1YNLL

Identification of key residues of the nc6.8 fab antibody fragment binding to synthetic sweeterners: crystal structure of nc6.8 co-crystalized with high potency sweetener compound sc45647
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
219
structure length
219
Chain Sequence
b'ELVMTQSPLSLPVSLGDQASISCRPSQSLVHSNGNTYLHWYLQKPGQSPKLLIYRVSNRFSGVPDRFSGSGSGTAFTLKISRVEAEDLGVYFCSQGTHVPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma light chain
publication title Cocrystal Structures of NC6.8 Fab Identify Key Interactions for High Potency Sweetener Recognition: Implications for the Design of Synthetic Sweeteners
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ynlL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ynlL01
2MQ0A 5I1AA 1JPST 3KYMA 3G5XA 3WSQL 4O02L 1A6UH 5B4MD 3V7AG 1OHQA 5JOEA 4Q58C 3WFHB 3PNWB 3ZZ1A 5FA3A 1AD9B 3FB6B 1NDGB 3SDXF 4G6AD 1C5DB 2GJ6A 1OGAA 4P0DA 4B0MM 2OTUB 5SX5H 4BZ1L 5GS1B 2M1KA 1QVOA 2GK0B 1M71A 2XZAH 5TE4H 2CLRA 3IJSB 1YJDL 1CU4H 3FL7A 2A6KA 4MD4A 4OTXH 3IXTA 3KJ4B 1TZIB 1MAJA 3OR6A 4JPKH 2FX7L 4PJDB 5HHPA 4PJDE 3VH8G 3KPQB 5C0FB 4EN3C 3VFNA 1GIGH 3QAZB 1CT8A 2G60H 3HNVL 1SMOA 2BCKA 3DXAB 5EIQA 3DXAE 2R39A 1YQVH 1EHAA 1X5YA 1F58L 1PKQA 3HMXH 5JW3H 5JMRA 3U4AA 5F71A 3DO7A 2YOCA 4AYFA 4OKVA 3QPQC 5ID1B 5IBTH 4I2XB 3MRJB 5SWSB 2AABH 4I2XE 1TZHA 5SWSE 4CNIB 3QIUA 3ILQD 1UCTA 4OGYH 5IB4B 3VFGH 5EUOB 1T03L 4FFZL 2XWTA 3RIAK 3B2UC 5D5MA 5F6IB 3F6LA 1HHJB 3SBWA 1CDCA 1FZOA 3HNTH 4NYLA 2CK2A 1FO0B 4IRJD 4KY1H 4KDWA 4LAQH 1T22B 4Z78A 1KIRA 1T6VN 3M8OL 3NFSL 4QY8A 2R2BA 4NO5B 5DRXA 1UM6H 1S7XB 2KKQA 2NY5C 3E0GA 3H42L 4HWZA 4A6YA 5KAQF 3BRDA 5JLZB 4YWGH 5D6CB 2XIDA 1UWGH 1NMCC 3ZKNC 4LCUB 1A9BA 4P46D 2XZQL 3PP4H 1G7IB 2VUYA 5CEYA 3MRDB 1T0NB 2E6JA 2P4AB 4S2SB 2BSRB 5DSCA 3E6FB 2VZSA 2ADIB 4LHUG 4POZC 4XCYA 1OVZA 1UXWA 5ADPH 4NJAL 1UVQB 4ZNEE 1CGUA 4M7ZB 2XZCL 1JNNL 4JR9L 4W70A 1ZHNB 2NY7H 2VDLH 4YEFA 5JXAH 1IEHA 3ARGD 5ECJE 3CNKA 5CILH 3DX6A 3QNZB 4TULL 2FL5A 1QNZL 3MSPA 5IMOB 4I0PA 3HS0A 5ETUA 1R3HB 3DX8A 4G9FA 3GSWB 1QSEA 5C0CA 2CLVA 3KR3L 1U8PB 2GW5A 1OAXH 1QLFB 1HCFX 1U8MB 1J8HB 1RV6X 1J8HE 4O2EA 2WUCH 5F1NB 5EUKA 5KVEL 1T2XA 1D5XB 3QDMA 5BXFB 1RULH 2SEBA 1F8TH 2VXTL 4X80L 2KPNA 5I71B 1KCVH 4D2NA 1JTPA 2G5BA 3NN8B 3MRKA 5E5MB 3ULUH 5BQ7A 3VXPA 2X40A 2ZG3A 1R5VB 2BVQB 3GHEH 1M7DA 5TDPA 3IGAA 4R2GB 3SO5A 1A4JA 4OFYA 4QT5A 1EXUB 3PL6A 4XC3H 1YYML 1YY8B 3ARFA 4X6FA 2DB8A 3RP1A 3TP4A 5GIRA 2A2QT 3CSPA 3FFCB 1AXSA 4ZFZA 3FFCE 5CBAA 1L7TH 3IDGB 5TE7H 5MHSD 4J4PA 3NZHH 2FSEB 1NEZA 1QSFD 2WW8A 2JCCB 1DANU 2VZ1A 4XC1H 2JCCE 1AHWA 3DV6A 4NM4L 4F7TB 4PRBA 5CBEB 1JYWA 2VSDA 4Z77A 1N4XH 1FVDB 5K9JL 3U0WL 4J2XA 1BQHA 4M61A 1KYOK 5JORB 4HJJH 3MO1A 4EI6B 1IJ9A 3B6SB 4JPVH 5I1LA 1FG2B 5C70A 3QO0B 5JA8B 4AJ0A 3PJSA 1E4KA 2I60H 1IGIL 1D6VH 4Y5YA 5FB8A 1BJ1H 4N9GB 1KXVC 2VZTA 1T04B 1XCTB 3Q6GL 1MHCB 1LO4H 5EU5A 1NH6A 4UIKL 5JTWA 1YDPA 5H35B 5D2LF 4O9HH 2JE8A 1JNLH 5GGUB 5D7JA 3CMOH 4CBPA 3OJDB 1NGYB 1D5ZA 3OHXA 1WCQA 8FABA 2UVFA 4ZFFB 1P4IL 4ERSL 1J12A 1VFBB 3PGDA 5T1MB 5DGQA 2NTSP 1QACA 3H9SA 4ONFH 2W9DL 2WWMC 3HCVB 4X4XB 5E00B 5AUMB 1A3QA 4RFNB 2OL3L 1ZV5A 1PQZA 3JWNC 2J88L 4H88L 2V6HA 4R97B 4U3CA 5KZCD 4YAQB 3W9DB 2YBRB 2BRRH 5C2BL 3MLTB 4GBXB 4H8WL 5FYKD 2GITB 1B6UA 4MX7B 4O2FB 3V6ZB 3D3VA 3DVNB 1OSPH 1S7WA 4HJGA 4QRUB 4UNVA 5IJKA 4K3DL 1I8IA 5IB3B 3HE7A 1IAIL 4NHCH 1IGFL 4JZJA 2R4RL 4YPJA 1UB6B 1FDLL 3D0LB 4ZUUB 3NIFF 1M7XA 3MLVH 1I9JH 1S7TB 5C6PB 1I8MA 1P4LA 3C5ZA 3E2HB 3GMNB 1IEBA 3VD9A 4RMRA 2GJJA 1TFHA 1A8JH 5E1HB 4KVCL 4RAUB 1KBGL 3BIAX 5DWUH 4F9LA 2VJXA 2Z93B 1C12A 1TVHA 4NM8L 3UXFA 3KYAA 5CJQL 1OW0A 5C8JA 4WFHE 1PG7X 1WIOA 4PJ5A 3SDCD 2VDMH 3EOTL 5DR5L 4NWUL 3E6HA 2IPTH 3RWDA 4P2QA 2R8SL 2PKDA 4NJ9L 1OP9A 1NUFA 3T8XA 2GSGB 2HLAA 2P5EA 3QUYA 1MFBL 4UOW0 1MHHA 3TPUB 3S96B 5T1LB 1BM3H 4P4KD 4MLIA 1QLEL 3T2QA 4K7PX 1OAZL 3NCYP 1D5IL 1OPGH 2CK0L 2NY1B 1KPUA 5F96L 3DUUA 4OLWH 4LSTL 4G6ML 5DFWH 1OP5K 5TPWL 25C8L 4I5BA 1V05A 5KANG 4S1RL 1OLZA 5E6ID 2BDNH 1UWEH 3EIFA 4L4VA 4QHLB 4KZDH 4Y4FB 3SOBL 1NC4A 2EO1A 3QHFH 4QYOB 1FFOB 3SE8H 1S7UA 5J57B 1WAAE 1FO0H 4X5WA 5E6IB 2EE6A 4U1LB 3D2UA 4AL8L 5IG7B 3IDJB 4NN5B 4U6VL 1OTSD 3UPAA 2D4FA 2EXWC 2MKLC 1KEGH 5EZIL 3QZWB 4M5YL 3RUGB 3WFEL 3RUGE 2LTQC 5E8NA 3SGDI 4L3AA 4YK4C 5HHQA 2IH1A 3TO2B 3TWCH 2AQ2A 3QPXL 5C7XH 4LSSL 2EYTA 5H37H 3MV11 5DA4A 5DJ0B 5FO8A 4MHHI 1G9MC 2XA8L 5IV2B 1R3IL 4U1KA 5JQHC 3KPRE 3QIBD 3T2NH 3HPJB 3MV01 4JDTL 1WZMA 3CFCH 5ADOH 3O9WB 1FVEB 2DKUA 4LNRA 3BYTA 3UO1H 1G7QA 1FNEA 4JQIL 3HA0A 5ISZA 3RDTA 4NQEA 5TFSH 5E2WL 1FFRA 1DBMH 4KJPC 3P4MA 2OQJB 4G7VH 3QIBB 1NMBL 3PV7A 1IBGL 3GSUB 4U1MB 2WIIA 1MSPA 3D85B 4RDQG 1CR9L 3MRPA 3ULVD 4M3JA 4ZUWA 4P4KC 4LP5A 3SKJH 1NBZB 2K7PA 1QFUL 1X5ZA 4ZS7L 4QRQA 2DLGA 4R3SB 2DIJA 4OF3A 4DEPB 5IUSA 3RIAF 3F6IA 1MPAH 3JV5A 3HB3C 3SDDA 5HVHB 2ZJSL 1I9IL 3FOLA 3CFEB 2NY6C 2YA2A 5DFVD 2HP4A 5HYJB 4WI8A 5HYJE 1EJOH 2P5WD 2AJZB 3GKWL 1J5OH 2BSSB 4XXDB 3T77B 4MVBC 3IKCA 3OXSA 4PR5A 3HZVB 4PRHA 2P8PA 4PJAE 4OZHB 3HRPA 2B39A 4Y4KB 2ZUWA 1VGEH 