HHKA 5ESAA 5JZ7C 1KJVA 5D71H 5IMKA 3V4UL 4Q6IC 5DJDB 3CD4A 3X17A 3UDWC 4S1DD 1T1YB 3SDXF 1N26A 1E4XI 1KCUL 5AD0A 1NFIA 3MGAA 5D70L 4ZFZB 1JNHA 3MRJA 1HDMA 2FIKB 5JR1L 2IADA 4X9BA 3WS3B 2CRMA 2FBJH 3DX9A 3T0XA 4WVRA 5JDSA 2NY6D 2WWKT 1D5MB 3IDXL 3VRIA 4JZJA 4X6DA 5FK9B 5EULV 3S96A 1T2QH 3BKMH 3OX8B 4M1CD 4N0CC 4R7DB 3P0YL 1PG7L 3TWCH 4NQDE 1BD2E 3CVHL 3ULUL 5FDWB 1N59A 5EBWA 1F4XL 3C2AH 3QIBC 5EZOH 3I2CH 5B38B 5KVGH 4HFUL 3CCHB 4X6FA 5E6YA 1U42A 2R0KL 5ICYB 3GSUB 1IAOA 4D9QD 1MRDH 5CILL 3EYFA 5EORL 2YK1H 3I6KA 4FXGB 5JORA 3RWCA 7CGTA 1RURL 1FE8L 2COQA 3QQNA 1WBZB 4KUZH 1BVKA 1BWWA 1FV1B 4U1JA 4KRMB 2J6EL 3BIBX 4BK5A 3RKDD 1AC0A 3V7MA 4X98A 4GXVH 3AM8C 5D5MB 5C0DB 5I1LB 3K1KC 3OZ9H 4Q9QH 3MLWH 3VA2C 2DI7A 4M1GL 1A7NH 1MCWM 1RZKC 3QDMA 2X9YA 2VL5A 4MA7H 1RJCA 3HC0A 3KPMA 4PP2B 2RFXA 5LVEA 1AIFA 2Y36L 1QBMH 1D6EA 5DFVC 3OKKB 4NHCL 4AIXA 1D9KB 3P4MB 2YN3A 4DEPB 4OF6A 5KSUB 1AQDB 1YEHH 3GO1H 4JZOA 5EUOA 5C0BA 1NBQA 3L3DB 3QXTA 4P49A 4YHPA 2F5BL 3Q2CA 5T3ZH 5D7IF 3EO9L 2YD1A 4HXAH 4MD4A 3RDTC 4UT7L 3QQ3A 4ZOEA 4I4WA 4I0PC 1EJOL 5EIIB 3HI1A 4OT1L 1MF2L 1OP5K 1U8HB 4KKAD 5CEZD 4QRTA 5ERWA 1WIOA 4L1HA 5GRVL 3SBWC 4MXVE 3CUPA 1S7VB 4LPWA 3VFMB 4NQEE 1NAMA 1A6VL 4PGZA 4DK3A 3E6FB 2YMXH 3L1OL 1XF1A 3V52H 5ICXB 5KJRL 1KCRH 2LU7A 1BAFL 3NGBB 5LGHH 5HHXH 1BQHB 3VWJA 2LTQC 3CFKB 2YZ1A 2FECL 3KLHD 4EQ3A 3HPJB 3GIVA 2WP3T 2VJXA 3T0AA 5IW3A 3GEWB 1RJZA 2I26N 5DSCB 5E8NB 2O5ZH 2VZUA 3PGCB 1KJ2A 1FP5A 1A7QL 4QHNA 4PJFE 4LLWA 3HE6B 5KANI 1U93A 2BCKA 3RX7A 4NNXB 2BP3A 2JCCB 4J7RA 2HN7A 4Y1AB 5ECJE 5IB3A 1OGTB 2HT3D 1XIWB 1QFWL 5K59E 3ZT5A 4FG6C 2HMIC 2NTFB 1P6AB 1J88A 4OCSL 4JN1H 3R8BB 1K8DB 5I1IH 4GMSH 3UJJH 1CD8A 1CXFA 2I5YH 5C09E 1NC2B 3QH3B 1Z3GL 5DVMA 1FNGB 1PG7W 5F9DC 4QRSB 4BA8A 4YXLH 4B7LA 5CIPA 4OKVB 2Y07H 4L29A 4KWUA 4GKNB 3WFEL 1G1CA 3QEQE 3TYFA 5HSFA 5F96L 1KT2A 2Z8WC 5CLWA 1BZ9A 5HYSG 3BKCH 3MV9A 3ZHLA 3RY4A 4M43H 3B9KB 5IT2L 2YPLD 3LIZL 3BAEH 4PS4H 1WVZA 3LKSA 1KCSL 1PLGH 3VXRE 3QAZC 2DI9A 1RUML 3GIZL 3BO8A 1H3VA 1R3KB 5SX5K 3RNQB 5F7WC 3BUTA 3PE9A 5F1IA 2ADJA 2X44D 3KS0J 3TF7C 5D7KD 4WW2A 2BNUB 3ZKNC 5C08E 1S9YA 3UZQA 2AP2A 1H0DB 1P7HL 4HQQH 3T08A 1HOCB 4GKSB 3OKEA 1QYGH 3X14B 5I17B 1JNLH 4KMTH 1JUFB 3N50A 3L5WA 1YMHA 3P0VL 2H32H 1I75A 4M61A 4R26L 4WWKC 2VXVH 4LCCC 3KYKL 1IQDA 2GTWA 4IOSD 3TIEB 4ONGL 4AT6B 2D0GA 1MJJB 3DX8B 1U58A 1V7NL 2XXMB 2BRRH 4R8WH 4G6AC 5IJVA 4BZ1L 4HWBL 3HB3C 3V2AR 2AV7A 4C55A 1YY9D 1C1EH 2F54D 2D3VA 4PTTA 5I1AB 1WZ1L 2HG5B 2VH5H 3JWOC 4Z7NE 4JFEE 4L9DA 1F4WH 2F8VA 1MFCL 2PYED 3EJYC 3NH7L 2C3WA 5C2BH 3LD8B 1Z5LB 3MRLB 2PNDA 2J8UA 2VDQH 5CBEB 3CPLA 2HRLA 4G42B 4HKXB 5T1MA 3VI3F 3PQYE 1QFUH 4MCYA 2DQIH 3W9DA 5I16A 2OR9H 5EU3A 3BSZL 5C0RH 5MHSE 3DV6B 4DN4H 4JQXA 4QRQA 4F9PA 1MUJA 4F58H 2VKXA 2ATPA 4FQXD 5SWSD 5HHQA 4OZ4A 2GJ6B 5CUSL 4H88H 5FUCE 1JGVL 3LN4A 2AI0L 2EYSB 2RCSH 3ARFB 3ZSTA 5D7JB 3HNSL 4P3DA 3VA6A 3GSVA 2B5IC 2V2WA 1N5YL 1X9QA 3WFBH 4P5MB 1JN6B 1Y6KR 1PEWA 1MIMH 4NRYB 3VFPB 4G6JH 1J1OH 3PL6D 1X5ZA 5AYUL 2DIBA 3OGOE 2VLJD 5C0AB 1T1YA 3DX6A 1J18A 4PRBB 1UZ6E 1YY8B 4QHKI 1MEXH 1YEKH 5IP4A 1ZT4A 3ES6A 1MCOL 1HHJA 1GOFA 4NQTA 4NT6B 4XX1G 2HFGH 4UV7L 4ZFZA 2J2ZA 2R0ZL 2FIKA 1X4ZA 3WS3A 1P7QA 4U05A 4JVPA 4LDLB 4MXVF 1BIHA 5DRNB 3DIFA 1I3VA 4X6CB 1D5MA 5A2LH 2XQBH 3CZFA 1C7TA 4ODVL 3OX8A 1N8ZB 4R7DA 2CRYA 5C8JB 1J1PH 3T3ME 4QXGH 2QADD 1WSST 1N4XL 2E7BA 3CCHA 2HLAB 2H8PB 2FR4B 1G9ML 1DBAL 2D03L 2BNQB 2QTEA 1JNNL 3GSUA 1IJ9A 5FA3A 2XZAH 5ICYA 1YEJH 5JW3L 4G9FB 1KF9B 4FXGA 4PY8J 1ZLUK 4KKCD 1UH3A 4RGNB 4LPUA 1WBZA 4I5BA 4MWFA 4HC1H 4QY8B 1MCSA 1T7XA 3FTGB 4EN3C 2C3HA 2CO6B 5BO1H 2FL5B 2X05A 1JHKL 3PG2A 5D5MA 5C0DA 