1EZVX

Structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
EVKLQESGAGLVQPSQSLSLTCSVTGYSITSGYYWNWIRLFPGNKLEWVGYISNVGDNNYNPSLKDRLSITRDTSKNQFFLKLNSVTTEDTATYYCARSEYYSVTGYAMDYWGQGTTVTVSSAWRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ezvX00
2I24N 5J1AB 3DMMA 1S78D 5D9SB 1IKNC 4L5FH 2OJEA 4QWWC 1Z9SA 3LPWA 3L3JA 3VA6A 4ZAKC 3TA3D 3MUY1 1TTUA 2XFXA 4EI5B 1CZ8H 1D5XA 43C9B 1YEHH 3KPOA 3FQXB 1A64A 3CUPB 4E41B 3AREA 4Q7DA 1I7TA 5DJYB 1KG0B 4KFZC 2DQJH 1HHKB 3ALPA 3LH2L 5DRZB 3VFRA 5CINH 1A6VH 2LAAA 4S11A 3GIVA 2W9DH 3KYKH 4PJDE 5J1TC 5ADOL 4L8SA 4M9OA 1K3IA 3ZTJG 3ARBA 4R96B 1YEJH 3CCHA 2NY7H 1PKQA 3VFMB 1R3KB 3OKKB 4GKOA 2HTLD 4MNQE 4QF1A 3RWDB 1CLYL 3FB5A 4L3EB 5ABDE 2VLJD 1XT5A 3CXHK 4FFYH 4YGVB 3V6OA 5DSCB 4UI2A 1ZWIB 3ARDD 5ECJE 3W5NA 1K3ZA 5HHMB 2VL5A 3MLXH 4UIKH 4IMLA 1XF3B 1E4WL 1NGXB 1QEWB 4K3DH 4QHLB 2RHEA 4KK6D 5BXFB 5C0AA 3AUVA 4MWFB 4NN7B 1NC2D 1U95A 3BQUD 4MAYD 4PRAB 2UZXB 1A47A 1AHWC 2J5LB 4RMWA 3WN5B 4OZHE 4JR9L 1OB1B 4U1MA 3QG6A 2VLLA 3TO4A 2WW8A 1FLTX 1Y18B 4P9MH 4X98A 4G43A 4XVTL 3GSNL 1J0JA 3ILPA 1X4XA 2V9TA 4M6OH 3VXQA 1C1EH 4ISVA 1QZ1A 4X4YA 4F8TA 4V1DA 4X7EC 2C4XA 1F8TL 5HHXH 2MQCA 2VDRH 4KXZI 5DK0A 4E5XA 2YSSB 2X41A 5GRWA 5IK3B 3MLUH 4PGCB 1DLFL 4H26A 3EGSA 5I76A 3MQIA 2EZ0C 1K5NB 4G80B 1F3DJ 5IESH 3GSQA 1YPZE 2J8OA 1AQKL 1DBKL 1HQRA 2H2SD 3A6BH 4FTVB 5CSBA 1T89C 4UNUA 4EUPB 4DKEH 5HDQH 2N1KA 2F74B 1MFCH 1ORSB 3QWOA 1H3UA 2NNAA 2A83A 3OAUH 3QIUB 4OCYL 5T1LA 4MNQB 1K4CB 1RIVH 4KU1A 4XNYH 4AY0A 1RZJH 1ZA6B 2ICWA 2R9HC 3OKOA 3FOLA 4P2QE 1X5YA 3O3BA 5B3JF 4YHKL 2BSSA 3MUGA 4U6TA 1MCHA 3WO4C 2V7HB 4H5SB 4V2BA 3ZDXE 4XCCH 3FKUS 3G5VB 5IF0B 1JNNL 5IUSA 4B0MM 1WBZA 4OCNC 3W2DL 2LU3A 1F4XH 3MRDA 5LKNA 1RZ7L 1CLZH 5IM7A 1NCTA 3DVGA 2VXQL 1A3RL 4YX2H 4MZ3A 1F58L 2VDQH 1Z3GL 3LPFA 1NLBH 3B9KA 3S35L 4M7JL 4QYOA 1EHAA 3ULUL 2AV7A 4XNMA 1ZLSL 3HI5H 4JGMA 5HXMA 2Y25A 2X9YA 4ONOA 4OZHB 2NW3A 2I5YH 3RTQA 4C55A 4LSRH 3MXWL 1DQJB 4P23C 4UB0L 4LRIC 1JNHA 1HOCA 1KJ2L 1W0WB 2X89D 3L3DA 4MDIA 4BM7A 5I1LB 1OF2A 3HLAA 5CD5C 5GRYA 2IANA 1AI1L 4IRJA 1AO7A 2APVA 2XWTA 2FRGP 4OLWL 4ZAKD 1KCLA 2VITB 5T33H 3EFDH 4EUPH 2YPKB 3BGFC 4Y16A 1C5CL 3PGCB 4KTDL 5E24E 3MV8D 4J3XA 5F7EH 2C7UA 5L88H 1QBBA 4JO1H 3QIUC 1PSKH 1BBDL 5JOFA 3VFUA 1HK6A 4ZOAA 2D31B 1A3QA 3DYOA 3VFOB 4QCIB 3IETA 4JHBA 1TDQA 2NY3C 4O4YL 3LKRA 5LGHH 3LSOA 1U93A 2D03L 1HEZA 3P4NB 1BX2B 2IPKB 3MFGB 4GRLB 1GL4B 1WCBB 2Z31C 4ZYKB 5HHVL 1OARH 1VERA 2WWMD 1NUNB 2A9ML 5IMMB 1WK0A 2VC2H 1WFNA 3TVMA 2Z4QA 4GRMA 2Q7YB 5CEYB 1N64H 3BI9X 1Z6JT 1KELL 4NQUA 3N1PC 4J3TA 3KR3H 4XC3L 4IHOA 1GYAA 3WCYA 4TUOB 1I8LC 3HE6B 4F9LA 3T1FB 1MJ7L 4M1GH 5F3HB 4OZGF 5JOPE 1JK8B 4HJGA 4G6KH 3L3IA 1II4E 3ZE1F 1EJ6A 1ODAA 5EFIB 1NCDL 5EUOF 1KCVH 1F11B 5E2JA 1MREH 3HZYA 3Q6FB 4BH7B 1A6WH 3O8XA 4KPHH 1CD0A 5MERA 2BSRA 2PETA 2GQHA 3H8NA 1D5ZA 4HGWA 1F13A 3EO0A 3QDMA 5J57B 3VRIA 1E6OH 1JZ3A 5I1CL 4Z76A 2JCCF 4LQ1A 3HZMB 4PJFE 5DMJB 5GGVH 3I3DA 2E7MA 4LLWB 1N4XL 5ISZB 4EI5D 3DURA 2NMSA 1I3RB 3S8WA 4S2SA 5JO5B 2YD6A 1WEJL 1IEHA 2Y7QA 3RGVA 4EBQH 4ZUWB 1JGUH 2AEWA 4HEPG 3UTSA 3TLRA 2V5RA 5JW4Q 3G5ZA 3NAAL 1S7VB 3ELAT 2HVKB 3EO9H 1KPRB 4HX1A 4P4KB 3VGAB 2JJTC 2RQ8A 1T5XA 4HUWB 4Y5VB 1XCTB 4GRLC 5GSVB 5GHWH 4FABH 5I15L 5DA4A 4W4NA 3V2AR 5BRZD 3NIDF 3QJFA 4DN3H 3CXHJ 1CCZA 1T80A 4FFWD 3I02B 4FNLH 3CUPA 1S3KH 3B2UC 4E41A 1FAIL 5LQBH 3PABA 1ZGLP 4I18C 3GHBL 1UM5L 4EUPG 3MLPA 1LMKA 3HE6C 3P11L 1I1AA 1P1ZA 4RX4D 3BRGC 2DI9A 4JFEE 3H3PH 3OKYA 4MNGA 1X5JA 1ONQA 4L3ED 4XRCB 4PGEA 3VJ6A 3F7PC 4NP4H 1KPVB 3J8F7 5DMIL 1OP9A 3LEYL 4I0PB 1BVKA 4HD9A 3X17A 2R2BB 3PV7A 2R9HD 1UJ3B 4U1JA 3TNNB 4FQQB 4ODTL 3WHXB 2V5YA 1ZHNA 3OKKA 3SPVB 1UB6B 1Z9OA 2HJKA 2CRYA 1I7RA 5E08H 1J88A 2IH3B 4P3DB 3T3MF 3HI6L 3VDAA 2BVEA 1I9RL 3P4MA 1R24A 5I9QB 1F4WH 1TZIB 3WUWA 1FZJB 1UCBH 5FB8B 2WWKT 2WBKA 4PJFB 2X5PA 3OV6A 1NGXA 2VSDA 2YXFA 4NO3A 4ELKA 2A77L 3SDCA 3P9MA 4X6CB 4C83B 5JORB 4MJ5B 4AJ0A 5IJKA 5L2JB 1CIUA 4XT1C 4MWFA 3HRPA 4HUUA 5E1AA 3OXSA 5IB3B 1J8HA 1R6VA 3DX7A 4P23D 4GFTB 1A4KA 2ZCKH 2XRAH 3P0GB 1RK0B 4BSWB 3WN5A 2D9CA 2M2DA 1F90H 3DOSA 4HFUH 1A6PA 2HMID 1C5DA 4JANB 4XB8A 1YDPA 1Y18A 3QIBC 1W72B 4XH2B 4M6ML 1XIWB 3UTQB 3MREA 4BZ1H 1BP3B 3ZKXC 3DX8B 2PYEB 2FR4A 3IS0X 5EU5A 3S37L 5EIIA 2BRRL 4G8IA 4ERSH 1ED3A 1O5DT 2EDTA 1I7UA 3K4AA 1Z2KA 2E9IA 1DQLH 2YSSA 3QIUD 3OAYK 5EZJA 4PGCA 4DWHA 4MNQD 5JPNB 2NY3D 3L6FB 4XP4L 4NKOB 4XBEL 4LNRA 4R7DB 4N0FB 3TGXA 1MCJA 4NKDB 4GG6F 4GW1A 5DD6B 5IMKB 1NCBL 1LD9B 3BD3A 1N6UA 1I1RA 3X14B 1MCCA 2UVEA 4GMSH 5DMYA 4R3SA 4P2RE 2WP3O 3BZDA 5I9QC 4JRWA 3SDXF 4ONGH 3OL2A 4UIMB 1K85A 3MZTA 3QR2A 1YN7A 1ZA6A 3EZ8A 1BZ7B 4QTIL 3KWWA 3RY6A 2R0LL 4PS4L 4XWOC 1QRNA 4LKXB 1KLGB 3D39A 3GFUA 5GISH 1RJLA 3HNTL 3QXAB 2D3VA 1KC5H 2J2ZA 3GBNH 4XXCC 5I1IL 2DKSA 1OAQH 1PEZA 2RCSH 2XNAA 1FPTL 2UZIH 4J1UB 4WVRA 2CLRA 1JE6A 1AIFA 2ERJB 3ILQC 1ZHLA 1W72H 1PZUB 1S5HA 1CGXA 1H15A 3BZFA 2C3GA 2DYPB 3RHWK 1JPGA 1T3FB 4RIRB 1LO3L 1Z9MA 2HN7A 3WS6A 1LNUB 1FG2A 2HKFH 4LRNH 5IG7A 4JRYE 1WIUA 