1YNLL

Identification of key residues of the nc6.8 fab antibody fragment binding to synthetic sweeterners: crystal structure of nc6.8 co-crystalized with high potency sweetener compound sc45647
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
219
structure length
219
Chain Sequence
ELVMTQSPLSLPVSLGDQASISCRPSQSLVHSNGNTYLHWYLQKPGQSPKLLIYRVSNRFSGVPDRFSGSGSGTAFTLKISRVEAEDLGVYFCSQGTHVPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma light chain
publication title Cocrystal Structures of NC6.8 Fab Identify Key Interactions for High Potency Sweetener Recognition: Implications for the Design of Synthetic Sweeteners
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ynlL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ynlL01
4LQFL 3I50L 5I1GL 4M1GH 2X4NB 1NUFA 4HMEA 4EXPX 3BI9X 3QO1B 1E4WH 1V05A 4PRIA 1CDCA 1P7QB 1JZ3A 1GRWA 3RL2A 4R26L 2NZIA 1YMHA 2BVQA 4P5TD 1FE8L 3QUZC 4OZFA 5MEOB 3PUCA 6CGTA 1LEKA 4MXVF 4UINH 5J56B 2J6EH 5HI5C 3CFEA 1N26A 3U4BH 2VDOL 5I18L 2VZ3A 4I3SL 2BCKA 4KMTH 4XB8A 1ZVYA 2EE9A 5DQDH 5DJDB 3UTTB 4APQC 5LWYL 2FX7L 4WNQA 3FRPA 1WCQA 3B9EA 3O2DH 5E2VH 5FYJE 3UTZB 4NKMB 4NWTL 5I71B 4P2QD 3FQTB 5T3ZE 5FGRA 4QRPA 4LHQB 4PGDA 3KVQA 5HYSB 4XNXH 1Y0LB 1VFBA 4DGIL 2R4RH 4PJHA 1KXQE 3KJ6H 3ROLA 3NA9L 1P69B 1MHHB 1NBVH 1ACZA 5FO7B 4NC1E 4MJ6B 3QT2A 5F96H 1T1XA 4Z5RA 1IGTA 4U1GB 4L9LB 4AYFA 1DBML 4Y4KB 1DBKL 4R2GD 4JQIL 1G7JA 4HXBH 3SKNA 4UQ2B 4HFWA 3JWOH 5KAQG 1TVHA 2EO9A 2AI0L 2E7MA 4HCRL 3BIBX 3U7YH 2VQ1B 2EDDA 3U2SB 1A1OA 5T33L 1OSZB 5CZVL 4YR6A 1DN0B 1UXWA 4JJ5B 4GT7A 1A9BA 1N2RB 5HBBA 2XZZA 3B6SA 1RMFL 1YNKH 4GS7C 3D2UA 3GMQB 2PO6B 4EUPA 3ILQD 4OKVA 4O02H 4FQJH 1G9MC 3VXSE 4FTVA 4X9HA 3HB3C 2IEPA 4L3EA 1N4XH 3UTQA 4MCYB 4JDZB 1JF1A 1Z5LB 2ZCLH 4X9FA 1TCRA 2CLZA 3LB6C 1QYGL 2P5EB 3O9WC 4UOW1 4YX2H 1S3KH 4Z6AT 1TENA 3MRJB 3RI5K 2HVJA 4QRPE 15C8H 2C1OB 1OGTA 3BYYA 3SE4A 1FZOB 3IU4H 4L5FL 3P11L 4HUWA 4JPKH 3WUWG 4X6BB 4EBQH 1ZLVK 5BZDB 2DJUA 1G7HA 1LD9A 