3S4SG 1KYOK 3O8XB 3ARWA 5GQBA 3S5LG 3SO5A 2L0DA 4PP2A 5E6IB 2QHLA 3T04D 5FYJH 4N1CA 2Q86B 3MX0A 3OJDA 1MCNA 3OKKA 4LCIL 3O3DB 1HNFA 4IRSC 5KSUA 5LAXB 5E9DD 3F65A 3MV8D 2DD8H 3GMNB 5GGVY 4GMTL 4RA0C 3S3JA 2NQCA 3LEYL 3TO2B 3MJ7B 1CICD 1T7YA 3CAFA 1VGEH 4HWZB 3PP4L 3SHSA 2ESVB 4JEGB 4Y5XB 5F3HB 3HFMH 1H3PH 2CSPA 4S1QL 4FP8H 5HHMB 2IBZX 3QG7H 4F3FB 3I02B 3EDEA 5CSGA 3RY6A 4ZUSB 5ITFB 1LILA 1P6FA 3KPOB 5J9PB 2DBLH 4B7IA 2XKNB 4LSQH 4U0QB 1P9MA 4EQ2A 2GK2A 1B3JA 2Y06H 1VKXB 3VFUB 5AZ2H 1NQBA 1KN2L 4ZXBC 3E6FA 4XP5L 1ITCA 5MENB 3QWQB 5ICXA 1E4XH 4PJIB 3OKYA 3ARDB 4UQ3A 1A6UL 3PABB 4HEPG 3CFKA 3QHZH 3HPJA 3K2MC 5DRZB 3W82A 3CX5J 2C4XA 3D39A 1HYSD 5KANG 1EJ6A 4YIQB 5E8NA 4PGCB 3QFJD 1KIRA 2QLVB 4UTAH 2ZWLT 3K4DA 5IBTL 4PTUB 2BSED 2NXZB 1ZSDB 3F6LA 5I1CL 4YO0A 2JELL 4Y1AA 1NH6A 2HA1A 1OGTA 1GSMA 2ZG1A 5JOFB 5I8OH 1B0RB 2NTFA 4LSPH 4RFNC 1MFBL 1K8DA 1S3KH 5B3NA 2P45B 2YC1A 1WEJL 5JIHA 3U7YH 3QYCA 3UTSE 4X4MA 4HBCL 4QRSA 4Z7QE 1OTUD 1JHLL 4LLUA 2BVPB 1LQSR 2BVQB 4D2NA 2NY2B 1EUTA 1G7JB 1TQBC 2AEIT 4OKVA 3WN5B 3K7UA 3UPCA 5HGHA 4PV9B 1UJTA 2W92A 4POZD 1OAQL 2ZZUT 4GKNA 4JQVC 2IBZY 4JY5H 4X6DF 1RK0B 2X41A 4J3SA 4UTBL 4AL8H 1KCLA 3A6OA 4Y8AA 5I1DA 4FFWD 1ED3A 4X7CC 3VXOA 4CMHC 4Q7DA 4O2FA 5FO8A 4YXKL 3WHXA 3B9KA 4RIRB 4UIMB 4JFHD 4P4KD 1U8NB 3K8KA 4J4PD 3GM8A 5IUSA 3TN0D 5F70A 1WT5C 1R3KA 1NCCH 3D39D 3RNQA 3NPZB 2GAZA 3LEVL 3DROB 2BNUA 4G6ML 5CZXC 5ADPH 5JXAL 1H0DA 1OP5H 1IC4L 1AHWB 4MLIA 4ZS7L 2OI9C 3HZVB 1BP3B 5T3XL 3QIUC 4WI9A 3QUML 4GKSA 2Y6SC 3X14A 2A74B 1KJMB 1GAFL 1PBYA 3SN6N 4MNQD 1JUFA 1UZ6F 1XCTB 4WHTB 1FRGH 4XNYH 5IOPB 4L8DB 4PRIB 2PO6C 5I6XC 3TIEA 4NQCB 1V5JA 4AT6A 4RMVA 1BQLL 5DVLA 5FUOH 5GSRB 1RUKL 3DX8A 3OAUL 1YMMD 2C3XA 2HTKD 3HNTL 2OTPA 5D93B 1A9BA 4JGJA 4LLYB 4LPVA 1F6AB 4UIKH 2HG5A 2XN9E 2DQHL 1RZKL 1ULVA 2ORBH 5SWQB 3QXUA 4F80A 2AK4B 4X80H 1A7BA 2M26A 2SEBB 4OCRL 5CBEA 4G42A 1JWMA 3QXAB 4LSUL 3GMQB 4HKXA 5EOQL 4HKZB 3WUWG 1FBIL 4PY8I 2NY3D 5KW9L 5B3JE 2P5EE 4M7JH 4NC1C 3DGGB 1ZHLB 1BOYA 1RIHL 5FM5M 4H8WC 1K9TA 4UNUA 5J06A 4PJ9B 3TESA 4NFBA 1MAMH 1OW0C 4XNQB 3DRTB 4HF5L 2GJ6A 2QSVA 1QEWB 2ADFL 4B41A 4EUPG 1R5IA 4HUKB 3NFPB 4NFCA 4F9LC 2EYSA 3O9WC 1ORSB 3ARFA 2QQNL 5D1XC 4UB0H 3D18B 5D7JA 2VXTL 3TBWB 1A1MB 4WUKL 3UBXB 4J6RH 2KL6A 5DUPH 4KZDL 2QBWA 2JJUA 1A8JH 3QNXB 1KUMA 3ARYA 5GRUL 1JN6A 2MQ0A 2A73B 3N0PB 1W72H 3T0EC 1BJ8A 4NRYA 3VFPA 3X3GL 4XP1H 3C60C 4OTXH 5C0AA 2AJSH 3SE3C 3KXFB 3QIBB 2NY1D 4PRBA 1YY8A 4MD5B 5AZEH 2AEQL 4FQ1L 4XCYA 3BN9D 3O2DH 3EOAB 4NT6A 2RB8A 2N1KA 1VDGA 3CLFH 3OJVC 2E8ZA 2X4PA 4PRPE 3MO1A 4FFZH 4JREC 1PJ9A 3DMMD 1U8JB 1NC4B 5DRNA 3KPRB 4X6CA 4YWGL 5BMFH 1MIEL 4HWBA 4R4FH 5HI4C 4DUVA 3UYRH 4X4XB 1VEMA 1QBAA 1M05B 4NFDA 3BRFA 1N8ZA 3D3VB 5C8JA 2OZ4A 3WJLA 4QRRB 4R7NA 2DWDB 4OGYL 2FR4A 2H8PA 3AVEA 2A9MH 1JYWA 5FOBB 5GS0H 3VG0H 1UH4A 1KPVB 3IXAB 4G9FA 2VABB 1BGXH 4JGUA 1UKSA 2J5LB 4WW2F 4QY8A 4KHXL 4OIIH 1KSRA 2P5WE 1KIQB 3FFCE 3FTGA 2JJTC 5GHWL 3RUGE 2FL5A 2FX7L 2NY7H 2Y5EA 3FT3B 4ZTOL 3HAEG 5LWYL 4I0PB 2IGFL 3O8XA 1CD1B 4L3EE 2XNAB 2PETA 3NAAH 4DTGH 4XTRD 5E6IA 3WLWD 2GI7A 3LQAL 3GHBH 3O3DA 4EOWL 5LAXA 1IKFL 1AXSB 3GMNA 2H1PL 3FN0L 1RUQL 1HIMH 3D85D 5DD5H 3TO2A 3MJ7A 3CFEB 3Q6GL 4R4BB 3MV7E 3DJ9A 4H20L 4P2OC 2ESVA 4FTVE 5F3HA 4UQ2B 2LTQB 3VI4F 1MI5B 2OX5A 4U7KA 2R2EB 1DBBL 1A6ZB 3TH3T 5LCVL 4ZUSA 5ITFA 3SO3B 5J9PA 4EUPH 3KPOA 5IBUB 2XKNA 3O0RL 2J8UF 1NCAH 1CT8B 1GC1L 5E99H 4LSRL 1VKXA 3MBEC 4IHOB 3VFUA 4ESKA 1DE4A 1EIBA 4TVPL 4V2BA 4XMLH 2ZCLH 5MENA 3DURB 4GQ9H 3P9LB 4PJIA 5DJ6B 3ARDA 2EDDA 3IDGA 4OD1L 3KJ4C 1PYWB 4ODHL 3PABA 1EFXA 1UB6A 3JWOL 1T2JA 2WQRA 1CLZH 4DZBB 1INDH 1AP2B 3T65B 3H9SD 1MH5B 3GJFB 4GKZB 