3O3DB 3M8OH 4QOKA 3FRUA 4M48L 5EZLB 1VPOL 5FYLL 1W0WA 2D0FA 4H88L 4I2XA 1H3VA 5IGXH 1UZ6F 2NZ9D 1LE5A 4XMLL 2DQDH 3EYQD 3RDTB 4HV8A 4GJTB 2WSKA 5CJBA 4GRLD 2YPKA 4XAKE 3PNWA 4K9EH 2R2CA 4N8VB 5IB5A 1X5XA 2APBA 2DKMA 5CSZA 4XI5C 5CZVL 4NQEB 1X44A 4RGMB 3TIEB 1J0YA 2D31A 3JVGA 3DGGA 4FQCL 4QCIA 1BF2A 1JPTH 3QUZB 1W0YT 3HE6D 4HK3N 4JDVA 3WIFA 4P2RB 1D5IH 2V2XB 4FXGA 1J5OL 4NZDA 4TVPE 5GS0C 4ZYKA 3UJJH 1FGNL 4CMHC 1R3HB 4CVZB 3HG1A 2WINA 1R0AL 1RUML 5DRNA 2YUWA 5ESAA 5A3IC 4HCRL 2VLME 5HHQB 3S35X 4NN5B 2XPGA 2IADB 1KLUA 4HC1A 1CL7H 1U8KA 4QO1A 3DIFA 1N59B 4TRPH 1N8ZA 1A6AA 2CIIB 4HIXH 3W9EB 4PJCB 4OKDA 5FUOH 3F58L 3TYFB 3STZA 3QP3A 1FCGA 4XNUL 3BH9A 4WV1B 4N5UA 2A73A 3L5WA 5GGSB 5KVDH 1NPUA 5K9QG 1Q9WA 2AI0L 3TBYB 3L5IA 5DJXB 1L7TH 4DGIH 1NC4B 2FWOA 1DANU 2VNCA 5BZWB 5BCAA 4ODVL 4UT6L 4ZOEA 1OGTA 2BSTA 1EEZA 2Z35B 4M7ZC 4M61B 3VXOB 2Z93A 4JPIA 3KXFA 1UWEL 2BVPB 4XPHH 4P4KD 2DQFB 2P7TB 1QUNA 2P45B 3GMOA 4HWUA 5EU7E 5IBLC 4D8PB 2ADGA 3QWQB 2E7LA 1MPAL 5T3ZL 1CQKA 5IMOB 5KG9A 2B4CC 2D7TH 1AP2B 5EBWA 1LO2L 2DLTA 3QIBD 2GKIA 3NACH 5F7MC 2EYSB 2HVKA 1KPRA 1T1ZA 4YC2C 4Z0XA 3VXME 3BT2L 4HAGA 2WLZA 5EWIL 1EXUA 1XCTA 2OSLA 1JPST 3OR6B 4ZUUB 4I77L 4C56E 4J4PA 2VZ1A 1Y0LB 2H1PH 3FQNB 2OR7A 4YXLH 1NGQH 4G8FB 3C2AH 3QCVH 2YHGA 4LDOB 2F5AL 2FX8H 4B50A 3Q6GH 5EU4A 1GGTA 3MRCA 1DQML 1HSBB 2CIKB 2OS7A 4AMKL 1DUZA 4MNHA 4XVUD 3U48A 1E0OB 4WFGE 5E7FA 3BKCL 4JY6B 1JFQH 1JJUA 1TETL 5DD0H 2AJUH 4HAFA 3EOBA 4NQDE 5KTEL 4QXTA 3KHOA 1BBJA 2I07A 2Z8RA 2R2BA 4NSKA 1UJ3A 2FX9H 1T7VA 2DWDA 1D6VL 1A22B 1DUYB 1Z9LA 2FGZA 1P5UA 2V7NA 3KGRA 3IFNH 3MCLL 5I1GH 3RKPA 2E27L 2XQBL 4GBXA 2V2WA 1PJ9A 3V6OE 3L5HA 1WC7A 2W0FA 3BX7C 3ZDZF 3ILQD 2VMFA 4JREB 3U0PA 5K93A 1NGWB 1EO5A 2DQGL 4RMVA 5INCB 2H2PD 4C83A 1LE9A 3T65A 3QUMA 5JORA 1DQQA 2IBZX 3EYSL 1B0WA 4QXGL 3C60A 5IB3A 3HB3C 2GTWA 1F4YH 3AU1A 4F15B 1MCDA 1N26A 4DUWA 1JMZA 4OLXH 5ESVA 5DUPH 3B5HA 2Q3ZA 3W39A 1PY4A 4JFED 1FV1A 4CVXA 4QHKJ 2H6PB 5TFSH 3VFWA 5LJYH 1JZ6A 3PL6C 4C56B 4MDJA 3FT2B 3PE9A 4N8VG 4X7SH 1O0VA 1WVZA 4BFGA 3VXUE 1XIWA 3HPJB 2PYEA 3QH3A 5FKPB 4CADB 1V5JA 4OCLC 1G7QB 1T22B 4W70A 2D7OA 3DLQR 1T03L 5FHAH 2L0DA 5KSAA 5E2TH 5D1QC 4Z7NF 4XNXH 3P4LA 4V1DE 5E56A 3S5LA 4N9GA 5BS0B 5HD8C 3PWLA 4WI6A 1KGCE 1KXQE 3GEWB 4WTZG 2P43B 3U0WH 1CBVL 3QAZB 4NKOA 3WIHH 5F93C 5J11B 2IALB 4UINH 4PJHE 4NQDB 4NKDA 3ARFA 4IJ3B 4RZCA 2DJ4A 4L9LB 2YS4A 2Y72A 2VLKA 2IGFL 1INDL 2YKLL 3NZ8A 1E28A 1J1PL 3X14A 5A3ID 1PAMA 3DBXB 3FTGB 1HDMA 3MBEC 3GHEH 1BGXL 2LE9A 2J6EA 2XI9A 4L9DA 1HKLH 4OQ1A 4QNPF 4UIMA 2CH8A 2QSQA 1XF2A 2YWYA 1NGYB 4HKBA 4L29B 1BZ7A 4YDKH 5L2KA 1TZGL 5EU7C 3OG6B 3BP5A 4MA7L 4HIEB 5ANME 1M6OA 1TQBB 2VDML 1DE4A 4EI6B 2DYPD 4P4RB 3SDDA 1T0NA 4D3CL 2FSEB 1LHZA 7FABL 1K4DA 5EBMB 1VKXB 1OAXL 2YRZA 2ICWI 5FGBC 5BVJB 1AGBB 1NAKH 1OOAA 4KVNH 5C0CB 4YR6A 3CDFA 4Z0BH 1AD9A 4HS3B 4KTEL 5EOQH 1RURL 3I50L 4LU5L 5JR1H 4LSSH 3TBSA 3PP3H 5D2LF 3S37X 1CR9H 3LQZB 1AC0A 5IV2B 4AEHL 5JMOC 3GMRB 4Y1AE 3DMMC 3O2DA 3PHOA 5LWYL 2AJYL 3RDTD 5KZCB 2V9RA 1BWMA 4YIQB 2NY1C 3I6LE 4NUJB 4RIRA 1A6ZA 3FJTA 3NTCL 1CT8B 4K23L 1KEMH 4H25B 2FIRT 5IBLD 3IU3B 4P46A 1B0GB 1KENL 2VXUL 2VISB 1S9WB 4PJ7B 4UZGA 1FZKA 2WBWB 1EVTC 2I9LB 5CWSB 5JQHC 4IIQC 2V2TA 3AREC 3VXUB 2X4NB 5JW3H 1LO0H 3B5GA 1LEGA 2GW5A 4JPVH 4G9DA 3IJSA 4XHQA 4P5TB 3QPXH 2DS4A 3QUZD 1DVFB 1ZXQA 5JIHA 1CE1L 4LCWA 4P2RD 4TULH 5D7KE 1QSEE 4PGJA 1QFWL 4LHUB 2ADIB 4KMTH 1J0KA 1UADC 2IANE 2DB8A 1NMCC 1W2KT 4L8SC 1YEIH 3U4BH 3JUYA 1HCVA 5I17A 2UWEF 3ZYJA 3ARBC 4MXWH 4PJHB 3ALXA 3I84A 2EXYC 1IVLA 1YQVL 4L4VE 1D5MA 4FS0A 3K2UH 4JKPL 1G9ML 3IDJA 5HI5C 4M03A 2A6KA 5HHPB 5DRXB 2BC4B 4YAQB 5GGTL 2WQ8A 4F58H 3MRBB 3MGTA 2EYTA 2Q8AH 4WTZA 2FL5B 5GGRB 5DURB 3V6OC 4Z7VB 3TM6A 3HUJA 5C0FA 3E2HC 5D5MF 3UTZA 1NC4D 1MRCL 1IAIL 4NUGL 5ANMB 5FGCB 4LCIH 2PTUA 2W38A 4GAJH 4YDJB 4XPFH 4PJCA 5E9DE 3CLFH 3MOAH 1JI2A 4YUEH 1RZKH 3VI4F 3T09A 5DQDH 2R8SL 3VCLB 3NBNA 2Y4SA 3ZHDA 4YXHL 3M1BB 4JRYD 5I8EA 3FFCE 4LAJH 5BO1L 1GOFA 2EDYA 3RWJB 3S34H 4UMGA 1IC7H 3EOYG 5T1MB 3EO1A 2FD6L 3TBYA 4PBVC 3T0DA 5HY9A 3DO3A 3RAJH 3WNMA 5DJXA 2XN9E 4Y1AB 3OAZK 4QRSB 4QRPE 1OM3H 3DYMA 5FCSH 2R2HA 3SKJH 5F6IC 3SOBH 1FNGA 4XAKD 1NCUA 4BUHA 3X11A 4X5XA 1BLNA 3GMLB 2LTQB 4FG6C 2CR3A 3QDME 2BP3A 3DO7B 4KC3B 2MKWA 3UBXA 5E6IB 3S97C 3HB3D 43CAA 4BK5A 5FO7B 5C0JB 3GI9L 1ULVA 5JW4M 3PUCA 4LMQI 5E8PA 1EK3A 4QGYA 2DD8L 5IMOA 4N1EA 2AJXH 1QSEB 1CXLA 4ZDHA 3KLHC 4TVPD 3O6LH 3RZCB 4LVNC 4NKIL 4OIAA 3UTSE 3S3PA 2VLMD 3CXDL 5FM8A 3B3IB 1FG9C 4LCYB 4L4VB 2V5SA 4HIHA 5JA8B 1JPSH 3FHQA 3X13B 1AGFA 4D0BB 1OGAE 3BWAB 3ZKNC 5T3XE 4KKCC 3L3HB 4PLNC 4ODWB 5HGDB 1IGYB 4UILL 5GJSL 5SWZA 1FNEA 1OW0A 1U0QA 1U8HB 1JIBA 1S9XA 3MOBH 4PRIA 1NCWL 3LD8B 3MJ8B 5JXAL 3GKWH 3QZWA 3ZSTA 5GRXG 1FCCA 4UDUA 2ITDA 4FXKB 4GXVH 5E9DB 5GZOD 3MBED 2HLAB 5FGSA 3MMEB 2FLBT 4Q0XL 1PD6A 4DQOH 5HYSB 3FFCB 3KPNB 1WAAF 4NN6B 1WSST 5BZDA 1SBSH 3N50A 1BD2E 2K7PA 4M62L 3B9KC 5JLZB 5CJQH 1YN6A 2JJVA 4U4BA 2HJLB 5J9PB 1DUYA 3CFDB 2LTQC 2XN9B 3QNZB 2FGWL 