1YNLL

Identification of key residues of the nc6.8 fab antibody fragment binding to synthetic sweeterners: crystal structure of nc6.8 co-crystalized with high potency sweetener compound sc45647
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
219
structure length
219
Chain Sequence
ELVMTQSPLSLPVSLGDQASISCRPSQSLVHSNGNTYLHWYLQKPGQSPKLLIYRVSNRFSGVPDRFSGSGSGTAFTLKISRVEAEDLGVYFCSQGTHVPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig gamma light chain
publication title Cocrystal Structures of NC6.8 Fab Identify Key Interactions for High Potency Sweetener Recognition: Implications for the Design of Synthetic Sweeteners
pubmed doi rcsb
source organism Mus musculus
total genus 52
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ynlL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ynlL01
5FGRA 1RIHH 2VDKL 3EW3B 3VG9C 4OGYH 3T0EA 4R7NA 4P3CH 1EUTA 1MJUL 1KCUL 5I19L 1V3JA 3EHBD 5D6CB 3FO2A 4QXUH 1ZLWK 5CLTA 4P5KA 3PABB 3F5WA 2I27N 3SKOA 4JO3H 2IH1A 1Q94B 3MR9B 3IDMB 4ZUSB 5BO1H 3DARA 1UWGH 5FAAA 4NJ9L 3UX9B 5I1DB 3UTTB 5IVZB 1G6RL 4FFZH 4MXQD 4C58B 3DYOA 1BD2E 2YPKA 1W0WA 3RP1A 3SDYH 3TZVC 1C5DB 1N2RA 3J7HA 5CWSB 3PWLB 2JB6B 3QJHA 5J9PB 1NCDH 5KVFH 2Z8VC 3K8KA 1J18A 1YC7A 4NN6B 3H9SB 2O5ZL 5D2LA 2ADIA 5GRVL 1IM9A 1QUNA 4HKZA 4D0CB 4PP1C 3OWEA 1RD6A 5FA3A 3V4PH 5F9OL 4IRSB 2HTKD 4FXLA 5I1JH 4N90D 1EO7A 4QHMA 1ED3A 3VI3E 3IDGA 4JN1H 1IC7L 3FOLA 2XPGA 1MAJA 5L7XL 2EH8L 2DQIH 1KENH 2FX7H 4DVBA 1CICD 1XCQA 4OLZH 1PG7H 1VDGA 4OCYL 1KCRH 3T65B 1DZBA 5E2TH 1ZVYA 3CFEA 2QADB 5EH1A 1W0WB 4CW1A 1P7QA 1N2RB 3IDXL 4G3YH 3ULVE 3QUXB 1AQKH 2XZQH 4LHUB 3O4LD 2ZCKH 4D94A 1RK1A 3LZFH 1A7BA 1IM9B 4IRJD 4HKZB 5H35B 1VACA 5HGGS 3JWDL 4EN3C 1G84A 4M7KL 4NQVB 2VJXA 5FA3B 4HBCH 2KPNA 3VFSA 2OQJA 4TOYH 1X4XA 1EJ6A 5DTFB 4XP1L 2RR3A 3D85D 3BXNB 5SWZA 4AIXA 3DO7B 1FL6B 5FECA 4OCWL 1O0VA 4JHWL 1AD0A 3CVHL 4MQ7A 4OFDA 2AEQH 2VR4A 1KGCD 3OZ9L 4LLAA 3BH9B 4L5FL 1T3FA 3VFUA 4WI4A 5E9DE 1I1FA 4GG6E 4RISL 2Q3AA 3MJGX 3P4NB 4O58L 5DXWA 5J7CC 7FABL 2GUOB 3KPSA 4V2CB 1KB5B 1XCTA 4LCIH 3QUZD 1JPSL 5F7HA 4OBSA 4GBXC 3BZFA 2EXYC 4X0KA 4XC1L 3UPRB 1H9VA 4ODUB 4UOW1 4FABH 3HZKA 2YBRB 4YFDB 1TDQA 2RFXA 3NGBB 3UBXI 5KBNC 3VFNA 2C4FT 2R1YB 3RIFK 4LLDA 1MHEB 2NW3A 3RX5A 5DHVA 4K7PX 1HK6A 3D2UD 2BVQA 1P53A 3LN5A 3RZCB 3FAWA 5IP4A 1HE7A 5IROA 2V2XA 1D5BB 2GK0B 3C60B 4YXKH 2P48B 1KNOB 3P3YA 3KLAA 1INDH 2W9DL 3CH1A 5C70A 4IM8A 1KJMB 2XZCL 4XVTH 1J05B 2YWZA 4OD1L 3QO1B 1DCLA 5FFLA 1DSFH 4PJFB 5T3XH 3PQYD 5IW3A 2XZZA 2P7TA 5D5MB 4XPHH 1TZGH 3VXUE 5IJVA 3C09C 4R96B 2J12B 1AXSA 2E7HA 4RWYL 1KEGL 1EFXD 3VXNB 4QHKI 5FK9A 4XT1C 3I84A 5MHSD 2VAAB 3RVVC 4KPHH 1G0YR 15C8L 2B4CL 2R2EB 5AZEL 1J8KA 4NQEA 1F02I 3LN5B 4MB3A 1CXLA 4I2XA 3VFGH 3TVMB 4IRJB 5DURD 1Z2KA 2AI0L 5J57B 2EDRA 5DJ2B 4M1CC 4J6RH 4N0FA 1P6AB 2H45A 3NCBB 5IJKC 1ACYH 3E2HC 3CH1B 4WI8A 3ZKNC 5DRNA 4WFFE 3UTSE 3FRPA 4HFWB 1UXWB 1NDMB 3UJIL 3FZUD 1NJ9A 2R23A 4U3CA 1FVEB 5ADPL 2FZ3B 1BD2D 4Q9RH 3DIFA 3VD7A 1NSNL 2HLFD 5AWNL 4APQC 1SY6A 1AXSB 4JDZB 3GBLA 1IVLA 4HIHA 4BFIA 3S4SA 5GRUL 1BIIA 5HI4C 1FNSL 2XN9E 2Q8BH 3IRPX 5MEPA 2I07A 1HILA 2ERJC 1I8IA 1BAFH 4GRLA 2D7TH 1WTLA 4I2XB 4GRWF 5EZIL 5I1IL 4GQPH 2JJSC 4OZIF 2BERA 5D7SL 2GSGA 4N0FB 1C1EH 4YHLL 1J1OL 2OSLB 4YFEA 3RWFB 5IM7A 2Y1VA 4XVJH 2WINA 5SX4H 2DS4A 1NJ9B 1IZJA 5CKGA 4OLVH 4L8CB 2VLKE 1ZLSH 4XVUD 1OVZA 1H3TA 1NDGB 5B8CC 4OLEA 1MCCA 3GIVA 3MV7A 4WHTA 3ULVD 5DUMH 5EC1B 3V6FA 1FNGA 1I9RH 2XA3A 5DHYA 4JQVC 1A6UH 4JLRB 5A2JH 5MEPB 4ISVB 2Z31A 5LAXA 1JTTA 5K9OA 4LSVH 3HS0B 3B3IB 1K3IA 2A73A 4WTZA 5CSBA 3MRLA 4ONHA 3MCLL 2B4CC 4F7CA 3MRBA 1VHPA 3EOYG 4Z7VB 3NZ8A 4G6ML 1TCRA 3FO9B 3T0VA 3NCYP 3BSZL 1S7TA 3W11C 4OZGF 1PX4A 2NXYB 3PUCA 4LVEA 2ESVA 1MCRA 3NFPA 5IM7B 5E9DD 1T1WB 4LEXH 3ARBA 3CH8A 1ITBB 2XWJA 1JPGB 2F74A 4F9LA 1J5OH 1T4KB 3VGHA 3VRLE 2MCPL 5I1AA 3WS6C 1HSBB 4CU8A 1NCCH 4P59H 4YR6B 1MWAB 3S5LB 3WKMH 5J56B 2FATH 4UDUA 1T0NA 5DD5L 1RMFL 1MCLA 1I4FB 2J8UB 5HHVH 3BPOB 4OQTH 3B9DA 4ELMA 4ZAKA 3ZMRA 4R2GB 3AB0B 1LO4L 2A73B 1ERNA 5I1CH 3QIUC 2EE2A 3ET9F 4F7CB 2OTWA 1NBYA 3DX8A 4POZC 3GBNL 3WXVL 1JZ3A 3LH2L 1X5IA 5DRXA 2NY3D 4WCYH 2ESVB 2W0FA 5GGTH 2RIKA 5GHWL 1QO3B 4HF5H 3L1OL 5CSZB 3EKCA 3GBML 3L3IA 1VADA 1G7JB 4PJEB 4AZ8A 3QEQE 5T1MA 1K8DB 1ES0A 5JUEH 3VXUD 1BFVH 1IGIH 2Q1EA 2OP4H 4QYOB 1ZKAA 4DEPB 4GXUM 4S2SB 1QSEA 1I9IL 1V5JA 4PGZA 2DTML 5EPMB 3QQ4A 3KR3L 4Q6IA 3RPIA 4ELMB 3LQAL 4PJCA 1BWMA 1BZ9A 1PKQE 3IFNL 1MIML 5IOPA 1DQJA 4G43B 5JHLH 2M2DA 4I4WB 2ILLA 3IDNA 1A6TA 3GHEL 3GJEA 5D7LE 3G9AB 5ALCH 1PX3A 3FHAA 2ZCHL 3C5JA 2OTWB 4ONGL 3GSQA 4PJHF 1I7TB 2YK1H 5INCB 2BXYA 1GGYA 1CTOA 4WFFD 4LFHD 1Q9KB 4JDTH 1YUHB 1BECA 3IXTA 1OGAB 2IPKA 1NANI 5DJDA 1VADB 2GTWB 1KPVB 3TO4D 3LHPL 4FQ1L 4G8EA 5E8PB 1G9NC 1ZV5A 4HMCA 3HNVH 3UTOA 1CIDA 2CXKA 4MJ4A 1A9EA 4OM0L 2C3VB 1D6VH 2B5IB 3QQ4B 3ARED 1MAML 3S3JA 2XN9D 3TYGL 1K9TA 1BZ9B 3MRCA 3O3BA 1DQJB 5IQ7L 1L6ZA 5E8DL 3WXWL 4YQXH 3WIIH 5F1OB 4FFWC 3SDXA 3U7WH 2BK8A 3EUUA 5GZND 1U3HB 2YPLE 4YEFA 3GZKA 4JM2A 1NLBL 1F6AA 1U8JB 1OW0A 1R3KA 2AEWA 2NY6D 4L3CA 