5FUZL 4YIQA 3VFNB 4OCXH 3W2DL 1VPOL 2PTUA 4PGCA 4R90L 1KJ3L 4M5ZH 1IZJA 4JKPH 1P1ZB 2MQCA 2HVKB 4PJ7E 5DJ8A 1Q0YH 4PTUA 5CKAA 1MNUH 1ZSDA 2C1OB 3ESVF 4F7EB 2LE9A 3SE4C 3MRDB 5JOFA 1MWAH 1B0RA 5D2NB 3G5YB 1INEH 2VLMD 1KTDA 3L5XL 3QDJD 4AK1A 3QA3A 1XGYL 3IVKB 4QEGA 4JGMA 5IIEB 1QVOB 5ID0B 3R0NA 1ZK9A 2XZQH 3ZHKA 1KPUA 2BVPA 3SE8L 1G7JA 3V5HB 3WCYA 4A6YB 4PV9A 3TJEH 2ADIB 3BGAA 2LVCA 2LAAA 5ITBL 2ICWJ 4QHUB 5TDPB 1JRHL 1RK0A 4WFHD 3LKQB 2VLRE 1EGJH 1SEQH 3RIAF 5GJTL 4O2CB 2IPUK 3HAEH 4TPRL 1IFHL 3UAJC 3UYOD 5C0GB 4RIRA 1FN4B 4UIMA 4GKOA 4RISH 4Z76A 1VFOA 4WWKB 5ID1B 4LEXH 2BERA 4YDIL 1G0XA 5I19L 3VXME 4A2LA 3RTQD 1UKQA 3DROA 1OSPL 2WBJD 2ERJB 4LVNC 1LEGB 4PY7B 4LQFL 1RIUH 2DMBA 4XVJL 3DUSA 4QOKB 5C70A 5D5MF 3EYUH 4EIGB 3ZKQD 1EEZB 1MVFA 3SGKC 1JZ4A 3MCLL 1WFUA 1U8OB 1GZPB 5H94B 5TDNB 1BM3H 5FFLA 2A74A 1KJMA 4NP4H 1RMFL 1ZGLA 2E6QA 2IANB 3WIHH 1XCTA 3ULVF 1ZLVK 1FC2D 2V9RA 2VDOH 5IOPA 4L8DA 4PRIA 3DXAE 4NQCA 3LDBB 4XNUL 3RVVC 1CBVH 2H26B 2KZWA 5GSRA 4Z8FL 3QPXL 3MRBB 1S7SB 3S36H 4NNPH 3N1GC 5CP7B 25C8H 1I9IL 4P3CL 5TDOA 5ISZB 5TF1L 1JF5A 4LLYA 3I6LE 4WCYH 1OD9A 2Q1EA 4BYHA 3L9RB 5SWQA 5LXGH 4LGPB 4LHUA 1QBLL 3QRGH 1HZHH 3QIWB 1A47A 2FRGP 4KRPC 3CJJA 4MAUL 5CBAB 3MXVL 2SEBA 5JQHC 3TNMB 4D0CB 3QXAA 3GMQA 1WLHA 5MI0B 4JFDB 2X1XR 4HKZA 4JHWL 4Q6IA 1IGJB 1MVUB 4NQDD 4TQEH 1BD2D 3VFOB 3DGGA 2VZVA 5T3ZE 5EBMB 1HCVA 3UDWA 1OD7A 3VFTB 5GJSH 2FH6A 3ULUF 2BNQE 3GFUA 1NCTA 4OFPA 4KVCL 2GIYA 4XNQA 3DRTA 4X7EC 4LIQH 4PJ8B 1KENH 2R23B 1U2HA 5IHUH 3FFDB 1T03L 3LPWA 1MCLA 1QEWA 3NFPA 1FFOA 3U6RB 1ORSA 4XP9L 1CU4H 1KB9K 3H9ZA 3D18A 4X7SH 5EPMB 2FATH 4ZUUB 4FQPA 3UBXA 1R5VA 4YBQD 2D7OA 4YR6B 4JO3H 4MZ3A 2JCCF 2A73A 1F3RB 4WHDA 3TO4D 1GVIA 4LCWE 4YHKL 4PJGE 4NYLB 2VIRB 3KXFA 3QIBA 4MD5A 5FYJU 1OP3K 1U8LB 3PGFH 4LNRA 4LLVB 3QWOB 4HCRH 2R1YA 3SQOH 3OAYK 4NNYB 5C86A 5BS0B 1Y0LB 3QJFB 2UYLA 1NGYB 3BKJL 1U0QA 1AI1H 3MQIA 4O5LL 2NLJA 3RZCC 4NM8L 3HTLX 5EO9A 4LHUD 3LZFL 1DUZA 4I1NB 1U8JA 1NC4A 3O2VL 4MA3B 3SDDD 3KPRA 2PXYD 2OMBA 1OPGL 3MODH 5HHME 1FIEA 2NX5E 4X4XA 2VDPL 3AM8A 1M05A 4I2XE 2BSRB 4TUKH 8CGTA 5JZ7D 2ZOKB 4R2GC 3W5NA 3PWJA 4WI4A 4U7MA 3D3VA 2Z31D 1TPXC 5HJ3B 1N3NB 4J2XA 3TFKC 1T89C 4QRRA 4PJDE 3IAQA 1WWWX 4NUGH 1XZ0B 4NQED 1RZFL 4OI7A 5FOBA 5DEGB 1NSNH 4NQXA 2OM5A 1KPVA 5BRZB 4IRJC 3EFDH 1CL7I 3IXAA 3LB6C 4FHBD 3NCCB 4Q0XL 4WTXA 3J7HA 5IFAH 1VADB 1FQ9C 2NY4D 3BIKA 1RV6X 3NZHL 3RDTA 3DVNB 3VFVB 4I0PA 2YKLH 1R6VA 1CD1A 4JFFE 2XNAA 2VDLL 5C08A 4KJPC 1X5JA 3FB8B 3V6OC 3SBWA 1ZT1B 4GG8A 3I9GH 3QO0B 1RZGA 1I8LC 1F58L 1AXSA 5T1KA 1FVDB 4Y5VC 1IC7L 5D7LE 1TXKA 4M6NH 4LCYB 5I8CA 4Y4HB 2WUCL 3H8NA 2H3NB 2YHGA 3AC0A 5C09D 4UQ2A 3NCMA 1MI5A 4MMZC 5L9DH 1YA5A 4JQIH 5FYKH 1P84K 2EC8A 4XMKL 2JLLA 3VGBA 2YD9A 4ZD3H 1A6ZA 4HXBH 4HZLB 5KN5B 4WU7B 2DLTA 1FO0H 3MV01 4R0LB 4HIHB 3ZYZA 1IM9A 1BHGA 1IAKB 1CT8A 5EU6B 3QEQD 2JB5H 4UILL 3MGOA 3DURA 3GUTB 3P9LA 3IGAB 1U3YA 4LEOB 1PYWA 4DWHA 2P49B 4RFNB 2VSDA 4S2SA 2EXYD 3VXRD 1MJUL 4CVXB 5ICZB 3OKMB 3NCJH 1AP2A 3QT2A 3T65A 1MH5A 3KR3L 3GJFA 4R4ND 4GKZA 5IB1B 2VLLB 1Z6JT 5DJCB 3VFNA 5C08D 3UZVB 1KN4L 1QNZH 4QKXB 3NIDE 4EKXA 1NGQL 3HI6H 3RWJB 2HVKA 5JHDB 4GJTB 4JLRA 2XT1B 2EDQA 3TIDA 2C1OA 1BJ1H 2CMRH 3CXHK 2EC9U 1B90A 1X5KA 2P1YA 5HDLA 5EA0H 15C8L 4MJIA 3VRLE 3C6SB 3G5YA 4H8WL 3HE7D 2FJHB 4I0KA 1OAYH 4TSBH 1VFMA 3A0OA 3IVKA 4F7PB 5FECB 5DVNA 5IIEA 1J1XL 4ZUWB 4FMFA 1KOAA 5C07B 1I9RH 1IBGH 1QVOA 1BBDL 5GRVK 1VFBB 1EO7A 4O4YH 3FQRB 3AS0A 5AAWA 4DZ8B 4QO1A 4JFQB 3V5HA 3QP3A 1QTYT 1DFBH 2B1AH 2B8OT 4A6YA 4FZ8H 4D0DB 4IJ3C 4RFEA 1UWXH 5EOCL 2IPUG 2ADIA 4X6CF 4ELMA 5FM4A 3DRQA 4QHUA 4HIXL 5TDPA 4WJ5B 4JFED 4BQBA 4K94C 2F5AL 3HG1B 