5MI0B 1GZQA 4QRPB 3RTQC 4GAYA 2B39A 4GLRI 2AXJA 1FIGL 3QQ3B 4WEBH 1UXSB 2H32A 4UDTB 3D0VA 3PWJB 3QWRA 4FQLH 3TWCH 3QUXA 1I8KB 2A9NH 4LFHD 3JV6B 4GAGL 1A9EB 1YEFH 3JXAA 4AG4H 4UBDC 5B8CB 3VXMD 5GGUA 4BSVB 1NFDF 3ESVF 1RQ5A 4JKLA 2ZSWA 1KJVA 1FAKT 4JFXB 3MROB 3T4AA 3EOTL 1ZLWK 4C56D 2EXWD 3RZCC 1KCKA 4IRJC 4YWGH 1P84J 2NY1D 3CZFB 3PWVB 1OP3K 5GS3A 2GT9A 4K7FA 4HWBA 4WFHE 1TJIL 5KSBA 5EOCL 3WL9B 2NR6D 4Y16C 1DQDH 3BPNC 4OF6A 4D0CA 4ZSOE 1F45A 2CR6A 3HAEB 3GSOA 4XPBL 3EOAA 1MVUB 3LKQA 4CMMB 1FHGA 2V5MA 2ARJQ 5IT2H 1H0DB 3QO0B 1J8HE 1FLRL 4TUKL 3SGJA 3I9GL 2GSGA 1U42A 3QEQA 4WFGD 4X80L 3ABZA 3BIKA 4NQDD 1WGOA 4MA3B 5E03A 1OGAB 1FRGL 3QEUB 2F5BH 4GS7C 2VDPH 4CADA 4ONFH 3WNOA 1IJ9A 4KHXH 3PQYE 3ARBD 1P7HL 3TVMC 2EXYD 4DAGL 1E4XI 4QRRE 5BS0A 2VQTA 5E7BA 4MAUH 3MLRL 5HI5D 2FEEI 4F9LC 1U8NB 4JJ5B 3N1MC 1FVCA 4POZC 2KQMA 3U30B 1EHLH 3RWGA 4MVBC 2BHYA 4PY8J 1SEQL 3FO0H 4PGZA 3O9WB 2H26A 2ZKHH 5SWSA 3SKNA 3T0BA 4S1QH 4J3SA 2PW1A 5C0CD 3O8XC 1G7HA 1N5AA 5CZKA 4LLVB 5E8NB 1KN2L 1OAYH 2AJVL 1NDGA 3T2NH 1NLDL 3O3EB 1OVZA 4OD1L 4P3CL 3S4SB 2Q3AA 3O11A 1KOAA 5KZCD 1YC8A 1MHPH 3LOWA 1M7DA 3SJVE 3HAEH 4BQ6A 1OQXA 1U58A 1JWUB 1EPFA 1JZ4A 5J12B 4HWNA 2FNBA 2OI9C 3K1DA 4HS3A 3VXUD 3F7YB 2HP4A 1TVHB 1RIHL 4JRXE 4FG6D 3P2TA 4PJGE 1DVFD 5I2IA 2DF3A 5T3XH 2A6JB 5IWLA 4HFWB 3L7FA 2ICES 4WO4B 3VWJB 5JHLH 4LHUD 3HNVL 1CT8A 4V1DD 5D7IB 3NCFB 3CVIH 5HHNA 4EVNA 1KGCD 1CS6A 3IRZA 5DJ2B 4XGZB 5TDPA 2I9LA 5TJWK 4KZDH 2H8PB 3K1KC 5C09A 1DL7L 3P73B 1QD0A 1BVLB 5T5NF 1HHGB 2FECL 1MUJB 3Q2CA 2HH0H 4P5TA 5HPMB 3V0VA 4H8WL 1I1AC 5AWNL 4Z7UE 2R0KL 2G5BA 5HYIA 1IGFH 1BAFL 2FO1A 1NAMH 1MRFL 5IW3A 2ADIA 1KB5A 2GJZB 4QRRB 5KSUB 5DURD 2AKRB 5KSVB 1UWGL 1O7SA 2RJMA 4LAQL 1BFVH 5E6YA 4JY5H 1UQSA 1P7QB 1CD9B 5ILTH 5I1HH 4QGTA 1XGPB 1DBAH 1YYLH 2ADFL 3UXFA 3V5KB 3PDOA 2QQLL 3RU8L 1HHIB 4YHMH 1JWSB 1DFBL 1XGQB 2FL5A 3REVA 5HYSG 4Z7VA 3D0LB 1SJEA 4NKMB 5HYJA 3DROA 4WCYH 3QFJB 2ZCLL 3GSXA 4Y1AD 5J12C 2QQQA 3HG1E 2Q87A 4PJDF 5TDNA 1I3GH 2DICA 3I6LD 4OCWH 3HMXA 5ALBH 2DAVA 3B9KD 4F7EA 2Q86A 1JGLH 1A4JB 5IHBA 3SDCC 3IDXL 3MRQB 1T83C 3C5JB 3CVHL 4OLVH 5IJKC 1CFVL 5H35A 2ZG2A 3RWJA 3PWNB 1DSFH 3F5WB 3L9RB 5E6ID 5I1DB 1AY1L 4JRXB 4S1SL 1TCRB 2YPLE 5I8KL 5FO9B 4F57L 1BVZA 3AVEA 4PLOB 3PIQA 5I74C 2O61A 4GKSA 4YDVB 1FZMA 1N5YL 4UBDD 5DDHB 4Q6YA 5D7KD 2Y36L 3AS1A 1QSED 2VXVH 4JFDA 3WDHA 5IOPA 1TZHA 3RZCD 2IAND 2HJFA 4JZNA 3D5OF 3HAEG 5C71A 4L8CB 4ZUTB 1L0YA 1EAPA 1I9JL 1KN4L 4G7VL 4OLUH 3KPSE 2FYYA 3EFFB 3L95B 3ARXA 4K55A 4L4VD 4Y2DC 4XXDA 3RWIB 2G60H 5HGHB 4UTBH 4RWYL 1HSAA 1HZHL 2MNUA 4JFOA 3R0NA 1TJHL 3SCMB 1PZ5B 3MJ7A 3RWEA 2YMXL 2EE6A 4OZHF 4Z7QE 3WE6B 3K4ZA 3U2SA 5T1DH 3KPPB 3QPQC 4R6UA 2BDNL 2VLRA 4KJPC 2QQKL 5F70A 4CW1A 1U2HA 1ITBB 3BE1L 5DLML 2R0WL 1L4IA 4OZIE 5E9DD 3RVXD 4HS8L 4JN2B 3IXTA 3U36B 3EJYC 3EUUA 1FORL 4E9LA 3FFCD 1XZ0A 2KBGA 1M05B 2AJZB 5J06A 1QFUH 3LKSB 3ARGB 3FRPG 3TJEL 2XOTA 4WI7A 4POZD 3RY6C 3H2WA 2X4SA 5CIPB 2XN9D 35C8L 4MVBD 5C2BL 2PXYB 1PLGL 4QRPD 4Z5RB 2UV3A 3GJFK 1YPZF 5BV7C 4JLRB 3MLYH 2A74B 1NGZA 3O8XD 4NWTH 1R3LB 3IF1B 5K9OB 1KUMA 3NFPA 4LOUC 1AGCB 2R69L 4OIIH 4F37F 3RVUD 4MD5A 4IRSA 5E94A 3QDMD 4L3CA 4AL8L 1AXIB 1OPGL 2VIRB 2VDKH 4HKJB 3WNLA 1VDGA 2YPLB 3ZMRA 1S7XA 5HI3C 1A8JH 1QG3A 3P77A 4HXAH 3H9SE 3MRHA 2EEDA 3B8SA 2D7MA 3WS6C 4NO2A 3I75B 4CN1A 3QG7H 3BEWB 4NNPH 3ZDXF 5EU6A 4NFDA 3TPUB 3UTSD 5DFTA 3TZVB 5B8CA 5J56B 4U1KB 2GEEA 2ZG1A 2C1OA 2L4OA 3KPSB 4BSVA 1T21A 4OLEA 1U8OA 4JM2B 1RZFL 2HRPH 1UVQB 3MROA 4PRDB 4J2XA 3DVIA 5EOTB 5DK2A 1RUPL 3L7EA 4RNRB 3WKML 1Q72L 1OGAD 2NY0B 3K0WA 5T3XD 2F8VA 5L6YL 2DMKA 1X5ZA 5E5UB 4KDWA 3ZE0E 3VI3F 2P46B 3QXDB 4MD0B 1F00I 1RHHA 2ZCHH 1MAJA 1IGIL 4K71B 4ZFGH 4P0DA 2ZUQC 3JVGC 3CLEL 5TDOB 5I1JL 2DRUA 3FQUB 5JW4R 4ORGB 1S7SA 1Q9LB 4TSAL 5CIPH 4I48B 4OZIB 4MA3A 1BQUA 5GSRB 4C57C 4LSQL 4U7MA 4F7PB 2PYFB 4AENA 2PF6A 1BIIA 1F3JA 1BD2D 3CFJA 1Q0YH 4KK9C 4X4ME 1YEEH 4YHNB 3BN9C 3DX6A 3GK8L 4UNTA 2HVJB 5TF1L 4KDTC 2OZ4L 4LLQB 2EO1A 5EB9A 4MXVE 1OD9A 1RY7B 4Q6IB 4MCZB 1I7ZA 5DYOB 4JO2H 1UG9A 5HDBE 1AGEB 1CK0H 1I85A 4X8JA 1NAMA 3MRFB 3O9WA 1E27A 2VUOA 1U8IA 4UTAL 4WW2A 3KDMA 2BCKA 5I19H 4HGKC 1T1XB 4ZS6D 4O00A 4WFHD 5E8NA 2EDRA 4N9OB 4WJ5A 3SDCD 1U3YA 2X70A 1FFPB 3LEVL 3NIGE 4KUZH 1NMAH 5EH1A 4DK6A 3TIDA 1MHEA 2NXYB 4XPAL 2YD7A 4WO4D 3VWJD 4A2LA 5MEQB 1J8HD 2R4RH 1DZBA 1C5BL 5AG9A 3QEGL 5L8LB 2E7LC 2EH8L 2AABL 4W68A 4NCDA 3PV6A 5D7LA 1XCQB 4BKLB 3RWFB 1CFQA 1H3PH 3BRFA 2YD1A 2AK4A 4M43H 3ZE2E 1PBYA 1YNLL 1ADQH 3U4EB 3PQYD 5DJ6B 2CDGB 4HFWA 1Z0NA 4L8DB 5D7IA 1IFHH 4QRRD 4Y2DD 1ZVSA 4M1DL 1CL7I 5DF0A 5C3TA 7CGTA 4HPOL 3C5SA 2OM5A 1EJOH 4J4PC 2R2EA 4ENED 5DVKA 4PJFF 5F9WC 3CK0L 1T4KB 5C6WH 3MR9A 2W9EH 4MQXC 5EBLB 2YD5A 4PG9A 3IFLH 4N0UA 1P7QD 3FO9B 3U79A 3QISA 1RZIB 4FQPA 1IC4H 1NDMA 2B1HL 5ELIA 1A7QL 1U91B 4LPCA 4Q6IC 4KJPD 5MEPB 2CKNA 2X4TB 1A9BA 1MLCB 4KZEH 1LQSR 2XG5A 1GGIH 1UM6H 3EZJB 3IDIB 2F54E 1LDPL 3SKOB 3CFBA 4TNVF 3SJVD 3NZHH 3JWDH 4KAQL 4PBXA 5B4MD 1Q1JH 5D8JH 1H5BA 25C8L 5E2UL 3RWHB 1IQDB 