3OKNA 1I8IB 5MHSE 1KLGB 4G6MH 1FYTB 1D9KC 3ZKXB 1NBYA 3MA9L 5CGYC 3JWDH 4G6KH 4QRRA 4LSTH 3QHZL 3G5ZA 1VFOA 4YDIH 1AO7D 4JFFB 1P7KB 4KUZH 5HHOB 2GT9B 1HWHB 2DLFL 1B0RA 4OJFL 4XMKL 4AIZB 2JCCA 4MJ5B 1OP5K 5JQ6H 4RFOL 4KPHL 1I9IL 3VWKD 1BMGA 3E8UL 4CMMA 3LKOB 2R0LH 3V6OA 1QR1A 3QXVA 1X7QB 3RTQB 1MIMH 5CIPA 2DYPB 1KCRH 3O3AA 4Z95H 1EXUA 1S78D 2QKIB 2WNGA 1XCTB 8FABB 3NN8B 4FTVE 4OLZH 3MROA 4IIQB 1A5FH 3U30B 2VAAA 3NZHL 4LCCC 1OT1A 5IQ7H 1C08B 1Z0MA 1BZ7B 1GGBL 3SKMB 3MBEB 3ESUF 4M9OA 4ZDHB 2VC2H 1NMBL 1UH2A 4RQQB 3GB7A 1K6QH 4RIRB 5EO9A 5IFHH 2APTA 4HUNB 3LKSA 3VFGL 2QHRL 4OLYH 1MWAL 3WMSA 2FYYA 3NFPA 5E8OB 3KYKH 3U4EA 1L9NA 5E7BA 4FFVC 5IFJA 4ZO8A 3LKPA 3HR5B 4G6FB 4FQXC 4OF8A 5HGAA 3RGHA 1A7QH 1IGYA 1PSKL 2YA2A 2VL5B 1I1AB 1KIPB 3BKCH 4DFHA 5IF0B 4XAKE 3VFMB 1WWAX 2Z8SA 3QEQD 4A2LA 2BNQB 4JHWL 4QRRE 1RZFH 2A9NL 1RJZA 2JKXA 4MAUH 4BQBA 5A2JH 1NBQA 5E9DD 4CVUA 1S9WA 4HH9A 1WGOA 1H5BB 4OFVA 3UDWC 3GMRB 5DMGC 4OQTH 1RUQL 4JFED 3AXLB 3FN3A 1I7RB 3RWDB 1YJDC 3EYVB 4Q6IC 4QRTB 4K94H 5H94B 4JKWA 4Y5XC 3V6OE 2OJEB 4LVOC 5FV2A 1HXYA 1DQLH 4M43L 5C0GB 5CAYB 1KGCE 1Q1JH 1N6UA 4J6RH 1RZ7L 2CGRL 1WCBB 4IMLA 1OAZH 3LV3A 5CSBA 2MHAB 4OV6F 1NC2D 2O5ZH 1CD1B 3OHXB 4NJAH 1MY5A 4JFZL 1D7FA 1T5WA 4F7EA 3QDJD 2I9TA 5KAQF 3KWWB 3PWPA 2HTLC 3BSZH 4NM4L 1AC0A 2BMKB 3L3HA 4HWBH 1UACL 1YMME 35C8L 4AJ0A 2EYSA 3GIZL 5GJSL 2IALA 2I5YH 2YPLD 5DDHA 1AGCA 2XICA 4YX2L 5ADOL 1KJ3L 4KVNH 1HHKA 1DJSA 3MV7E 2P45B 1C5BH 2DQTH 5GGRB 4DCQB 1A7NH 1F45A 3FONB 1UQSA 1RPQA 3GNMH 1ZVSA 4OCXL 2JTDA 4KXZI 2ZSWA 3TT3L 4X7TB 1SBSH 2A77H 3C5SA 1MCPL 1HDMA 1HYRC 4P46B 1LO4H 3I6LE 4LAQL 1ETZB 4JRWA 3BN3B 4ZTPH 2R0KH 4WV1A 4M5ZL 3MRPB 4KHTH 1VADB 4OF3A 1U95B 1KYOJ 1A7PL 3VRIB 5CSGA 5D71H 3MRNA 1F42A 4NC1C 5JNYA 4LLQA 3WLWD 4HV8A 3S36X 3H9SD 2Z93B 5MP6H 4EJ1C 2EIDA 1I4FB 4JG1H 4N1EA 3V4VL 4GBXC 1XGUA 5CEZD 2X05A 3ARGC 2X4RA 5IVXA 4RGNB 2ATKB 4C83B 4NNXA 3B2VL 3O2VL 4KHXH 2AK4D 5DLMH 4TSCH 5JXED 4HWNA 4ORGB 3SGEI 1HHHA 1GZQA 