4OLZH 4YC2C 2IBBA 3LKQA 1HWHB 1SY6L 2PTVA 2D0HA 4O2CA 1PX3A 2AK4E 1A4KB 3HMWL 2YD8A 2JIXB 5C0GA 4Z0BL 1JPTH 2HMID 1FN4A 4BUHA 4WWKA 4LCCA 2PO6B 3PQYD 4KK9C 1RVFL 2HFEB 2BFVL 1M7XA 3HN3A 5MHSD 1FNSL 2OSLB 2DQCH 2DLEA 1D6VL 2EH8L 2KZ1B 4LDEB 4PY7A 1QR1A 4C83B 2F19L 3PV6B 2CKBB 1D5XB 2DB8A 1EEZA 4QGYA 5A40E 3A6BH 1GZPA 2DQFA 5H94A 5TDNA 3GJEB 2A6KB 3QG6B 1NMBL 2AV1B 4CGTA 4XNXH 3WMSA 1T04B 1T5XB 1BVLB 4YEEA 3CX2A 1GGBL 5FYLH 3BKYL 2WBWB 1NUNB 2CDFA 5HYJE 5I1HL 1EHLH 5E95B 4OZFG 3MRBA 3NMEA 4RNRA 4WI2A 1XGPA 3PWPE 2VR4A 1UCBL 5ISZA 1KYOJ 1JV5B 2ED8A 3KPLB 2BDNL 2C3VB 4LHQB 2I60L 1QFPA 5AWNL 5E1HB 1S9XB 4OGXH 1WZKA 1NBYB 4JRYE 4YH6A 1W0YT 2IQAA 1AQKH 3RGVC 3UJIH 5ILTH 2V17L 1YQVH 1SHMA 4OLVH 5D71L 4LAJH 4AM0A 2CLZA 5CBAA 5FYJE 1YYMH 5IQ7H 5EZIH 3TNMA 1Q8MA 3CK0H 2ARJA 4WWID 4JFDA 4D9LH 4PJCB 3B5TA 3T0EB 1MVUA 4PJIF 3VFOA 3LPGA 5J7CC 3VFTA 4G6AD 4K8RC 4YHMH 4E0RB 3H42H 2VQUA 3FHAA 3IS0X 4KDTC 4O02H 2R23A 4HULB 3QDGE 2R1XB 3FFDA 4HK3N 2FBJL 4HSQA 5D1QC 4FFYH 2Z8VC 1XGTB 4YPGA 1EAPB 3EZJB 4ONFH 4JREB 4RFOH 4ZUUA 1T2QL 3BKML 1OGAE 4LCUB 3TWCL 1DN2A 5TQ0H 3C2AL 5JA9A 1SBBA 2ZUUA 5EZOL 2HJKB 3I2CL 4QXTA 5KVGL 5IEHB 1J0ZA 4M93C 4NYLA 5K9KB 5K93A 4Y4FB 1U8LA 2YK1L 4LSVH 4KKLD 4LLVA 4H26B 2ZCHL 1VCAA 5GXBB 2DTMH 4KUZL 5BS0A 1GYAA 3QJFA 1AGCB 4XC1H 4XX1E 5BV7B 1JFQH 4GXVL 3OZ9L 5BCAA 4Q9QL 3MLWL 1A7NL 5EC1B 4EN3A 4ZAKB 1TETH 3AB0C 1WTGT 3FT4B 3L7EA 4JHBA 5DMIH 4OF7A 4P0DA 3INUH 4TNWK 4ZQKB 2GUOA 1QBML 5HJ3A 1N3NA 1WGOA 4ZSOB 2EDTA 1YEHL 3GO1L 5HD8C 1XZ0A 1OTSD 4QWWC 4YQXH 1FDLH 3HZMA 5T3ZL 4IRSA 3VXUA 4NOFA 5DJ0B 5D7SH 3G08B 5E2VH 4HXAL 4JJHA 4P5TB 3QDHA 4NWTH 5K9JH 1VADA 2XWJA 4JRXE 1FL5B 4P2OB 1WIPA 4OZFH 1WC7A 1GGUA 2FJGB 3DVNA 3VFVA 1HHIB 3OKOB 1IGFH 2I9TB 3PDDA 4NO5B 1T66D 4AQ1B 3FB8A 1JZ2A 1CIUA 4HUVB 3L5IA 5FF6B 1ZT1A 2YMXL 3X3FH 5FGRA 4IDJH 5A43C 4UV4H 3V52L 4ZO9A 1KCRL 1KNOB 1JWSB 3MBEB 3W11C 5HHXL 5LGHL 4ZXBA 1FVDA 1MREH 1I9EA 5D6CB 2QQKH 4PLNC 5D2NE 1DANU 1J8KA 1OAKH 1S9KC 2YBRA 1FG2B 1CLOH 3RKPA 4LCYA 3EJJX 3BISA 4Y4HA 4OF3A 4NRZB 5E8DH 2H3NA 2VDNH 4KK8C 3DO7B 3UTSD 4YHYC 4KVNH 3TVMC 2O5ZL 4Y2DD 2NNAB 3GBLA 3M1BB 5GS2D 2YWZA 3N06B 4HZLA 1UJ3B 5KN5A 4WU7A 2G75B 3PNWB 1C7SA 3RQ3A 4LQ1A 1J10A 4R0LA 4HIHA 4RAUB 2PN5A 3MJ8B 5EU6A 2OJZH 4E41B 3BYYA 3OL2A 4DOHB 4JN1L 4MHHI 4LVOC 3RVXC 3IFLL 5I1IL 3UJJL 1KFAL 3GUTA 2GTZA 5I1EH 3IGAA 4JCMA 4M7ZC 5D8JH 5GS0C 3MLVL 4YXLL 5HYQB 3DOSA 3PXHA 3GB7A 3OKMA 3BZ4B 2J4WH 2Y07L 3SJVB 5IQ9A 2W9DL 1CGWA 1N64H 5IB1A 3K0WA 2VLLA 3QSKB 3T0VA 1KLFA 4ONOA 3RWJA 4QOKE 5JHDA 5FKAB 3BKCL 4JQVA 4OZIB 4JE4B 4TSCH 4NN7B 3EUUA 5IFJB 4NZDA 1GXEA 4G7VH 3GI8H 3BAEL 4PS4L 1PLGL 2EDFA 1GGYA 3C6SA 2A38A 2FJHA 5E8PB 3S7GA 1ERNA 2IANE 4F7PA 1CL7H 4N68A 2X6MA 4I77H 4D9RE 1JPST 3FQRA 4XP6H 3STZB 3MJGX 4DZ8A 1I7RB 4JFQA 3T0BA 4UDTA 4D0DA 4HQQL 3NACH 3GGWB 1U3HB 3L5JA 3L7FB 1PSKL 2XN9D 1QYGL 3DARA 5EN2B 1O0VA 1JNLL 3HG1A 5T5FH 3DUHA 2CUMA 1OM3H 4WTWA 1A4KA 2VXVL 2JIXA 5IBLC 2MWCA 4HIIB 3JZ7A 2D4FA 2EDBA 1ZA6B 1ZE3C 2PO6A 1RULL 1S78C 1KIPB 3IXTB 4BH7A 2HFEA 3QEUB 3VMPA 4B0MM 5IVXB 2BY3A 2P5ED 2OSLA 1C1EL 3OAZH 1C16A 2VH5L 2Q3ZA 5BXFB 2YRPA 1F4WL 3FMGH 4RBPK 5F7EH 4OF0A 4C83A 5CCKH 4KK6C 1QSVA 3SDCD 2CKBA 1U3ZA 1LDPH 1D5XA 5C2BL 3WE6A 5J13B 3MXWH 3FQNB 4RCAA 2VDQL 4U0RB 3QG6A 2A6KA 3EJZC 2AV1A 3JV0A 1QFUL 3D48R 1T04A 4JM2C 5CS7A 2X9XA 2DQIL 3V6BR 4YK4B 5B8CC 1BVLA 1HKLH 1IAIL 2OR9L 5C0RL 5JQ6H 1T21B 1UACH 4DN4L 3NCEB 4F58L 4Y4KB 1OB1A 2VDKH 1F3DJ 1NFDE 3WEXB 5HYIA 1H3GA 2BVUA 4H88L 1D9KD 1JV5A 3KPLA 2C3VA 4YPJA 3BOVA 1IGTA 1QSEE 2RCSL 4XAKE 4LLQB 1AFVL 1DEEB 1LK3H 1NBYA 4UNTA 4D0BB 3U4EB 3MV7A 4PRPD 3QIUD 1ZVSA 4F9LA 3O9WA 4LKXA 