3O45A 2YWZA 5AZEH 2NXYC 2ZSVA 3NCYS 3LN4A 2F53B 4U1IB 5J89A 4JRXD 3QNYA 3QFJA 4LOUD 4GBXC 1U3ZA 1XF5A 3O2WH 4PV8B 2IQAB 5CCKL 5KVFH 1KTLB 1L9NA 3LKNA 4U49A 3RA7L 5ACLA 3V8CA 3K4DA 4YHOL 1RVFH 3MRQA 4DGVH 1W8NA 4QHUA 1KV3A 5DJDA 5C0IA 5IIEA 2R1YB 3PWNA 3TEUA 2CQVA 4K3JH 4HH8A 1IM9B 1OAKH 5FO9A 2P8LB 3LN5B 5GS0L 1CD1B 2LFGA 1T04B 4GG8A 5B38G 4RAHA 1G0DA 1IGCH 4NZRL 4XNQB 3EHBD 4HH9A 1WTGT 5DUML 1JPFB 3PDDA 4YO0A 1ND0A 3V7MA 2CKBB 4OM1H 3STLB 1VEPA 3JWOH 3L5XL 1CGVA 1JHTA 3VMOA 3MCKA 2EIBA 2M8XA 1J05B 3QEHB 4UQ3A 2AK1L 5L0QC 4Z78B 2DM2A 1JHKH 1EX0A 3TJHC 1OTUD 3M17A 4KUCD 4I4WB 5KSAC 5HGHA 3CPLA 3KJ6L 2WP3T 3C6SA 4UV4H 1NCAH 2GAZA 2LV4A 4YH6A 2CD0A 1PZ5A 4GH7B 4NHCH 3UBXI 5DFWH 2IG2L 3ME0A 1HN1A 2WZPD 3V6BR 4EZMA 3P40A 1H3XA 3QDJE 2ICEB 5FIEA 3WE6A 5C08B 4KKBC 5AYUL 2IH1A 1VFAA 2VDOH 3HG1D 4WI5A 3I3BA 5TQ2H 3DXAE 3WFDH 3T8XA 1KACB 3G6AA 3VFTA 1UYWL 2AV1B 3U36A 3DX9B 1Q0XL 4JDTH 4Y4KB 1SY6L 1YUHA 2JLLA 5DFVC 3VFNB 2DMCA 1RULL 1MCWM 2FEDD 1ZLVK 4OQTH 3ARGA 2IBBA 1C16B 5DJ8A 5DS8A 4UV7H 1B0RA 2B4CL 2YPLD 4R4BA 3SDDC 5E00B 1ETZB 2K3TA 2EDOA 1I3UA 4WU5B 3U9PL 1Q9OA 4K94H 1P4LA 1L7IL 3E6HB 4NQVB 1GGBH 2KKQA 5JOEA 2XV6B 3G5XA 4JG0H 3KPSD 1EO8H 2HKHH 2CKBH 1YYMH 4JM2D 3FFDA 4P2CG 5FA3B 4F2MB 1EAJA 3LN9A 2QTEA 1T7XA 5DGRA 2YPVL 1H8OA 4BH8B 4R4NC 2NY0D 4OGXL 4P46C 5DD3H 3VRLF 4X99B 5E1HB 3DSFH 2ATKB 4XMKH 3B83A 1T1WA 4PB9H 1MFEL 3FL7A 1WT5A 1S9VA 5GQBA 1IL1B 4LQFL 1R3IH 4BQBA 4ZOCA 1MF2L 3U9UB 1QVOB 3VXRE 1IGTA 2DDQH 4AYFA 1MIMH 4JAMA 5B38A 2XZCL 3FB7A 1CFTA 1U8MB 1GAFL 3G6DH 1A7NL 1ZT7B 2AJ3B 2QV2A 3LIZH 3MV7B 2B0SL 5I6XB 4NQXA 2OR8A 1KT2A 1FVEB 3QDJB 2MHAB 4MQXD 2N7BA 2QLVB 4Y4KC 5ID1B 3GBML 5D6CB 3KJ4B 3QDAA 5HTSA 2NXZC 5C0BE 4ODXB 4I48A 3BOVA 1D6EA 4N0CC 1KCSL 3KYOA 3ULUE 4OBSA 2F8OA 3BPOB 4NOFA 4PJ5E 1TFHA 4U31A 1VFUA 5GS1A 4NFBA 4Z6AT 3LH2H 5B3NA 3K46A 1Y6KR 1BECA 4YE4L 3GRWH 3H9SD 4R0LB 3QULA 3GSNB 3G5YA 3AMLA 3GJEB 1WFOA 2J8UE 4DEPB 1TIUA 4TOYL 2CLZA 5ADOH 2NXYD 2OTWA 4TVPL 2PCPB 2I26N 3D85A 3QHFL 1NCCL 1BFTA 4TUJB 3OKEA 2CRIA 1WBXB 3VFPB 1CLOL 4GBXD 1KJ3L 3MGOB 2DIJA 5EG6C 1Q94A 5F7FA 5HYQB 4OI8A 2UYLA 4RRPG 3T08A 3OBAA 5F9JB 3CFCL 1CLYH 2YUVA 3DRTA 4R26L 3FAWA 4PY7B 4PG2A 1DBJL 1NKOA 4HUVA 3FN0H 3LQAH 4Z18A 3VXSE 4L1HA 4R7NA 4HHAB 4I9WE 4HWZB 3G04B 1E4WH 3VXRB 3U6RB 2G9HB 3O41A 2YOCA 5I6XC 3KPMB 4IS6B 3ORJA 1U3JA 3M45A 4Q2ZB 2IFGA 5EPMB 3FMGL 4Y4HB 3K8LA 5EO1B 3P0VL 3KJ4C 5ETUB 2PTTA 4NZUL 3IDMB 1QKZL 1IC5L 2WK2A 4MLIA 2EIZB 4HZLB 4JR9H 4QXUL 4P48A 2N4IA 3RNQA 4HK0A 3C6LB 3U1SL 4YBLB 4WRLA 4XVTH 2VDNL 3GSNH 4C54A 4PJBA 1U91A 4PJ5B 3DV6A 5AUMA 2R56L 1QO3B 1F8TH 4RQQB 4YEFA 5CMAA 1UXWB 3MA7B 5EO0A 1QLRA 5CEZE 5DO2D 1DLFH 1UZ8B 3H9HB 1P4BL 3QDGA 2EYRB 5DFVD 5FM4A 1KJ2B 1P4IL 1QRKA 1NH6A 4UT9L 1MLBB 4P49A 1AQKH 4G42B 3ZKQD 3D2UB 1DBKH 4LKCB 3SDDD 1T6WA 5D2NA 3TNMA 2A0LD 3W9DA 4ELMA 5HJ3A 2OP4H 5F9OL 4OCYH 3U0TA 4OFYD 3QUXC 4DVBA 4Q9RH 5KAQF 1U8PA 4PV8A 4YHKH 1XR8B 1OSPL 1KTLA 2UVFA 3MRKB 1VFBB 2GK0B 5IROA 3WS3B 4PJ8A 4QRTA 1JNNH 3CIQA 1T5WB 2NYYC 3QUKB 5EO9B 3X3FL 3I2CL 3W2DH 1RZ7H 2R1YA 1U8LA 4EXKA 2VXQH 1A3RH 3L3OB 4LL9A 4MJIB 1EH9A 1F58H 1Z3GH 2VAAA 3FB6B 3QJHA 4WW1A 1HILA 3S35H 3JTSB 4M7JH 3SGJC 3ULUH 1J9CT 3TN0B 5EUOB 1ZLSH 4XNQA 4PJ9B 4G8GE 3IB4A 1BOGB 5TPWL 4U1LA 3P3YA 3MXWH 4JFDE 3JV4A 1HHHB 3UTTA 2BFVL 1WZKA 2NY2B 2F54D 3D87B 5FM5M 4UB0H 5A2KH 5T1KB 4YBQD 2UY6A 1NBYB 1MIEL 1QBLL 4I4WA 1KJ2H 2X40A 3VE0A 2XQYK 4Y4KD 3BEVA 2OXHA 3LVEA 1AI1H 1F5WA 4OLWH 3O4OC 2ATPA 1C5CH 4N0CD 4KTDH 5C08A 3OQ3B 4PJ7F 1WIPA 1U3HB 1DR9A 1HH9A 1QNZL 4LLMA 4J23A 1U8JA 2CO7B 4DCQA 3H7LA 3L1OL 5D70L 5IW6A 1BBDH 2AV1A 3B6SA 4CBPA 1S7RA 4O4YH 5IVXE 3M07A 2I9TB 4BA8A 4NGHL 1M7IB 2D03H 2GJ6A 3MRGB 5F89A 1A02N 3AROA 4GW5B 5HHVH 4GKZA 4PLJC 2A9MH 2ENSA 4Y5XA 3BP4B 2YZ8A 1P9MC 5E00A 2EDBA 3QQ4A 1NJ9A 1X5LA 4OCMC 4PJHF 3BDXA 2NZIA 1ZA3A 2VSCA 5TH2A 1X5IA 1KELH 5DC0A 3WEXA 1YMHB 4XC3H 4N5EC 3IU4L 3DI3B 5HGBA 3IDYB 4ETQB 1MJ7H 3QT2A 3LV3B 5C07B 1CGWA 3QHZL 1NCDH 5DUBB 3GRWA 3TCXA 1N2RA 5FA3A 3C5ZA 5IWLC 1HE7A 1MI5E 3BUYB 1ES0B 4MD4B 4YHPB 3W0WB 2G2RA 4JZOA 1D5BA 1CXKA 5DA0B 3UTOA 4I5BB 3MV9A 1A6TB 5ICZB 3MRIB 4K3EL 4BQ9A 3R8QA 4P2OC 1FL5A 2OR9L 3QDJD 4FQJL 3ECBB 2P5WE 1T66D 4JO4L 3QNXB 5I1CH 5EU6E 1JYXA 3CDGA 3DXAD 5AD0B 4RFEA 1N4XH 4J3WA 1MRDL 2GFBA 1XF4A 1MEXL 1WEJH 3RUGE 1VESA 1CWVA 3S3SA 4PP1C 1HH6B 4JFQA 4YDLB 3NAAH 4FZEL 4ZPVA 3TBVA 2MHAA 2A2QT 2EICA 2ZUXA 1LEKA 4L3AA 4GUPB 2UY7A 2LVEA 2UUDH 1JGDA 2ZP0T 2HT2C 3IVKA 2UZYB 1A7RH 3VWKA 3NPZB 3VG9B 1I8IB 4F7TA 5JDSB 5I15H 2CSPA 2EDQA 5IVXB 4LPYA 3DJ9A 5CJXA 5DJCA 1FAIH 4JE4B 2KZWA 1S7TA 2VN4A 1JYVA 4PGDB 2MCPL 4X7TB 1PYWA 5F1OB 3EYUL 4Y4FB 1FH5L 1UM5H 3GHBH 3KPQB 4FMKA 3P11H 1ZEAL 5EN2A 3ZTNL 1U2CA 3H42L 4HKXB 4PJEE 5JTWA 3GJEA 5I66B 3P9LA 2CRMA 4BZ2H 2BJML 3FT3A 4LCUA 4LK4A 3ARYA 1AD0A 2ARJB 3KS0J 5DMIH 1EEQA 1CDGA 2LVCA 3LEYH 3WDIA 1IEAA 4TUJA 3SDAA 3F8UB 1KB9K 3VXRD 1S9YB 4D0DB 3DUUA 4HF5L 1WFTA 1MJJA 3MGOA 5I75B 4ODTH 3V79C 2BXYA 4M93B 4X6EA 2IAMB 3NMEA 5KJRL 4J3VA 