4WW1B 4ODHH 4LLMA 5F70A 4Q0XL 2ARJA 4YUEL 1GCFA 1ORQB 3HLAB 4WHYG 3AS2A 3TJHD 2BVOA 1OTSC 1UEMA 3HI1B 5C0IA 4Y5VC 1FQ9C 5FDWB 4FG6C 3MLYL 3F12A 2VH5L 5DD3H 2P45B 5L6YH 2ATPA 5LGJA 2DOCA 4O4YL 4WU5A 5DUMH 1FYTA 1GC1C 1KPRA 2APBA 4NN7C 4LSQH 4H1LG 4N5ED 4P5TD 1NL0H 7CGTA 5IMLA 2RCSL 3PQYE 3QUMA 1QEWB 3S37H 5C09E 3T4AA 5JOPD 4S1DC 4P2RE 2D0GA 2Z8WC 3R0NA 4FQJL 1DQMH 4ZOEA 4HW6A 2OJEA 4I0PC 5D72L 2X41A 5FM8A 5IB2A 1Q0YH 4P5TB 5FHAH 1Z5LB 2ICWJ 2ZUSA 3B5TA 3KAAA 3MJ8B 1CFSB 5DD1L 4LARL 3LPWA 1TZGH 2AW2A 4LSUL 1MCHA 3JV6A 1R3KA 1N3NB 3TBYA 3EFDL 5JDSB 2JJWA 4LEXL 4JN1H 3T4YA 3Q0HA 3BXNB 5FYKU 4NUGH 3U6RA 4PJFF 1LEKA 3OX8A 4P49A 1MH5A 5DUBB 2Y4SA 3PL6C 2V9TA 1R3JB 1A7BA 3FQUA 4DVBA 3VWJA 2ZSVA 1SEBA 5EUOF 1U3YA 3LDBC 1MRCL 1U93A 1RU9H 5DO2D 1TCRA 1N64H 1UC6A 4NZJA 5GGSA 4TYUA 1KOAA 2PO6A 5E4EC 5D2LA 3MR9B 2DQJH 4HC1H 5KSBA 5DFVC 5KSAD 4CAGA 5D7IB 2HFGL 2ZUUA 3MV7D 4XPFH 3LOWA 5D7IE 6FABH 4AEIH 1ZXQA 2FO4B 3QQ3B 3MROA 3QH3B 2YKLL 2ADFH 4XMLL 2X4SA 4YC2B 5JZ7D 4X0KB 1SJEB 1YNTB 4YLQT 3DGGB 4WUUD 1QOKA 5SWZD 2BVYA 2C3GA 5BS0A 4TSBL 3FTGA 4YDLC 4QHUA 1CGWA 2HVKA 4PV8A 4Y5YC 2VMFA 4XCCH 4UDUB 4JGJA 3QNXB 2WBJD 1XF2A 2IAMC 1HHGA 1IAKA 2CRYA 1MCOH 4LSVH 2Q76A 5EC2B 2FYYB 1EEQA 5EULV 4OF5A 3U36B 4DKFH 1UENA 5DD0L 4Z7WE 1MQKL 3T65B 4N5EC 4JRYB 4LPVA 4P5KA 4JKPH 1WEJH 4JRYE 4O2CB 1T4KA 2PXYC 3K1DA 3WXVH 4JLRB 1CFNB 4WNQA 3T0DA 4LRIC 5B8CB 1KG0B 1F13A 3O6MH 3CXHJ 4Z7VF 1T1XB 4OV5A 4F58H 3SO3B 1KENH 2A1WH 3QDJE 1EO5A 5ANME 2A9NL 3W39B 3RTQA 3C6SA 2OX5A 5DVOA 1V8HA 1FL3A 5GJTH 3W0WA 1RUML 4XT1C 1U36A 4JFDD 2OR7A 3EOBB 4HF5L 1CXEA 4KUZL 3IETA 3GSNL 4M4PA 5CD5C 4KJQC 5KSUB 2MFNA 3L5HA 4RFOH 4XVTH 5JQ6L 3AM8A 5CEXB 5DK2A 4JFDB 1L0XA 2VLJA 4P23B 2CGRH 2F8OA 1BECA 3BZDA 3QIWD 4TVPE 1VFUA 3UCRA 4JREC 3C5ZC 5DO2C 3BPNB 3MJ9H 2UZYB 5TDNA 2H1PL 3CFDA 3IFLL 4YHKL 5JW5A 5I1DB 1LP9A 4F9LC 5JMOC 4U0RC 5FKAB 2NX5A 5FGCB 4OM1H 1CXHA 5FGCE 1JFQH 5IEKB 1X7QB 4APQA 2JTDA 4K2UH 5E8EB 1C8PA 1DUZB 5BW7A 5IWLC 2DL9A 3SCMA 3QQNA 5I8CB 1NJ9A 1U58B 5T3XL 3CVHB 4KI1A 4JFHD 4S11A 4ZXBC 1S9XB 3JWDH 4JKKA 5DJYB 2BSTA 4POUB 4HWEL 3SQOL 5CIPB 2QKIA 1KTRL 3JTTB 3QUYC 1ZTXH 5DJXB 2YS4A 4HK3J 1EO7A 3BOVA 1EVTC 4D0CA 1GHFL 1EGJL 4N0UA 4PLJD 4PJ7A 2BNQA 3UTQA 2H8PA 4KMTH 2W65B 4QRTB 3ARRA 5AD0A 3V0VA 4X8XA 3QXDA 1ZHLA 1K4DA 3GJEB 4MA7H 4CJ1A 1K4CA 4AENB 3AREA 5BV7B 4L3CA 2ICCA 5HHXH 3LPGA 3NCMA 2I27N 5JIPA 1CICA 5I0DA 3OXRA 5M94B 5D1XA 4BZYA 4EEEA 1CWVA 5CSBA 3CIQA 4QHKJ 4LLVB 4HUVA 4GXUM 5HJ3A 3AAZB 1XGRB 4FQHB 3N06B 2X89D 4LLYA 4XP1L 4Y5XA 5KVGL 4MB3A 2E27H 2PN5A 4JFZL 4U33A 5I1KH 1YMMB 1YMME 3O4LD 3PIQB 4G8EB 2IF7A 1CZ8L 4PD4J 4ZSOB 4N8PA 5LBSL 1A1NB 4WO4A 3MBEB 2C3VB 3AS0A 3DMMD 1S5IL 1QTYT 3QIWC 5F88A 1OT1A 3ARQA 4LDEB 3WV0A 2UYLB 2DBLH 4X9HA 4LSPH 4Y2DA 1MCWW 4IRZH 1RZGB 5GGQL 4I18B 4XTRD 2IH3B 1G7LB 4Q9RH 2Z0BA 1LDSA 1KT2A 1LWRA 3UEZA 3C5JB 4WWKB 5SV4A 4OLYL 1N6QH 1JWUA 2YUWA 1RUPH 2CKBL 5D4QA 4ZO6A 1AQKL 3NA9L 3V6BR 3SKUD 4YDJA 3RDTC 3EO0A 4LLUB 4LCYB 2IQAA 3RI5K 2AEIT 2AJSH 3K4ZA 3QJFB 1H3XA 1EEYA 5IB5A 2C4FT 1DE4A 4YBLC 3RWEB 1HYSC 1AFVL 2NMSA 4FQ1H 4YDIH 3MRIB 2MCPH 1PSKL 1Z3GH 1GGUA 5JHDB 5LWYL 4PLJC 3PNWA 5JHDE 4K9EH 4GH7B 3C87A 3LHPL 5GRJH 1EHXA 1VPOL 1AD9A 1JPTL 1CXKA 1NDGA 1C5DA 4WY7H 1RK1B 2QR0B 4F2MB 2OTUA 3VFPB 2JK5A 5GS1A 1NCNA 3IU3B 2GK0A 1VEMA 2OMNA 4WTXA 4LSRH 3NAAL 2J6EL 4ODXB 3IJSA 1GZQB 4DN3L 1MUJB 3SE3C 1P53A 1TZIA 1W0VB 4N0RA 3V4PH 1WAAF 2YRZA 5CSGA 2K3TA 4PJDA 4BJLA 2AEPH 2Z31D 4XMPL 3KPQA 1LO0L 3EDKA 5F89B 4IOFD 4LLDB 3DXAA 3FO2B 3P0GB 1IAOB 3RUGF 2VISB 1WBZB 5TQ0L 5CWSB 1MCPH 3L6FB 4JPWH 1UACH 1FPTL 3X3FH 3U79A 5F9WB 4JCMA 1CVSC 2ZSWB 5ID1A 4I2XA 4NRZB 3MRJA 4CNIA 5EWIH 4LIQL 3L5WA 5HYSB 1DQJB 5JR1L 5IB4A 5EUOA 3HE6D 5FUCE 4XTRC 1HHJA 4UILL 5IFHL 1Q9OB 1Q8MA 1FO0A 4ENEC 3C5SB 3VD7A 1TETH 2R0ZL 4X7EC 4PG2A 5CJ8A 3UZQA 1T22A 2OTWB 4U7SA 3OKLA 4LCCB 4QGTA 3UTSB 1MCFA 4E42B 3UTSE 1WVZA 5K9KB 4NO5A 4AQ1B 1S7XA 5GGTH 4FQXC 2IFFL 5JLZA 4FHBD 4KMQA 4LCUA 1A7OH 4KK6C 4EXPX 1G7IA 1NCWL 3MRDA 1T0NA 2GYSA 5CKAA 1KCLA 5GS0D 2BOBB 4S2SA 4BYHA 2BSRA 3E6FA 4Z7QF 2ADIA 5J13C 5ITBH 5IQ7H 4BM7A 3S3SA 3VWJC 5T3ZE 4ZNEA 1UVQA 1F6AB 3UDWA 4HH9B 4X98B 4K23H 2DQUL 4P46A 3ULVF 2PO6C 4X7TB 4LKCB 4MA3A 2BX5A 4GRLD 3TPKA 2X4OB 1B88A 4WJ5B 3QNZA 1X6LA 3I9GH 3M07A 3ALPA 4ODTL 5IMOA 4TVPH 2D9CA 5FAAA 5IT2H 4OZHF 3GSXB 4R26L 3J8F7 4LCWD 4Y1AD 1R3HA 1K5NB 5B39G 4GRLB 3GSWA 2DBJA 4GUPB 3I2CH 3U1SH 1FN4B 1NLBH 1U8PA 3T0ED 1QLFA 2KH2B 4UV4L 1U8MA 4JQVC 2UUDK 1L0QA 2W38A 5F1NA 5KBNC 3HKFA 3C8DA 1D5XA 5BXFA 5DQDH 5I8KL 4KAQH 5I1CL 5I1IH 4DK3A 3PP3H 1SMAA 1JI2A 3O45A 3RL2B 2IFGA 5J6HB 1HOCB 3NN8A 5IVXF 3MLUL 4K8RH 1AXTH 5E5MA 2GY7B 1R5VA 2BVQA 3CVHH 1ZT1A 3LAFA 4JG1H 1A6PA 4TSAH 5F7LB 1EXUA 1G7HB 4RWYH 3LH2H 3TZVB 2MNUA 1BVKA 1RJYB 1HQ4B 4NFDA 1CDJA 3FFCA 3BJLA 2APTA 3PV6B 1FL6B 5C08E 3IDGA 1OB1B 2VQTA 2B1HL 3HE6C 4WHDA 5DJ2B 3Q1SL 2FSEA 4JY4B 3ROLB 1QFWM 2JCCA 3GIVB 4NCC2 2D7TH 4G7YL 2BNUB 1CE1H 4F7TA 3QNYB 3WDJA 3S37X 5LXGH 3L3KB 1FRGH 3KPSD 3ETBF 3WMSA 1FVDA 1P84K 5JORA 4YHML 1T2QH 4K7FB 4EI6A 3B6SA 