5C0EB 3C5ZB 1ZHNB 1MIML 4G6JL 1J1OL 4KHTH 4URTB 4JG0H 2F53B 1P5UA 3BZFB 3FAWA 4PJCA 5CLTA 1CS6A 3G5VA 3DI3B 4NN5B 1J8HA 3T0EA 1MEXL 1YEKL 5D96B 4H0IA 2Y72A 3C60A 1BZ7B 3CMOH 4JKKA 3SE3A 4E0RA 1NAKH 3S6CA 3GMMB 1FAIH 2R1XA 4QYOB 5SV3A 1CGXA 3CC5B 4WY7H 3RZCB 1I8MB 3KYNB 2WAHA 4X5XB 5JNYB 4HKBB 1XGTA 2XQBL 4Z18A 1VEOA 1EAPA 4EI6B 2P5WD 1ADQH 3FFCD 3SDAC 4X7TB 5CJQH 1OWRM 2VDMH 4LCUA 3C5SB 3FRPG 4DVBA 3CFDB 1J1PL 3NIFF 1IEAB 4QXGL 2HJKA 3VJ6B 2VAAB 1RZJH 4L3ED 5IEHA 1FJ1A 4R2GB 4FQQB 2XZAL 1YEJL 1IGCH 5FDYA 1TPXB 5IMLB 3ZKXB 1G6VK 3HE6D 5DT1H 5F7DA 2IAMB 4H26A 3R1GL 2EZ0C 4X4YB 4KJWD 2ZOLA 4HC1L 4IRJB 2ENYA 3FRUB 3TP4A 4ZPTA 5TQ2L 4KRNA 1N6VA 4H0HB 3MV7D 5D1XD 2VLKB 3QRFM 3OB0K 4FTVD 4H1LB 5EC1A 1NC2D 2JJTA 3CLEL 3FT4A 5FYKU 3VRJB 1IRAY 2NY0B 4JDTL 5FYJL 1S7UB 3HZYA 3PF2A 3IDNB 2EYTB 4YAQB 2YUVA 4MQXC 2R0WH 2DD8L 2W38A 3CDFA 1I3RB 1C08A 3ZO0A 5GGTH 1VGEL 1UVQA 3P4OB 1CD9B 3HFML 1H3PL 2NR6D 3QUYD 4FP8L 3QG7L 4Q2ZB 2P7TB 4P2OA 4GBXC 3SKJH 2FJGA 5HI4D 2DBLL 1HHIA 2VE6B 5IMOB 3OKOA 2I9TA 4LSQL 1JYVA 5A3ID 2Y06L 2Q8AH 2GCYB 4HUVA 5J11B 5AZ2L 5INDA 4IRZH 3VH8B 1E4XL 3MRRB 1O7VA 1KNOA 4JFXB 3MBEA 1SVZA 3ISWA 1QO3B 4JFYB 5D6CA 1MRFL 2BVOB 3IT8D 4U2YA 3WFCH 1FG2A 5DK0A 4ENEC 4G6KH 5D4QA 3QEGL 4NRZA 5C07E 3VFWB 3OHXB 4OZGE 4S1DC 1UA6H 3QB7C 2MNUA 4M7LL 2NNAA 3EYOB 2YD7A 3M1BA 4UTAL 2JE8A 1UWGH 2E6PA 4ZG1A 1T1WA 4MHHG 2G75A 3PNWA 5KVEH 1AKJA 2NTSP 4JO2L 3CZJA 5I2IA 1NBVH 3GK8H 5MEPB 3U1SH 3WNMA 3MJ8A 2AJ3B 4GLRI 5HGBB 4E41A 4EBQH 2ZSVB 3AUVA 2DS4A 2VLRD 4LSPL 2Q87A 4APQD 2NY6C 4PV8A 3RWDB 1IMHC 1JK8B 3U7YL 2YD5A 4M1CC 5I71C 3VU2A 2UWEE 1Y6MR 1ES0B 3FQWB 3ZLQC 1KXTB 3SJVA 2J88H 4JPIB 3VXMD 4PLKC 5J4MA 5JHLL 2EDLA 4JY5L 2H9GB 2J7LA 2VB5A 4IJ3B 4AL8L 3ARGD 1A7OH 3BEVB 2CK0H 3DSFH 1W0VB 2MCG1 5J0BA 3RPIB 3RKDC 1FGVH 2VWEC 3HC3H 2V5TA 1NGPH 2DQUH 2QHRH 5IB4B 3LHPH 1NCCL 2OL3B 4X0KA 2MJWA 4ZDHA 4Y19E 2ICWB 3IAPA 3DXAD 5EBLB 5I74B 4LIQE 3E0GA 3T1FB 2DICA 1KB9J 3STZA 3P3YA 1CK0H 1X5AA 4U1HB 5ADPL 1ZXQA 3D0LB 3GSNH 3GSRA 1NLBH 1I7RA 3LCYA 3CVIH 3BMWA 4XNMB 5DGRA 4G8GE 3GGWA 3I6LD 3L7FA 5CP3A 1TTGA 2JJSA 1CFNA 4U3HA 5EN2A 4GH7B 3ZL4H 5D9SB 5JLZA 1DTUA 2APWA 5IJKA 1FRGL 4XNYL 1QFWM 1CQYA 3IDJB 3DI2B 1GGTA 5JPNB 2B0SH 5FUOL 1B4JH 1N0XH 3GI9H 1ZA6A 1R5WB 2X4UA 3MCKB 1KIPA 3IXTA 1NBZB 1QSZA 3W0WE 5DQJB 1S5HB 5HDQH 3ZTNH 2G5BB 5T3ZD 4PJDA 4UIKL 3LRHA 1T4KB 2BNQD 2ORBL 5BXFA 2CLRB 3VWKC 2DKUA 1I8KB 2DJSA 4NOBA 3WIIH 3BT2H 4XCEB 1EBAA 4DFIA 3AAZA 4I13B 1T83C 4HIEB 5ANME 3AGVA 1R3HB 2E3VA 3PHSA 4X80L 3MYJB 1LE5A 3B3IB 5HY9B 4FA8A 5D2LB 1PY4A 2AQ3A 4NHUB 4YJZL 4JJ5B 2PR4H 3FT2A 1T21A 1ZS8B 4M7JL 5KSBB 1H3XA 4XVTH 1NDGB 4LCWD 2ICEB 3BGFB 1A4JA 5CZVL 3WEXA 4EDWL 4OLUH 4DVRH 2HT3C 1O5DT 3DYPA 4UUJB 3HMXH 3MRNB 1URLA 1DEEA 4M8QB 5TE7H 1QKZH 5DTFB 3PUCA 5D7LA 1SM3H 4OM1H 5D1QB 1UENA 2X1WL 4J6RL 5EZLB 3U4EA 5DUPL 3LN9A 1DQJB 3T77B 3K8LA 4HH9A 2X70B 2VWEE 3C5ZA 5C0EA 4AY0A 2DYPD 1W72L 2D0FA 3THML 4W4NA 5HHMD 2NX5D 4XP1L 2F53A 2MFNA 4OTXL 3BZFA 1KEGH 2AJSL 1VFUA 1CVSC 4L4TB 1FIGL 3RVVD 5IB5B 4TUJB 4M93B 4ZSOE 3KJ6L 1BZ7A 3S3PA 1DVFD 3CLFL 3WKNA 1KLGB 4TNVK 5F1NB 2H32A 4CMMB 3KLSA 5J89A 3TPUB 3LOWA 5JW4M 4JPVH 4PJBB 3T0WA 4QYOA 5FYKE 3BGMA 4FFZL 3RZCA 1I8MA 4R4FL 4X5XA 5JNYA 4HKBA 3UYRL 3VXSB 5SWZB 3JV4B 4X7TA 4KRPD 1GJIA 4ZNCD 3C5SA 3MLTA 4L3AA 4ORGB 3MRKB 3A67H 4PRDA 3KG5A 5EO1B 3VJ6A 2VAAA 3ZDYE 4JFFD 4RAVB 2A9ML 2WWMD 4FQQA 4BFBD 3VG0L 5GS0L 3B9AA 5IMLA 2EKSA 3G6JE 3SEPA 3QUZB 1T89A 1E28B 1BGXL 2NXZD 4NO0D 2IAMA 4X4YA 4GW4B 4U1GC 3EOYG 4O9HH 2WINB 4LFHG 4IRJA 5CEXA 4OIIL 1AO7E 4WI8A 5D7LD 1KCVH 2NY7L 4M7LT 3RI5K 2VLKA 2X40A 4H1LA 1CFBA 4IOIB 1DBJH 3TLRA 4DTGL 3VRJA 