2NYYD 2BNQB 2DJUA 2MFNA 3WJJA 2BOCA 3B9EA 2YD9A 1T2XA 4KQ3L 3HI6H 4WUUE 3SDXB 1I9RH 1A1OB 1YJDC 1I8MA 2X42A 2X4PA 3JSSA 1KIRB 1QQDA 4HHAA 2P5WB 5DI8A 3ZDYE 4D94A 4OM0L 4ZFFA 4ZNEE 4O51B 4JCMA 5C0BD 5D1ZB 3C6LD 2A77H 5DHYB 5SX5K 4Q2ZA 3QA3A 3RUGB 4JY4B 3ULUD 2Z9TA 4Y4HA 3FQTB 1QFWM 3CFKB 5C0GB 4PJ5D 4X4ZA 2AK4E 1RUQL 2Q76B 4FFZL 1M71B 5LCVL 2X4RA 5A16B 2B1AL 1ZT4B 4KJYB 1YNTA 4LEOA 4MX7B 3IDNB 4ZFZA 2O5ZL 4M6MH 3F6IA 3SKMB 3IGAB 3P30L 4JGJA 3SQOL 5CJ8A 3D2UD 2OQJA 5DD5L 4WI3A 2BRRH 4M4PA 3GMMA 3B9DA 2ZNXA 3QIWC 5LBSL 1FFNB 2GUOB 4OF7A 3RGHA 3QI9A 3VFSA 1IAIM 4PRHE 1TPXC 4PJEB 1ZGLA 1UZ8A 4M9PA 1BREA 2EYRA 4XP4H 1CE6B 5L7XL 4XBEH 4L4TA 4P2YA 4ALAL 1F42A 2VWEE 3MOQA 4IRSC 3SN6N 3QQ9D 4RMRA 3VXSD 3ZT5A 4OF5A 4JDZB 4FZ8L 3CC5A 1NCBH 4PLJD 4I9WD 3N1GC 2I25N 1I9EA 4HJ0D 2NX5E 4Z77A 3S9DB 3OX8A 4XTRD 5HHOB 1WWBX 2XACC 3O4LE 3Q3GB 4N5ED 1T0MB 1XGUA 1DJSA 1AQDA 4WUUB 4QTIH 3VFGH 3VG0L 5AAWA 1R5WA 1K8IA 2OK0L 2R0LH 1EMTL 4PS4H 4PJ9D 5KW9L 3WJLC 2ZG3A 5F1IA 4O2FB 1T5WA 5CBAA 3HNTH 4JN1L 1D9KA 3MYJA 2NY2D 5I1IH 4TNWF 1BMGA 4K8RC 3ARTA 5AEAA 5T1KD 3L3OA 1FPTH 1HI6A 2GSIA 2VQ1B 4KV5E 4P2OD 5AZ2H 4OZGA 1JYWA 3O6FB 1QPPA 2YC1A 1OSZB 3W5MA 2UUDK 4Q58C 4ODHL 4HZAA 5EUOA 4XCFL 3QUYB 5ERWB 1LO3H 1PG7L 1A7BA 3BP7B 5F3BB 1ACZA 5CEZD 3UPRB 1HHHA 3R1GL 2NW2A 3ZHLA 1RIVL 3D25B 3VXPA 5C0RL 4BUGA 3RBSA 4M48H 5FUCE 1VPOH 1F6LL 5FYLH 2P24B 2FATL 3OGCA 4H88H 1UKQA 1L0XA 3BO8B 4PUBL 4HIIB 8FABB 4XMLH 1GH7A 2JCCA 3U46B 2HT2D 4HPYH 3K8KA 1B9ZA 1MNUL 3GMPA 4PRHB 4YPGA 3CH1B 3K8MA 2VDQL 1U3HA 1I85C 4ODUB 2JJWA 4LBEA 4F33B 1MOEA 3A6CL 4DZBB 5CZVH 4NYLA 4G9FA 1E4XL 4Y19E 1AXSA 5KBNC 3SGDI 4U0RB 4FQCH 1UB5A 5C8JB 3DARA 1CF8L 3NGBC 2OJZL 2NX5B 1FN4A 4NDMB 3AB0C 1J5OH 4AIZA 5C07D 4OF0A 2MTPA 1FGNH 1X9QA 3O4LB 4APQB 1JMXA 5FK9B 3MYZA 1R0AH 1WICA 1RUMH 5E4EC 4HCRH 3OSKA 4PREB 2VH5L 5DWUL 2FDBP 5ID0A 3ZKMC 4G8GD 2BMKA 3H3BC 4QLRA 5C0DB 3FB8B 4KDVA 3F58H 5K33A 3VXTB 4JFDD 1BQHB 4XNUH 1FE8L 3LV3A 4FQXB 1NBZA 4XNZB 4OZFB 5K9KA 3MLTA 2AI0H 4Z7OF 1SEBA 1ZS8B 4JQXA 5DEGA 1GOGA 4OD2B 4I0CC 4ODVH 4UT6H 2FO4B 1A6TA 1K8DB 3MRIA 1HYSD 3OB0K 4YPJA 1LO4L 3FHAA 4Y5YB 5BV7L 5BVPL 1UWEH 1BZ9B 4EN3A 4UU9B 3GSWA 4FA8A 5DC4B 5F1NB 2KH2B 3U7AA 1CG9A 1P2CA 5H94B 1N0LA 4WWKA 3MFFA 5T3ZH 1B4JL 1UEYA 4OAWB 4PJGF 4PLKC 2JJUA 1LO2H 5DQJA 3E6FB 4Y4FD 1I3VA 3BT2H 4X6DE 5EWIH 4Y19B 1Z5LB 1H5BC 4I77H 1U92A 4MMXC 4APQC 3QIWD 5D93C 2Y9RT 1INQA 1A3LL 1J1XL 4Z7UF 1G7JB 2IFFL 3PP4L 2F5AH 4G3YL 1FSKB 4HWEL 1MI5D 3LRSB 2BVOB 4HS6A 2IAMD 3UO1L 1JRHI 1VGKA 4JKKA 4AQ1B 4XNZC 5ESQB 2DL2A 4OGZA 1TETH 3V5HB 1K2DB 4KUCF 4PB0L 1T0PB 5KTEH 5KS9E 5BJTB 4M8QA 3OG4B 4CVUA 1J12A 3PHQB 4CN4A 5IFAL 3HN3A 3KLAB 5IW1A 2P5WD 1CICB 5EU6D 1SMOA 1U41A 4J12A 4GG6A 1L9MA 5I73B 5D1ZD 1P6AB 32C2B 1ZHBB 4OZ4A 4Y5YC 1D6VH 3EYOB 4ZXBC 4FN0A 4PRPB 4HC1L 4JG1L 4LVOC 2EH7L 4DZ8B 4S1DC 5CEXB 4RA3A 6CGTA 2A6IB 1EEUA 3MCLH 3KPRB 3SDXA 5IMLB 3SDYL 2E27H 5DTFB 5MP6L 4K8RD 2XQBH 4KKLC 5DGQA 5A43C 4AH2B 3O81A 1A2YB 1UWXH 2XZZA 2A6DA 1MFBL 4WU7B 3CX2A 3R06B 3H3PL 4PYHA 5DJZA 3RJDA 2DQGH 4LLUA 2KUTA 2WMPA 4HLJA 2ZOKB 3GMNA 3EYSH 5I16B 3RL1B 2G75A 5JXEA 4QXGH 3OF6A 5C0GA 3VGEA 1ZT1B 4LPTA 3N85L 5E8OA 3BZ4B 4O5LL 5ITFB 1VADB 2EDEA 2Q76A 1GCFA 5F8QC 2IEPA 5CAYB 4ZODA 1YECL 4NQSA 5A2FA 2FZ3B 1EERB 4JM2F 4PR5A 1DTUA 4ZUVA 2XA8L 4JHWL 1BJ1H 4GO6B 3IGAA 1IEBA 4U1SA 3AY4C 4JB9L 2KZ1B 1IGJA 4HQQL 1AFVL 3C09C 2ZZUT 4XCYB 4BFIB 1QA9B 4Z7QF 3G6JE 1NUDA 5E2VL 3C9NA 1HQ4A 2VTFA 1CBVH 1CICC 5E8EA 3MRJB 2JJSA 4JVPA 4WUUD 2O5YL 3QDGE 4OZIF 5KS9B 2AXHA 2BNRE 2E7BA 2X6MA 2XRAL 2IGFH 1INDH 1EEYA 1RZ8B 2YKLH 1IGML 1KPUA 3EJZC 1J1PH 4AT6B 3BW9B 5MEOB 4R2GC 3ZZ1A 1RUAL 3H9ZA 4UOW1 2CGRL 1XH3A 4NHUB 1BGXH 2WBJA 4C59B 1WT5C 3D3VE 3BQUB 3P4OA 4ELME 2HFGL 4FQ2L 3O6FD 1EFXB 5H8DA 1TZGH 2AXGB 4MAYB 2YBRA 4MA7H 5JHDA 2AK4D 2VDMH 5J1SC 1Q8MA 5BW7A 2ZOLA 6FABL 3QUYD 5D5MB 2IPUK 1AGDA 3WFCL 1OAXH 1M4KA 1U8QA 3HZVA 5HBBA 5BMFL 1SJHB 5C7XH 1DBMH 2CUHA 4XCEB 2OMNA 4KTEH 4JKWA 4RBPH 4NNXB 1RURH 4LU5H 4NJAH 2VQ1A 3RFZC 5GRUL 4R9HA 3T3PE 4MSWA 1MWAA 5DT1L 4AEHH 5D1XB 3TBWB 5LWYH 2AJYH 4GW4A 2Y07L 1G7IB 4MB3A 1TQCC 3NTCH 4K23H 3REWA 3VDCA 1CN4A 3OHXB 3FZUD 4PRHD 1KENH 2VXUH 4MJ2A 1C08A 4W4OA 3F12A 4RGOL 3KYNA 1CIDA 3D25A 2E9WA 4KROC 5T3ZD 3QUML 3UTTE 2HG5A 2J3SA 3AXLA 3TO2B 2X7LA 3I6GA 5GS1C 3B43A 8FABA 3AMKA 3H7BB 1WF5A 2H3NB 1CE1H 1FZOB 1MQKL 2AEQL 3CX5K 3TBTB 3ZE0F 5GXBB 2NX5D 4QTHB 2JKXA 1QFWH 2WIIA 4XVJL 1IZJA 4M6NL 3G6JB 4P5MA 2YR3A 3FCTB 3O4LD 3AS0A 4APQD 5CHNB 4X4XB 5FFLA 1EUTA 5FECB 4DZBA 5FV1L 3T2QA 1YEDA 3BP6B 5CGYC 1YQVH 2BNRB 4ZD3L 1LO5A 3G08A 4JKPH 1G9MH 3BZEB 3LQMA 1EBAA 3NCCB 5CP7B 3SO3C 3BMWA 5IVZA 5GGTH 5EULV 2DQTL 3V6ZB 5D7JC 3MRNA 2HFFA 2R1XA 4IMKA 5HPOA 3M8OL 5F7LB 4JFPA 5HDOA 3P9WB 3S98A 4NRYA 1QHPA 3D3VB 4MXVF 3BVNA 2MQ3A 1MRCH 1IAIH 4JPWL 4NUGH 5KOMC 3VGBA 3LB6C 1QBAA 4Z7WB 5HDBF 3TH3T 1ZK9A 3BXNB 3HE7B 3MRRA 3MLVH 2R8SH 3PJSA 3HPLB 4ZXBD 4YXHH 5BO1H 5F88B 4S1DD 3V95A 1FNHA 4PTTB 4WI4A 2J6EL 5FUZL 5D6DC 2FD6H 3O2VL 4WGVB 