3MOAH 1OWWA 3QO0A 2R1YB 2W0FB 2NXYD 3AM8C 2AK1L 4NC2B 4N9GA 5GGVY 4M9PA 1ZWIB 3ZDYF 4NUJB 1XCTA 4CW1B 1MHCA 4KI5E 5FM5O 5GGVL 5H35A 5GGUA 2R4SH 5IHUH 3IFNL 1BJMA 3OJDA 5ICYB 3L5JA 1NGYA 1P6AB 1J8KA 4Q74A 15C8L 3NIGF 2DICA 2BY3A 4DW2H 3UJTH 4E0RB 4Y4HB 3WD5L 5CZXC 4ZFFA 1M7IB 3T0WA 3P0VL 4APQC 2IBZY 4N0YH 4M7JH 1VFBA 1A7NH 4Z0XB 5FUZL 5T1MA 5BW7C 3QXTA 3WXWL 2Y07L 3AMKA 2F74B 3KYKL 3VA2C 4GSDH 3ULUC 3HCVA 5AUMA 1BBDH 5E00A 4OD1H 1B90A 5F6HI 2K1MA 1KEML 3R4DA 4G8GB 3DLQR 2XV6B 4Y8DC 4G8GE 3TV3H 4YAQA 3W9DA 3PABB 1P7KB 2YBRA 3WEXA 1HNGA 3MLTA 1L4IA 4GBXA 2GITA 4JDVB 5IVNA 3VD3A 1IL1B 4O2FA 3V6ZA 3WN5B 4QRUA 4Y19E 1DP0A 1P9MC 5HI5D 4X9IA 4KKBC 1ZLWH 5IB3A 1MCDA 1GGBL 3GI9H 1F02I 4ZUUA 4NKOB 1B3JA 1U8JA 1S7TA 4XCEB 3DVIA 3B43A 1A1OA 5E4IA 3LN5B 3GMNA 4HG4K 3MYZA 3O0RL 3OBAA 4TPRH 4NQCB 3AREC 5DD5L 4NQCE 3RKPA 5DXWA 2Y36L 2R56H 4TSCH 5F7HA 3BUYB 4WTWA 1X5LA 5DFTA 4Q97A 3TVMB 4ZFGH 1C5BH 5DURB 4PPTA 2PW1B 2EYSB 4LU5H 4EIGB 3TBSA 1MHEB 3HR5B 2E7BA 4ELME 3ZSSA 1QFWH 1QFHA 1TJHL 5TDOB 2APXA 1ZAGA 3GJFB 2EDJA 3MACL 1J86A 2VLKB 3LRGA 2VLKE 4QHMB 2XXMB 3IDMA 2Z9TA 2GSGA 4MXQC 3DETD 4HX1B 1NLDL 3CUPB 1X4XA 4ZAKB 2O5ZL 4XVJL 3S96A 5T1LA 4NP4L 3CU7A 1YPZB 5DUPH 1BFVH 1YPZE 3L3IB 1ONQB 4BA8A 1G9NH 4PRID 1GGCH 3IDIB 4Y2DC 1YEHL 4KK9D 3WIHA 1IQDB 1Q0XH 1BAFL 4I13B 3IAGC 1YEFH 5DVLA 3CFKB 5IHBA 3MXWH 4MAYB 5EORL 2YPLE 3ZDXE 4ONGL 3V4UH 4UTBL 3AFLA 3MRHB 3WL9A 4GQ9L 4IRSD 1JIBA 3OKEB 4F15C 1YYLH 5E56A 4QHLA 4Y4FA 3V6OA 3RI5F 3DARA 3RGVD 4QYOA 1FFOA 1WAAA 5E6IA 5CZKA 4JFEE 3MBXH 4ZDHB 2CUMA 2X5PA 3MLXL 3DWTA 5ICZB 5DDHB 3QB7C 3MJ9A 5GRVL 1BFOB 3SGEH 3CLFH 4GAFB 5HI5C 1T3FB 3RUGA 1C08B 4MA1B 4OGAD 1I7TB 3NFPB 5HHVH 3K80A 4P2OD 3QUZD 2J8OA 3CD4A 3O8XC 5A2FA 1NAML 2YD6A 4NNPL 5SX4I 1QSVA 4OCYL 2B0SL 5GS1C 5T3ZH 1KCKA 4Z7UB 4IJ3B 4MJID 4Z7UE 3W11D 4YNYB 4HS8H 3KJ4C 1VENA 2R29L 4D9RD 5CJOL 1KPVB 3MOBL 4G6JH 4R4FH 4NQUA 1H3TA 1QFOA 4D9LL 5IV2A 1K3ZA 3BO8B 3CVIL 4AT6B 1AKJD 3V8OA 3HPJA 3QAZC 4M6OL 3NABH 2YK1L 3O9WA 3FN0L 2IQ9L 5INDB 5L9DL 4KXZI 1D9KD 2IBGA 1AKJB 3QIBA 4ETQB 1J1PH 4U1MA 2F15A 3UBXI 1WF5A 4JM2D 1GAFH 5LAXB 2AXFB 4KV5F 2FB4L 1NBZA 3BPLB 3NCYS 1NCDL 2XRAH 4R3SA 3WFZA 2HWZH 2P8LB 2UZXB 2B8OT 2XN9E 3CFEA 3BW9B 2EDXA 3BIKB 4LKXB 5F6IC 1U3ZA 4K3GA 3RZCD 1G6RL 3BGMB 5F7FA 2E7MA 2AJZA 2AJYH 3DECA 1WWCA 2BSSA 1TNNA 4XXDA 1X5FA 4PG2C 3T77A 4UDTB 4P3CL 3I3BA 1NEZG 4IRSC 3HZVA 3CH1A 2Q8BH 4OZHA 3RWIB 4Y4KA 5L7XH 1KB9K 5ID0B 4L9DA 5DLMH 2P5WA 3DRQB 3BQUD 4WW1A 1NCAH 4HS6A 1J10A 1ZS8B 2HT4D 3QG7H 1ORQA 1BQHG 4WFGE 4MGXA 4V1DB 4V1DE 3OG6B 3S98A 1BVZA 2YXMA 5FDWA 3NBNA 1Q38A 3UJJL 5JW4N 2VIRB 3HC4L 5B38B 1MF2L 3GMLB 4M7ZC 3BQUB 1F00I 3V9FA 5IVXA 3MXVL 4P2OC 4M62H 1WLHA 5DRZB 1QEWA 4NKIH 3L1OL 2AEWA 1S7SB 1FNFA 2NY3B 5INCB 4S1SL 1FNHA 2DTSA 3AMLA 5C0BD 3U0TB 3FMGL 4P5TA 1BMGA 1B0RB 2HN7A 1P1ZB 2CDGA 1Z5LA 2DD8H 4BUGA 1FAIL 3MJ8A 2WINB 1CFSA 1HI6B 3QCTL 2E9JA 3UYPA 3H7LA 4F80A 3MODH 5AYQA 3OF6D 4WTZA 3SPVB 1N3NA 2ZCKL 5I71C 5JDSA 1A6VH 3BXNA 5F3HB 4Z18A 1D9KC 4NPYB 2J12B 2MOVA 3BRFA 3NH7L 5DUBA 3UZEA 4R2GC 5MERB 4JM2C 1P7QB 1Y0LB 2PTVA 3ILPA 1WCBB 1LK3L 1MIMH 1WWBX 4J12A 4UQ2B 1R3JA 5AAMA 5TF1L 3ZHLA 2XQBH 4GG8B 3HN3A 2JJUA 1U3HD 3FB7B 2DJ4A 1IILE 3RVXD 3MR9A 4GJTB 4NO0B 1PGRB 2NW3B 2W1NA 4M93B 5E8PB 5HHMD 5JUEL 3F58L 4O58H 3A6BL 5FV1L 1JL8A 1WTLA 2FO4A 3NZ8B 4XNZB 3QQ3A 3QH3A 5JXED 4X0KA 1SJEA 1F97A 1YNTA 5FCUH 3VGEA 3DGGA 1TTGA 1S78D 4NRYB 3T04D 3R8BB 2BOCB 5C6TL 1WWWX 2B4CL 4GQPH 3NCFB 4RGND 3QNXA 2ADJB 4X6BA 1MCNA 4HMCA 1QHOA 4WUUA 1P4BL 1S8DB 1JVKA 5C0NC 5EC2A 5E08L 2A74B 3P30H 4XPBH 4QXUL 4ODSH 1T20B 4PV9B 3GJFH 2XWBB 3IJYB 5M7QA 3W2DH 4KK5C 4EI5D 2QADB 3T65A 2AXGB 4JRYA 4P9HL 5GS3A 4GRWB 4O2CA 4JJ5B 4GRWE 5IFAH 3VW3L 1J1OH 4JLRA 12E8L 5DGRA 1CFNA 3G9AB 5B8CA 1KG0A 5DC9B 1FP5A 3QFDB 1QR4A 4JVWA 3OQ3B 4P2CG 5GGTA 3MA9L 4EI5B 5IW1B 4YBQD 3DI3B 5L2KD 3W39A 2ORBL 4XHJD 3S34L 4NHUB 4RFNC 1I1CA 4FNLL 3WNPA 2IWGA 4P59H 3BEWA 2DLFH 1CDIA 3EOBA 3HC3H 2JKXA 1MREH 5K9QG 1T80A 2OCFD 4L9LB 5L2KB 5E9DD 3LRHA 1I3RB 2ERJB 5LQBH 4M02A 3O3BB 1ES0B 4NKQB 5CEXA 4JFDA 4ZTOH 1WZ1H 4P23A 4GAGL 4WHTB 2W92A 2JJSA 4WI5A 3C08H 4GLRH 1U3HC 3U7WH 3VG0H 5KN5B 3TNNB 1NMAL 2FIKB 1INEH 2BK8A 1BBJB 2BVUA 5I1DA 3L9RB 2LU4A 1YN6B 3KGRA 4BK4A 5FKAA 3T2OA 5AEAA 4KC3B 4XAWH 5IEKA 1X7QA 3HNVH 3BE1H 4M6ML 5E8EA 1LGVA 4Z7OF 1DUZA 3O41B 1JMXA 4L4JA 2AJXL 1NBQA 2FJHB 4J3WA 4N1HB 5I8CA 2EDTA 4TTDD 1AGFB 1JN6B 1U58A 2NR6D 3F65A 3SE9L 1U95B 3CVHA 5EZLB 1JGUL 1S9XA 2EIZB 4KZEL 3FT3B 3EDJA 1JGEB 5DJYA 1OARL 4ZOBA 5CIPA 1MVFA 4OCXH 1UA6L 3JTTA 4CN1A 4TUJB 4DZBA 1HCVA 3X11B 1L7IL 3GO1L 5DJXA 1A9EA 4KKLC 4UT9H 4TN9A 3L5XL 1N59B 4PB0H 4FFZH 5E6YA 1EO8L 2Q20A 4UTAH 1TJGL 3QG6B 5I1EL 3VRIA 1H3VA 2YEZB 5LCVL 2NY1C 3BT2L 4FZEL 1K8DB 2W65A 2Y6SC 4QRTA 3UTTB 3UTTE 2XKNB 4HXBH 3VD5A 3MV9B 2EIBA 4MWFB 2ED8A 3GNMH 3GJEA 3PE9A 4HJ0D 2JIXD 4AENA 1PLGL 4M1GH 1MWAB 1RAMA 4YBQC 2VXUH 5CAYB 4M43L 1KSRA 3O2DH 3U82B 4N1EA 1SJXA 4JY5H 4F37F 4Y4FC 5M95B 3EJZD 1J0KA 1XR9A 1ZSDB 4LLVA 4ZO7A 1G9EA 2DF3A 4KGJA 1CQYA 1XGRA 3C60B 5D1ZB 4V2CB 4I8DA 