4PJ5B 1S7UA 3P40A 5J8OA 3GHBL 3IDNA 1YPZE 5F93C 4JG1H 2ID5A 3V6OA 3H7BB 2EYTA 4YAQA 1CTOA 1VGKB 3V8OA 4XB7A 5DD5L 1I3RA 3X13B 1HQ4B 1MCCA 3BP6B 1I8LA 4KDVA 3WDHA 3P4OA 4Y5VA 1QSFB 4K23H 5EU7E 4UDUB 4HS6B 5E2TH 2DWEB 4WI6A 2P7TA 4JKLA 1A21A 5GGVH 4AEFA 3TYGH 1NDMB 4YHYB 1XCQA 2VE6A 2R69H 5IMOA 4C56E 4RMRA 5GGSB 3TVMB 1D5BB 5E99L 1CDJA 2GCYA 4XBPB 2HKHH 4AEIH 4PD4K 1YEDB 1HXMB 3VH8A 2XZCH 4XMLL 2ZCLL 4GQ9L 3MRRA 5C0CB 4JFXA 5MERA 3BRDA 1H5BC 3SCMD 4LVOB 2BVOA 1CLZL 4NCDA 4J8RB 1INDL 1R3IH 4WUUB 4P2QE 3VFWA 4IOFC 1T3FB 3OHXA 3PL6C 4OCXL 5ESVB 1G6RB 5KVFH 4G6FB 5KSVB 4OCNC 4M5ZL 4QXWA 4JKPL 2ZUWA 3EYOA 4N90E 5KG9B 1Q0YL 3KWWB 2FJFB 1MNUL 4PJEA 1J0JA 4P2YA 1OTTC 4KJPD 1I1AC 4N8VB 5MEPA 3O6LH 4P57A 2ZSVA 5FYLE 1P4IH 4PJCF 3RWHB 4P5KB 2AK4D 3RWDA 3UCRA 2DQEL 4FABH 1F97A 1JK8A 5AYQA 1UGNA 3HRZB 1FYTB 4XRCA 5L88L 2XZQL 2XV6B 4PP1C 5FGCE 5KTEH 1ES0A 3FQWA 3U0WH 5IVXE 3TJEL 4P4RB 2Y4SA 2CDGA 2H9GA 2BNRB 2N56A 2A6DB 3LKNB 4IMLB 1EGJL 1SEQL 4KV5F 3BJ91 3BEVA 3W9EB 2B2XH 4YHNB 1W0VA 1H3TA 3DSNA 4PJAB 1CDGA 1Q9LB 4FS0A 3RPIA 3C2SA 1DBMH 4RISL 3HKFA 1C12B 2VZOA 4QRPE 3CH8A 5F8QC 1LO4H 2ICWA 1EHAA 2YD2A 4N9GA 4OFYD 3W39B 3Q48A 3T1FA 3KPSE 2DQDH 5HYJD 4DUWA 1ZGLM 3D0LA 2OR7A 1RIUL 5DYOB 3D2UB 3PWPD 4K9EH 3EYUL 5GZNC 4XNMA 5FCSH 4PRHE 3PWVA 1J5OH 5CJOH 4Z78A 5FV1L 3EDJA 1CICC 3F7VB 5E2UH 4NP4L 4YXHH 4JRYD 5D9SA 3WIHL 4UBDC 5KAQG 3VMOA 1TVHA 2VDOL 2HKFH 4YDLC 4QF1A 4MNGA 3GMOA 3J8F7 5FYJD 5JPNA 1CBVL 4U6VH 4V1DA 1R5WA 4DGIH 5HDOA 3MCKA 2W9EH 4NRXA 1NBZA 1TJGH 4NNPL 3SQBA 25C8L 5DQJA 4HJGA 3BH9A 3K1DA 2G5BA 1XGUB 3TBYB 4WCYL 1NPUA 3ZYOA 1T4KA 1KB5H 2CLRA 3QDAA 1EVTC 1MFAH 4KI5E 4XCEA 1K4DB 4M3KB 3QDGD 4M48H 2J12B 1B0GA 3BEWB 1HZHL 4HIEA 3RWIB 2OBGA 4I3RH 1R3HA 3ZDYF 4FXLA 1HNGA 2VO5A 5GSVA 3B3IA 5HY9A 3UTPE 1YEGH 4GLRH 4NHUA 5LJYH 2FGWH 3PWUB 1YJDH 2YR3A 4JJ5A 2J8HA 1OGAD 4JANB 3O4LE 4TQEL 5L0QB 5DJZB 5GJSL 2XQYG 1NDGA 4ODTH 4KK9D 1TVDA 1OAXH 1IC5H 5BW7C 2EIZB 2DQTH 4LIQL 4CJ0A 5IHUL 1JJUA 4XXCA 3VXQB 1PW3A 3BN3B 3NA4A 4UUJA 4Y16B 1B2WH 1WUNT 1X6NA 4KDTA 1CU4L 4M8QA 5E8EB 3V7AG 1XR8B 4X7SL 4PBVC 2FATL 5D1QA 5EZLA 1HHGB 4HWEH 5T1LB 2DL9A 2GK0B 1U8PB 4M9OA 3T77A 2X70A 1OTUC 3UJTH 3SDAB 4LSSH 1A02N 2QSTA 4PJHE 4Q9RH 1H15B 1DQQB 1S7WB 4M1DH 3QCVH 3PGFL 4K3DH 4POZC 4L4TA 3VE0B 4HCRL 5C7XH 4XCCL 3SQOL 4G7YL 5DK2B 5FHAH 4NKQB 4CMMA 5F1NA 1X44A 4OI8A 4YEFA 1AI1L 1B6DA 3MREB 1MCHA 4JFZH 3IFPB 3TPUA 4FFWC 1F6LL 4PJBA 4LRNH 2FECI 5F9WB 1NGWB 2AS5M 2JK5B 1UB5B 3MODL 1A64A 3TN0C 1NAMH 4F8QA 3VXSA 3KVQA 3RGVD 5IEKB 4JRXD 5SWZA 3JV4A 3JUYA 1AGBA 4TUKL 5TGBA 4OZIF 4PG2C 3EFFB 4ORGA 1RI8A 3VD7A 3MRKA 4N9OB 3BWAB 4WI3A 4GG6E 5EO1A 3QWRD 4NUGL 2FYYB 4RAVA 3ELAT 1UEMA 1NSNL 1RZIB 3EFDL 3MUZ1 1E28A 1YNKH 3O6FC 4GW4A 4P3WA 3A6CH 3DUUB 2VR5A 2WINA 3GKWH 4W6WB 5DHVB 5IFAL 1BFOB 1HSBB 3QUXB 1KJ2H 2KDGA 3O45B 2HH0H 3ARBB 3EAKA 4DKAA 1SYSB 1JZ5A 5CD3B 1LE9A 2R2CA 1QFHA 4XBGB 2DN7A 3LVEA 4IOIA 1NGZB 1NLDH 2DQGH 4GRLD 2GSGB 2ED9A 2VZSA 4Y5YB 2VDRH 4U3XA 1DANT 1OOAA 1LHZA 3H7LA 2PW1B 3I9GL 4DCQB 2BJML 1JF1B 3H7BA 1AXTH 4AIZB 1MCDA 2C7UB 1GIGH 3EW3B 2R8SH 1MHCA 2IQ9L 5CIPH 3X13A 1HQ4A 4XGZB 3BP6A 2MTPA 5IVXF 3CIQA 4Z7VB 3ZHDA 4NN6C 1QSFA 2ZUYA 3BW9B 4UDUA 3O6KH 5L2KE 4HS6A 5L9DL 2DWEA 5FYKL 2W65B 5GGQL 5J12C 2NY3C 4TYUA 4ZD3L 4HXBL 4OB5H 1LGVA 1NDMA 5CEYB 3WXWH 5GGSA 3TVMA 1FO0L 1D5BA 4PFEA 4XBPA 5F7UA 3WO3B 2JB5L 1ZLSH 3MRHA 3AXLB 1YEDA 4QOKD 5HD8D 4CU6A 5C0CA 3CSYA 3QCUH 1DEDA 1RZJC 2QR0B 1X7QB 1CFVH 1L9MA 3MRMA 1RY7B 2NY6B 2IAND 2Q76A 3N85H 1MCWW 4Q97A 3K81A 3IJYB 4ODUB 3NCJL 4FN0A 4NBYB 4U6TA 1MJ7H 4D9RD 4Z7WA 1QNZL 4Z7UB 5ESVA 3RWFA 2NY1C 1I1RA 5KSVA 3HI6L 4L8SB 1IM3B 4AMKH 