2IAMD 3A6OA 3B9KB 4EJ1C 3IKCB 1GZPB 2Q8AL 3LEVL 3MRGB 1F00I 4LSPH 5F3HA 4IS6A 5CFHA 4O5LH 1YEFL 4G6AC 4BELD 4IOSD 4N1HB 3DV6A 2VLKD 3F12A 5GGSB 5C71A 4PJ5A 1BLNA 4GUPA 4KROC 3W5MA 3V6OC 4G8EB 3ORJA 1UXSA 1NMBH 4CGTA 5I18H 2Y6SD 3DJ9A 4LCUA 4MNQB 4LLWB 4OCRL 3C5ZC 2ZG2A 5F7NC 1JGLL 2JE8A 4RFEA 2EDLA 1NAMB 4JFEE 2NY7L 1JYVA 2PN5A 2CXGA 3O6FA 3SEPA 3LQAC 5DK2A 2BNQB 4B41A 4QT5B 3EJZD 2DM7A 5FF6A 4YHYC 3KPOA 4U1MB 5D2NA 3STZA 4JM2B 1HHKA 4QOKA 5FUZL 5EFIA 1U36A 1MVFA 2AK4D 3QHTC 4Q0XL 4HKBA 4HCRA 2FX9H 1FPTH 5KSBB 1A21A 1BHGA 1D6EB 4P46A 5IGXL 4NQTA 1Z9MA 4CVWA 3RWJB 3BJLA 5B22A 3TYFA 5IW1A 4J1UA 4S10A 1FL3B 1KJ3L 1XH3A 4NGHL 4GO6B 1QVOA 4KTDL 4UDTB 4UU9B 4GUPB 1NGYB 4QGTA 1MCOL 2I24N 1OOAA 3QZWB 1KXTB 1SEQH 3MLRH 2CUIA 1IC5L 2J4WH 2CGRH 2J8OA 2W1NA 1EXUA 1MCJA 1T2XA 4LCUB 3TO4B 4G8IA 1AE6H 1MQKL 4X7EC 2NY2B 1R0AH 4XBEL 1Y6NR 5DJZA 1NGWA 4LNVA 4I0PD 5F7LB 4XVSL 2W07A 4Y5YB 4U1JA 2D0HA 3H42H 3O6FB 3CSYA 3CFJA 2XG5A 1LQSR 5T3XE 3C2AL 4ONOA 1G7MB 4LPCA 5I73B 3MRIA 5FGBA 3G08A 2ZUVA 1XT5A 4X99A 2EDQA 4KU1A 4GRWH 3WSQH 3DRTB 3GMQA 5DI8A 1SBBA 3QP3A 5LGHH 2NY1D 2X4UA 1GZQA 3VGGA 3QUYC 1WBXA 3SKMA 3R8QA 3QEQD 3T0EC 3UJJH 5KG9A 4JM4H 2BSTB 3HC3H 1A6VL 5I8CA 5JNYA 4JJHA 1L0XA 4UAOB 3Q6GL 3FN3A 1CLYL 3P4OB 3HNSL 4NZTL 5IG7B 3L3GA 3AC0A 1DQLL 4AIZB 2C4FU 3KYOA 3EDKA 1ZTXH 4M93B 4XNXH 3H3PL 1OCWL 1FO0H 1MUJA 5I1HH 3O8XA 4KRPC 1UJ3B 3RL2A 4JRYB 4PTTA 3ZKMD 2ICWB 5C0BA 1ZA3A 3WHXB 2FLRT 2BVOA 1S7RA 4Y4FA 4U1IA 4MLIA 2V9RA 5EO0B 1YJDH 2IG2L 2D9CA 4JFQB 3QT2A 2AK4B 3JTTA 4YDJB 4A6YH 3TCXA 4F33B 4O9HH 3K8LA 4R90L 4NM4H 2JCCF 2H2PC 4L8BB 1NFDA 2X4UB 1GZQB 3CDFA 5DD0L 4YHKL 3IJHA 1EAPB 3MRMA 1UZ6F 3ZDZE 3LSOA 5KG9B 3SO5A 1WF5A 2LU4A 1CQYA 1A4KA 1CLCA 1T03L 12E8H 2I9LA 3MSPA 4LSQH 2ZJSH 3SDCD 3IAQA 4W4OC 4X83A 1U2HA 2ZOLB 4PJIA 4FQXD 1W2KT 3DVNA 4DUWA 2XWTA 3VU2A 2ARJB 3VGFA 3V4UL 4OF7A 2HMID 4BK4A 3X3FH 1K8IB 4HGMA 1CYGA 1OWWA 1CDJA 2EH7H 4X7CC 3TBTA 2A74A 2C3WA 3ZT6A 1F45A 2MSPA 4KJYA 5DD6A 5IEHB 2XOTA 4Y4HC 1FG2B 2Z9TA 4DJMA 5C0BB 1ZA3B 4PLOB 4J12A 1YQVL 3NA9L 5LCVH 1RHHA 2NX5A 4RBPK 4YHMH 3JTTB 5TDOA 4X9IA 1LDPH 5AUMB 2MNUA 1JZ2A 2P44B 5KSUA 1UWEH 3QDAA 1N0XL 5DWUL 2MMXA 1RPQA 4DN4L 5BZDA 3LSOB 3ETBF 5T1DH 4JO1L 5KANG 2EDFA 5B3JE 4MCZA 1A4KB 4JJ5A 1INEL 1JHKH 3BISA 4KK5C 4X5XB 1ZOXA 3MNWA 4YDVA 4X8JB 1MFEH 1Q9WB 3FQNA 4O2CA 3BKML 2BFVH 3RGHA 4LLYB 1SY6L 3IAPA 1V3LA 3DXAA 1EERB 4XPTH 5TQ0H 1KBGH 1UG9A 5E8OA 1Q0XH 1IEBA 5L9DL 4ODTH 4ELKA 1RHHB 1C7SA 2ADGA 3MA9L 4LOUD 5B38G 1NBVL 4NNPH 1WWWX 4ZTPH 1JF1A 2G9HB 3QCTL 4N0CD 4MNGA 5EU7C 3ME0A 1IAIH 2WLYA 4V2BA 1FC1A 4LBEA 3UYRH 4JJ5B 2FJGB 3O9WC 3U7YL 4F37F 5BV7C 1IFHH 1ZT4A 2IJ0C 5C2BL 2OS7A 1A1MB 1CFVH 4O2CB 5IBLC 4OZHA 1WZ1L 1YY8B 3DOSA 3FOMB 4U3XA 1P5VA 1D5XA 3WIHL 5C0AE 3E1F1 2ICWJ 2QQKL 4NKOA 5T3XD 1QRNA 2DMKA 4P2RA 5E2VL 3QG6B 4JEGB 1NAKL 1D9KD 4RMTA 1IEBB 1PYWA 4HUXB 1ORQB 1KCSH 3CSBA 1EHLH 1FCGA 2XKNB 1INQA 1F3JB 3MRQB 1LEGA 1WT5A 3RJQB 2YKLH 4KUCD 2IANE 1T1XA 4LBEB 5C0IB 1E0OB 4Z78B 3RKPA 4OCSL 4PJBA 4Q9QL 2NXZB 2UZYB 3NACL 3MACH 1FLTX 4AEIL 1QQDA 4HZLA 4NOBA 1B4RA 1C8PA 1WCBA 1S78C 2VLRB 3VFMA 2CIKB 1JN6B 1LP9F 1CD1A 3G5YA 1MFBL 1D5XB 3G6JA 2X40A 4L29B 4Y5XC 5CCKH 1CLOL 4JO2H 5FYJL 4JPWL 3QIWC 1QFUH 1QFOA 4X7DC 5IFHH 1PYWB 3QJFA 1LK3H 3JUZA 4JANA 4WW2A 5I1EH 1RUMH 5KSAB 3GSWB 2WK2A 4EUPA 1U8LB 1G0XA 5BQ7A 1QSFE 1F4XH 1INQB 1DLFL 1R3IH 3P0GB 2EE9A 1A6WL 1M6OA 3W9DB 5ID1B 1MH5B 4PJ8C 4NYLB 5KJRL 1IBGL 2VLLA 2VISA 2X10A 1QYGL 3C08L 3EO0A 4HZLB 1GIGL 3GFUA 4LKCB 4ORGB 4G6KH 4P23D 2W91A 1T21A 2XZAH 4Y4KD 2BOBA 1YEKH 2O61B 3QDMA 4OCNC 1VB9A 4RNRA 5CJ5A 2NR6C 2YRLA 4DW2L 4FA8A 1CFQB 3B2UC 5FDYA 5I0ZA 4NNXB 1XF5B 3T2PA 3MLYH 5F7EL 3QJFB 4AEEA 5EC2A 2D2OA 1J87A 1AY1L 2FH6A 1LILA 5C3TA 4EUPB 3BZ4B 4JFOA 2H41A 3P9MA 4WY7H 2PO6D 4DFHA 2ENSA 1L7TL 3OXRB 3OBAA 3RU8L 3MBEC 5F9WB 1BFTA 3QPQD 2VLLB 2VISB 1BZ7A 3K2UL 2EDJA 3S9DB 3OXSA 5B39G 3OJMB 3IJYB 1BIHA 1F58H 1RIVH 1W0VB 4KQ4L 5D7KE 4PRIB 5FYKE 4EDXB 4J8RA 2J1KA 3X11A 4WWID 4P2QA 4BZ2H 1I1YA 4CU6A 3QXTA 4X6FB 4KKAD 4ODHH 4DZBB 1BM3L 2HRPH 4LVOC 1G9NH 2EECA 3KLDA 4NO3B 4GMSL 3VD9A 2OZ4A 4GRMA 5D1ZA 3IF1B 5KN5B 2AABH 4Z7UA 5LQBH 4OFVA 3KXFB 3ZTJG 1KJ2B 1UH4A 2FJHB 1KXVC 1XGYL 1HQRB 3MLUH 4JFOB 5E70A 4ZAKC 3P9MB 4TVSa 4OLUH 2EIEA 1LO0H 3GMNB 4E41E 3EYSL 3BPLC 4H20H 2VSCA 4G7YH 1VEMA 4PFEA 3BRGC 1DP0A 1PY4A 1SVZA 2CKBA 1WZKA 4PJXB 5E5RB 4J8RB 3OKNB 4GRWE 5BXFB 4HV8A 4K71C 3EJYD 4UILL 3SE8L 3TNNA 1AGCA 4OZIE 1MLBB 5EZOH 3B9VA 5C0AD 4LPUA 3TP4A 1WIPA 1EO5A 2GJJA 5E56A 1U58B 4R4BA 1BF8A 1Z9OA 2DLIA 4P5MA 1UVQB 4LF3A 3O6LH 1Q9OA 3GSVB 1DEEA 1MCPL 1KIRB 3HLAB 2ZNXA 4GW1B 4Q6IC 4WO4A 3IETB 3O41A 5ICXA 3MV11 3MA7A 1TFHA 4B7IA 2IAND 5ICZB 2B0SH 1I85C 2ARWA 4M1DH 4XC3H 4C56B 3OKOB 4BZ1H 2CKBB 4P4KA 1PG7X 4RA0C 3BUTA 1FH5L 5I9QC 2IEPA 5D1QA 4DKFL 2NY4B 3TBWA 5FKAA 4HV8B 3TNNB 2BCKA 3AY4C 3MV8E 1RURL 5ACMA 4OZGE 1OB1A 4TPRL 3NTCH 1SM3L 4WWKA 2ZOKA 2XQBL 3C2SA 3S34H 3UDWA 4BSWA 1GGBH 4NHCH 3RQ3A 3RVXC 4P5MB 2FIKA 4LF3B 1T20B 3ZE2F 3ISWA 1OD7A 4YAQA 3MLZL 5DD1L 4QKXB 4QRSA 5HVGB 4ZNEE 3RHWF 1EJOH 