4A6YL 4JFFA 1NEZB 2FBJL 4KKLD 4P57A 3NIGF 4ZAKB 3MSPA 3ROOB 1IBGL 3IXAA 4KH2A 4Y0GA 3O6ML 2Q6WA 4BJLA 4ZOBA 4RDQG 5DRWA 4WFFE 3DUSB 4KI1A 4Y19D 2L7JA 2ZNWA 4JFHE 4PJXE 1S7UA 5FEBA 1FVDB 3GI9H 3GM0A 5EU3A 5JDJA 3ZE2F 3CNKA 2PO6A 3O2DL 1VEOA 2DD8H 3PDGA 1DEEB 4X9BA 1JF1B 1B6UA 1IM3A 5GPRA 4XC1L 4O2CA 1IAKA 2R39A 1EGJL 3AS2A 5F9DC 1WTLA 1I1YA 3QBTB 5D71L 3CXDH 3T04D 4LCCA 3DETD 1FIEA 5GJTL 2QSCL 3DRQB 5JIIA 4ZPTA 5D2NC 4I3RL 3ULVC 3EYFB 4NPYB 5GGVY 1EO7A 1LK2B 4QY8A 4WHYH 5F7UA 1G7JA 4U6YA 3IFOA 3OXRB 3OZ9L 1CICD 3S36L 2YD4A 3RIAF 4EDXA 5DJ0A 4UILH 5GJSH 5F7KC 5JNYA 2P8PB 3IS1X 3ET9F 4WFEE 1NCWH 4PV9B 4PRNA 3SGEH 4PJ8C 1FC2D 1S7WA 3EJZD 4LDLB 4R2GD 4CNIA 2C5DC 2SEBA 3WSQL 1Q9KA 4PP2A 2DL9A 3RVVC 3MNWB 4LVHC 5FOBA 4Q0XH 2BY2A 3KLAA 4OGYL 1JWMB 4HUNB 4WDIA 3O3UN 2R4SL 3KNBB 4M62H 1JZ7A 1OP5H 2R29L 4NQCA 1AHWB 4XZUB 4G6AD 3EYOA 2FGWH 3MACL 5CEXA 2CO6B 4DZ8A 1FIGH 5C9JA 4QRUB 1F2QA 1RZGA 4OV5A 1KCUL 1GHFL 3KPRA 3GMQB 3BPCB 3MA9L 4UQ2A 2R1WB 4GAGH 3NFNB 4Q9QL 4PJIE 4KWUA 3TA3A 2ZUWA 1A2YA 4XP5L 5E99L 4CDGC 2QSVA 3HNSL 1YEGL 3Q5TA 4UNVA 4XP9L 3EOTH 5IEHB 2YD3A 5BRZB 4F3FA 1XR9A 3KPLB 5B3JE 1QLFA 2OL3B 3HS0B 5EOCH 3PGDA 5I16A 5FF6B 3MC0A 1LDSA 2X4QB 1JTOA 1EIBA 1J1OL 4CU7A 2ESVE 3QXWA 5ITFA 4XPBH 1JN6A 4KROD 5HGGS 4L4JA 3L3GB 1J87A 1HNGA 2VAJA 1FLRH 5D2LA 4PTUB 3G9AB 4TUKH 1RK1A 5CD3B 3I9GH 4EIZC 3ZO0A 2EKSA 3MNVB 3VD7A 1XEDA 2BX5A 5MENA 4X80H 2BVTA 2PW2B 3PHSA 3T0EA 1FRGH 1MCRA 4E0RB 2C3VB 1QSZA 4JFYA 4RSVA 4YK4C 5HI4D 4Y5XC 3CU7A 4QHNB 5FHBL 5HGAA 3WO4B 4DAGH 1C12A 1BEYL 4IDLA 2Y1VA 4NO0B 3VH8A 2RGSA 4F7CA 3MLRH 2VLJA 5EUKA 4QKXB 2LAGB 3HRZB 5LAXB 1FL3A 3B9AA 1EFXD 1QSFE 4KY1L 4LDEB 3ARDA 5ENWB 5D7JD 3WFHB 2C3HA 3TYGH 2XZQL 3C5ZC 1SEQH 5IHZB 4AT6A 2UWEA 4WHYG 3OPZH 3UYRL 1VACB 2NLJA 5E4IA 2JK5A 3LB6D 3MGAA 5JIPA 5IJVB 3PWUB 1EDQA 1KN2H 1NC2A 5TE4L 3BQUA 2AJVH 1NLDH 2GITB 3LEXB 4OD1H 4P23B 1B3JA 4P3CH 3GB7B 5D1XD 1NEZG 1S8DB 2R15A 1PVHA 4G6FB 4LSUL 1ZLUH 2HWZL 3WHE1 4PJIB 3CX5J 4G6JL 4U1HA 3T77B 4CL7A 3MLZL 3FONA 5IP4A 4DN4L 2P42B 1R3JA 4PJDB 1R5IB 2GY5A 4XCEA 4I13B 1NGPL 4UINL 3BGFB 5FYKL 1P53A 1RJYB 1RIHH 2BXZA 3FO1B 4KK8C 4C58B 5D7SL 4IBLT 2ESVB 2VABB 2NY5C 1LP9E 3WDJA 4ZTPL 3DUHA 1FDLL 4J8RA 3CVHB 3HNVH 3VWKC 4GXUN 2HLFD 1I1FB 2NY3B 4XHJC 4YHIB 3DVFA 1FO0A 4X6FB 3EAKA 1FL6A 4ACPA 4NNYB 4BYHA 1DL7H 1SM3L 2P5EE 1QP1A 2Z31B 3QDGD 3FQRA 1FGVL 1A6UL 4HWBL 2BNRD 1JUFB 3TO2A 3OR7B 1G7LA 2BOBA 1GC1C 4I3SL 5BQ7B 5ICYB 2H3NA 5AWNH 1BAFH 5FKAA 1MRFH 4LLYB 4XBGB 4H8WC 4OKVA 2JCCE 3FCTA 4XCNB 3H9YA 4MCYB 1UWGH 3D3VD 4JCLA 4ZQKB 5HVWA 1S5IL 5IFHH 1QSFB 2E6PA 1FJ1A 1TXKA 5IEKA 4LAQH 4TSBL 4JEGB 1HINL 4YHLL 5FDWA 5IKCB 3HE7D 3ULUF 3MZGB 4RFOL 5CP7A 1CFNB 2ADFH 3FOMA 2QADB 2QQLH 3RU8H 1N3NB 5I8CB 5DHVA 2B20A 1L0QA 1DFBH 5H2BA 1BFOA 3WJJC 5DEFB 5J13C 4U1GC 3RVVD 1RJZA 2R23A 5CILL 1N6QL 4MJ6A 2ZCLH 4QWWD 2J8UF 4KK5C 1FYTE 3DV4A 2OXGA 1KIQB 3RNKB 3QPXL 3WLBB 5JPMB 2ICCA 3DHMA 4X6BA 5SV3A 3VW3L 3BXNA 4LLDB 2C4FU 3A67L 2J88L 2CDFA 1SYVA 3ULSA 3CVHH 1G1YA 1AE6L 1CFVH 1E4JA 4H20L 3MRPB 2X9XA 1YPZB 3HMWL 4OCXL 3U4BL 4YNYA 4K2UL 1IT9L 5J6HB 1AY1H 3BWUC 1CDBA 3MRLB 4S1SH 5I8KH 4F57H 3QB7C 1WAAA 4JZJA 3RY5A 1N5YH 1LP9B 5C92A 2Y36H 2ED7A 3DHJA 2CK0L 4U7KA 1AKJB 3A6OA 3MV8A 3V8OA 2QQNL 1ZANL 2E6JA 1XMWA 4P2QB 5F7DA 2ADJB 1KN4H 4G7VH 2FIKB 2BNUB 4I18B 3CJJA 3MJ9H 4RWYH 3LPGA 1HZHH 1NFDA 3QI9C 2P8MA 4GQ9L 3VFVB 1TJHH 5EC1B 3DTXB 1LEIB 2YMXH 3W11C 2DQEH 1IC7L 1OWWA 2W60A 4NQTA 2QADC 4NRZB 3SGKC 4S0SD 2FJGA 2BDNH 5T5NG 2QQKH 4LEXL 2ZUVA 3BHBA 2EO9A 1KTDB 4KXZH 2Y06L 3BE1H 3ARRA 5DLMH 5IBUB 2R0WH 1P6FA 5CLWA 4ETYA 3OKDB 4DKAA 1LK2A 2W92A 2FJHB 2WNGA 4JM4L 2CMRH 1KJMA 1FORH 2VDLH 3QO1B 5CEZL 2DTSA 3FQWB 5IQ9B 1KB5L 4LHJB 3TJEH 3OKNA 2XTJC 2IQ9L 5IB4A 2P8PA 3QXVA 1MH5A 1UKTA 4PV9A 35C8H 3FO2A 1FYTB 5C2BH 2X1OA 3X12A 1GPOL 1PLGH 3IFPB 3UJTL 2Y6SC 1ZKAA 5J1AA 2R69H 5D9SA 1NKRA 9CGTA 1GOHA 1G9NC 4OGAC 4AL8H 2J1KA 4WFFD 1OPGH 4JFHD 4EI5A 43C9A 3T4YB 2Z91B 1ZHKB 3QQNA 3FQXA 5IVNA 4HDIB 4OF8A 2EZ0D 5DJYA 4QRUA 2W65B 3HMXL 3QIBB 1KG0A 2QHLA 3GMQA 1BPVA 1HHKA 5DRZA 3RWCB 3N9GL 3ZYOA 3ZKXB 3HR5B 4N1CA 1NCNA 1T1YB 2ITCB 3SE4A 2ZUSA 5IQ7L 1MVFA 2WLYA 3IDGB 3MOBL 3CSBA 2WANA 3HCVB 1F6FB 3IAQA 3DWTA 1KCRL 3RIFK 3IT8D 1RZFH 4K07A 3RL2B 2X9WA 1XFPA 1RUPH 3WKMH 1REIA 3KPLA 1Q72H 4R96A 2XWBB 5L6YH 3ROLB 2FH8A 3S36X 2ICWJ 5EIQA 1K6QH 3H0TB 3VFMA 1R3KA 1YY9C 1FYHB 4RX4A 5E6ZA 4WFED 1IGIH 1T89A 3RWDA 4NO0D 1YJDL 4Z8FL 1RU9L 1ORQB 1EZVY 2ORBL 3CLEH 4L3EA 4YGAB 5I1JH 4YGVA 3ETBF 4TSAH 5DSCA 2VE6B 1ZWIA 3NN8B 5I1EL 1TVBB 3BYYA 1XF3A 4LSQH 2EE9A 4H0IA 4LPVA 3IJHB 4AG4L 1MFNA 1QEWA 4FQHB 4QHLA 2WUBH 5BXFA 4B53A 3GK8H 3CSGA 4L8BB 4RISL 5TF1H 3VU2A 1RIUL 2OZ4H 1G7MB 4OLZL 4NBZB 1KNOB 4PRAA 4PJAE 4G6FD 4YHYC 5IVXF 1OB1A 2RFXB 5IHZA 1N6VA 3O0RL 5CD5D 4JQXC 4KRNA 3VMNA 4KK5D 3F7VB 3KPTA 1ACYL 3KYMB 1WZMA 2XWJB 4U6XB 3QRFM 1QLEL 5HSFA 4WNQB 3LEXA 4P23A 3LEVH 2ESVD 3PWPE 4S1RL 2OTUB 1KIUA 1KIPB 4EN3C 4XPAH 4HIJB 5IK3A 3RZWA 4JFEB 1C5BH 3QEGH 3HZKB 1M1SA 1K5NA 