4R4ND 5K9OB 4OZ4A 4I3RL 2H2SD 5HJ3A 4G6JL 1NCBL 2YUVA 3GMNB 4XH2A 2NY1B 3KPNB 5FYLH 2ESVA 4HUUA 5J11C 4LDEB 1PYWB 1MQKL 2BC4B 2ZCHH 2X7LB 2AJVL 1M6OB 5C0BB 1R3IH 4U1SA 5GSVA 1J8HA 1OM3L 4M6NL 3KYAA 3OKEA 3HMXH 2VZTA 1FO0L 3JTTB 3IFOA 2HKFL 3QDGB 4TUOA 5IW1A 4S2SA 3F58L 4DEPB 5I19L 3RL1A 3UMTA 4XCFH 4Y16D 5JDJA 2HJKA 1RZGB 1BIIA 4X0KB 2VDKH 3L5WA 2J3SA 3JWNC 4KJYA 5JA9A 3ULVD 3QCVH 1NGWB 4JM2B 4MD5B 5E70A 3KLAA 3ETBF 4RDQF 4K94L 3AS2A 2K1MA 2B1AL 5LXGH 5EWIH 5B38B 3GSQB 2WW8A 1VEPA 2BVTA 5SV4A 3QWOA 3HA0A 4LCWD 5DMIL 1BQUA 4LCYB 5E4EB 5C71A 5EU3B 1UH4A 4AEEA 4GKZA 1QHOA 3RNQA 1JTPA 1TJIL 1NEZG 1MFNA 2P5WD 1TLKA 4GAJL 4QRQA 4DFIA 1IEBB 4G9FB 2BSTA 4BJLA 5DWUL 2BNRD 5I8EB 2NZ9C 1KJMB 5FA4B 2AQ1A 2WBJA 3D39B 5B3JE 4OLUL 1OAUH 1LGVA 4H1LB 4UDUB 1MJ7L 2VXSH 3IU3B 3VXPA 1CDUA 1R24A 1QKZL 1MCCA 5DJ8A 2VDQL 1CLOL 5C0CE 1Q94A 5D5MA 1R5IB 3QG6A 4ELKB 3FO1B 5C07E 1ADQL 3HN3A 1S7WB 1PEWA 4TSAL 3ET9F 1QSFB 3S88H 2GITB 4Q6YA 1J0KA 3OV6A 2B1HH 5ITBH 3M45A 1MFAH 3HCVB 3ULVF 2IAMB 5EZIL 4MQXD 1ZA3B 5E8PA 1RK1B 3SE4C 3BJLA 4LARH 4WU5B 3TPUB 1EFXD 1EEYB 5JPMA 3B5GA 5HYIA 3VCLB 5E24E 4DTGH 3QDMB 4OF0A 4W6YB 3BPOC 3HHRB 5HD8C 4K9EL 4F7PB 3D0VB 4I0PB 5FOBA 8CGTA 4HJGA 2X9XA 1QLEL 2Z0BA 4PRBB 4M7KH 5DJ0A 4NQCB 4X5XA 5D1XD 2HRPH 1UWXH 5T1LD 5D7IF 3FQWB 3VJ6A 4BZ2H 4EQ3A 4L1HA 3WIHA 3IDJA 4NCC1 4QHNB 1INQA 3K1DA 1U8QA 5F7DB 2ILLA 5K9KB 1QLRA 3ZE0E 1ZHBA 5D7JA 5GS2H 4QXGH 1JGVH 1T04A 3LH2H 3QI9A 3V6OC 4QNPE 3LIZL 3S9DB 4PV9A 5GQBA 3DETD 5DLML 4PJ9B 5BMFL 4OCNC 5CGTA 2H45A 2DQGL 3QUML 1XH3A 4WW2B 2YBRB 2FLRT 4N90D 3DSFH 2VIRB 5FM8A 3LVEA 3ZE2E 4MWFA 4QTIL 5D5ME 2X4SA 5DJXB 4UU9A 1SHMA 4OGAD 4NT6B 4XP1H 1LEIB 1AQKH 2YA0A 4M7ZC 3MV9A 1DDHA 5HYJB 1T21A 4AMKL 1M05B 1FVEB 2IF7A 1S7RB 4ZOBA 5C08A 4HPOH 1J1PH 4NRYA 1FNEB 4N8PA 3EKCA 2XQYK 4D2NA 3VXOB 3LKRA 4D8PA 4L4VE 3GZKA 2J4WH 4CGTA 3SDCB 3LQAH 4ONGL 3QCVL 2Z4QA 2ZKHH 3O3EA 4XCCH 3BDBA 1UEMA 3T0EB 2BVOA 2W9EL 4Z7UF 1KPRB 2ZG3A 2X9WA 5LXGL 2XZQL 4KI5E 3MYJB 