5A2KH 3AXLB 1QSFD 3B2VH 4FTVA 3PG2A 3O41B 5ID0A 1AD9A 4TTDC 3L95A 3FO0H 3MA7B 5CIPA 3BWAA 1JHLL 3WEXB 1LO2L 3P11L 1BVKB 2VLJA 1IGFL 1BGXL 2FGZA 4V1DB 3MTRA 4CNIA 4ETYA 2NY0D 4WW1A 1DVFB 4Q7DA 5IT2L 3PGDA 5D1QB 5DHXB 2A9NH 2VE6B 1CD9B 1NFKA 2BRRH 3GJFK 1F3DJ 2H32B 3BQUA 3WNKA 1I9JL 1U8PA 4PUBH 4X6CF 4WWKB 2GTZA 2EDDA 2P47B 2V5TA 1J0ZA 2GITB 5CINL 2LTQB 2R2CA 3GKWL 4XHJD 5KANI 2AK1H 4KAQH 2VDMH 3VXRE 4B5EA 1GC1L 3RDTB 4M4RA 3HRZA 4IIQA 3JV5A 2DDQH 4FG6C 4XPAL 2QBWA 1GRWA 1EX0A 1AD9B 4MAYD 4QXTA 1MCNA 3BMWA 4U1KA 5EA0H 3ARPA 5E6IC 3PP3H 5D2NC 4GAGH 2DRUA 3BKJH 1OTUC 3UTZA 2VQTA 2GJZA 1ZHLB 1PY9A 5D7KD 5FYKD 3KYKH 4HLJA 3WNLA 4P46C 3JWNC 3MGOA 4PJHE 2X2YA 5DQDL 3C6SB 1U8PB 1KN4H 4RX4D 4U6YA 3AUVA 1JRHI 4WUUE 4R3SA 4I18A 3FRPG 5C0RL 4YBLB 5JQ6H 5FV1L 5J6GB 2IPTH 4X6EB 3ZHKA 4HH8A 3IDJA 4X80H 3RY6C 1MHHB 3ZE0F 5DUBA 1A7QH 4U1HA 4E41D 2YR3A 3EYVA 3MLTB 2MCG1 3SQOH 3S4SG 2DQHL 1E4KA 4XAKE 2AXGA 5L88L 4Y16B 3UTZB 2BP3A 5FGBC 1VA9A 2Z91B 5M94B 1DFBL 1H15A 2C1PB 4FFYL 4HLZH 3P9LB 3AMLA 3MGOB 3DBXA 4EN3D 4YE4H 4Z18A 1CE6B 5JLZA 1FYTB 4M3JA 2OXGA 4X4YA 3EFFB 4R3SB 1FNHA 3RX7A 3KPMB 2V5MA 3P30L 1S7VA 4KK6C 1T83A 2UV3A 3GRWH 5T1KD 2HWZL 5CUSL 2CO7B 4Y2DB 4MAUH 4GLRH 2GI7A 2GHWB 5DUBB 5IWLA 1GC1C 5C1MB 3Q6FB 4Z7QF 4YZFF 3WN5B 4LARH 4EXKA 4PIRF 2QQLL 3M1BA 4R9HA 3BDXA 3O8XC 1D5IL 5I2IA 1CDUA 4I48B 2P5EE 5I66B 2AXGB 3HUJA 3ARFB 1R5WA 4Y4FC 1RUKH 2VZSA 3I85A 4WTZG 3VWJD 2E5EA 3EZ8A 3D0VA 3MV8D 4ZQKA 5ESAB 5I16B 2FD6L 3OJDB 4OJFH 4ENEC 2Z8RA 5JA9A 1E6JH 3MODL 3WFDH 1YY9C 4ODWA 3HZVA 1FGVL 4TNWF 4DGVL 5D93B 5D1XB 3SDAB 1CDIA 2D4DA 1HSAB 2BRQA 4LNRA 4NKMB 4E42A 3BEVB 5HYJE 2FEDC 3GSNA 4XPGL 5EU6E 5F7DB 1I3RB 2AERT 1GYAA 5JIPA 1PDKA 1ZLUH 5IVXB 1IEAA 4KKNA 3HUJB 3MX0A 2VDPH 1V7ML 1CZ8L 3T1WA 5AEAA 5HD8C 5IB2A 2AJVL 3RVVD 3HE7B 3O4LA 5F6IC 3F65A 3HC0A 3MRPA 4RMRA 4AT6B 4JHAL 2ID5A 2VRAA 2OI9C 5DZNA 1H8SA 1QSZA 4JFFB 4NP4L 4XCEA 5IR1B 5D6DC 1N59A 3LEYL 3GMPB 3NZHL 1AFVL 2EO9A 4J4PC 4LIQL 4JFPB 4M1CD 4JN2A 1SYVA 1MFDH 3VXRD 4MMZC 1HZHL 2ED8A 4LNRB 4ODBD 1N5AA 3JV4A 4XNZC 4F8QA 3L5WA 3K4DA 5GJTH 5FYKU 1MFCH 1T7WA 1FAIH 3QDJB 3BDYL 5CGYD 3MNVA 4K7FB 4DAGL 3CX5K 2DM2A 2V2WB 2X6MA 1LE5A 1ZS8B 1BFSA 3MO1B 4RFNB 5AAWA 1CR9H 1NQBA 5JOFB 3GMRB 2YD3A 5JTWA 1CXKA 3OKKB 1P1ZB 1I1AC 5E99H 3QUZA 4HIXH 1JBJA 3D1MC 1FO0B 1T66D 4K23L 1CD0A 3EYFB 5IB2B 4PGBA 1FVCB 3BD3A 4KHTL 4NOFA 4H0GA 1NEZB 1V3MA 3L3OA 1T6VN 3FN0H 4OGXL 5JIHA 5IW6A 3VWJB 1R3HA 3B8YA 4XCEB 1B4JH 1AP2B 4WUUD 5HGDA 4P5TB 3D2UA 3N1MC 2JCCE 5ISZA 1RUQH 5T1LB 2ATPA 4JFHE 4Z9KB 5JW4R 1EHNA 3MNZA 2VDRH 1D3CA 4AQOA 1EEZA 1UZ6E 1OWRM 5TH2B 5DC4B 1TZHA 1Z6JT 4Z77B 3K80A 5IFAH 2IQAB 2CK0H 1ZA6A 5C0DA 2ED9A 4JFXB 1K6QH 1TENA 3D3VE 3V5HA 1RULL 4XAKD 3PQYA 3TBSB 5J11C 2MKLC 3GO1L 4JFDE 5SWQB 4NUJB 5I75B 5FA4A 1HI6B 4U05A 3CIQA 2LVEA 3MXWL 2JTDA 3R0MA 3FB7B 1BVLA 1S9WB 3P0VL 3QQ3A 4RDQG 4N5EC 1EMTH 2R2HA 3D39A 4FS0A 3L7FA 4PRHA 2IADB 5CZXC 1YMHB 4P0DA 1R3HB 1F4YL 3FQTA 4RAVA 3OR7A 2DLFH 5ISZB 3TNMB 3W11D 5LKNA 3GHBH 3HRPA 3MNZB 4HWUA 1RJYA 2PW1A 2EYTB 3KPRB 1Q0YL 4PB0L 3V0AC 1RHFA 3K4ZA 3AS3A 1KCVH 1R5VB 1I7RA 2OZ4L 1WFOA 2AQ1A 2HT4C 1IGML 2P5ED 2UY7A 3KPQA 4MNHB 3P2TA 5HHQA 1BD2A 2F8VA 3C8KB 3WHE1 4K2UH 1NGXA 4F57H 1RJLA 5L0QB 3LPWA 4PJDF 1WC7B 1KELL 3NCFB 3JV6A 1OP9A 1X6NA 3IXAA 3QQ3B 4YHIB 2P5WE 2R1WA 4PYHA 3D39B 3L7FB 1U41A 2IQ9L 3MFFA 3CXHK 2X42A 4O51B 1HHJA 3NN8B 3QIUD 1J1PL 2KBGA 4ZFZB 3GK8L 5E4IA 3U9PL 4POZD 5IVOA 4DZ8B 3G6AB 3MXVH 1AR1C 3X13A 1MCKA 4N68A 4BQCA 4XP9H 4NC2B 2FB4H 4XWGH 5HYJD 4PRBA 3ZKXC 3ARDC 5EU6D 2Z92A 1WBYB 4MA1B 5FYLH 2EZ0C 5E2WH 2R0KH 4TULH 1P69B 2DQJH 3EFDL 2CPCA 3ZTNL 5ACZA 1FZMB 2X4PB 5C0EB 1RFDL 1IGCL 4DGYL 3VG0H 5GGVH 1YNTA 1RJLB 4U6VL 5IMMA 3SOBH 3HAEB 4OTXL 3JV6B 2Q7NA 1H5BB 4O4YL 2GSIB 1DN0A 4H8WC 5I6XB 3WFHA 5HY9A 1NGPL 3QDGD 1QKZH 3EO1B 4LDOB 3W39A 5C0GB 3S96B 1FFQA 5FUCC 4F7TA 1FE8L 5GRJL 2R1XA 3SE4A 2VR9A 3QNXA 3W81A 4U4BA 4FXGA 4ZYKB 1FYHB 5SWSA 3DUSA 3LQZA 4XP4H 3U7AA 2DQUL 1VFAA 2AJZA 4EOWH 2Z92B 4D9LH 4J3WA 3SDDC 3RVTC 4CJ0A 4ODVH 5E9DA 2D4FA 4GG6A 5DJ6A 3O6MH 4E0RA 5KS9F 4N1EA 1U8IB 3QSKB 1IQWL 1LP9E 1TLKA 5D1ZC 1YNTB 4NFCA 1E4XH 1ZSDA 5BS0E 3MOQA 3NIDE 3QEGL 2YUZA 5F3BB 1I7ZA 4K3EH 1QNZL 3NFSL 5HHOD 3WFHB 5HY9B 4FFWD 3W39B 2AVGA 1J8HE 1JGUL 1UYWH 1XZ0A 3CFDA 4F7TB 3DUUB 1KPUA 4FXKA 2ITDB 1CLZH 4WGVB 4LQFH 5JHDE 2OL3A 4AH2B 2Y5EA 4JFHD 5DEFA 1IAOA 3VFPB 2EYSA 4KKBC 3CLFH 5F21B 5L2KE 5SWSB 3DMMA 3LQZB 4IJ3B 4J3OC 2PETA 4JO4H 3ZYOA 4G6AD 3TA3B 3RWHA 4K8RC 4EBQH 5DLMH 5J3HC 5CHNB 5D7IB 2CJUL 5E24E 3HHRB 1JP5A 2NLJA 4Z7NF 3QULB 1SEBB 5HYQB 2ZUXA 3DGGB 4RGMC 1CN4A 3SBWC 3VXUA 2O93L 1O7SA 2A6DA 1B2WL 3H9ZA 1WJ3A 2N1KA 3C5ZD 1AR2A 5GISH 3L5JA 3OKEB 4WO4C 1TQCC 2D31B 3T0WA 1T5XA 1Q72L 3G5XA 5ECJE 2I26N 4DQOH 4FQJH 2HJFA 4P48A 3QYCA 2SEBA 1HDMB 4EQ2A 3BESR 3K4AA 1P9MA 4XBGB 3QDGB 5DEFB 1IAOB 1DQQA 3F7VA 4NQCB 2PR4L 2EDXA 3E8UL 1R24A 3BHBA 2AJXL 3DMMB 5DA0B 1AO7A 3T4YA 5E94B 2F19H 4KRMB 4ZUUB 1RZKC 4LPYA 3UTSA 5IB5B 2E8ZA 3KNBA 1M7DA 3T2NH 2HVJB 4QHLA 4L3EB 5F70A 1ZAGA 2CKNA 4PJ9B 3S35L 2MHAB 3UDWC 3UAJC 