4IOIB 4WWKC 1NL0L 4G80A 1QR1B 2AABH 1MHCB 4PJDA 3NFSL 2Z31D 1DEDA 4F7MB 4FTVA 3ZLQC 3SQBA 3FT4B 4EUPA 1DDHB 1W0VB 5EC2B 1XGTB 2F74A 1EZVX 1YNLH 2IBGA 2VABA 1ORSA 1R5VB 4QRQB 3QIUA 3OB8A 4M1DH 4MNQA 5J6GB 1CFSB 1K4CA 4HPOH 1CXEA 2KDGA 4HSQA 4B5EA 5CP3H 3QFDB 3CK0H 3ISWA 1OAYL 1QSFD 2Q7NA 5L9DL 3T2NL 1N0XL 2EC9T 1YY8B 3MXVL 4CMHB 2V7HA 4H5SA 5HVHC 1JUFA 3G5VA 5IF0A 3EJJX 5CLTA 3RUGF 1TTFA 4N68A 3MV01 2B1HH 3EIFA 3GNML 1A7QH 4K8RL 4NO5B 5IBUG 3V6FB 2QADD 4Y8DC 2AJSL 4O2EB 4F37K 4XBGA 4DW2L 5F1KC 3NPSC 1I8LA 2E9BA 2XKNB 3MJ9A 4PJAB 4W6XB 2BY3A 4OZHA 1A1NB 2H9GB 4HXBL 4DFHA 4KAQH 2VXTL 1DQJA 2X4UB 5I8CA 1UKSA 25C8H 5E2UH 5CBEB 1MCPL 5CKGA 3WFEL 5KVEL 4M7ZB 5DMGC 4H0HB 5I1LA 3EYVB 2Y6SD 5B39B 4OJFL 5I8OL 4PJEF 4GOSA 4Y7MA 3PWPB 1KIQA 3RNKA 2BHZA 2VITA 2VR9A 5CCKH 5CKAA 2MWCA 3RA7H 1N7ML 5IR1B 3PGCA 2FJFB 4YHOH 1AKJD 1YC7A 1XGRB 5JIKA 4NT6B 4R8WL 4P2QD 3B2UD 3MRPA 4KGLA 1YPZA 2DQUL 2P5ED 1HXMB 5JXEC 1A14L 2V9QA 4P5KB 1OAUL 3BKJL 3VFOA 2NTFB 4YC2B 3DGCR 5GS0H 4LF3B 5K59E 1SVCP 3RJQB 3IJYB 2AEPL 3P4NA 1BX2A 3GUTB 2IPKA 4GRLA 4NZRH 4M5ZL 1WCBA 5DUMH 4B41A 3BSZL 5IMMA 3ZDYF 3L5XH 2ADJA 2Q7YA 5CEYA 2AK1H 4NZTL 4WHTB 1CQYA 2N56A 3HE6A 3HC0B 4OCWL 4TUOA 4UT7L 3T1FA 5F3HA 2B5IC 1JGLL 1IMHC 1JK8A 3DVNB 3V52L 4HGMA 5FYJL 2PTVA 5EFIA 3DTXA 3CSYB 1PFCA 2IG2H 2JJSC 2APXA 2E7HA 1F11A 3SE8H 1WISA 3Q6FA 1YMME 5AYUH 4BH7A 4KRPC 1FYTD 3KYAA 4LLAA 4LPWA 4P9HC 4R90L 3RBGA 1QSVA 1UYWH 1Q0XH 3HI1B 4JRYB 2WBJC 1RULH 1ZSDB 3HZMA 2AXFB 4LLWA 1RSFA 5ISZA 4ZNCD 1CXFA 2B4CH 1I3RA 4LGRB 4OCRL 2YRPA 5JO5A 2JTDA 1OLLA 15C8L 4Y2OA 4ZUWA 1NFIB 3IFPA 3U9PH 3GI8L 4X0KB 1L7IH 1S7VA 1HYRC 2YEZB 4WUKL 3RX5A 3GSUB 1V7ML 4EQ2A 4Z7NE 1W8OA 4P4KA 4HUWA 4Y5VA 5ACZB 5GSVA 2DLHA 3TCLB 5LG1A 5GRVL 5IHUL 3WYRA 5I1AB 1JV5B 1KBGL 3BD5A 3E1F1 4HDIA 3I02A 3VA2C 5JOPD 4OGXH 3WXVH 3BKYL 1NFKA 1NSNL 3PL6B 4W4OC 2Z92B 1MFEH 1G6RB 3SE3C 2F9BT 5I30L 2JIXD 4LVEA 2EDWA 4LQFH 1GZPB 2YD2A 4TYUA 1C7TA 1B4RA 1GIGL 4XRCA 5D1QB 2XZCH 3OKMB 4IOFC 3BH8B 4KV5F 1KPVA 1CGUA 3MLYL 4NM4L 1GAFH 4I0PA 1A7NH 4TNVK 3LHPL 3A0OA 2B0SH 3TNNA 4FQQA 3TT3L 1A21A 4XWOD 3WHXA 4RAUB 3SPVA 1UB6A 1PKQE 1YMMB 4G8EB 3GBMH 3BN3B 2IH3A 1WZLA 4P3DA 2ZJSL 1MJ8L 3SE9L 5D2LE 1WV7T 3MBEB 3NABL 3D18B 4LIQL 4XP6L 2M26A 4ZUSB 4ZS7L 4D2NA 5GIRB 4LSVL 1TZIA 4DTGL 2CLVB 4IMKC 1KCSH 1FZJA 1IAOB 5FB8A 5MENE 4PJFA 4LP4A 3IJHA 3T0EE 3AAZB 4X6CA 5EZIH 5CP3A 4MJ5A 5L2JA 3B8YA 2ZPKL 4YE4H 5ITBL 5EBGA 5BOZG 4H1LB 4O9HL 5C0AE 3D69B 5B39G 4TOYH 5CUSL 2VLJE 1RK0A 4BSWA 5KOVC 4TVPH 4W6YB 3VXMB 1F3DH 3QHFH 1NCCH 2J12B 4JANA 3DMMB 2V17L 1CLOH 2OJEB 3EDDA 2Z8SA 1KJ3H 1W72A 2NY1B 3F7VA 2MQ0A 4XH2A 3ZT7A 3UTQA 3DX8A 1GJIA 2XFXB 1G7PB 1QFHA 1QFWI 1D5XB 3CFCH 3KPOB 1J0IA 4R26H 4IIQB 3AREB 1I7TB 4XI5D 5DVNA 3INUL 3O6KL 4JFEA 3K3QA 5JPNA 3L6FA 1G84A 2W07A 4R7DA 4N0FA 1QR1A 2PO6C 2QSTA 3GIVB 5DD6A 5GS0D 1INEL 5IMKA 1TLKA 4F7MA 3VGGA 3UC0L 1NMCB 1LD9A 1OTSC 3GM8A 3FMGH 4L8SB 3FT4A 4M8VA 5DZOA 5TQ0L 4HEME 2PNDA 1W0VA 2EDHA 1XGTA 4X7CC 3ARBB 3LDBC 1R5VA 2OCFD 4NZUH 4LCCC 4QRQA 4ZMAT 3CCHB 1QKZH 1PKQB 1IC5H 4QXUH 2NY6C 1T7WA 3U1SH 4QF1B 1NANI 4FP8L 3FB5B 5A40E 1SBBA 4LKXA 4HULB 2VDNH 1ZV5A 1KLGA 1PKOA 4H1LH 5KN5B 3E2HB 1PEWA 3RVWC 2VL5B 4NWUL 3V6FA 3QXAA 2DQCL 4IMLB 4M7LL 5EORL 5C2UB 4KQ4L 2R56H 3HA0A 1E6JL 5DD1L 4RDQF 4J1UA 4POUB 1OD7A 4X6DF 1P4BH 1ZTXL 1P4IH 3BPLC 2DYPA 2FX7L 3PWPD 4UT9H 1T3FA 2QEJA 1LNUA 1JRHL 4TPRL 3O3DA 4U1MB 1DN0B 3QG6B 2VLLB 5F6IB 4RMQA 5EZLA 3TO4B 1A7OL 4X98B 5F9OH 4G43B 3EYVA 4XWGL 5B39A 4MQ7B 5JUEL 1S78C 3RDTA 1IC1A 4ISVB 3TH2T 2D4FA 4X4YB 4V1DB 1OSPH 1V05A 5KS9F 3NH7L 1AO7E 4N8VA 5DK0B 1VHPA 1XGRA 4E5XB 3X3FH 2X1WL 4HBQA 1BJMA 3H6JA 5GRJL 1GGIL 2IMMA 3I2CH 4H26B 1CDUA 3EGSB 1KTRL 3GSVB 5I76B 4NQEA 1IKFL 3TIEA 5F71A 4LVNB 3GSQB 3QUZA 4UOW0 2XG4A 4P2RA 2V2XA 1HQRB 3IJYA 5SX4H 5E5RB 2N7AA 4WI8A 3SGEI 4I3GA 4J6RL 1R3HA 5TPWH 4CVZA 2NNAB 2A83B 5HHQA 3CMOL 4JVUA 3T0EC 5T1LB 2BFVH 2IADA 1HWGB 1N59A 3K2MC 1TJGL 2CIIA 2R0ZL 2ICWB 1BM3L 3S96B 3W9EA 5FM5O 1UACL 2I60L 3FOLB 3OKOB 4WHTA 1MIEH 3O3BB 1QBLH 3TYFA 2BSSB 2B2XL 3MUGB 2HYMA 4WV1A 3BMVA 1XGYL 1WBZB 5GGSA 5DQ9B 3MRDB 3ARDC 3DVGB 5IM7B 3LRHA 5E8DL 1NC4A 3CD4A 5BZWA 5DVLA 2MCG1 1NUGA 1QNZH 3B9KB 4QHMB 3TO4C 4QYOB 3L1OH 5D70H 2Z35A 1HIML 4XNMB 4M61A 4KK6C 3VXOA 4H1LG 3HI1A 4DKFH 2BVPA 4JRYA 2NW3B 4F9PA 5F7YC 3RTQB 4NGHH 4LFHG 2DQFA 2P7TA 3T1WA 4LMQE 5D96C 4D8PA 1JCKA 3G6JF 1RFDL 1HOCB 4ZFOL 1I1CA 4MDIB 3L3DB 4LSTL 1OF2B 4LARL 3B2VL 3HLAB 1AP2A 1NCAL 1UFUA 3PL6D 2IANB 4IRJB 3WD5L 2XWTB 2EYSA 3IU4H 3HR6A 1UA6L 4Y16B 3ULVL 1OAZH 3BPNB 5FCUL 3AC0A 3S88L 2F58L 4WY7L 3OR6A 2GI7A 4ZUUA 3QHZH 1JHLL 5CJOL 2C7UB 2EDFA 1CTOA 5D1QD 5KAQG 5TQ2L 1Y0LA 3WFDL 3FQNA 3PXHA 2MPAL 5HD8D 4ELMF 3VFUB 4G8FA 2HFTA 1MFAL 3IETB 4JDTL 3LKRB 4Z7WF 3FN9A 3LSOB 1U93B 4K3EH 4E41E 2WM0A 5L8JB 1HSBA 2CIKA 5C1MB 2OR9H 4FQJH 5CGTA 3JTTB 4GS7B 1YMMD 2H2SC 4OFKA 4JO4H 4JY6A 3TVMB 2Z4QB 4MMZC 4MNGE 4GRMB 3T3PF 3PP3K 2BSED 1MRDH 1MEXH 2EDKA 4IHOB 1U6AL 5E95B 1A5FH 2ZUTA 3JZ7A 4FZEH 4JG0L 3L3IB 