4PS4L 2VAJA 2XZCH 3PG2A 1YMMA 5LGHH 3V2AR 3UJIL 4PBWD 3G6DL 5E8DH 3PIQA 4G8EA 1SY6H 4QWWC 4PUBH 4ZSOA 2Q8AH 1A1NA 4A2LA 1U6AH 4ZS6D 3EBAA 3GRWL 3PQYD 1Z2KA 3MBEA 2C3VA 3BIBX 1LNUB 2H2SC 4NSKB 5LG1A 3O4LA 2UYLA 4U1IB 5E2UL 1RZGA 3KR3H 5I75C 4I18A 3LIZL 2IH3A 1G7LA 1H8SA 1OY3B 1H8OA 4QRRE 3IJHB 3IDYC 2R23A 5DMIH 4WWKA 1MCRA 2FLBT 2NY2B 2VXTH 4CUCA 5BVPH 2DM4A 3MV8D 2NZIA 5D2NB 2AXHA 1NFDF 4LLUA 4X4ZA 4WFFD 2EE3A 4QKXB 1YPZF 2NY5L 3QJFA 1ZANH 3D1MC 1HXMB 2H6PB 3DV4B 1LEIA 1NCCL 3VFTB 3RWEA 5I76B 1NGQH 4OLVL 3ULSB 2Q3ZA 5TGBA 1DEEB 1M6OA 5DMKB 2EE2A 2AQ1A 3MRIA 5CCKL 1HN1A 5IB1B 4DEPC 4OF8A 3CFJB 3K0WA 1BWMA 1YEDB 3OPZH 1WC7A 4N0CD 1SHMA 3DIFB 4NDMB 5D8JL 4OZGB 2OK0H 1MNUL 3CFIC 5E8OB 4OZGE 5DVKA 3EJYD 4NM4H 1RK1A 3RPKA 3S6CA 3BPOB 2QR0A 4FQLL 4F2MA 1T1YB 3VFPA 1CFQB 4WHYH 3IU3A 2NY4D 2R0KL 5JIKA 4HJ0C 3U0WH 1JE6A 4ODXA 1GZQA 2BHUA 1MUJA 4PJ8D 2VDOL 2ZWLT 1T2JA 1BPVA 1VHPA 5F1KC 1IGIH 3H3PL 3LEVH 4OM0L 5LJYH 4MA8H 3VRLF 1RZFL 2OJZH 4MCYA 4OUOA 1EX0A 4Z0BH 1FCCA 5F89A 2HH0H 1S3KL 3FO2A 3UAJC 1IAOA 4LVOB 1ND0B 2VISA 4HK0B 5FFLA 4KTEH 1WBZA 5JHLH 5CWSA 4WIQA 3L6FA 1EAJA 2XNAB 4WW2B 4ZS6C 2ZSWA 2G2RB 2GI7A 4NRZA 5I9QB 3B5HA 4W68A 3QEQD 5HYSA 1DQJA 3R0MA 4HIJB 3DNKA 5FGBA 2FX8L 1NAKL 1XGTB 4R8WL 1FHGA 4DTGH 4LVNB 3WFCL 1Q9OA 4GRWH 3C5SA 1JBJA 3RWHB 1DZBA 3QJHB 2OTWA 1MOEA 4LCCA 4I77L 4FQIL 3UTSA 1N7MH 4H8WH 4E42A 2IAND 4PP1C 3T3PE 5K9KA 3LKNB 1VGKB 4LP4A 3B9KB 2R0WH 2AEQH 4K3DH 5DS8B 2BHYA 5HDLA 4K9EC 5C0DB 3GDBA 2EDKA 3NACH 4M3KB 4GKNA 4DGYH 4DKEL 1DQLL 1FDLH 3PWPB 4HLJA 4RMQA 3PWPE 1IGCL 2BOBA 4IMKC 3BYYA 3QP3A 5IOPB 1EAPB 1GGIH 5FA4B 4XP5L 3PWVB 1F6AA 4LNVA 4HH9A 1CD1A 4ALAH 1F4YH 4X98A 5KW9L 3LKRB 3KXFD 4X7TA 4LKCA 5D6DA 2ZCLH 2HT2C 4H26B 4Y0GA 1FZMA 4TTGA 2X4OA 1A6WH 2BXZA 4WJ5A 1T7XA 1S7QB 4DVRH 3TO4D 1W72B 7FABL 4GKOA 2EXYD 4UT6L 3GSXA 1T1ZB 1J18A 3EOTH 4YC2C 4WI4A 2VC2H 1EPFA 5DR5H 4ORGB 4U1GB 1VKXB 1K5NA 5CZVL 4GRLA 4GUPA 2FECI 2R8SH 3FT4B 1FN4A 4PTUB 5C0AD 4NJ9H 2I9TB 2HRPH 1RZKC 5JIHA 4KROB 1EBAA 1V3JA 1AD0B 1FSKB 4RISL 3D5OF 5EZOL 2X10A 1YY9C 3DSNA 3RL2A 5J6HA 3KWWB 3FB8B 5BO1H 1K6QH 5HPOA 2M8XA 2V7HB 3WIFB 2R1XB 1G7HA 4Y16D 25C8H 3TZVA 2Q87A 1RJYA 4XNXL 1HQ4A 4OLZL 4JHWL 4H0GA 3MRNA 3VI3F 4DUVA 4KK8C 2CLZA 5DMGD 1OB1A 1VFOA 2I24N 1BZ9A 5J1SC 3HFMH 4OGXL 5DJ2A 3ARBC 3R1GH 3VI4F 2UZIH 4WFEE 4JY4A 3SO3C 3ROLA 4Y16B 3U4EB 3W9EB 3GIVA 3VXMD 2BNUA 5DYOB 2AKRB 2VLRE 3QNYA 2EZ0C 3L3KA 1RIHH 3CK0H 1QBBA 3EDFA 4OAWB 5F1OB 1I9EA 4ZOAA 1KB5L 3GSRB 4HUWB 4K7FA 1MWAH 4MJ2A 5EU6B 4HCRA 4XMKL 5EU6E 3VXMB 3AS3A 2R1YA 5T3XD 2W0FA 1ZWIA 4NUJA 1BD2B 1Q72L 4P23C 4CW1A 1BD2E 3VXQB 3QI9D 2HLFD 1JMZA 1I3UA 3EYQC 2JJTC 1ZEAL 3FN9A 3RVUD 1QBLH 3RX5A 4F8TA 1JRHI 2V2TA 4RMVA 4E0RA 2PYED 2FBJH 4Y4HA 1FZKB 3QI9B 2F54D 1M7IA 4NZTH 1F45A 5I73B 2G9HA 1I3GH 5I1HH 5DHVH 2F74A 2ZNWA 4P48A 1B4JL 2YN3A 4K8RC 1J1XH 2PYEB 4K3EH 4QTHB 1BIIB 4G8GA 3MRMB 1RURH 1DLFL 1CLYH 1KN2L 3ARWA 1P7KA 3C2AH 3MRGB 3PABA 1QFUH 4H20L 3C9NB 4PJEB 4JDVA 4PJEE 2GFBB 4MXVE 3WN5A 5C86A 3V4VH 1JK8B 1QSZA 4O5LH 3I6LE 2P47B 4Q6YA 3GKWH 3WNKA 4NKOA 4XCEA 4YHZH 3IU4L 3LN5A 5ACLA 4PRPD 4ONOA 5DMGC 2EIDA 2IALB 3BP4B 4NQCA 2A77L 4PJXF 3MLZL 4R7DB 4GMTL 4HKJB 3BX7C 2CR6A 3BUYA 4ZD3L 1MCEA 5E2TL 3MRQB 4X6DE 4YXKH 2HFEB 2FBOJ 1NFKA 2VKXA 2PW1A 4OQTL 2EYSA 4F9PA 1ZLVK 1MHEA 3HR5A 2BP3A 2NXZB 1A7PH 3O2WL 1G9ML 3MLYH 5F9OH 1LO3L 5T5FH 3GJFA 1IKNC 3K8LA 1F2XK 3IDUA 5E99H 2XPGA 5FYJD 4NNXA 4I3SH 2E9WA 4ZAKA 3GI8H 1LK2B 5CSZB 1YPZA 4U1NB 2HLFC 5F72S 3TT3H 3WFBH 3L3IA 1ONQA 4U7KA 1I1AD 4F7CB 3U2SA 1MCSA 1IQDA 4MQ7A 1CGXA 1GGTA 1IM9B 4I18C 4V2BA 4KKNA 3CFKA 3RAJH 4H0IA 3TA3B 4C59B 5MEQB 2J4WH 2R2HB 4JANB 3S36L 3QEUB 3MRHA 3EFDH 5FYLD 4G6FD 2FX9L 5A2LH 3OKEA 1OGAB 1JYXA 1OGAE 1CFTB 1MJUL 2F58L 3BN9C 2FIRT 3QUXD 2CLRB 4KTDL 1RFDH 2PR4L 3RJDA 3UYOD 4ZDHA 5IESL 4G6FB 3OR6B 1UCBL 2VDPL 1MRCH 5ICZA 5DDHA 3CC5B 5D7LB 3AS1A 1ZLWK 5D7LE 2FHCA 3RGVA 2QQNH 5FEBA 1T3FA 3BKCL 1C08A 1I7TA 3ZKXC 3VH8B 3H9YA 4MQSB 2OR9L 5H37G 1AI1H 3RVTC 4I4WB 4I9WE 3GUTB 4YHOL 4TQEH 2CO7B 1GC1L 3V0WL 1NDMA 5ILTL 4Z7UA 1GH7A 2B7DT 3ZE1F 3DO7B 4YNYA 3QUZA 4LOUD 3VGAB 1AY1L 4TOYH 1MI5D 3BO8A 2AJUL 4XWGL 3SKNB 4AT6A 5EOCJ 3VXUD 1W72H 5I74B 3B8YA 4HS3A 5FUOL 3GMQB 5D5MB 2PTUA 5F7UA 5D5ME 5INDA 2BJMH 2P44B 4NYLB 4ZOCA 5E6ZA 1X4ZA 1QG3A 1KTDB 1AKJA 2QQKH 3F7VB 4ETQA 5ENWB 1D6EB 2ICEB 4Z78B 5F9WC 1NGXB 1X6NA 5LAXA 2AXFA 4NQSB 2N4IA 4A6YB 3ARDD 4GS7C 4NO2B 4LHUD 2X4NB 5E2VL 1QR1B 2P8LA 3O2DA 4MQTB 2BXYA 5FUCC 3BW9A 4LKXA 3BIKA 1A3LL 2IMMA 3BGMA 1RUMH 3LPFA 1I1YB 4HAGA 4UDTA 5AWNL 5HDBE 5I2IB 4LCCC 4KUZH 4UIMB 3Q48A 4UB0L 1S7RB 4AEHL 4D3CH 3CFBA 1MCQA 2VUOA 3NTCL 1SY6A 5C92A 5ID0A 4YDKL 5E1AB 4P57B 3DRQA 2CPCA 3VGHA 1W8NA 1A3RL 1ZS8A 3TJEH 1QFPA 1RMFH 3AVEA 1EVUA 1N0XL 3H0TA 3H9HB 4K3JH 2FGWL 2A6JB 2AK4B 1DFBH 2AK4E 1J0ZA 1QSEE 3K2UL 3MREA 4C56D 5B38A 4O2EB 3GMLA 1NSNL 3BQUA 4OZGF 4F33B 5EUKB 4XNMB 3KS0J 3TT1L 2YSSB 3QDME 5GS2D 3P11L 1K8IB 1XIWD 5INCA 3MRKB 2ARJQ 1XGUB 3VXPB 3LKPB 2OI9C 1M7DB 2CJUL 4JCLA 3U0TA 3V52L 3ARFB 1B0RA 5A2IH 1P1ZA 2VITB 5L8KB 4H5SB 1NUNB 