3CLEL 5A1AA 3SGEI 5IBUG 2H1PH 1VPOL 1JV5B 3LKNA 2R29H 2IFFL 2WBJC 1XIWD 4M7LL 5F7KC 2XY2A 3L3DA 4UT9H 1KEML 3N85H 4GS7B 5IEKB 4HQQH 5GQBA 4GMTL 5DA4A 2P5WD 4XXCC 2XN9A 3WFEH 1DBBL 3GUTB 1TQBC 2XRAH 3SCMA 1U91B 2D7OA 2SEBB 3DSFH 1G7HA 1RZ7H 4P2OC 5EOQH 4EI5C 3EGSB 4KWUA 5HHOB 1KIQA 2WV3A 1OAKH 3RUGB 2DQEL 4TSBL 1M71B 1W72A 2UWEB 3LS4H 4RWHA 3UC0L 1FNEB 4X7TA 2IAMA 2QV2A 4K9EC 4X9GA 3S98A 1AO7B 2BOCA 1KCLA 2X4OB 5BVJA 4I1NB 2HT3C 3C6LB 3KNBB 3BQUC 3MCG1 4NO2A 4YNYB 3X14A 3RWDB 1P2CB 3QFDA 2VLKA 3BGMB 3BO8B 5GRXG 4ZXBA 4PGDA 2W9EH 2RHEA 1YEJH 4PGCB 4R0LA 1LNUA 4ZD3H 2GJ6E 2AJSH 1JNNH 4TUOB 4IIQC 4PTUA 2IF7A 3WFBL 4XGZA 2R8SL 1WUNT 3SCMB 2B1HH 4MDJA 3UBXA 2BSRA 4M62H 5J89A 3VWKA 1BEYL 3FTGA 3RL1B 3KPPA 3O3DB 4QCIB 2Q3ZA 4AMKL 3ECBA 5F7WC 1CGYA 3C9NB 1AIFA 3HG1E 4JZNA 3FRUA 4GAJH 3B6SB 3PIQA 2QKIB 5I71B 1UACH 2R4RL 1DE4A 1K2DA 3MLWL 4WHDA 5I19H 1I3GL 1CFTB 2A6JB 1CGUA 3QFDB 4NT6A 3WO4B 4I18C 3VXSA 4ZUVB 3WMSA 3KPLB 4ZXBB 2JB5H 1TJGH 5FUOH 4PRNB 5DC0A 1I8KB 5E7FA 2GFBB 5C9JB 5GRVK 3MGAA 3GSNL 3OKDA 3PWPB 3BKYH 4L4VE 4ZSOE 1FDLH 2DD8H 4KY1L 5D4QA 5BS0D 3PL6D 1MLCB 3JXAA 4NJ9H 1ZHBA 1Q1JL 3FFCB 2QADC 3ZE2E 4I0PA 4XGZB 4FHBD 4Q9CA 1J8HD 4HSQA 3H8NA 1HHIB 4Y4HD 3QUMA 3QUXC 1A7OH 2VC2H 3UBXB 5JHDD 3HMXH 1XR8B 1T80A 3DX7A 1WISA 5L2KD 2NZ9D 3CXDH 3QWRD 1A6AA 3ECBB 3GDBA 1AIFB 3FQUB 1RI8A 1DUYB 4NUGL 1A7NH 4U1SA 4U1LA 1TTFA 5DSCB 4EDWL 5C6TH 4HS3A 1A2YB 3DX6B 3HE6B 3OR6B 1KF9B 3QEQA 3WUWG 3VXSB 1IC7H 4EQ3A 4M8VA 4UINL 1FZKA 5L7XH 1KTDB 2EH8H 3BW9B 3OKDB 1L9NA 4X6CE 1T83C 5DC9B 2Q6WA 5ADOL 4U6HA 4MHHG 4OCYH 4ZPTB 3L5XL 3KWWA 4W70A 3QCVL 3U6RB 2ENYA 3ZYIA 1JF6A 1G9ML 2DQDL 1S9VA 4Z5RA 1J86A 2GY5A 3ZDYF 4KVCH 4ZFFB 1EEYA 4M6OL 3IDXH 2PYEE 1HNFA 5D7LA 4MA7H 4MXQC 4HC1A 3I9GH 4H1LG 3MRRB 3GJFB 4KGJA 4G80A 3VXQB 5BRZE 5JXAL 3OKMB 3FQXA 3NGBC 4LCCA 4HJJH 4D0DB 1LDSA 3GGWA 5LXGL 5F88A 1V05A 2HT2C 3OF6D 5EWIL 2AW2A 3GSOB 2V6HA 4F3FA 2D9QB 3VFRA 1B0RA 2E7BA 1JNLL 1DBJH 1N4XL 1UCTA 1OSPH 3EYUH 1FVDA 4GH7B 4OCWH 2HA1A 1QFWL 3O45A 3H3KA 2HTKC 4YPGA 2ATKB 3CVHH 3HMWH 5TDNA 3ZZ1A 2DQGL 3H9YA 1P4LB 4L5FH 5I76B 3L6FA 3V4VL 3CFKA 1DTUA 4IRZL 3SDCA 1XF2A 5DJYA 5AD0A 5MP6L 5I8EB 1UWXK 4FQXA 4HIIA 1CICC 3HTLX 4TUKL 4HXBL 4RISH 4Z5RB 4O58H 3RGVD 3GSXA 3KLSA 5D7JA 5ANMB 3P77A 4YXHH 1A02N 3GB7A 4IEFB 5D7LB 3ZE0E 3Q1SH 2V7HA 2YPLA 1FLRH 4XC1H 2LVCA 2ZSVB 2DYPD 3CFCL 3S88L 1V7NH 1NEUA 1AJ7H 4LCCB 2VYRE 5EOTA 3SPVB 4X8XA 5BOZG 1IKNA 4MA3A 3MYJA 4IRJC 3TVMC 3MBXL 4N0UE 2E9WA 4Z7WB 4UNTA 3WIFA 3SJVD 1YEHH 4NC1E 2W9DH 1H3UA 2GJ6D 2IBGA 2PXYD 3M17A 2PW2A 1WCQA 2NPLX 3CFBA 3AS1A 4HIIB 4OFYD 3REVA 5C0CE 5AZ2L 4YK4B 3GSXB 5HDQL 4JFEA 5D7JB 3GB7B 3DI3B 3QIWD 4FQ2H 1N3NB 3QAZB 3LIZL 1U2CA 3MMEB 5F1NB 3FB5A 4YZFE 3S6CA 1OF2B 4GAYB 3DRQA 4QTIH 4DUVA 1C5CH 2Z4QB 3HG1D 3EDEA 5EU4A 3GM0A 3BKCL 15C8H 1B0GA 5LGJA 4MA3B 2DLGA 2YMXL 4JZOB 4PJ8D 4Y19E 3MYJB 1ZANH 5FHAL 1NPUA 2EO1A 2GK2A 1HXYA 5GS1B 2ZSWA 2OJZH 4K3DL 3U4BL 5DQJA 1GOHA 4NO0D 3LS5L 3U4EA 3VW3L 4PG2C 4LP5A 3VH8B 4NN5B 1HXMB 4QHKJ 3VGDA 1YN6B 1LEKA 2P24A 2FNBA 5JW4Q 5D9SA 5ADPH 2BSED 2HKFH 1U8NB 2X4SA 4CRPA 4IMKC 3TJEL 3HR5B 1EH9A 5AWNH 3MROB 3ULVL 1NL0H 2K9UA 3SE3A 2JKXA 4F58H 1D9KA 5GRUH 2UVFA 3W82A 2HFGH 3ZKQD 1ETZA 3WJJA 2NZIA 2KQMA 5E08L 4H8WH 4OKDA 4RFOL 4BH8A 1VESA 3V95A 3IVKA 3A6CL 5E4EC 1QP1A 3MBED 5EORL 5I1IH 1MHPH 5EZLA 4GW4A 1ZT7B 4KUZL 2ZSWB 3T77A 2FX8H 4JDVA 4FZ8H 4XNQB 3TPUB 5LJYH 3L3KB 3DURB 3U30C 2P8LB 4OZFA 5DD3L 1F90L 2CLRA 4X5LA 1LEIA 3WCYA 4IOFD 3BVNB 4KHXL 3QEUB 4NBYB 3Q5TA 4PBXA 3U46B 3BGFB 1JUFA 1YMMB 1AXTH 1ZT1A 4JPKH 1U8KA 1HH6B 4GG8B 1FORL 4NM8H 2HJKB 3CCHA 4Z95H 3SO3C 5E2JA 3BT2L 1S5IL 2OMNA 4S1QH 3VGBA 1G1YA 5JPMB 4WV1A 4PJFF 3N06B 4LP4A 1PG7W 3S36L 2HLFC 5BRZD 5HYSA 4TSAL 5D5MF 1YEDA 2JIXA 3AB0C 4HKXA 3RTQD 4EVNA 4HH9A 5FKPA 1CXFA 1ZEAL 2JJWA 4Y8DC 1X5YA 3EOBA 5A2LH 1IAKA 4OT1H 5CEXB 3HI1A 1B3JA 1RZ8A 1REIA 2OL3L 3RNQB 4ZUWA 3JWOC 3MV9D 3T77B 3U0PB 4U31A 1N7ML 4WTXA 4URTB 3NIGF 1X7QB 2AXHA 4TVPE 3MLVL 1FGNL 3MJ7A 2CMRH 5HHME 4H0HB 3STLA 3ZT7A 1CFNA 1LVEA 4K8RH 1EDQA 4YBQC 5F97E 4P23A 4DTGL 4OLWH 1Z3GH 4JRXB 1RUAH 2EC9T 4DEPC 4BQ9A 1F42A 4XVUC 1A8JH 4H25A 3MLSH 1RZJC 2F53B 2EXWD 4L8SA 1H3PL 3VMNA 1RMFH 4K7PH 4NO5B 3ULVC 3DSNA 4L9LA 1KLUB 2JIXB 1S9KC 1S5HA 3UJTH 4PB9H 1HHHA 4HKXB 4HH9B 2D7PA 4UQ2B 3IU4L 3OKLB 3ROLA 1OPGL 4LHUG 4KZEH 1UQSA 1VGKB 3W0WE 2PO6A 1I8MA 2BY2A 3HFML 1QACA 4WU5B 2C3HA 3BN3B 3GBNH 2JJTA 2AJUL 6CGTA 2HVKB 4ETQB 3G04B 4NDMB 4DK6A 1UH3A 3U9UB 4WNQB 4G5ZH 1TVHA 1PEWA 4JY5L 1RZKH 3STLB 1CFNB 3QUKB 1E27A 4NQXA 2YZ1A 4YUEH 5C0CD 5BOPA 5LWYL 5DMKB 5CGMA 3S37H 4I77L 1AGBA 1FZJA 1T0MA 5IVNA 4HPYH 3CUPA 3RVXD 2FLBT 4M9OA 2B5IC 4M7ZB 4L8SB 1I9IH 4ZDHB 4LHJB 43CAB 2Z35A 3HC4L 3KR3H 5K9JL 5E6YA 4RMUA 1HHHB 4JREB 1MIMH 2VDLL 3QI9B 3P4MB 3VMPA 5L2JA 3RAJH 3Q0HA 5FCUL 3ROLB 2D0GA 4CMHB 3GHEH 5IB3A 4OQTA 4PJDE 3LKPA 2E27L 1W72L 3B9KC 4TTGA 4C54A 4G8GE 1R5IA 1K4CA 3MRJA 3LKRA 3MUZ1 4ZFOB 2DI7A 3VXOB 1JGDB 4K9EH 1MRDL 4F7PB 4RMSA 1TITA 4Z7VF 4YXLH 1XGTB 3MV9B 1TVHB 3SGDI 2NY3C 3QFJE 4N5UA 3CZFA 5E0QA 1E27B 3AM8C 4U7MA 