5CHNA 2NZ9D 3BN9C 3KWWA 2FJFA 5FXCH 4JO1H 2CMRL 2EH7H 4ZO8A 1JCKA 1HEZB 5EA0L 1WBXB 5CSBA 5EU5B 1OAYL 3RWHA 4TSBL 1CDCA 3DMMC 4P5KA 2APXA 3WO4C 3QIWD 1I9RL 1JGLH 1FYTA 3HRZA 5C0IA 4O4YL 3WFHA 5ESAB 3S37L 1MCIA 2R39A 5IMKB 2HFTA 4PJXE 2XY1A 3P4LA 4KK8D 1DFBL 3EDKA 3NCFB 1JTPA 4OSUL 3MUY1 2YSSB 4P4RA 1MCFA 3SKOB 2BNRA 1R3JA 2A6DA 1NFIB 4IMLA 1MPAH 1MRCH 3GBMH 1JNHB 4PJ8D 1F2QA 3MRJB 3W9EA 4YHNA 3QHTC 4PJAA 1JPTL 4PGDB 3IDUA 2DLFL 5D2LE 4XCFH 4U1IB 3DECA 1VB9A 2CO7B 4TUOA 1AJ7H 2XFXB 2AJYH 3CFBB 2DM3A 3S96B 2BXZA 4UU9A 3W39A 5KSBE 2DQCL 1N59B 3WLWC 3JWDC 1XGQB 2C9AA 3VCLB 3D2UA 4QNPF 3IAGC 2VZTA 1QUNA 3A6BL 3EYFB 1FPTH 1QSED 4XAKD 4K2UH 4P9MH 3RWCB 5JORB 3F7VA 4PRAB 2XRAH 1AD9A 3UTTE 4XNXL 1N0LA 5KS9A 3ZE0F 4U1JB 3JWNC 1C5DB 1YEIH 5FYLL 5D1ZD 4P48A 3NFSH 1KLUB 1EHLL 5B8CA 3HI5H 4CAGA 1SVCP 5L7XH 3RL1A 4BFEA 4OV6F 1TITA 2G60H 2RFXB 2Q3AA 4DFHA 5J6GB 5DMKB 1TZHB 4OGXL 4JZOB 5EUOB 5C0BB 1K4DA 3QFDA 1AQKL 1OAZL 3UJIL 5ILTL 1YQVL 4OLVL 3T09A 2AEPH 2C4FU 3SDXE 1YYML 1VHPA 5EZIL 2J1KA 5IQ7L 1CG9B 5HBBA 3PWUA 4XPFH 3V4PH 4JANA 5F6IB 5J1AB 4EXPX 4XWGH 5BOPA 2CQVA 5DJZA 5ERWB 1X4YA 3C6LC 1S78D 4P2RA 3WJJC 4YHML 3L6FB 3TBTB 2EIZA 4HUNB 4O02L 2ZPKH 5F7YC 4KKBD 1RU9H 3SGEI 5FIEA 1BF8A 3VXQA 4FFYL 2VQTA 4Y16A 5E8EA 2Q6WB 1JMXA 2YPLB 4ONFL 4RFOL 4GT7A 4BKLB 1Q9KB 1HHGA 5T1LA 3ULVH 2CXGA 2GK0A 1U8PA 4NZTH 3VWJB 3FJTA 4KQ3L 3C87A 1XF3A 2IG2H 5TQ0L 4TULH 5MEQB 3SDAA 1H15A 4JM2D 4K7PY 1DQQA 3HZKB 1S7WA 1HHHB 1EHXA 4LSVL 4L4VE 3VE0A 2UY6A 4QHNB 3JV5A 3GSOB 3UP1A 2AXFA 2DTML 3SKUD 4NBXB 2YRLA 3MREA 4J3TA 1I8IB 2JJWA 3IFPA 4XC1L 1JFQL 1LDSA 5JR1H 2XXCB 2JK5A 4LPTA 3B4NA 1TETL 1UB5A 5DMIL 4XPGH 1AR1D 5IEKA 3QXVA 1WBYB 3LQZB 1G9MC 4UT6H 2UWEA 1SMAA 3IKCA 4NM4H 3RTQC 2WBJC 2FB4L 3P0YH 2FYYA 3ULUH 1CLYH 3BFOA 3L3OB 5F6HJ 1FDLL 5F7LB 3OKDA 1I1YA 1TTUA 3C8HA 4IEFB 4MQ7B 4BH8A 3GRWA 5D7SL 5E2VL 4YNYA 1C8PA 4OCMC 2PYEB 3DUUA 4NWTL 5DHVA 5K9JL 3MV9B 5H35B 1BFOA 2D7TH 1FE8H 1HSBA 3O45A 3WNPA 3ARBA 4RGOH 5AG8A 1XGRB 1SYSA 2Y9RT 1IGFL 3BO8B 4Y7MA 4XBGA 5C07D 5IESH 4GBXA 3ME0A 1NCNA 3FAXA 2ARWA 2GSGA 1AR2A 1KTRL 3T4YB 4NSKA 7FABH 3EO1B 1VACB 3X3FL 1LO3H 1A7RH 4IDJL 2PW1A 2UVFA 4UV4L 3VGAC 5E4EC 4DCQA 4FQXB 5SWSB 1JF1A 4WNQA 5DS8B 4AIZA 1MLCB 2CLVA 1MREL 5D6DC 4BM7A 3OKNB 1J05A 1OAKL 2GJJA 1P5VA 4XGZA 3U46A 3BESR 5EOTB 5IK3A 2AW2A 1LNUA 3VXTB 1H5BB 2F5BH 5E8DL 4Z7VA 4ERSH 2VDNL 3BW9A 3MOQA 3L5WB 1YMHB 4KVNL 3UBXI 1IQDB 3U83A 2W65A 1JGDB 4F2MB 3PL6B 1ONQB 2FX9H 2VLJB 3ZZ1A 5IJVB 5E94A 4G8IB 2OJZL 5D2LF 1BLNB 2YUZA 2X09A 2EKJA 4UT9H 1KELL 1RUAL 3AXLA 4OLWH 3KHOA 5HVGB 4MQXD 4CDGC 2WZPD 5I1EL 2ZCKH 5KSBF 2QR0A 1X7QA 4DW2H 1QLEH 5TPWL 5D8JL 3L1OH 3LQMA 4ZUVA 4NZJA 5KJRH 1A6WH 5IW6A 1U8QB 3OXRA 3IJYA 4ODUA 2J4WL 4MA1C 4Y19D 4MCYB 5I8EB 5ACZA 1YQ2A 5C2UB 4Z7UA 4OLYH 3VDAA 5I16B 5EDXA 4QRQB 2QADB 4ZUTB 1S9WA 1IM3A 3M17A 4L8SA 4YBLB 4TSCL 3QISA 3MRIB 1OHQA 4G8GD 4G7VL 5HHQB 1XEDA 3MLZH 3GI8L 5CKGA 3QR2A 2B1HH 1WBXA 4D8PB 5EU5A 2MHAA 5GIRB 1Z9OA 1AGFB 1FCGA 4ISVA 2Z9TA 2AEWA 5I9QC 5E08H 4HK0B 3FCTB 4U1MA 1CL7L 5HHOE 1B9ZA 5DFWH 3SDDC 2PXYC 4HHAB 4I77L 1REIA 1QRNE 4ENED 4XP6L 4PJBF 2Z31C 3W0WD 5AUMA 3BYTA 5LKNA 3NACL 4KUCF 2YSSA 1U8KA 3DX6B 4N0UE 5FO9B 3SKOA 3ECBA 2W07A 1E6JH 1G7QB 1ZT4B 3ES6B 1Z0MA 3C09C 4X8XA 1HHJB 5T5FL 3H9YA 4HS8L 5ABDE 5FV2A 2D2OA 3MV8B 3ZE2F 1OM3L 5DEZA 1CICB 2EDRA 4PGDA 2NY4C 1P7QB 5DQ9A 2V2XA 2WWKO 4GRWB 2A6IB 3DIFB 4I48A 5H8DA 4U1IA 1KCSH 3OKLB 3CZFB 4P23D 2XFXA 3CFBA 3H0TB 1NEUA 5IHBA 3UMTA 4PB9H 2KPNA 3FMGL 5DJAB 5F7EL 3K3QA 1ZMYA 1XGQA 5CCKL 3G6JA 4G8EB 1A1NA 3VCLA 4Y4FD 4PLKD 5FA3B 3S97C 1LDPL 1JWUB 2HT2C 3VI3E 1BX2B 3VWKA 2EE2A 1UCTA 2Y23A 4PRAA 5KVMC 