1IQWL 2WINA 1OAQH 3FCTB 3V5KB 1HI6A 5CBAB 4LASH 3BGFB 5C0BA 5B3JE 2AV7B 4Z76B 1ZT7B 2DM3A 3SPVA 2J8HA 1I7ZB 2LFGA 4GOSA 4HPOL 4KQ3H 5EG6C 5F3HA 1HKLL 4AG4L 2DDQH 3GSQB 4NPYA 2ZCHH 4OLXH 2DRUA 5J4MA 5K33A 4HD9A 4Z77B 4U1HB 5DJ8B 5CP3H 2CSPA 5MERA 3CXHK 4Q6IC 1P7QA 3QXUA 1Y0LA 2V5YA 1WCBA 4UQ2A 3MO1B 3ARDC 4MS8D 4RBPH 3NA4A 5GHWH 3ZT7A 3EYUH 4GG8A 2NYYD 3DHJA 5CLTA 3FB7A 4S1QL 1WBXB 3U83A 1ULVA 4OIIH 5J12B 2Z8SA 2NTFA 1T66D 4XAKE 1IKFL 4NO0A 5E8PA 2NW3A 4OD3L 3NCEB 2PYFB 3KLAA 5IMKA 4KFZC 1YDPB 2ESVB 5EBGA 2ESVE 4L4TD 3QQ9D 1K3IA 2VDKH 3HG1D 4PGEB 2RB8A 1UM5L 3F8UB 1YNKL 4MCZB 1VEPA 1GRWA 1DDHB 1KCSL 1C5CH 4PJ9B 3BDBA 2ADJA 3O6LL 2WQRA 5FYJU 1HDMB 1EHNA 1S5IH 1F90L 4M6NH 4YO0B 4J6RL 4KI5C 1S8DA 1T20A 4NBYB 4PV9A 2XWBA 4MDJB 3NIDE 3GBNL 3ZT6A 1CDHA 2FR4A 4RGOL 2OL3A 3NGBB 5EN2B 4JJ5A 4Y4HC 4XNYL 3VMPA 1B2WL 4PJIF 4K94C 1CK0H 1X5JA 3D3VE 3N9GL 5D7SL 4E41B 3FQRB 4E41E 4KHXL 5L88L 3QFDA 4C4KO 4JZJB 4EI5A 1QQDB 1X5AA 4K7PY 1HNFA 4L1HA 3MLRL 5KVFH 4PJXA 2R15A 4G9DB 1A02N 4NHUA 4XP4L 2X42A 4K7PL 4RX4D 4PYGA 3VXRD 1S9YB 2GT9A 5MEND 3O6FD 4LLQB 5MP6L 1SJHA 3OZ9H 4JRXD 3VE0B 1L9NA 2E9IA 4L9LA 1PSKH 2WLZA 5L2KA 1KTKE 3SGDH 2FH6A 1IC7L 1MEXH 2R1WA 3AY4C 1I3RA 3O3BA 1ES0A 3HUJB 4K07A 3VXRB 3HUJE 3FRUA 5J1AB 3O6FB 2R9HC 4JFXA 4WHTA 3FHAA 4I3GA 4MNHB 3PDGA 3NAAH 3QZWG 3QEGL 1X9QA 1JRHL 1DBJL 5KN5A 3TNNA 1A7RH 3I6GB 3SDAC 2FIKA 4X5XB 4B41A 3ESVF 4W4OC 4M48L 1MJ7H 2JB5L 4EBQH 1BBJA 1MFDL 2A0LC 3L9RA 4XMPH 1YN6A 3TVMC 3MLWL 1CDYA 4HT1H 3O41A 2D2OA 1QKZH 2FJHA 4YHYB 4R90L 4XXCA 1AGFA 1JN6A 4JO3H 4OLUL 4ONHB 2BVPA 1U95A 2LAGB 3KHOA 5EZLA 1T7WA 2NY0B 3SDXB 2EIZA 3FT3A 4KHTL 1JGEA 1RSFA 1D3CA 3SDXE 4TUJA 4GMSL 5DZLA 3X11A 4IMLB 4DUWA 3A67L 3O6KH 1FBIH 2FH8A 4Z5RB 3CXDH 1U2CA 4XB7A 4NQDB 5DC4B 2QJDA 4NQDE 1N59A 2E7CA 3QG6A 2YEZA 2HYMA 2XN9D 3QHZH 4QOKD 1PEWA 5EA0L 4UILH 1K8DA 3ALXA 3UTTA 1EMTL 2R0ZH 2XKNA 4MAYC 1LD9B 4OZ4B 3MV9A 4YGVB 4MWFA 4A6YH 4C57C 1WZKA 4PJGF 4XPGL 4OCMC 2DYPD 2QSCL 5D70H 4QOKB 3QCVL 4U4BA 3VRJB 4YR6B 4BSVB 2DIAA 2HJLB 4XH2B 1FNLA 3ZDZF 3OJ2C 2HRLA 1NCWH 1ZSDA 3MNVA 5J11B 2NZ9D 1JGVL 4X4MA 1G7JB 1CLCA 2DYPB 3K1KC 1YEKL 3G5YB 3C60A 3C6LC 4N90D 3QDGD 4PLKD 1HINL 3MRCB 2D7OA 5I8OL 4JY6B 3UPCA 2VQ1B 2QBWA 4IDJL 4MA1C 4EUPA 1XGPB 2G75B 3QDGB 1GPOL 1I1FA 5ISZB 5EOTB 5ISZE 4NSKA 1S5HB 1M05A 5I19H 4RZCB 1WQVT 3QUML 3QULA 4U1IA 5KVMC 4JE4B 3MRPB 3SDYL 3ARUA 1BIHA 3DPBA 1HHIA 3IJHA 4JFOA 2BFVH 5I1CH 3IRZA 5IIEB 4K3HA 3SDDB 1Q1JL 1VB9A 3OGCB 2P48B 4U31A 5D2NA 4HIXH 1WK0A 1YNLL 1CG9B 4WTZG 4JKWA 2WV3A 1G6RB 4I1NB 3LS4H 1A6UL 3WS6A 1HXMA 2EH7L 3DV4A 3ESUF 4PRHE 3EYVB 3WS3B 1INDH 1XF1A 3OB8A 1LE5A 3BJ91 3VFTA 4AIZA 5I76A 3ULSA 5DMKA 1FNGB 4UUJB 3CFJA 1YEDA 2LVEA 1A6TB 3BAEH 5GGSY 4CL7A 2XZAL 3DIFA 4NDMA 4OZGA 5IK3A 2X1PA 5TE4L 5E8OA 4G7YH 5C0IB 1BQLH 2VERN 1T1YA 1CFQA 4OTXL 4LCIH 2HT3D 1MFEH 2VXVL 1LO2H 1A1MB 1KPRB 1GIGL 1DVFD 3GHBH 1YC8A 3N85H 1EIBA 3P4NB 3R8QA 2FD6L 3E3QE 4R4ND 1RHFA 2NZ9C 4WCYL 3ROOB 1RUQH 1U92B 2DJSA 2N7BA 2RR3A 5I30H 1T1WB 5DEZA 3HMXL 5JW3L 1DVFB 2AJ3B 2DWDA 2MPAL 4HK0A 1EFXD 3RKDC 4UBDD 2BVTA 5IBTL 2F5AL 2XNAA 4WW2A 2AABL 4HZAA 3RVVD 5K9OB 4JQXC 4QTIH 3JV6B 2APFA 3TBYB 4OGYL 3VG9B 3VFGL 1YMHA 1AR1C 3P0VH 4FXGB 2NY3C 2KDGA 3HNTL 3WXWH 4HIJA 3TYFB 1HILB 4WI6A 3VFOB 2BSED 4KY1L 1XGTA 4RFEB 4LAQL 3VWKD 1J11A 3WHXB 3EOAB 1KEMH 5AYUH 5EO9A 1UM6L 5F3BB 3JV4B 1HWGB 3RWHA 3QJHA 5L2JB 4NIKB 3RU8L 5D2LE 2YPKB 3VWKB 1KYOJ 3PP4L 3LKNA 1VGKA 4R0LB 4M6AA 3B9KA 3G5ZB 3RIFF 4M1CD 4FFYH 4IS6B 3B9AA 5C0DA 1DUYB 3CLEH 4NZDA 4BH8B 5ADPL 2IC2A 3H3BC 3PWPA 5IP4A 2Z92B 3PWJB 1FIGL 1EAPA 3B4NA 2VDLL 5FA4A 5JXAL 3P9MB 3PWVA 1E6OH 3O0RH 3FTGB 1XGYH 5EPMB 4YXLH 5BS0E 5DD5H 3LKRA 3I85A 3GK8H 2DQIH 1XF2B 5ABDE 4H26A 1RHHB 1E27B 2FHFA 2Q76B 5E95B 2HTKC 4AMKH 5HVWA 1M1SA 3VFVB 1S7QA 4XNZC 1W72A 1T5WB 3QCUH 3N0PB 2HT3C 5IKCB 3UP1A 1OAXL 2ADGB 1TJHH 1T1ZA 5C07B 3WLWC 5C07E 3KXFA 4ORGA 1VKXA 2WUCL 1TPXC 3N1PC 5B3NA 3MACH 3FT4A 1T4KB 4PTUA 4N5UA 1RULL 4G8IB 1F8TL 2X1QA 2I9TA 4RA3A 1X5GA 5ICXB 4UOJA 3TO4A 1KCVL 4JHAL 4D94A 3MYJB 3NIFE 4NP4H 4BZ2H 3ULUL 1H8NA 4X7CC 5D1QD 1AD0A 4XZUB 1MAMH 3GHEL 35C8H 5L8JB 3MGOA 4NFCA 2V9QA 4XC3L 3T1FB 2B5IB 5JOFB 3FB8A 1YEHH 1KCRH 4QXWA 1BAFH 2V7HA 3WIFA 2LAAA 1L7TL 2R1XA 4UT7H 5EORH 3OAUH 3UPRA 3NZHL 2Y25A 3M17A 1UH2A 4XC1L 3HZYB 4X4YB 4LF3B 4LFHD 4GKSB 5GSRB 3QRFM 3MZGB 1IAII 1U8QB 1N4XL 4Y16A 3U4EA 2DI7A 3W9EA 4AIOA 1H5BB 4FZ8H 2AKRA 3GEWB 3U30C 4BSWA 4YZFF 1BP3B 4MNQD 4OAWA 5SWQA 3JVGA 3MFGB 4U1JB 3BZ4B 5JW5B 3GSRA 4HUWA 5KJRL 5EU6A 1N26A 4KU1A 3VXMA 2ERJC 1LO4L 1LQSR 4YHNB 3QFJD 3EGSB 1UWXH 4O9HL 1JNLL 5J9PA 5GZNC 1AO7D 3ZE0F 1BD2A 3CMOL 4XP9H 3SCMB 1PVHA 1T0PB 2FEEI 3O3AB 3VXQA 5C0EB 2XXCB 3LKSB 4JGUA 4PY8I 2VXSH 3TYGH 3REWB 5F7WC 3MFFB 3EHBD 4TRPH 5KS9F 4B50A 5EOCH 1FZKA 3QI9A 3CVIH 1JJUA 4G80B 1IE5A 2VZOA 4ONFL 4WV1C 3CU1A 1V3MA 3CGTA 2H8PB 4YFEA 2PF6A 3BSZL 5L9DH 4MSWB 2PYEA 5HHOD 5CP3A 3FO9A 3BDXA 1FE8H 1BIIA 2V2XB 4PGDB 3MRMA 1UZ6F 1OSPL 4HGWB 5D1QC 2YD4A 1Q9LB 2VR9A 3MRGA 1KGCD 2IADB 4P5MB 2W0PA 4PJEA 1NCDH 4NHCL 4QNPF 2GFBA 2A73A 