4OUOA 2VXTH 1RAMA 1T7XA 4OF5A 3VGAB 3RVWD 5KVDH 4FQ1H 1W8OA 5C0AA 5MERB 1VFBB 1EK3A 1AGBB 3M07A 3LEXA 1MRFH 3KJ6H 2LAAA 3FT4A 4HUVB 1X9QA 3CU7A 1CE1L 4XZUA 2AQ3A 2VH5H 1XGUA 4MHHI 4AENB 5E8DH 1X5HA 1JNHA 2J8UF 4ODXB 2PCPA 1NLBH 4JKLA 3WFCL 3LKPB 2IBZX 1OTUD 5CP7A 2IANA 1Y0LA 1P4BL 4DCQB 3CX5J 3MRJB 5HVHB 2Q8AH 4Y1AE 2EIDA 1MJJA 5JOPE 1LE9B 2N4IA 4N8CH 4NCDA 4D8PB 4O2EA 2L7UA 4UTBL 4M7JL 1MREL 1I7UA 1LD9A 3V7MA 3BUYB 1L6XA 4MD0A 4UIKH 1MJ8H 4PJEF 4OD3L 3TO4C 3QHZL 4FP8H 2DI9A 4OCRH 1LK2B 2VXSH 3DVGA 1QHOA 2FJFB 3I02A 4Y5YC 4LCWB 1JGLH 1GGIL 5CP3A 2NNAA 2NY7H 3AREC 1JNHB 3LRSA 3QUML 1QSFA 4OAWA 1S3KL 3RKDC 4MJ6B 4ELMF 5FDWA 1E28A 1MF2H 2MQCA 2VITB 5FUZH 2OK0L 4D9QE 1EO8L 3V5DB 2O26U 4KGLA 2EKSA 4HEME 5GZNC 3WNMA 5JPNB 2VN7A 4NQDE 2NY6C 2YEZA 5DJ8B 3F8UB 5HHMD 1OY3B 1FJ1A 2IAMC 1HYSD 4OFPA 3IDIA 2C1OA 5E5MB 1JPTL 1KJ3H 4G8FA 2JJVA 3HI5L 3MUY1 2XXMB 4BFBD 1RIHL 2VWEE 3D0LB 4Y89A 4OGYL 4P3CL 5CD3B 2C7UB 4LPTA 4HJ0D 1LD9B 4KC3B 4LLVB 8CGTA 2H8PA 3GSUB 4LSRH 5DT1L 1A7PH 4QXUL 2VXQH 1MQKH 3QRGH 1DL7H 3CC5B 4QRRE 1BBDL 1U92B 4MZ3A 3T1FA 2Y6SC 4Z7NE 3UCRA 4MSWB 4QWWC 1RVFL 5GGQH 1KB5H 5BO1L 1ORSA 1TZIA 4YDKL 4YWGH 1UJ3C 3HCVB 1QFWM 3QCUL 3W0WD 4QRPD 2WQ8A 4MAYA 4HC1L 3VXME 4FFZL 2R56H 4U1GB 3EJZC 1R3JB 2UUDK 2D7NA 1FNFA 4HULB 3UTQA 1NCDL 4Z76B 4U7KA 5K9QG 4GKSB 5AAMA 5KVFL 4TYUA 4MCYA 2EIZB 2ZUQC 5HPMB 3D69B 5T3ZH 5KVGL 7CGTA 1NUNB 3V4PL 5IFJA 2CDFA 5FM5O 5I1JL 5F89B 5C09B 3UXFA 5DR5H 4RX4A 1A6VH 5ETUA 2XNAA 4MJID 3Q6GH 4KMLB 2BNUB 2ZP0T 1MPAH 4R7DB 4R97B 3CXHJ 4PBVC 5CBAA 5I1KL 3O81A 2DQIL 2FX7L 4PV9B 3QG7H 4PPTA 5DJAA 2D3VA 1FHGA 4HHAB 5DZLA 4AK1A 2ITCB 4OUUA 4QNPF 1TZIB 3SY0B 1X5LA 4H0IA 1TETL 4I0PC 5MENA 5E2TL 1FFPB 2NYYD 3FT3A 4OCLC 1S7UA 3GNMH 4G8GD 3TZVB 1JGVH 4JM2F 2HFEB 1AQKL 3BP6B 4LPWA 5HD8D 4CADA 2BSSB 5DHVH 2ZCKL 3FMGL 1CGSL 4R90H 4G9FE 3QFJD 4O2FA 3LZFL 1QBLH 5KSBF 3TIEA 3ILPA 3QH3B 4M61B 3L7EB 5DD0H 4OZIA 4HBCL 4EN3A 2NY1C 4J2XA 4TQEH 4TOYL 5ETUB 25C8H 4J4PD 2YD8A 2RB8A 3WE6B 3I6GA 4M6NH 5MEOB 1G6VK 1U8HB 3MJ6A 2ZKHH 2IALA 1A0QL 3TIDA 1KJVB 4QEGA 3V4UH 4YBHA 3TN0D 5T1KA 3IS0X 1A7RH 1JHTB 3T4AA 2VZ1A 1F2XK 1CDCA 4PY7B 5MENB 1VENA 2DQFB 2CDGB 4YX2H 1R3LA 3LAFA 4LCIL 4HWZA 1S7UB 1I1AD 4XX1G 4QRPB 3ZKMC 2W0LA 1QBML 4MX7B 1LO5A 4GBXA 4Y1AD 4PJ7B 4FABL 3EDFA 5JOPD 2BNRB 1QA9A 3P73A 1ZWIB 1U8OB 3MV8A 1WLHA 5HHNB 2H3NA 4OZGA 3VFTA 4WFHE 4JO1H 2L0DA 4HAGA 3E3QC 1YYMH 1SBSH 4CMMA 5JOEA 2BY1A 1AKJB 4YXKL 3I6GB 2RQ8A 2AEIT 2Y06H 1BVZA 3B5GA 4DOHE 5HGAA 4PY8I 1INDL 2ICEA 3SDCC 4G6FD 4ZNEA 4MJIB 5IB1A 2WIIA 2HMIC 1DSFL 1X5AA 1SY6H 3HZMB 1W0YT 5T3XL 5ICYB 3MRNB 3GMOA 3BFOA 4D9QD 3IFOA 2D7MA 4HWZB 3UO1L 1TZGL 3L9RB 1RU9H 1G6RB 4NQDD 3V8OA 2G75B 1AGFB 1CK0H 4GBXB 4LU5H 4H88H 2HFTA 1DDHA 3OGOE 3CVIH 3F7YA 1QR1B 4KPHL 3O3AB 4YHZH 2AV7B 1F2QA 3FQWB 4RAUB 2OCFD 2ZUTA 1IC4L 3IT8D 3VFGL 2IMNA 3L5IA 4BUHA 3DHMA 5EOCJ 1HOCB 2HFFA 4QRRD 3OAUH 1ACYL 5HGAB 2E6PA 5F6HI 1BBJB 1C16A 2BY3A 5FB8B 3VXRA 5DYOA 2C5DC 5J13B 1WZ1H 4P57A 3DX9A 3OGCB 5DK0A 2QQKH 4GXVL 1MWAH 4AM0B 2HT4D 2YSSA 3QNZA 3LV3A 4Q9RL 4MD4B 5DVKA 3VDAA 1OL0A 1N8ZA 4QTHA 3EOTH 5KSAC 4QHUA 4N9GA 3C09B 5HDBE 3ZDYE 5IKCB 1RJZB 1ZGLP 5JW4M 4HPOH 3K74B 2Q8BL 4HFUH 4L1DA 1XGQA 4GQ9H 4LOUC 3QO0A 4C83B 1G7PA 5E2UH 1BAFL 2HLAA 4PJHA 2D7TL 2EC9U 1IGYA 3JWOH 1F4WL 4BH7B 2W60B 1NMAL 4Q9QH 3NACH 1NH6A 4WUUA 4L4TE 4LFHG 1AR1D 1PBYA 1UB5A 2JJSA 2V7NA 5JW5B 5ENWB 1C1EL 3KS0J 1ZHKB 3E2HB 4G42B 1E6OH 2DMCA 4NZDA 5GRWA 2FBJH 4P57B 2NY5H 5C8JA 4XVJL 2APBA 1MFBH 3CVHB 2VQ1B 2I9TA 4J3XA 1A9BB 4NPYA 3ARGD 4OLVL 5FYJH 4JPWH 4G6FB 2HRLA 1ZLSL 3WLBA 3QNZB 3LB6D 2DN7A 4NWTH 1A6PA 1RZJH 4PRPE 5B8CA 1HH9B 1JTPA 5DUML 4N9GB 5EO1B 1ZLVH 4APQB 1UKQA 3MOAH 1I9RL 5EG6C 4NHUA 4RIRA 4G9FD 3UTTE 5J1AA 4JQVA 1XGQB 5HGHA 4YFLF 3KPNB 3G6DH 3JTSA 1BQLL 1G7PB 5F9WC 4LSVL 5BZWA 1KLGB 4HUUA 5E8NA 4RZCB 1IBGH 5HYEA 1QYGH 3C08H 4JKMA 5HHPA 1NC2D 5TGBA 3H9SE 4G9DB 1SYSA 1ADQA 3P0YH 4OZ4A 4HWEH 2F54D 2I9TB 1MCDA 4PGEA 5ESVA 1J5OL 3QXUA 2A38A 3OHXB 4PJAB 4JQIH 1Z0NA 3K46A 2AXFB 3K3QA 1OP5H 4YDLB 1NCCL 3WLWC 5F7EH 2P5EA 1QG3A 1BMGA 3WS6A 3NIFF 5IHZA 4NBXB 1E4WL 2MWCA 2EICA 3WKML 2FATL 3KLHD 5EO9B 1N64H 4WEMB 3LMJL 5HHVL 4OQTL 4UNVA 5J1AB 4YHNA 1L7TH 3K1DA 1NC4B 2E8YA 3L3JB 2JK5A 4P9HH 4HUUB 4M1GL 4ZOCA 1JPFB 5EBWA 4WFHD 1MCSA 4KZDL 3SKJL 5EZJA 5C0FA 5IMOA 3QIUA 2NTFA 3FT2B 4KKBD 3TT1H 4WCYL 1SYSB 5FHBH 5JORA 2MTPA 5HYJA 5JMOC 1A3LH 4HF5L 4K8RD 4QHNA 5EU6A 4P23C 4PGEB 4QY8B 5I1LB 4D3CH 4Y4KC 4NQSB 4NSKA 5J3HD 4Y88A 1QFWI 5DK3A 2V17L 4XXDB 5JUEL 1CBVH 2M8XA 1BFVL 5ALBL 1IGIL 5EU3A 2OP4L 1NAMH 2PYFA 3ZT5A 3ALPA 4LCYB 4UQ3A 4DUXA 1ACZA 1LWRA 3EYSH 5JHLL 2UZIH 2R2BB 5C08B 1GAFL 1UKTA 3MRFB 3VI4F 2PO6C 5FO7B 5EUKB 2IBZY 1B6UA 5ALCL 3V52H 1CIUA 4NWUH 5GJSH 2A83A 2VABA 3T0BA 2NY4C 3BAEH 3BIKA 2X4RA 2YK1L 3PWUA 3NBNA 5K9QI 3SE8H 3ILQC 2X4NA 2LQRA 4F80A 4NRXA 1T7ZA 4KI5C 2ORBH 4K3JH 2EC8A 5T3ZE 1UKSA 5H2BB 1P4IL 2UZXB 2A6IB 2F54B 1DLHA 3BJ91 5KOMC 3IGAA 5CILH 2WBJD 3RWGA 1D6VL 1TNMA 4PJGB 1UCBH 2WUCL 3GI8H 4KKLD 5IQ9A 4PJFE 1CG9B 3RIFF 1J10A 4HD9A 2CIIB 4HCRH 5D5ME 3WIIL 4YQXL 