3VD4A 1FZJB 4I5BB 1HI6A 1T83A 4GAGH 4MWFB 4TOYL 4LNVA 3BXNB 1HKLL 5JQ6L 1C5DA 3RVWC 1BQUA 1UACL 4J23A 3DLQR 2J3SA 1DBKH 1KLUA 2XY2A 3T0DA 1RHHB 5E5RB 5C9KA 1CN4A 1E0OB 2YA2A 3JSSA 3BH8B 4K3EH 4NC0B 4WHYG 1YPZA 3ARED 3BDYH 3QFJB 3L5HA 1WCBB 3UX9B 3OJDB 4HWBH 5J6GA 3CU7A 4WTZG 5DMKA 1LK3L 3VD9A 4L9LB 1TZHA 1QP1A 5MEOA 3MFGB 2OZ4H 1U95B 5FYKD 5BJTB 2B7DT 2EXYC 1CG9A 4ODSH 5DJ2B 4KHTL 4JG0L 4NJ9H 4R4NC 4XH2A 4PGBB 5J1AA 3T8XA 5M7QA 3KLAB 1EHNA 1RPQA 1YECL 4OI9A 4BZ2L 4JY6B 3WDJA 3L6FA 3TBTA 1NAKL 4RAHA 3MMEB 5DDHB 5DQDH 3P9MB 1FAIL 3ET9F 5C0FB 2NXYD 3WUZA 4WY7L 3VWKD 5CD5C 3HE7C 5JOEA 1AO7D 3GNMH 2Q6WA 1JGVH 4PD4J 1ADQL 2YPLA 4UQ3B 4BKLA 1Q9KA 4K9EC 2AI0H 2VDML 5CJQL 3S9DB 4P4KB 2O61B 3CVHB 1S9VB 3FOLB 3TN0B 3MJ9L 5MEQA 1AGEB 1RZJL 5F7FA 3D39B 3NPSC 3DTXB 3FO2B 1IGCL 3QI9D 3HZKA 4NQSB 1NMCC 3WIFA 1HHHA 4MXWH 5GGSY 3WHE0 1WFOA 4FQLH 1S7XB 3FB6B 3GSOA 1KIRB 3FZUD 2ILLA 2VXUH 1I8IA 4RMQA 4YO0B 5CGMA 2X4TB 3HUJB 2YPVH 4S1SH 3VD5A 3IJSB 3D25B 4MNQB 3ZDZF 4DGVH 4UAOC 3IFNH 1HKFA 1KACB 1IT9L 2YC1B 1N7MH 5MP6H 1WBYA 3LQZA 4FZEH 2VMFA 4LLUB 1YMMB 3DPBA 4C56D 4ZO7A 4PJAF 1A2YA 4OBRA 1E4KC 2R0WL 1UYWL 5HGHB 4P59H 4WDIA 1DDHB 5GISH 4FQ2L 3L3OA 1YJDC 2F54A 5DRWB 1N4XH 5GGTL 1CGSH 5FUCC 2D03H 3V0WL 4MQ7A 1UM4H 5JIKA 1JZ3A 5I1DB 4G43B 4CKVX 2PYEA 1ED3B 2ZUQC 3VXOB 5H35A 4O2FB 5FO8B 3WHXB 4ACPA 2ATKA 3SKJL 1IAMA 1XGRA 4WHYH 3L3GB 5IGXH 1HH6B 1FG9C 2IMNA 3LQAC 4FQJH 4P2QD 5CINH 3O3EB 5FGBC 1JHKH 4CADB 2Q8AL 1MFDH 2NY3B 1L9NA 2GAZB 4N90D 3B9DA 3IU4H 1JRHI 3N1MC 4IRZL 3T4YA 4YE4H 3EO1A 1VACA 5A2KH 4FQXA 3NIGE 5SWSA 1U3HD 5DS8A 3V79C 1G7LB 1MLCA 5L8LB 3OKNA 5FYLD 4XPBH 4W81A 3UBXG 3FN3A 3GSWA 4G6KL 5JTWA 3JWDL 4LVHB 3PJSB 2UUDK 5EOTA 3VXTA 3BD4A 1H5BA 5AAMA 2EDWA 3SGEH 4WEUD 3BUYB 1CI5A 4BSJA 1UA6L 4ZFFA 3D1MC 5T33H 1GC1C 1JGDA 4KPHH 4F2MA 1UWGL 2XWBA 3PL6A 1ONQA 4GXUN 3FQUA 5DURD 2VLJA 4HIJA 4QTHA 3UYPA 5KVEL 4MJ6B 3GK8L 4G8IA 3U1SL 1RZ8A 3B8YA 4EBQL 1A9BB 1BLNA 2OQJA 5KOVC 3LY6A 5JOPE 3MRPA 5I66B 1I1AA 5I15H 2WQ8A 4R97C 3KAAA 3DMMB 4HGKC 3WO4B 3ARSA 4QRPD 3OR7B 1U8QA 2MQ3A 4X6DE 5DWUH 1JWMB 1LP9A 2E7MA 4KQ4H 2J88L 4B53A 1WTLA 5I8EA 1B4RA 3KPSD 4Y4KD 3EYQD 4KKLC 4ZUTA 5HVHC 2CK0L 3DSFL 3MRIA 3JBG7 4PRHD 1EPFA 5IBTH 5I8KH 5EOCJ 1FGVL 1BQSA 3HC3L 4D8PA 1R5IB 2XWTB 4PUBH 1NGPL 2IH3B 2JELH 2DQUL 5GIRA 1AGFA 2QHRL 3LHPL 2YA1A 4HK0A 1CFSA 3FCTA 2FH8A 1T7ZA 4HHAA 2F74A 1DSFL 1MFBH 2WK2A 1MJ8H 1CK0L 3HA0A 2V5RA 4E42B 3GSNL 3CVIL 3QDME 2XTJE 4IOFD 4LLDA 3DV4B 1OTSC 5FO9A 4D3CH 2QSCH 1G7QA 5FKPB 4XCYB 1JF6A 5E9DA 3ZL4L 1OTTD 3HR5A 5TE4H 4KI5D 3MV8A 5EUOE 5C0BE 3GM0A 1I1AD 3D85B 5I73B 2X4PB 4X6BB 1CICA 1EXUA 2HLFD 3IU3A 5B21A 1XFPA 2B0SL 2YXMA 3MO1B 4OV5B 1B4JL 3GI9L 3UTPD 1BPVA 1FFQA 2A6IA 5HVWA 2RIKA 1Q9OB 3O4LD 5IVOA 3GMLA 3OKLA 5IBUG 3DYMA 4UOW0 1T66C 4GUPA 3H0TA 4POUB 3ZTNL 4GG6A 1ZV5A 2VKWA 2WMPA 4MJ5B 4PP1D 4JAMB 4FFVD 5DJAA 4R7NB 3G6AB 3WIIL 4G6MH 4G8EA 3BT2L 1CF8H 3ESUF 1JWUA 3IDYC 3T1WA 4HMDA 1CDIA 3LMJH 1BX2A 3TZVD 3ZDXF 3E6HB 1YC8A 2BXYA 5E00B 1FZJA 5T3XH 3RVTD 1WFTA 3BXNA 3D9AH 4JO4H 2PR4L 4XVTL 4Y2DC 3H9SB 1SEBA 2G2RA 1RHHA 3H3BC 1NCDL 1YYLH 1H3UA 1BQLH 3BH8A 1RUKH 3QFJA 4OLUL 4Z7VF 4YHZH 5EBGA 3UXFA 4DVRL 1WCBA 5ALCH 1WAAA 2XTLA 3HMXL 5TE7L 1QKZL 1PKQB 4L9LA 4KAQL 5GZND 3ARUA 1SM3L 5IW1B 4OM1L 2WIIB 1IC1A 2OTUB 4KXZH 4ZMAT 2DQHH 4U1NA 1RZKH 1U95A 1MHEA 4GS7C 4ZS6C 5BJTA 3ZSSA 3BMVA 3ARQA 3QDJB 4PBWD 2ZG3A 1QQDB 3V5KB 1KXVC 4UBDD 1GZQB 5IM7B 5F89B 5DJ2A 1KEGL 3BD5A 3ILQD 4PGBA 4F9PC 5M95B 5C0JB 3KLAA 5DI8B 1R0AH 5HGDB 4JY6A 1ZOXA 1FSKC 3QULB 1Y6NR 3MMEA 4JPVL 5DDHA 3MZGB 3P9MA 1JGUH 5C0FA 1DE4B 3T2PA 1NGXB 4Z7UF 3MV9E 1T1ZB 2GFBB 1G9NH 1GGIL 4KY1H