4ORZC 4GRMB 1YN7B 5D1XB 5TE6H 3WHE0 4L5FH 3KPTA 4ZG1A 1JK8A 4EN3D 3MLVL 1I9JL 2B2XL 4HFUH 4HUVB 4OB5H 2DQEH 1QZ1A 4Y5XB 5J56B 1BF2A 2AJVL 2G5RA 2I25N 2IALA 3BP4A 4R7DA 3VXSB 1A0QH 1NC2D 4WO4B 3QPQD 3VXSE 3I75B 4UQ3B 1U42A 2VDML 5F88B 4JB9H 3MRQA 4CGTA 2IPTL 2HFEA 1JPFB 4HGKC 3SJVD 1F4WH 4L8DB 2W9LA 2N1KA 4L3ED 4GAJL 1T7ZA 3C60C 5D1ZC 1QD0A 3RNQB 2PETA 4DN4L 2UVEA 8CGTA 2ZPKH 3KS0H 3HC4H 1II4E 4BSJA 5I16B 1WZLA 4GG6B 1BM3L 4GG6E 3DBXB 3OKYA 4N68A 4JM4H 2CUHA 3VFSB 1RVFH 1LK2A 5CSZA 4PG9B 2Y06H 4UV7H 1IC5H 3DSFL 1V3LA 4HKXB 4F7CA 2YA1A 4POYA 5IB5B 1IM9A 1WBYB 4POZD 5KOVC 1U8HB 2BNRD 1YZZA 2BDNL 2EDNA 2VZUA 3TA3A 5MEQA 5CGYD 1YEJH 5HYSG 2R2HA 4JANA 1NMCB 3QEUA 4TVSa 2CRIA 4ZODA 1DBBL 1I1AA 2NY2C 4ZPVB 3QHFL 3SE8L 1IGYA 1FO0L 1TQBC 2BNRB 1TTUA 2JK5B 5CUSH 1CFTA 3HI5H 2DM7A 2J5LB 4HIHB 4X6CB 2CQVA 1JHLH 4K71B 1CE6A 1KEGL 2ENYA 3LEYH 1I8LC 2X44D 3WS6C 2I9LB 3WJJC 3NFNB 4HLZH 4WENB 4Z7NF 3CC5A 5D7LA 3WNOA 1IT9H 4DFHA 4DOHB 1NANH 3TWCL 4DOHE 4YDVB 1V7MH 4R7NB 5C7XL 2IGFL 3VH8A 1JWMB 3MGTB 3BKMH 2I07B 4I4WA 4TNWK 3GUTA 2AVGA 5F93C 2EO9A 1NUDA 4JFFD 1E28B 5EC1B 2X1XR 1T83C 3O3DB 3WKMH 1REIA 3UBXB 4PTTB 3B83A 4PJFB 3T2NL 3RY4A 4PJFE 3FONB 3L3JB 4F7EB 3CFCL 5ADOL 3UO1L 5ESVB 4OCWH 5A2KH 3SKNA 3L5WB 5DK0A 3EYSH 4JKMA 2DJUA 5TFSL 4HXAH 2DQDH 1DBML 5EUOE 5E08H 5BRZD 3GMQA 2Y5EA 4LVOC 5HHNA 1F42A 4WW2C 3SKJL 1KTDA 3F7VA 4HMDA 5DQJB 3RQ3A 2F53D 4OF0A 5ENWA 1D6EA 3OKLB 3WNMA 2ICEA 3QRGH 4P9HH 1CGVA 1NGXA 3OMZA 5BRZB 2OXHA 4NQSA 1MPAL 3JSSA 3TH4T 1ADQH 4NO2A 3LQAH 2X4NA 1QR1A 3SE4A 4IRJB 3KG5A 1EJOL 4PJBF 1GXEA 1J5OL 4RDQF 3KPMB 5ESQB 3WIIH 2ORBH 3S34H 2EDDA 4QHNB 4RMUA 2Y5TA 4CDHA 1EERB 5CGYC 2HKFL 2Z35B 1I1YA 3IRPX 5HDQL 1VGEL 4P46B 5I2IA 5C2UB 2QHLA 5IROA 4UIMA 3OKDB 4MA3B 1KN4H 4ODHL 2VLMD 1S7RA 4C58B 3B9KC 1Y6NR 3MUJA 5E1AA 4AZ8A 4P57A 4M7LH 3C2SA 3V7MA 1ZT4B 1W0YT 5CJXC 1JZ8A 4GAGH 2ZKHH 3H9HA 1DQQB 5HVFB 3ARGB 5DD3L 2A6JA 5L6YL 2AK4A 5EBMB 1UH4A 5DUML 1Z9OA 4Z7VB 2WWMD 4LSQL 1NL0L 4Z7VE 1NMAH 3U4BH 3S37L 4HV8B 1XFPA 4CMHC 5I17B 4F33A 4XNMA 1SEQH 1GVIA 2YSSA 4OCRH 1T21B 1K8IA 4LRNL 3QSKB 3O45B 1Q0YL 3K46A 2EEDA 3JTSB 3RWCB 1OOAA 1XGUA 5GISL 2AJXH 3LKPA 4YXHH 3BWAB 1ZT1B 3C8HA 2DTML 3OKNB 4U1GC 2O5XH 1TZGL 1JF5A 2VITA 1BVKB 3P0YH 4H5SA 5AZEH 4F3FB 1XIWA 2FATH 4FQ2H 3FCTA 3V5KA 5FO9B 4JN1L 5IGXL 1QRND 5F1SA 4NUGL 1OGTA 5GJSH 2AV7A 1HK6A 4Z76A 1ZT7A 1FSKC 4LL9A 4M8QB 1INQB 3OSKA 1SVZA 1KFAH 4YE4L 1ACZA 1I7ZA 3GSQA 1UG9A 5I1EH 2HAZA 4JVPA 4G5ZH 4U1HA 5DJ8A 1OTUC 3BN3B 5GGRB 1RU9L 3QWQB 5MHSE 1N64L 4P9MH 2DQGL 2OXGA 2YPVH 3OR7A 1QSFB 2FZ3B 3C8KB 2DQJL 1QSFE 4HC1L 4B53A 4QRPD 1WBXA 5EIIA 4XPFL 6FABL 4AEIL 1PLGH 3U9PL 1ZLUH 3PDOA 1DQDL 1DBAH 1FVCB 2XTLA 4M1DH 2ADFL 2VTFA 2LU7A 4LQFH 2PYFA 3MOQA 2FCBA 3GIZH 3ZTNL 1PBYA 3T1WA 2IPUG 2ESVA 2ITCB 4QRPB 3KPNB 5H94A 5DVNA 1U9KA 4X83A 3DX9B 1H3UA 5EOQH 1B9ZA 4XCCL 4PGEA 5HI4C 4MCZA 3G6DH 3KNBB 1MCOL 4LSVL 1DDHA 1JWSB 4PJ9A 3HG1A 3VU2A 1HDMA 4YO0A 1FH5H 1BVLB 3ZYIA 2QSTA 3QDHA 4PJCF 2VZVA 4FTVD 4ODUB 1WEJL 3GKZA 1UYWH 3CMGA 4NWTL 4OQ1A 1MFAH 5E2UH 3WXVL 4MDJA 1F4HA 4F7MB 3O6ML 3WEXB 5EN2A 4JPIB 4S10A 1IAMA 1D5MA 3BKYL 2HKHH 4F58L 2EXWD 4FTVB 2IG2H 4FFVC 4E41A 3EKCA 5EO0B 1V7NH 3FQRA 4XBGB 3UZVB 1J0HA 4NQVB 1VA9A 5GJTL 5KZCB 3IVKB 1QQDA 4XP6L 2FGZA 2GJ6D 5I6XB 1ZA3B 5FYKE 4G9DA 4HUNB 1U8JB 1A1OB 5EH1A 1MJJB 4JVUA 2VO5A 1S9YA 4O51B 4LLQA 4RFOL 2YUVA 4NKDB 4YK4B 1Z6JT 4QO1A 1DBKH 1Q9KB 3VE0A 4MZ2A 5CCKH 4NCC1 2R0LH 4YHLH 2CGRL 2WSKA 1RIVH 3HUJA 5SX4H 3VXRA 2FEEL 4OIAA 3TBSB 5J1AA 1MNUH 5MENA 3O6FA 3FRPA 1N0LA 3MJ9L 4OT1H 3AGVA 3FO0H 4L8BB 4MNHA 1AP2B 3CAFA 4RQQB 3UC0H 4RMTA 4KJPD 3IDMB 5CINH 2LQRA 3I6GA 3S3PA 5DF0A 2VDOH 4X5XA 1A7QL 4OM1L 3SDCB 1JFQL 1R5IB 3TN0C 3U0PB 4K2UL 5T5NG 2CMRH 1PY4A 4HPYH 4QGYA 3ARZA 5EBLB 1NGPH 4U05A 1KV3A 4HDIB 2J7LA 3D25B 5FXCH 4Z95L 1HEZB 4KXZH 3HB3D 1T5XB 1RJLB 4CU8A 2YMXH 5A43C 2NY6D 1ZHBB 2J2ZA 4PB9L 5FKPB 1F11B 4ONHA 4P4KB 1ZTXL 3SDXA 5IM7B 3KJ6L 4MAUH 1NGWB 4MVBD 5DD6B 5EB9A 3WL9B 3MJ6A 5HXMA 3SGJA 1KIPB 3IB4A 1TVBB 4IMLA 4Z5RA 3SKMB 1UEYA 5IF0B 4KMTL 4NQDA 1P7HL 2ICWI 3V6OE 3FQXA 3KDMB 2OYPA 2O26U 4WU7B 3HAEB 5HGAA 2Z8RA 3ZYOA 4MA7L 3U7YH 4QRSB 4NOBA 5HHXL 4JG0H 1LD9A 4FG6D 4OZ4A 5FHBH 4YGVA 3LD8C 2HMIC 3LSOB 1Z9MA 3FFDB 4QOKA 3VRJA 4N8CH 4YR6A 1RUAL 2P49B 4XH2A 2HJLA 4BSVA 4Y5VB 3S35H 2WIMA 4S1DD 5A3IC 1NAMA 1CLOH 2X1WL 5I1KL 4I0PD 2ZP0T 3DURB 1G7JA 2DYPA 4DUXA 4NN7B 3G5YA 3E8UH 4G9FD 5C0CD 2EKJA 1EHLH 3SGEI 3MRCA 5HGBB 4JY6A 1JTTA 2IJ0C 2XKSA 3M45A 1ZGLB 5IBLC 5I15H 1BGXL 2VQ1A 5BMFH 2A83A 3B3IB 4Z9KB 4TNVK 3QDMD 3D39D 1HH9B 1XGPA 2DBLL 2G75A 4LSPL 3QDGA 1I3VA 5B38G 5EOTA 1DSFH 4Q9RL 1S5HA 4FP8H 4KRPC 4RZCA 3D39B 3PL6D 4TUOA 1N6QL 4LHJB 1RUPL 4PP2B 3QIUC 2X9WA 4Z7QE 5CFHA 1OF2B 2W60B 3ZE2F 4OI9A 5IIEA 5I74C 2BY2A 1MCIA 4GG6F 4Z6AT 3OGCA 2AJSL 2CIKB 3ULVE 3SBWC 4PGZA 4RAVB 3LDBB 1CG9A 1IGTB 3Q2CA 5CS7A 4FQ1L 1G6RA 1J0IA 5D7KD 1FGNH 2MCPL 1Z3GL 1J05A 3CH1B 5MEPB 3EYVA 4K9EL 3WS3A 4OZHE 1IC4H 1FNGA 2P8MB 1RZJH 2P5WB 3QXWA 4UUJA 4WY7L 5IVZB 3W5MA 2P5WE 3MUGA 3INUH 4HS6B 4CKVX 1JYVA 1EA9C 