3U7WL 4PBWD 3MLXH 4TRPH 4P2OD 4EI5D 1DVFC 4Z0BH 1NMCC 4L4TD 5B38B 2A83B 5DJXA 3OTTA 5DDHA 4ZFGH 2X4RB 4DKFH 3CAFA 4GSDH 2Y07H 3DETC 4X98A 3WS3B 5LBSL 1CFSB 2ZCLL 3PHQB 4KQ3H 1OLLA 1RURH 3QWOB 4ZNCD 4LSPL 4TPRH 3NIGE 5M95B 4O5LL 1SM3H 4X4XA 1JTOA 1GOFA 1UGNA 1S7WB 3D3VA 3OB8A 5KSVB 2DMBA 1T1YA 2DKMA 4MS8D 1T2QL 4ODSL 2P8MB 1NMBL 5DD1H 5I18L 4JFDA 2H26A 3VMOA 2ZNWA 3OB0K 4YJZL 2RBLA 4M8QB 3C5ZA 4WENB 2ZPKH 3PHSA 5FO9A 2Y5TA 2RAMA 1H3VA 3DROA 2RGSA 1H0DA 1FC2D 2BZDA 4YO0B 1S8DB 2VOTA 3H9SD 4DKEH 2FX9L 5FYKL 1FPTL 1PW3A 1U8QA 4XCYA 3HZYB 1VKXB 5IMKA 1S7XA 3QIBB 4IRSD 4PJXF 2OTUB 1ZHNB 4I2XE 4GAFB 2W0KA 4HUKB 5B3NA 4YBLC 2BMKB 5EUOB 3GKWH 1JWMA 3MLRL 1SEQL 4WUKH 2PTVA 2CGRL 1CVRA 5GSRB 4LEOA 2KH2B 2VLME 1AE6L 1NGZB 3IJSB 1LMKA 1R0AL 4HX1B 4XPAH 5MEQB 1XIWA 1BOGA 5H94B 1FFNB 1WWBX 2QADD 1F8TL 3H42L 3NMEA 5F1KC 5JW3H 1SMAA 1XEDA 2P5WA 3I75B 1DUZB 3QUXD 5F9JA 1F6FB 3DROB 5DS8B 4YHYB 4NJAH 4PG9B 3WJLA 4P99A 1MCBA 4CAGA 3DNKA 2CUHA 1JYWA 1D5ZB 1IM9D 4XCNB 3GMLA 4HIJA 5IMKB 4YHPB 4Z8FH 1Z5LA 3MV01 4BZYA 4NKIH 1RK0B 5LGHL 3ZO0A 2OR7A 2E7MA 4Z7VE 5KAQG 2P49B 4D9RE 3QUYA 5L8KB 1WBZB 4JM4L 5C0RH 2R0LH 3QWQB 3O6KH 4KI5F 4Y2DC 4KDTC 2BVUA 4Q97A 4XHJC 4I0CC 5ITFB 1WZMA 4TUJB 4CDGC 1ZVHA 2XXCB 3V0VA 2DM3A 2W38A 5BJTA 1HQ4B 3U2SA 1MI5A 3RVUC 5L8JB 3O2VL 3UTPE 4MAYC 5I1HL 1A4JA 1GHFL 2N7BA 3D25A 4S0SD 5J0BA 4UT7H 2ZWLT 1A1NB 1DFBH 4BM7A 2J8UE 4OBRA 3S8WA 2BVEA 1YJDL 3PGCA 3VRIB 4XMLL 2XKUA 3MUGA 1ZLWH 2HAZA 2HT2D 1Z5LB 1B90A 5FOBA 4NM4L 2VUOA 3RZCD 3KDMA 3RX8A 3RWEA 4OZFG 3EYOA 5SWZD 5GGVY 4OLYH 5B39B 3D18B 5D96C 5T3ZD 2FR4B 3C60D 2XI9A 3QUYB 2Q7YA 5D93C 2VMFA 3QXDA 4Y5VC 3T0EB 4R7NB 1EGJA 1MFAH 4J3SA 12E8L 3FO2B 1LP9A 1N6QH 2OJEA 4LSQL 4CN4A 1EA9C 3O11A 4ZUTA 5ILTH 1M05A 4W4OA 4P5KB 1BWWA 4PJEE 3F5WB 3SKOB 1NLDH 1MI5B 2APWA 3PL6A 5BS0A 2IH1B 3X3FL 2QQLH 3WDHA 1NBQA 2XT1B 2EH7L 4DFIA 5HYSG 1U8MA 4GJTB 5TFSH 1J8HA 1NUDA 3LD8C 5C7XH 4KRPB 2YPKB 4WFEE 4Y4HA 4ELME 3QJHB 5JHDA 3HE7C 2YHGA 5TE4L 5LCVL 4AEHH 1OTTC 3OPZH 4YHML 5L2KA 3QWRA 3SGJA 4JAMA 5D2LB 2ADIB 4XX1E 1LDPL 3AFLA 3F58L 4OI7A 3EYOB 1JYNA 3TVMD 2F5AL 1BREA 1EZVX 2ZUSA 3FONA 3QDHA 5EU5A 3N1GC 2YC1A 3PJSA 4XCFL 1OTSD 2J5LC 4DKAA 1JHKL 3LDBB 5C92A 1OT2A 4QHMB 1ED3B 4O00A 3IDGB 3FOLB 2IH3A 2XPGB 4U1NA 5ESQA 1OGAE 4XPGH 2F8OA 5ITBH 1MFEL 1CD8A 4DVBB 4ZPVA 1XCQB 3GRWA 3O2DH 2BFVL 2ADFH 1U8MB 3MUJA 3IU3A 1OSZA 5GS0H 4NN7C 3PWVA 3CFEB 4XPTL 5F8QC 1CZ8H 4CW1B 1P7QB 5TQ0L 1KBGL 4ODTL 1YJDC 3ULSA 4IHOA 3VWJC 1MOEA 1RK1B 4ZTPL 3OF6A 3IFPA 3BN9D 5GSVA 1IAIL 1VACB 2OR8A 4OGZA 5IHLB 3LEYH 3NZHH 1KC5H 1AFVH 3VFSB 2OQJB 2NTSP 3UYRL 5SWZB 1U93A 5FECB 1UEYA 2HG5A 1IFHL 5DRWA 4IOIA 3O9WA 3OG4B 3CK0H 2DWEA 2VLMD 1AD0B 4HWNA 4MQ7B 1VCAA 1XR9A 1UM5H 5ESQB 4HJGA 5FGCB 4RMQA 4EIGB 1T3FB 4DAGH 2A6KA 5IB4A 3VFUB 2GT9A 3BZEA 1I1FB 4XPFH 4CN6A 5GRZA 3RGVA 1AI1L 5I75C 4MNQE 3KPSB 4XTRD 1XCTB 4QNPE 4M6ML 4EUPH 5TQ2H 4M5ZH 4K23H 3L3HA 4LGSB 3BZFB 1YNKH 4X0KB 1KCSL 1SQ2N 3S37X 4OGXH 2BNQE 1EHLL 3HZKB 4M5YH 4P3WA 1MEXH 1ZVSA 1HKLL 2RFXB 5E8EA 4Z7OF 5GSVB 3VFNB 2FYYA 4LLDB 4R8WL 4D9RD 2NW3B 5F9DC 35C8H 5DHVB 1PD6A 2BVQB 2NXYD 2PNDA 4UNUA 5KSBE 1AGDA 1U93B 1Z9LA 2V2XB 1ADQL 3FB8A 3IYLW 4I5BA 4IOIB 3O9WB 4WTWA 3SKNA 4OSUH 1J1XH 4X6DA 3KLAB 4HJGB 3DGCR 2YD4A 1F3DH 3RWIA 1WV7T 4NKQB 2GT9B 4UUJA 1RULH 4RGNB 3UTPD 1JI1A 5CGYC 4HUWA 2AKRA 3RI5K 5CCKL 4JO2L 1KJ2H 5DEGA 2P7TB 3FAXA 3GO1H 1QFUL 4Y5XA 2DBLL 3TBVA 1FL5A 3QIWA 2ICCA 5IJVB 3MXWH 5IVXF 3ABZA 2Z31D 3HUJF 4R2GD 5I1EL 1RUML 1T66C 5FK9B 1XGRA 2QSCH 1R3IL 3HG1A 3V5KA 1JZ7A 4K94H 4KVNH 1F4YH 1Q8MA 1VERA 1KIPA 4PJ8A 2HYMA 4NQEB 4F7MA 5DF0A 3GIZL 1SJEA 2ESVD 4I5BB 3SKNB 4MZ2A 43C9A 2HH0H 1FRGH 1FG9C 5I8OH 4MA1C 1JMZA 1Q0YH 4X6DB 4XP5H 5JQHC 4L4VA 4ZSOA 4HGWA 1H3WM 1UM4H 4G6KL 4P2CG 4ONFL 2XZAL 2QHRL 2CUMA 4WU7A 5DRNB 1OP3K 4ERSL 4YBQD 1YEKL 5IHUL 3K1KC 2OZ4H 5JIKA 5JR1H 3VDBA 3U79A 2R23B 5DVNA 2X9YA 4LVNB 4WFED 4Y5XB 3RNKA 3DIFB 3WIHA 2VDOL 1H5BC 1WZLA 4HIHB 4BFIB 1JFQH 4LL9A 3S4SB 3E6FA 3DHJA 1BIIB 2XTJB 2B1AL 3FCTA 4RMWA 2I07B 3O2WH 4JRYE 4WIQA 1HILB 2CKBH 1I8IB 4GRLB 4F7MB 3BZDA 3ZL4H 5J6HA 3MBEA 1PEZA 4H5SA 4J3TA 5CSGA 1JRHL 1F58L 2AK4E 2C26A 2GSGB 3MREA 1OGAD 4X6CA 4BZ2L 1MELA 2WINB 3NCEB 3TV3H 4D0BA 3I3EA 1G9NL 1JWUA 4OI8A 2PYEA 2JLLA 3GIVB 5CJXA 3PV7A 3MV7B 4L8DA 2AABL 4WHTB 1TTUA 2EE6A 5HGBA 2B2XL 4AQ1B 5LQBL 3V6FB 4IDJH 1P7HL 1FNGB 3VXPA 2FL5A 5DFVD 5BRZA 2CRIA 4X6BA 5DHYB 5INDA 1U3HD 3FCTB 4EI6A 1LO0L 1B0WA 2Z31B 5LAXB 5C0BE 4K3GA 5K9OB 3ZKSD 4H20L 5GRJH 2A0LC 2QR0A 2DICA 4XBPA 3B9KD 4G7YL 3MRLB 4ONHB 3QHFH 4IJ3C 3AS2A 2X1OA 3MRBB 3NZ8B 1KG0A 1TCRB 3MUHL 1S7TB 3G5VA 3TGXA 2H32H 1T04A 2DAVA 3EIFA 1I3UA 4YGVA 3EYQC 1GGTA 3NFPB 3HNTL 1M7IA 4N0YH 3ARBB 2XWJB 4I9WE 2UYLA 2F74B 3LKQA 4RCAA 4LVOB 4MNQD 2NCMA 3OAZK 5GGRY 3LKSA 5I1AB 1A6ZA 2EDWA 1H8NA 3O6LL 1GGCH 2CLZA 1JCKA 1QPXA 5FO8A 4UDUB 1T0NB 4UIMA 2BNQD 3BP4A 4JM2D 1JGUH 4ZAKB 5DMJB 4KK8D 2W65A 2QR0B 3BPLB 2B0SL 4N0UA 1KT2A 2X4TA 3K2MC 4M1DL 4XC3L 1I85A 4LLQA 1NBYB 3DX8B 2LABA 4CBPA 3RJDA 4RA3A 5DRXB 4W6YB 5MI0B 3MGTA 5I74B 2W0FB 3H6JA 3AY4A 4XWOD 