1EO8L 1A0QH 5C9KA 3WIHA 2XXMB 4U3CA 2IMNA 4M7KL 4EIGB 2YN3A 3RVWD 1I4FB 3HZYB 3LKOB 1NMBL 1OCWL 3O8XB 3MBEA 3QRGL 5MERB 4XMPL 3D18A 2BSRB 2EC8A 1D5ZB 4HGWB 4KGJA 2EDLA 3EO0B 3QDMB 3VRIB 5HHME 1NGWA 3DMMD 2MCPH 1EVUA 4Z76B 4U7SA 3DECA 1QYGL 3EYUH 4M3JA 5INCA 1FH5H 1MIML 1SMAA 1NUFA 1ZEAH 3ZTNH 5L8KB 3DURB 3WXWL 3ZHKA 4S2SB 4MA1C 3UMTA 1MCBA 2Y7QB 3RGVB 3WUZA 4NJ9L 1KXVC 2OI9B 3ARED 2BJMH 3UTSB 3G5ZB 3BIAX 4LHUG 5EA0L 2H6PA 3LZFL 3UPAA 3RRQA 2NPLX 4HX1B 2FECI 4HF5H 4JZJC 3RI5F 4C56A 3FT2A 3AM8A 1T5XB 3WIIL 3CSPA 3HPJA 2X4OB 5FKPA 1G7QA 1YEKL 1G7PA 1T22A 5KJRH 3TT1L 5KVGL 5C6TL 4IIQA 2X44D 1KULA 3QJFB 4KQ3H 1ZAGA 3LS5L 3PABB 1LVEA 5JQ6L 1NEUA 4XVSL 4G6ML 1I1AB 2DMBA 1P1ZB 4OM0H 3GRWL 4C4KO 4DUVA 2IALA 4NQDA 4MNGB 1ONQB 4L9LA 1J18A 4BQCA 2WWMC 4PGEB 4NRXB 4AIXA 3VJ6B 4X5WB 5MEND 1MCEA 3DBXA 1BD2B 3T0ED 3FTGA 4FTVE 3MUJA 1RUQH 4FFZH 4P59L 1BVKB 2NTSP 5LCVH 2B1AH 4U1JB 3Q1SL 4OCSL 1NGYA 4O58L 4L29A 1ZHNB 2GJJA 2HJKB 3ARQA 1I7RB 1X5GA 5C0AD 4HIEA 2OL3L 4LSPL 4PJXF 4EI6A 4P4RA 1T2JA 2O5ZH 2DWEB 3FN0L 3LQAL 5CSGA 3P4MB 1R24B 2FSEA 3P30H 3SQOH 5KN5A 5EBMA 1VKXA 5GGQL 1QRNE 5DD5H 4FOMA 2X09A 5BVJA 1AGBA 3WUWB 5C0CA 3D39E 1BHGA 3RGVC 2DTML 3PGFH 4FFVC 4RGNE 4XAWL 3TO4D 5LBSH 2NY5L 2YK1L 3AS3A 4NO3B 3SDCB 4ELKB 3P9MB 5J3HC 2EEAA 4U0QB 3LQZA 4YXKL 1GGUA 5IV2A 5L7XH 4ZSOB 3GMRA 3GO1L 4ALAH 4IRZL 4HJJL 4YIQA 4HUUB 5E1AB 4NUJA 4DUXA 3MLSL 2OYPA 3OXSB 1J8HB 4H25A 3DX7B 1A4KB 3IU3A 1B0GA 4FZ8H 4EI5C 2VISA 1S9WA 1DBBL 4PJ7A 5I74B 5CWSA 3OWEA 1DN0A 1GVIA 3VXUA 3KLHD 1GC1L 2X4NA 1C5DB 5BOPA 1YDPB 1I9IL 5K9JL 4LSDA 4QOKE 4MQ7A 3MREB 1ZVYA 1DVFA 4RMUA 3BGAA 2E7CA 2FR4B 3PQYB 4YHZL 5EU5B 4I2XE 3SE4C 5EIIB 4G8IB 4LHUA 5ALCL 3VG0H 1ED3B 4Y2DB 2OK0H 1EMTH 2EC9U 1I7UB 5KW9H 3FAXA 1OL0A 2O5XL 4GLRH 1EHNA 4FXLA 1E4KA 3ZKND 4JN1H 4FFWC 4KKCD 4Y88A 5EZJB 4PJHA 5T1LD 3GSVA 1LILA 1CFBA 4LNRB 1OLZA 1WZ1L 3NCBB 4GW1B 2W0LA 5HHPA 5DRXA 2BC4A 2DLFL 4JGUA 4YAQA 1TITA 3HFML 3MRBA 4ODHH 4GAFB 4R3SB 4XCFH 1ERNA 3DI2B 5GGRA 1X5KA 1PG7H 4PJIF 2F19L 3VRJB 2OP4L 3R1GH 1AJ7L 5ANMA 4O02L 4Q9RL 1J10A 1YN7B 3WHE0 5C0RH 1H3TA 3S96A 4YDJA 3TESA 3SJVB 3KWWB 4M3KB 1RZJC 2FATH 1QRNB 3VCLA 4PUBH 3M1BA 5EZOL 2DQHL 3D39B 3RTQD 2DJSA 1RJLB 4A2MA 4RGNB 4NN7C 5T1MA 5BV7B 5DQ9A 1MNUH 3JV5A 4JHAL 3WV0A 4CGTA 4PJGB 2W59A 4Y1AA 2J5LC 2XNAB 4QRSA 1AR2A 3WN5C 3OMZA 4OFDA 2CLRB 1AIFB 1KLFA 1ZHLB 3A6CH 3BFOA 4DGYL 1MAML 1Q38A 4QHMA 1E4XH 1S5HB 1H15B 3BZFB 3VI3E 4IRJD 1AO7D 1JPGB 4W81A 3GMLA 5TE6L 1CF8H 5AYQA 12E8L 2HN7B 2OJZH 4Y16D 1FG2B 3DO7A 2P4AB 3KXFE 3NCEB 5E6IA 5IG7B 4WHCA 5FO7A 5C0JA 4QOKB 3FRUB 1F02I 4Z7UB 1X4ZA 4I2XB 5ISZE 2VH5H 1QSEA 5DWUH 2HMIC 1LE5B 3VXNB 3CMGA 3RZCA 4HV8B 3EW3B 1GGCL 5J8OA 1MJUL 3PNWB 4ODSL 3B3IA 1FE8H 4LCYA 1T2QL 5TE7H 4L4VA 4B7LA 5IB5B 1XAUA 5CSZB 3X13A 3TVMD 2IWGA 4KTYA 3RX7A 4D0BA 3UCRA 3BWAA 4OD3L 2ZUQB 3DGGB 3L3HA 4ODWA 4JDVB 3WIFB 5HGDA 4X7FC 1IGYA 4OF3A 3ARVA 4U1NB 3V0AC 4FXGB 3D9AL 4P3WA 3R8BB 1U8HA 2IPTL 4GMTL 1LO4H 2OMBA 3JTTA 5F9AC 5T5FL 5BV7H 3MJ8A 3HG1B 5CJ5A 2WINB 1MCQA 5DRNB 5ESAB 4RGNC 4FXKA 2XPGB 5E9DA 1KLUB 1U8KB 3DIFB 2HLAA 3MMEA 1N8ZB 1A6AB 1G9NL 2E8YA 3S4SG 5HYSA 1B4JH 3FFCA 3I6KB 3KPNA 3HC3L 3OAYH 3STZB 1LP9F 3V7AE 3BH9B 1RUKL 3WNPA 5JLZA 4OB5L 2HFEB 3HC4L 2A73B 3L5WB 4CJ0A 2HJLA 5J9PA 3WUWG 3BDYL 1Q9WB 2XN9A 3CFDA 3QNZA 3ESUF 4CJ1A 4QRPA 4JQIL 3QQ3A 1UXSA 1I4FA 3LKOA 4UDTA 2FWOB 3C2SA 3PWJA 3U7WL 2YD8A 3LMJL 3RGVD 1I8KA 2AQ1A 4FFVD 3MODL 3JV6A 1OGTB 1A9EA 2BSTB 4HBCL 1EEZB 4X5LA 4Z95L 5E5MB 1J1XH 1A3LH 5J3HD 2Z93B 4JPIB 3VD5A 2IFFH 3PP4H 4PBWD 3KXFB 3QXUA 4JFXA 4G3YH 4KVCL 4HWEH 3PWVA 3CZFA 3GMOB 5K9QI 4TNWK 3WL9A 2ADGB 4X6CE 3UO1H 4EOWL 1IQWL 3HAEA 1MVUA 5KG9B 1CGYA 2EKJA 4CMMA 4E41D 4PB0H 1H0DA 2DOCA 5EBWB 3QO0A 4M4RA 3U82B 1PX4A 5IFAH 1T1ZB 2NZ9C 2FHBA 4Z0XB 1I1AD 3EYQC 3QYCA 4HUXB 4U6VL 1EXUB 2OSLB 1A7RL 1OGAA 2X4OA 2CUIA 3QEUA 1JZ2A 3MTRA 4GSDL 4HC1H 4KHTL 4JG1H 2EH7H 2GCYB 5F9WB 1MQ8A 1KF9B 2PYEE 5F44A 1B2WL 3JWNC 4G5ZL 4WTXA 3SDYH 5MP6H 5EU4B 1KEGL 2APWA 3MRCB 2C1PB 3S7GA 1DUZB 1U8NA 4MNHB 5TGBB 4JJ5A 1MFBH 1CXIA 3T0AA 2VQUA 3K80A 4ZTOL 4BZ2L 3EOBB 4NRXA 3FRPA 2DQIL 4X5WA 4QXTB 5HHMD 1BD2A 4D9LL 2VLKE 3N85H 4O5LH 1HHJB 1BBJB 2I07B 4LLVA 4NSKB 3H9SB 1TNNA 1CGSL 2DWDB 3O3EA 1YECH 4FRWA 4N0YL 3S4SA 1LK3L 2V7NB 2DBLL 3THMH 2XA8H 4JHWH 3TF7C 3CFEB 5L2KE 4K7PL 2DWEA 2AERT 4J3OC 4JB9H 4D9QE 3T0XA 2X2YA 1JWUA 4GBXB 3ARPA 2V2WB 3LRGA 1AFVH 4HQQH 1PGRB 5JW5B 3R0MA 1WC7B 2W0FB 3U0PB 3F7YA 4AM0B 5LGJB 5DR5L 5E2VH 1TVHA 4NBXB 1T83A 2DM3A 2FHFA 1LE9B 3T65B 3QUMB 1MCOL 1DQQB 4ZSOA 4QT5B 2A6JA 1G0YR 1QBML 4P4KC 4XPTL 3C60B 3VGAC 3VWJA 4WO4A 4Y5VC 2O5YH 2GTWB 2VOTA 4M5YL 3AU1B 1NBVL 1IGMH 5DJ2A 4XGZA 5ESVB 3RY4A 2H8PA 1RUAH 2A1WL 3W39B 2CGRH 3P73A 1FV1B 3T0WA 4CVXB 4W6WB 4RAVB 3VFWB 1BVLA 1HHGA 4MDJB 1MUJA 5HPMA 4Q97A 4M00A 2HFGH 3QPQD 4FQ2H 3QH3B 3PQYA 4XBPB 4JKMA 4FTVD 5L0QB 1EV2E 4IDJL 3QCUL 2GJZA 4Y2DA 5KSUA 4QRRA 4LCWE 5KSAB 6FABH 1RV6X 4G7YL 2AKRA 5KSVA 2FLRT 3EJYD 3S5LB 1OTTC 4N9GB 1UM4L 3WFCH 3PWLB 4OSUL