3A6CH 1LO5B 2IAMD 4LSRL 1A6TA 2F19H 4DGVH 1FNSL 1UXSB 1JZ2A 4QCIB 3ZKMC 3PUCA 1XF3B 5FIEA 3V4PL 4YDLB 4WUKH 4M4RA 2HTLC 5D7JD 1A1MA 2AEPL 3A0OA 4F57H 4CMMB 5IVXB 5IVXE 2IAMB 3BKJH 2Q6WA 1DR9A 4X6CF 3RPIA 2PXYD 2WZPD 1UH3A 4B7LA 4XVUC 4EDWH 3P4NA 3ROOA 5DMJB 1MCPL 2QTEA 3W5NA 1U92A 4JPWL 1UACL 1ZKAA 4QXGH 1T1WA 3X3FL 3QYCA 1DVFA 2AJ3A 1GOFA 1RZKL 2HN7B 3H9SD 2CDGB 2YUXA 2PXYB 4GXVL 5JOPE 2D7QA 2ITDB 4KDTA 4WGVB 5K9OA 5EWIL 5EFIB 1B4RA 3BH9B 1T89A 5CD5D 3P40A 3I50H 4KJQD 1BZ7A 4FXGA 4KQ4L 3D3VD 3BGAA 2J8UB 4U3XA 2J8UE 3TYFA 1HILA 3HE7D 3VFOA 1TETL 5HYEA 4RFEA 4NT6A 1FJ1B 2VSCA 3ILPB 4ZO8A 3ARFC 2DKMA 2GSIB 3WHXA 1A21A 3TF7C 5GRUH 2NW2A 3EOAA 3ZDYE 5A2JH 3BDYH 2EC9T 5F3BA 3JV4A 3C5ZD 5GGTL 2YD8A 5L2JA 3BGFC 4J4PC 1R0AL 2YPKA 3VWKA 4FABH 4R0LA 1AGEB 1KXQE 5GZOD 3G5ZA 4IS6A 1AHWC 3NIGE 1DUYA 5FYKH 2GAZB 5IQ7L 4MMXC 4BH8A 2C4FU 3CCHB 3F7YB 4OZFB 4PJ5D 2Z92A 4NZUH 1BJ8A 4K23L 3PWJA 5KSAB 3IU4H 3P9MA 3MV7B 3ZTJH 1X5IA 3MV7E 3ZYJA 4ZXBD 4P2QD 1SVCP 5EPMA 3CDYA 1E4KC 4X7SL 3I9GL 3MLZH 2IPKB 5J12C 2P5ED 4QHKI 4X6BB 3ZYZA 3EZJB 5IT2L 3QUYD 1RHHA 1E27A 4WUUB 2ENSA 4WUUE 5SWZB 3D87B 5SWZE 4ZXBB 3VFVA 4OQTH 5AG9A 1N5YL 3I2CL 1I7RB 1NLBL 1T5WA 2GK2A 1MJ8L 2P46B 1A5FH 5IKCA 5D7JC 2ADGA 3L3OB 5C07A 3O2WH 2WBJB 5DT1H 1D7FA 2ZUQB 5IFJB 3QISA 1I9RH 5KSVB 1JHKH 1KJ2B 1TDQA 5DQDL 4KAQL 4G8IA 5I1IL 2GJZB 3FAXA 5ICXA 4RGMC 3MYJA 1UKTA 1Y6MR 3LRSB 1YEGL 3QWRA 4K8RL 1ADQA 4XZUA 3CVHL 4O00A 4JG1L 4L4VD 4TSAL 3WIHH 2EEBA 1YECH 2MWCA 3T1FA 5JOFA 4DAGH 1J9CT 3LH2L 5J3HC 1MCLA 4MJ4A 1UM4H 1WSST 3BEWB 2D31A 3MCKB 2DWEB 3D2UD 1MCWM 2QQLH 1MHPL 3NGBC 4KKAC 3FB5B 3G6JB 3G6JE 3EZ8A 4OJFH 3S36H 3S4SB 5IJKC 2H2PC 3HZYA 2D7TL 2FX9H 4X4YA 1CE1L 3HE7C 4LF3A 3L5IA 3OGOE 3MCLH 4JFDE 5LXGL 4GKSA 5I8EB 4JZJC 1FRGL 3HAEH 5GSRA 1U8QA 5B21A 1H5BA 3UYRL 4HZLB 4Y8AA 1T2QL 2FEDC 3KLSA 3MOAL 3B5GA 4EVNB 4U1JA 4WDIB 2LV4A 3BZ4A 5GZOC 1F4AA 2VL4A 3QIWB 3BKCH 3IFPB 5FV2A 4YHNA 2D03H 3EGSA 1OW0C 5E5RB 2R4SL 3QBTB 4IIQB 3MUZ1 2VE6B 1GOHA 3UTZB 5IHUL 1ETZB 3O3AA 5C0EA 1Q94B 3SKOB 3V0WH 2HA1A 4PBVC 4R4BB 2JJVA 3RDTD 1BX2B 4DW2L 4NQED 3LKSA 5HGDB 3UJTL 3QFJA 4Y7MA 5D71L 3REWA 3MFFA 5DZNA 3N1FC 4DZBB 4N0YL 4M7JL 3RY6A 1A9EB 3BMVA 3FO1A 2AJUH 4XWGH 1HYSD 1PAMA 3FZUC 5JW4R 4G80A 4JFHE 3U48A 4GSDL 2O5YL 5LKNA 4NGHH 3KVQA 3D0VA 1BBDL 5FUOH 4OD1L 3VRIB 1FL5B 1VERA 3GMRB 4MSWA 4LSDA 5KTEL 1UT9A 1P2CB 3TV3L 4YBLB 2NY0C 2XKUA 1OAKH 1R3LA 2V2XA 4OUUB 4PGDA 4HGWA 5KANI 1Q9LA 2IADA 4P5MA 3GI9L 1L9MA 1WTGT 4RCAA 4GRMA 1YN7A 5HHOA 1L6XA 2B1AH 2WUBH 3ULVH 1I4FB 1TVDA 1XR9B 1IRAY 5J89A 4MZ3A 1E4XI 1IZJA 1U3JA 5JPNB 2J1KA 4TPRL 2DI9A 3P73B 4N8VB 4M9OA 2R56L 4TSCL 5K59F 1E6JH 4OGZA 4LMQI 4EN3A 4HFWB 4UB0H 3DUSB 4G8FA 2BRQA 4ZSOE 5C0JB 1FYTD 1C5BL 5EU3B 3VXSA 1KNOB 1GJIA 3I75A 4UQ3A 2ZG1A 2GTWB 1QFWL 1MFNA 3O4LB 43C9B 1JPFA 5EU7E 3O4LE 4ODVL 4L8DA 1SM3L 4KV5E 2FGWH 4UAOC 2H32B 1HE7A 1IVLA 1XT5A 4MXWL 2GKIA 1GL4B 1TENA 4NNYB 3RNQA 3DMMB 3ZSTA 4NOFA 5I16A 4GG6A 4XPHH 4ENED 3CPLB 1YQ2A 4ELKA 5DUPL 1BFVL 1P5UA 2R23B 3DBXA 4TNVF 4CVWA 5CEZD 3WO4B 4WI3A 2XA3A 3DRTB 4XBEL 2EEAA 1GGCL 2Q7YB 5ALCH 1G7MB 3VFSA 4BQ8A 1X5XA 4PG9A 5FYJL 4FQXD 2ZUTA 1Q0XL 3X3GH 3GMPA 1E4WH 3MXWL 4HKXA 3O3EB 4KK6D 3PWNB 3DYPA 3V4UL 3TFKD 4RWHA 1WBYA 1LEIB 2D0HA 2QQQA 1IQWH 1U8HA 4FQXB 5TGBB 3VWJD 4HBCH 1M6OB 1SBBA 1MELA 2VN4A 1F2QA 2E7HA 2PO6D 4ZPVA 3SDDC 1WC7B 5HI3C 4EZMA 4ACPA 4N1CA 1OAYL 5DJAB 4AG4H 3DUHA 2BNRA 3K4DA 4OCSL 1KB9J 1SBSL 1IGMH 4HIHA 4X6CA 5FYLL 5GPRA 3CLFL 2I9LA 4ZTPH 4KJYB 3NFNA 5HHVL 1K9TA 4FMKA 5ERWA 3ABZA 2P24B 3IT8D 3P4LA 4YDVA 4WEBH 4MCYB 4R7NA 1CIDA 4KJWC 1KULA 5T3ZL 1JWMA 3UTPD 1S7VB 3MGTA 4PJHB 2I07A 2RJMA 4OZFH 4KGLA 5C0RH 4HS8L 4M5ZH 1E28A 2QHRH 4G6JL 4R4FL 5EC1A 4U7MA 2Z31B 3BVNB 3O3DA 2VDNH 1AE6H 3TC9A 3UBXA 2VDQH 3X14B 1CD9B 4PTTA 4PJFA 1F4XL 1MRFH 3FONA 3L3JA 4GW1B 4F7EA 3NABL 5ESAB 4JJHA 5ESVA 1Z9LA 4AM0B 3VMNA 3IS1X 1OD9A 4KRNA 2RHEA 1AIFB 1TTFA 4KDVA 4KKCD 1GAFL 2IEPA 5B22A 2VR5A 3RTQD 5IW6A 1KJ2H 2EDEA 2JELH 3MMEA 5DQJA 3DO3A 5EIVA 3S35X 5BOPA 3W0WD 2XRAL 1CDUA 5I1GH 3HE6B 4OF6A 3V6FB 5I18H 5BRZA 4XGZB 4RSVA 3VG9C 4NC1E 3CZJA 3ARPA 1U8LB 3K8MA 3OKKB 4CVZB 3N9GH 3MRBB 1FGVH 5L88H 4IRJA 3QWOB 3NPSB 1PG7W 4ODWB 1XZ0B 2F53A 4GKNB 4PBXA 2AJYL 1OM3H 3TFKC 3ECBB 2WP3O 3KPMA 5ESQA 2VLJD 5FOBB 4QHNA 3BZEA 2APVA 1V5JA 3HNSH 2Z35A 1CD1B 2XTJD 3ZHDA 1KJ3L 5DLML 3U46B 2L7UA 3OKDA 5SX5K 2CUIA 3MJ7B 1NCAL 1FZMB 2EDFA 1ZVSB 2LU3A 3QG7L 1IC7H 5CJBA 3NCJH 3GB7B 4WI7A 3ZKSD 3RWJB 5CZXD 2R2EB 3C09B 2NX5D 3S7GA 1ZT4A 2DI8A 4APQD 4KVNH 1IFHH 5A16A 1DQQA 3ARGA 3UTOA 3FKUS 5EBMA 1ZE3C 3ULUD 4Z7VA 4M62L 4NKIL 4HV8A 5I17A 5F97E 3VFUB 2D7MA 2E6PA 4LCWB 4Y1AB 1JV5B 3QO1B 1T21A 4LCWE 4Y1AE 1OAUL 3MLWH 1LDPH 3T0EB 4OFKA 3JTSA 5C9KA 3RWCA 3T0EE 2RIKA 1JPGB 4KKBD 3BWAA 2BNQD 3OKNA 2KZWA 1CLZH 1DL7H 4G3YL 4WEMB 5CIPH 3MODL 9CGTA 3S8WA 1DTUA 4K94L 4HEPG 4F3FA 4XVSL 3MRNB 5FO9A 2CLZB 4EOWL 1BZ9B 3ARED 1BEYH 4M8QA 3LQAC 4OKDA 5TH2B 1INQA 1CICD 4NZRH 4KKCC 3RTQC 1MIML 3EO1B 2B5IC 2KQNA 2XQBL 5C6WH 4Y89A 1MFCL 3VFRB 4XNUH 5GGRA 2AV1B 4GW5B 1QSFA 2J8UF 2FZ3A 