1H3GA 4PJ9C 3R8BB 3NTCL 3L3IB 5C0CA 3TF7C 3E3QE 4Z6AT 5C0ND 5T1MB 3S34L 1G1CA 1GGBL 1ES0B 3LKSB 2NY2D 2DF3A 5L6YH 1S7QA 2K3TA 4JG1H 1MCQA 1G7QA 1VFOA 1EJOL 1QSEB 2VSDA 1HEZA 3O6FD 3B2VL 4Q6IB 3RPIB 5DUPH 3RKDD 3NIFE 4PJCB 3FO0L 3NOIA 5IOPB 4QRQA 3GSRA 4HT1H 4Y19A 1MFNA 3IDNB 1A6TB 3GJEB 2FBOJ 3Q2CA 1C5BH 1UENA 3C5JB 1U95A 1U6AH 3GSQB 3H9HA 2AJXH 5ERWA 1F5WA 2FHCA 5JDSA 5I9QB 1MCWM 2Q20A 1H3XA 2WNGA 4G7VL 2A9NL 3C6LC 3BP5A 2BRRL 1BJ1J 2ADJA 5HBBA 3H0TA 3INUH 4WDIA 3IXTB 2IPKB 3M8OH 5DJDB 1LGVA 2D0FA 2EEDA 4K3HA 5GS3A 3VDCA 5TF0A 1L0YA 1BZQK 2VLRE 1QLFA 2AK1L 3EBAA 3BRDA 1YECH 4KAQL 1A9EB 5EIQA 3SE9H 2ZZUT 2ICES 4GMTH 4QWWD 2DDQL 5SX4I 4XNUH 3MRCB 1P84J 2G2RA 4JRYD 3O3BB 4QRQB 5DFWH 1HCFX 1YDPA 3GSRB 4LKXA 5EA0L 3SDXB 3BKJL 5E6IA 5IV2A 1SJHA 1F6AB 1KCKA 3REWA 1R3KB 3VI4E 2BJMH 4L3CB 5KW9L 1YZZA 3ROOA 5HVWA 5CZVH 5F96L 1N26A 2VZTA 5SV4A 5F3HB 4IS6B 1EGJL 4WDIB 2DOCA 3PGFH 3DV6B 4HS6A 3F12B 5T33H 4PJ5B 1BLNB 1XF3A 1MRCH 1QLFB 1UXSB 4KV5F 5D7IF 2FSEA 2IPTL 8FABA 2EDBA 1KACB 4X80L 1FN4A 1XIWC 4BSVA 3RY6A 5JZ7D 1A7QL 2R8SH 4U2ZA 4LAQH 1PQZA 4RFEB 3SQOL 1AQDA 5C0BD 1KPRA 3PWNA 5DK2B 5FF6B 5E6IB 3KPOB 5D2NB 3STZB 3WJLC 2BVTA 5IV2B 1HHKB 5H8DA 4QOKB 1EEUA 5EFIB 3REWB 4B7LA 4HKBB 4F15B 3IDYC 3DWTA 5CLWA 4P46B 3TFKD 3ES6A 3TYFB 5IW1B 3HE6C 4J1UB 4YE4L 4I9WD 1XH3B 4HS6B 4AG4L 1QVOB 5DJCA 2A2QT 3PNWA 4LQ1A 4PRIE 4MJ5A 5DJ0A 4QRUA 3PXJA 2NW2A 3KYNA 5CEYA 2X70A 8FABB 3GRWL 1EXUB 2O5YL 3BPNC 4BQ6A 2FDBP 4G8IB 4WGWB 1FN4B 3U1SL 4JY6A 4MAUL 1IAIM 2DIBA 5DJZB 1CL7H 1NGWB 1KFAL 4MJ2A 1PQZB 3QB7C 2DWDA 4U1JB 2YD5A 1W8NA 3VJ6A 5KZCB 1A3RH 3A6BH 3W0WA 3CSYB 4U0QB 3CFJB 3EAKA 1DBAH 3KXFE 1PSKH 2P42B 4GKZA 1N6VA 5EBMA 3MRIB 1RUKL 2Z8WC 3G08B 2DLHA 4X99B 4CVXA 4PP2A 1JZ6A 3RUGF 5A16A 2UWEF 3ES6B 4JR9L 5T5NF 3VRJA 4KXZH 3WHE0 3GMQB 5FM5M 4QXGH 4OJFL 5DI8B 4EDWH 1E6JL 1J0HA 4LLUA 4K7PY 1WBXB 5DJCB 3SKMB 3QA3A 2VXUH 1F13A 1MIEH 3T08A 4CVZA 4MDIA 4PJXE 5BV7L 5F1IA 1TVDA 3KYNB 5BMFH 5I8CB 5JNYB 1X5XA 3RWCA 1L7IH 3CDGA 3CSPA 5IIEA 3MPCA 4XI5D 2DL2A 3L3GB 1G9MH 1YYLH 2DQDH 3WBDA 3PL6C 2H2SD 2Z93A 1DQMH 3KYOB 1ND0A 4L4JA 4X9FA 4LSTH 1MUJB 2EDTA 4WJ5A 4OLXH 4PJDA 3O8XB 3RL2B 3HA0A 4PTTB 1II4E 2VDPL 2BVOB 1S7RB 2X09A 1XAUA 4OM1L 4Y4FB 4U1IB 5LXGH 3HMXA 4CVXB 4RRPA 2NZ9C 3SGJC 1JNLH 4ZS6D 1N4XH 3QFJA 1EBAA 1OAQH 1UB6A 4NZUL 1UFUA 3MCKA 1NFDB 4C56E 5IF0A 3ALWA 2NXZD 1NBZA 3IJHB 3D9AH 3DYPA 1BQHA 1FAKT 3MRMB 3O0RH 2DQGH 4FQIL 5D6DA 1WTGT 2VLRD 3MRHA 3PP4H 4J4PA 3V4VH 1MFDL 3H7LA 4FZEL 2I9LB 5KVMC 2XICA 4UT6H 3CDGB 5F9AC 5IIEB 4PJIB 4YK4C 5GJTL 4KI5E 1MFCL 3DVNB 1Q9LA 1C12A 3E0GA 4HDIA 3TN0A 2XWTB 5CAYB 5IESH 4RBPH 3QAZC 2VIRA 3RIAK 1CR9L 3TBTB 1N5YL 2A74B 1YEGL 5D71L 5GS0D 1NCBH 4KJYB 3BEWA 1QR4A 5DD6B 4OV5A 2VZUA 5E99L 5KSAD 4HIXL 4BA8A 1I1AA 2FCBA 2VL5A 3VFOA 1UEMA 4TNVK 2NX5B 3QPXH 5TDOB 2E7LA 5F6IB 3MBXH 5GGRA 5GPRA 5C2UB 2YD6A 3RRQA 4V1DE 5KSUB 2EDKA 5HHXH 2P4AB 1B4JL 1BQSA 2X7LA 4MD5A 5HI3D 5BZDB 1OM3H 3MRHB 2LU7A 4L1HA 4MCZB 3WNPA 4NN5C 4HXAH 3THML 2VDRL 5H37G 3T2OA 1MCEA 1GJIA 3MNWB 4YDVB 4FQHA 2M26A 4XNZB 3FO1A 5IFAL 1C12B 2CK0L 3FQNB 4WHCA 2E3VA 1K6QL 1QEWA 5IBUB 2VIRB 4BKLA 4GW5A 2LV4A 6FABL 3PV6A 3RGVC 3BH8A 3MJ8A 1QFHA 3BEWB 4Q6YA 3HAEH 3DXAB 3AMKA 4RSVA 4XNYH 4JB9H 5E8OB 4NQDA 4ELKB 2HN7A 2ADGB 4ALAH 2F15A 2DLEA 4POYA 1EMTL 1JF1B 1FIEA 2N56A 2A9MH 4MNGB 4R4ND 4ZOBA 4PGJA 2DLFL 2W92A 4PRID 3LS5H 1MNUL 3I3DA 4UB0L 1Y6MR 5J12B 4PR5A 1QZ1A 5F7YC 1ZT4B 4QRRA 1A14H 3O3EA 5GZOD 2PXYC 5DVMA 3FO1B 3AU1A 3VCLA 4OZHB 4EIZC 3I6KA 1CDBA 5CJQL 3BH8B 3CPLA 3VXMA 4NKOB 3KXFD 1QRNB 3WLWD 4NNYA 4P2RB 2ZUUA 2J88L 2H9GA 5J11B 4F57L 3NA4A 5AYQA 1PKOA 1KLFA 3U36A 1OD9A 5C0JA 3BYYA 4RFOH 5E08H 2HN7B 3DI2B 1HNGA 4OCXL 2C4XA 3ARWA 4LASL 1CDHA 5DGQA 1A1OA 2AJ3A 1NKRA 1DR9A 3MLPA 1LEGB 4BSJA 5FXCH 2DIJA 5DD3H 1F90H 1T1XB 3CDYA 4Z7WF 4PJBB 4XP9L 3KJ4C 4PR5B 4KHXH 1QQDB 2FO1A 1WCBB 1FYTE 3VFMB 2BVYA 3WUWA 1LO3H 3ARDA 2CQVA 3T8XA 1FORH 3ULUF 4JFZH 5E2WL 1CD1B 2R0KL 3G5YB 4TULL 1BX2A 5DQ9A 2XKSA 1NGQL 3ARGA 3LPFA 3G6JB 2DQJL 4JKWA 4WI9A 3VXMB 4XMKH 2WIMA 4N8VA 4X7FC 2JELL 3ARZA 1U3JA 3UPCA 3HPLA 3DTXA 3U36B 2OMBA 1UZ8A 4JANB 4WW2B 3MZGB 4G9FA 4MMXC 4S1RH 2XWBA 5BQ7B 1MHCA 4H1LA 4C4KT 4C56D 1M6OB 3AAZA 3ARXA 1N7MH 5CEZH 2K1MA 4KJPC 1PGRB 3MLVH 4XPBH 1C08A 2NY4D 4XH2A 4Z7OE 1Q38A 3AVEA 3ILQD 3EO0B 3ARRA 3T3PF 5CMAA 4EOWL 3A67H 4RQQA 4JFYA 4KI5D 3WUWB 3ZKXB 3EDDA 1T21B 4IOFC 4ODVL 5IK3A 2BOBB 2K7PA 3SDDA 2Y7QA 1YPZA 3QDMB 3O6ML 4RNRB 4M7ZC 1CGTA 1FV1A 2V5YA 5CJXC 4YDIH 1XF4A 1F11A 2R4SL 3DYMA 4JREC 2FEEI 2MPAH 1IE5A 3QI9C 1E4XL 5JXEC 3U0TA 1FBIH 1IKFH 4OCMC 1JWSA 5EC2B 1CFBA 2FO4A 4K3EL 1D5MA 3RTQC 3WFZA 1OGTA 5IVXE 2WWKT 3KPTA 1T22A 4H1LB 1YNLL 1CF8H 3HUJE 4V1DD 1UYWL 4W6WB 1AGEA 3OQ3B 1DVFD 2FHFA 1CLZL 2YD9A 1BZ7B 4LQFL 4X9HA 5D1QD 1TPXB 3OXSB 5F7FA 4R4FH 4P3DA 4JY5H 3DETD 3NFNA 4F2MA 4YIQA 5CMAB 32C2A 3X11B 4P2QB 4WWKD 1I1YB 4JFFE 5LWYH 1IAII 4UV7L 3SDDB 2Y7QB 1HWHB 4I77H 1YPZB 3OMZA 4EBQL 5DLML 3BIBX 3RPKA 3WD5H 1HIML 5E03A 2EDNA 3RDTD 3Q3GA 4W4NA 1XF4B 1F11B 3C5SA 3PWJA 4GRMB 1OAYH 4DN3H 5K9JH 2R39A 5D1ZB 