3C8KA 5BV7H 4BFGA 4Z7OE 2NCMA 2ILLA 4O58L 1KB5A 4JO4H 2QSCH 5KVDL 2DM2A 4MXQD 3KPSB 3KPSE 1A6AB 1FVCA 2DS4A 5MEOA 3S5LB 2O93L 1SQ2N 2ZOKB 5FCUL 3MA7B 4D9QD 2ITCA 4QRPA 3KPNA 2XTJC 2DQCH 4BFBD 3DX9A 1CQKA 4Y2DD 1C16B 4H25B 2NXYB 3O2VH 5I8OH 2V2TB 1QBMH 3KNBA 2XACC 4HWBL 4E5XB 1JWSA 3PDDA 3P30L 4XPBL 1NBYB 4ODSL 2G9HB 4W6XB 1MRDH 2WWKO 2XQYG 3LZFH 3VCLB 2H9GB 1BVLA 4I0KA 3SCMC 2H32H 3W2DL 3RBSA 4ODUA 5GRWA 2EC8A 4KPHH 1R6VA 1O7VA 1U8OB 4JFPA 4F7MA 3K3QA 1C7TA 1A14H 4NQXA 3RY6C 4JPIA 3N1MC 3V5DB 1YEIH 4FTVA 2ICES 3KPOA 4XCFH 1IM3B 1RZIB 4F8QA 5EO0A 4XBGA 2OP4L 4HUKB 4EDXB 4NQVA 5FCSH 3IVKA 4FS0A 3O8XD 4P59L 3WFDH 1YNLH 3BMWA 1ZA3A 2DLFL 5E0QA 3HC3L 1EZVY 2PUQT 1MREL 4W6YB 1MJJA 4CVUA 1AGDB 1N8ZB 2EH7H 1DN2A 4O51A 1PY9A 1GOGA 5LQBL 2VWEE 1GGYA 2X09A 4NKDA 3O8XB 1CICC 1A64A 1ZLSH 1Q9KA 4S0TD 4ZTOL 5D1XC 1WZ1L 4JO1H 2ED7A 4KMLB 3C08L 1WT5A 4KUCD 3G6JF 1ED3B 4UNUA 1YEEH 3U7WL 5AZ2H 3UMTA 3VG0L 3VDCA 1FYHB 1UJ3B 4M00A 4MHHG 5GRZA 4UOW1 3DXAD 4OQTA 4L8BA 4Y5XC 1INEL 1AP2A 1JPSL 1ZLUK 1FORL 3ORJA 4RQQA 2VXVH 3L3DB 4PY8J 3WUWB 2XPGB 1MCCA 4NNXB 4YEEA 1NFDB 4HIEB 1NFDE 3SDCA 3DGCR 4XAWL 1R5IA 4U1SB 3U0PA 2UUDH 3BE1L 3JV0A 4WO4C 4YGAB 1RK0B 2V17L 3CX2A 5SWSD 2FD6H 5EBLA 3DVFA 2Y7QB 43CAB 3Q6FB 1W0WB 4WCYH 1G0XA 4HDIA 1CXIA 3D25A 4XNQB 3U2SB 3S36X 1HEZA 1GZPB 1FC2D 1T5XA 1EK3A 2MPAH 1RJLA 4MQ7B 2DLEA 4ZQKB 5F9AC 1ZHBA 4OCXL 5FKPA 1F11A 4P4KA 2F5AH 5I66B 5IM7A 4UT9L 3ME0A 4XX1E 1NGWA 2E3VA 4PRIB 1KIUA 1P5VA 5DD6A 4PRIE 1JGLH 3MRRA 2DQTH 3GBMH 4DJMA 1VESA 1EH9A 4PB0L 1KIPA 4UTAL 1TVBA 3MGAA 3RA7H 3BHBB 5CGTA 1A2YB 3SKMA 1RIUH 3NCCB 5IF0A 4M7KH 3A6OA 4FXKB 1E4XL 1NBVL 3KDMA 4HXBL 4X7FC 3FT2B 1V3KA 4WU7A 3HAEA 2WBWB 3GNML 1CL7H 4IRSB 3VRLE 2XICA 5JPMB 1JYNA 4QRSA 1KLGB 4M1GL 5DC0A 1LE9B 4NO3B 1NFIA 2VXUL 3RU8H 3O2DL 4U49A 3RGVB 3LSOA 4JY5L 1EEZB 3FFDA 3THMH 4P99A 3KLHC 4I3RH 4Y5VA 2PW2B 2C1PB 1Y18B 2J5LC 4PGBA 1NDMB 5B4MC 5IMMB 3RVWD 5LGHL 4K71C 3DURA 4JHBA 1UZ8B 1FIGH 5E8DL 3S97C 4P2OB 1SY6L 3QUZB 4X9GA 3I84A 4PUBL 4G6AC 2Q8AL 1U6AL 2X4PB 5HGBA 2OMBA 5GS0H 4P3WA 1ZGLA 1J8HD 3OAYH 5IBUB 4MJIB 3B3IA 3RHWK 3ARSA 4MJIE 1ZK9A 4HS3B 3RZWA 1HH9A 4YQXH 4HH8A 4MD0B 4D9RE 1WICA 1H9VA 5EU4A 4EXKA 3MLSH 3T2PA 3IDXH 2D3VA 4R2GD 4EJ1C 1MLCB 5DMIL 3D39A 5BVPL 4PP2A 1L0YA 4JHAH 3D48R 3FFCD 4F7PB 3TBTB 4N9OB 1D9KB 1OF2A 2W60A 4OF7A 2D4DA 1C1EH 1KCUH 4JM2B 4NFBA 2OZ4H 2CIKA 1ZANL 3UROR 3L7FB 1K2DB 4PRDB 5DJCB 4RAVA 3ILQC 4JEGB 1NGQL 1IGTA 1N6UA 5MEPA 3CFBB 2W0KA 3OPZL 2CDEB 4URTB 2P8MA 3RZCB 2OK0L 5IVZA 3BZFB 4IRJC 4AIXA 1FLRH 3JWOH 3LQMA 3LKQB 4X6EB 1BREA 1LO5A 3H0TB 5DRNB 2XYCA 1UXSA 2YN5A 4QCIA 5C0ND 3IYLW 1XF3A 4OZIF 3MREB 1ZGLP 3UDWC 2HG5B 1LVEA 2VDRL 5FECB 3PGCB 1CD0A 3LEVL 4HCRH 4P46C 2MQ3A 4CMMA 4MA8L 5KJRH 4KK5D 2IAMA 2OJZL 1QA9B 4Z0BL 4AEFA 1FIEA 2HH0L 1CGSH 1P6FA 1G1CA 3HRZA 1KELH 3CX5K 1ODAA 3RVWC 4KTEL 5JHLL 3ARXA 5KSBF 2EH8H 4LLAA 1QUNA 3D18B 4MQXD 3LMJH 3ARGC 1JP5A 3VI3E 2UY6A 2PXYA 3QR2A 5HPMA 4TUKH 3VI4E 3GFUA 4PJHF 4LRIA 2ITDA 1JI1A 5EFIA 5C0BB 1JZ5A 3S88H 5BZDB 5C0BE 5E24E 3BH9A 1SJVA 4FQQB 2UWEF 4GBXD 4ZO9A 3FOMA 1PZ5A 4DTGL 2EKSB 4HKBA 1CGYA 2VXQH 2J8UA 4JFYB 2WAHA 1ACYH 3BSZH 1N2RA 4OSUH 1FJ1A 2P7TB 4HQQH 2GSIA 4MDIB 5F1IB 1N7ML 3OB0H 2BVEA 2V5SA 1O7SA 4DQOH 5C0GA 4QEGA 2R0WL 2AEQL 4ESKA 1AR2A 2NTFB 5A40E 3NACL 4DGYL 2DQHH 3PWLB 1RZJC 5F7MC 1AGEA 3KLAB 1TJIH 2MCG1 5IMKB 1CVRA 1U3HB 1GGIL 2B2XH 2GAZA 4WFHD 3CCHA 3F7YA 4OZFA 2KUTA 4ALAL 1F4YL 3Q5OA 1H3PL 2AJVH 3TCXA 5HHMB 5KSAA 2UV3A 1FFNB 1HHHB 5DI8B 5HHME 3MV7A 4FXLA 2ZCLL 1A6WL 2CXGA 5T33H 4MJ5B 2IPKA 3FRPG 4D0BB 3OV6A 5D93B 4DVRL 4JO2H 5IWLA 1BOGB 5T1LD 1D5BB 3QUKB 4KKLD 2VC2L 2VR4A 5SWZA 1FZJA 1OD7A 4ZXBA 3QA3B 1I7RA 4UINH 4GAJH 4X9BA 5L0QB 3L3OA 2HRPL 4RGNB 4YIQB 2FR4B 4RGNE 4DN4H 2WBJA 2OL3B 2NY1D 2ZNXA 3B9DA 2FHBA 1RZ7H 5IFJA 4MJ6B 2Y6SD 5KSVA 1KJ2A 5FK9B 2YR3A 4GT7A 4MD5B 4LK4A 2DQFB 1MIEH 2GJZA 1CBVH 4AH2B 3LRSA 4M7LT 1TCMA 4MQXC 5BO1L 1LP9F 1K6QL 1GSMA 3P4OB 3EO9L 4G6KH 1I8KB 4PJXB 2A6IB 3LVEA 4PJXE 3DSFH 4G43B 4Y4FD 4XCNA 3JUYA 4R97C 2E8ZA 2GT9B 3MCKA 2DWEA 4PYHA 3ULUF 3REVB 3DX7A 1SJHB 4MB4A 3FB5A 3G6JA 4GBXC 3HFML 3WSQH 4O02H 1VACB 1M4KA 2R1WB 3BP7B 3R1GL 5L2KE 1DBBH 1JNHB 2UZIL 3S4SA 1ZHKB 4QWWD 1YC7A 3FRUB 5DEFB 5ALBL 5I8EA 4BZ1H 1RIHL 3CK0L 4JFXB 2CIIB 3F62A 1TMCB 5I6XC 4HZLA 1W8OA 5DJDA 1CCZA 4PJ7F 5E9DB 2H2SD 3E2HC 1MCJA 1YJDH 5E9DE 1MWAL 1UQSB 2Z4QB 3FQNB 1VFAB 3O4OB 2CRZA 4EVNA 4WDIA 2FX7H 2AI0L 1OSZA 3QIWA 4RNRB 3IFPA 2DKSA 3VD4A 3K81A 3LKOB 3KPRD 2IGFH 1YUHB 3BH8B 1WT5C 1KC5L 5C1MB 3QXVA 4IIQA 3B2VL 3O9WD 5I75B 2VE6A 3UTZA 1ETZA 1Q94A 1QBLL 2BVPB 3SKOA 4R4BA 3GM8A 1BX2A 4HAFA 1F58H 5F44A 5HGDA 2FBJL 3K8KA 2F5BL 3KPRB 3DHMA 3IDYB 4NZTL 3SDCC 4QF1B 3D85D 4WWID 3RJQB 1I3GL 5I1HL 2Q86B 5KAQG 5IHZB 5E94B 1J1XL 1T03H 4K3EL 1HZHL 4ZUTB 1DANT 3G6AB 5C9JB 5I1JL 1A6ZB 1CXFA 4HULB 1FL5A 2V5MA 3GMRA 5F21B 1UFUA 5CHNB 1RURL 1P2CA 5BVJB 5HYJD 1CLYL 3C2AL 5IR1B 2YWYA 3MV9E 3M8OH 1ZVHA 3NFSH 4OUUA 3V4VL 2VABB 3H42H 1VADB 1G0DA 1BLNB 4DK6A 5LVEA 4O5LL 4HKZB 3ZE1E 4LLWB 4Y4KD 4BKLB 2R69L 2XZQH 3V6OC 1I4FA