3SBWA 2EXWC 4Z7UB 3QDJE 2AAVA 2YA0A 5FCUH 3PDOA 2A1WL 4B0MM 5DO2C 1OGTB 1CVSC 1T22B 1T5WA 1W72H 4FQJL 2E7CA 3HI6H 3E6HA 5AG9A 1MRDH 4HLZG 1VGEL 4NC1C 4UTAL 3NFNB 4F2MB 4BFEA 3BRFA 2QSTA 4YHOH 2F19L 3W2DH 4FOMA 3IS1X 1AGCB 2VAJA 3T2NL 1IQDA 1PLGH 3D87B 3QQNA 4R26H 5TJWK 3H3BC 4R4BB 3C5SB 1FNLA 1M7XA 2H1PL 4HAFA 2E9JA 1ZGLA 5C07A 2XA8H 4RGMB 1Q9OB 4LPVA 1DEEB 2Q76A 4UT9L 2WBJA 3N85L 3PDOB 4HQQL 4E5XA 4PLKC 3WFEL 4WO4B 4U0RB 5ICXB 4XXCA 1WIUA 4Y16D 1OARH 1TQCB 2XRAL 1T5WB 2PKDA 3DSFL 4OKVA 4KK9D 5EOQL 4TVPL 2V5SA 1OAKL 4P2OA 4EI5A 2XV6B 4G6JH 2G5BA 4P4KB 1SVCP 1P6FA 1IC1A 3MRDA 1FYTD 1J11A 2BC4A 4IMLA 2MFNA 5FKAB 3BPCA 3DVFA 3RA7L 3TBWB 2BCKB 4M7JH 1DBKH 4AIOA 4PYGA 3TO2A 3BIAX 5ISZE 1OB1B 1Z9SA 3HKFA 4OD3H 5D6CA 3RVWC 2ZOKB 2DQCL 3KHQA 2ED7A 4Y2DD 2W9EL 4PRPA 4XB8A 4BSWB 5CKAA 1YEJL 3KPRE 3LN4A 1TCMA 5C07B 4CUCA 2FIKB 2QLVB 4ZD3L 2AJSL 4YAQB 1JNNL 1IARB 2Q76B 1Q94A 3MR9A 3IDMA 4QRSB 2FH8A 4ZUSA 1TJHL 1S3KH 5IVZA 3UTTA 3RVUD 4U1GC 4FTVB 5ID0B 2WWMC 2X5PA 3L95B 3GJFH 2EKJA 3ARFD 5CIPB 1TQBB 4JHBA 3BWAB 3F6IA 1C5DA 5CWSA 3PWLA 2JB6A 4S0TD 5J9PA 5KTEH 4M62L 1WFTA 5TE6H 2AP2A 2VLJB 2VZVA 5DVOA 5EULV 4CNIB 3H9SA 4KMTH 4WW1B 3D39E 1YN7A 3PGDB 1NCNA 4IRSA 3RFZC 1UACL 3TO2B 3BQUB 5D1XD 3NABH 4R97C 5DT1H 2GTZB 3SDAD 1J0YA 4KRLB 2JB5L 1TJGL 4PRPB 5FUOL 1BBDH 1OAUL 3LN4B 3BKYL 1FDLL 2DD8L 1RVFH 3T65A 3HRZB 4YDKH 4IIQB 5F7MC 3QCUH 4HC1H 2R0WH 4QXTB 4MQXC 3MOBH 2P8PA 4U1KB 1A7OL 2VC2L 3QUXA 4XMPH 3HMXL 2GJZB 3HE7D 4YH6A 4LHUA 3S7GA 2DL9A 4M48H 3W9EA 3CXDL 1PFCA 1X4ZA 1OTTD 1YN7B 5H35A 3S97C 5KVEH 4K07A 1HYSC 4JFFD 5KVGH 1MCFA 4NQVA 1A7NL 5D8JH 3WDJA 5DTFA 4L9DA 1VFUA 5C6TL 3BXNA 4WHYH 1FL6A 3DO7A 4U6YB 4LMQI 3ULUH 4HJ0C 4I18B 4JPIA 3BH9A 5I1KH 4DGIL 3MJ9A 4Q9BA 3QDJD 4ZS7H 3TH2T 2AEPL 5GS2H 3IDJB 4QXWA 1TETH 4PS4H 5GXBB 3P4NA 5LGKA 4U1HB 2F5BL 2GUOA 2P8PB 4KVCL 1KB5A 2DLTA 2YS4A 3DO3A 3EYVB 3G9VA 4MA7L 5GGSY 2VO5A 3I9GL 3UPRA 1EFQA 3NH7H 1WEJH 4HKJA 3FMGH 1CGSH 4ODUA 4UOJA 3W9EB 2YBRA 4HJJL 3N0PB 1H15B 2R1YA 2VDQH 1MHEA 2VXVH 1D7FA 1DBJL 4P5TD 3DBXB 2X1WL 5D70H 3RZCA 4HGKC 5I30L 5T1LD 1OSPL 5JLZB 3EYUL 1D5BA 5BCAA 4X4YB 2GK0A 3C60A 2XYCA 4U49A 3HMWL 5SWSE 1KNOA 1K4DA 1A5FH 4JPIB 3NCMA 1A0QH 2CLVA 3NVQA 3PXHA 1KJMA 1S7VB 4N1CA 1J05A 3QXVA 3ZHDA 3QO1A 4KV5E 4FRWA 4PJFA 5D7IE 1CICA 3ARSA 5T5FH 4W6XB 5D5MA 3M1BB 5F93C 4YXHL 3Q1SL 4R96A 5I2IB 4NCC1 4M02A 1FLRL 2NYYC 1QBMH 3VXNA 4AYFA 1R5WB 4HKJB 2ZG3A 1L9MA 1V7NL 3P4LA 1AJ7L 2VAAA 4M43H 4XCCH 3QR2A 3BDBA 4Z0XA 2R2EA 5E1HB 3D0VB 5K33A 4YC2C 4ZQKB 4HIEA 1IGTA 4NZRL 4MVBD 5ISZD 1CT8A 3TVMA 3QDGE 4IRJA 3ZHLA 4ZTOL 4NQCE 5TPWL 5DJ2A 5CEZE 1K4DB 4ODWB 3HZVB 1IMHC 1YEHL 3KPRD 5J13C 3D85A 2CLVB 2YPVL 3K7UA 2WM0A 2O5XL 4HFWA 1NUFA 2C3GA 1UXWA 4PRDA 4E42B 3OJVC 1NDMA 1J7VR 4L3EE 3I2CH 3GSNB 4PD4J 3TN0C 1CICB 1FVEA 2FZ3A 4LRNH 3UO1H 1YEEH 4FQ2L 1IEAB 4JDZA 1TVBA 4KTEL 3TWCH 4LGRB 4QTIL 3D39D 1C5CL 2HJLA 4PY8J 4PRHD 5BW7C 4Z0XB 2DQTH 2E7LC 3O4LB 4HUNB 3HC0B 4HIEB 1IGTB 4OZFH 3MRPB 1NANH 1IC4H 1ZANL 3EO9H 1CT8B 3JWDC 5HHOE 3RUGE 2UWEE 2OJZL 4LHQB 1N59B 1AO7E 4FQQA 3D85B 2OSLA 4JN2B 2VQUA 3RWFA 1SYVB 4LMQE 2QEJA 1N5AB 4PG2A 4PRDB 3JV4B 1KN2L 5L8LB 4GXVH 3L5WB 5I8KL 4L8CA 2HKFL 3MNVB 1NDGA 1RIUL 1LE5B 1AHWC 4IMKA 5EC1A 1NL0L 5CJOL 2WP3T 3QQ9D 1TVBB 4F58L 3QUZB 5TF1L 4JLRA 2HFGL 2CR6A 2HJLB 4ISVA 3ZLQC 5F6HJ 4H8WL 4PGBB 1EFXA 3HS0A 3B3IA 4PJ7F 2FECI 4NRZA 3L3OB 1F4WH 3NCJH 3JVGC 1NMAH 1MHPL 5IW6B 2VWEC 4Z7VA 3FO9A 2FX8L 4FZ8L 2I25N 3JSSA 5HGDB 1BQUA 3D2UB 4MXVF 4FQQB 2ATPB 3X12A 3BE1H 1EEZB 1T1WA 1JPGA 1TZHB 4OB5H 4P9ML 2YD7A 1T4KA 1AXTL 3N9GH 4JPKL 5JDJA 1ZA6B 5C0DB 4YDLC 4NM8L 4Z95L 3V5HB 1HSBA 2KZWA 4S1QL 3PWPE 4YR6A 1MWAA 3PQYB 3IFLL 3S5LA 4Y2OA 3MYZA 4I13B 4OIIH 1I4FA 2J8UA 2WUBH 5FA4B 3FFCE 4GLRI 1BQLH 1OQOA 3S35X 1EFXB 3OV6A 3R1GH 3ZYZA 2YOCA 1BVLB 2IGFL 1DBMH 4NRZB 4OT1L 2R2HB 2OLDA 2A0LD 3PDGA 4PRHB 5E4EB 5HI5D 1FSKB 3FQTB 4RAVB 3OR7B 5SWSD 2FGWL 4GOSA 3D5OF 1HCVA 3U30B 2J6EA 1OHQA 3X12B 1CU4H 2CMRL 5DURB 1NCWH 3TA3D 1RJYB 2PW1B 3QEHA 1QO3A 3EYQD 4N0RA 4K8RL 5CSZA 5IBTH 4PJEA 1G7JA 1K8DA 1MJ7H 3VXSE 4OLWL 1MY7A 4I3RH 2LFGA 2EDHA 3ARGC 1Z3GL 4M6AA 1I7RB 4FN0A 3B83A 1RUAL 3SO3B 3LB6C 3KPQB 3MLSL 4QYOA 1E4WH 5HHQB 1BD2B 2X1XR 4S2SA 2APFA 4XRCA 4K7PL 5EPMA 3LRGA 1NGXB 3LMJH 3UJTL 4PB9L 1J12A 5TE7H 2FWOA 3W5NA 4G43A 4I4WA 2HTLD 5C6PB 4M1GH 3IXAB 4KZEL 3OAYK 2R1WB 4KZDH 2GY7B 4TSCH 4S1DD 3SKJH 3MFFB 4NQCD 1HHJB 3I50H 1R6VA 2WQRA 1I7TA 5CEZD 3DMMD 5INCA 3BGAA 1PAMA 3X13B 5EIVA 4G5ZL 1Q9KA 1J9CT 1Z0MA 2YUVA 1RZKL 1YUHA 3QEHB 3IAGC 1OGAA 4L3ED 4PRBB 4YUEL 4PJ9D 2GTWA 1IZKA 1KPVA 1FCCA 3S37L 3OAYH 2GAZA 2V17H 5AYUH 5E8PA 5ALBH 4HPYL 2R0ZH 4FNLH 5ACZB 2C3VA 4UMGA 4XRCB 4XP6L 3GI9H 2FWOB 5IMMB 3KLHC 3SGKA 2RCSL 3OX8A 5ANME 3RAJL 1GAFH 3F62A 2APVA 1DN0B 1U3HA 4X7SL 1U8JA 3WYRA 1MQ8A 3K8MA 4MYWB 3VD3A 1RZGA 3B9KA 2R1XB 1AO7D 4HBQA 1UM6H 3IKCA 1GZPA 3QNXB 4K9EL 3MRGA 2CSPA 2YA2A 3UTSD 4YXLL 4FXGB 4FQCL 3C6LD 2BVPA 3DUSB 1JIBA 4LVHC 1C7TA 5EBGA 4NQUA 5HDOA 1VFAB 2AJZB 4Z7WE 3KGRA 5I1GH 3AM8A 2VXTL 5GGSA 2MJWA 4KJWD 5E9DB 1P4IH 3ZE1F 5KVDL 2GAZB