5KSBF 4KQ4L 5SWSA 1UA6H 4BSWB 4KQ3H 1WC7B 1GPOH 4ELMB 1VHPA 2M1KA 3KPPA 3MRIA 3VWJA 2HKHL 5KTEL 3EYFA 4U1LA 4A6YA 4C59B 2J8UA 1GOHA 2YPKA 4QOKD 1CFQA 2Y25A 5D93C 4NQDA 3R1GH 4PP2B 1I3UA 1E6OH 1GZPA 5CLWA 4PRPA 4PLNC 3TVMB 3BD3A 3LKNB 4M93B 3BGMB 3MV9E 3QFDA 1AJ7H 4NZJA 1YPZA 2R0ZL 4X83A 5EZJA 2GJ6A 4X4MA 4FA8A 3LS4L 5C8JA 4EI5B 3QYCA 4D3CH 1EAJA 5DRNA 4ALAL 2V17L 3VXUB 4WENB 2A6DB 3MLTB 1SJHB 4UIKL 4XP5H 3ZSTA 3FQNB 4KK9D 4NSKB 5EA0H 3DVGA 5ESAB 1JNNH 4HXAL 5DRWA 5I8CA 1T4KB 1ZT1A 2A9MH 2VLJA 2VLRE 4AM0A 3UTPE 2VH5H 4Y2DD 4HKJA 4NN5B 5DQ9B 5A3ID 2J5LC 5TE6L 4LEXL 5DUMH 2JB6B 3EJZC 3QA3B 2GAZA 3MLWH 3VFTA 1LEGA 2R56L 4U1HB 1TJHH 5SWSE 1NFDF 3H0TB 1NDGB 3OR7A 1UG9A 1ES0B 1MJ8H 1NC4A 4WV1C 2VL4A 1MRFL 1RFDH 5ALCH 3VFUB 4CMHB 3WO4B 5ACZB 2V5YA 2X4NA 3T1WA 1GGYA 3QO1A 4HQQL 5TE4L 1P7QA 3GO1H 5CUSL 4N8CL 2NY7H 3TEUA 3MV01 3B83A 5B4MD 4NQDE 2YR3A 3DWTA 5MEOA 3WFZA 3JUZA 4PJIE 5KBNC 1YEGH 2W9LA 3LH2L 4ODSL 4RISH 3CFJB 5HI5D 1Q9KB 4PRPE 4OZIE 4M7JH 5CILH 5C7XL 1EMTL 5TH2B 1HXMB 2XN9D 2ZUSA 4NIKB 5DJDA 3UTTA 4MNGE 4X7EC 4APQD 4KI1A 2GJ6E 2NNAB 4X4ME 4UUJB 2FIKB 3ULUH 1NPUA 4ODHL 2X2YA 3UTZA 4NKMA 1N6QH 2MKLC 2OZ4L 2VLKD 3CNKA 2H3NB 2ARJB 2ERJB 3FQTA 3P73B 2FZ3B 2ZJSH 5HYSA 4YPJA 1Y0LA 4MGXA 3FN0L 2QV2A 1G6RH 4HJJL 3K2MC 3OF6A 5IMMB 2B2XH 1MHHA 4LVNC 4MA3B 5FO7A 4GRWB 4MJ6A 4H20L 4U33A 1JRHL 3GJFK 4PJGF 3IF1B 2WMPA 4L9LA 4Y4KA 2AEIT 1R0AH 4KGLA 4JN2B 5JHDD 3LQAL 5ILTL 3VI3E 3CFKB 4UQ2A 2ZKHL 5DUPL 4IHOB 4FQ2H 4UV4L 1DFBL 1SYVB 5KVGH 1BJMA 3O2DA 4AH2B 3LPWA 3HAEH 3OJDB 1IJ9A 1DBAL 3F7PC 4DWHA 5DD1L 2OCFD 2VQ1A 2WWKO 5E6IB 1FNLA 1CGTA 3U2SA 2C5DC 3BPCB 3UO1L 1OSZA 1NAKL 2Q6WB 3WHE1 4O58L 3AMKA 1DN0A 4JJ5A 5E7FA 4K2UH 5ADPH 1N2RA 2F9BT 3GMQA 5H37G 2PO6A 3DUHA 3QQNA 1IILE 4NWUL 3HB3D 3UTTE 1OQXA 1H0DB 1KPVB 5GZNC 3EYUL 1NCWL 4WI8A 2AEWA 3D3VD 4MCYA 2DQIL 4JDZA 1Z5LA 5CD5C 3RY5A 1DE4B 4EI6B 2HN7B 1HNFA 2P5EA 3W39B 3LB6D 5KN5B 2I60H 3O9WD 5DFTA 3PQYE 2GQHA 2QQLL 3EW3B 3OB0K 3SE9H 3MRJA 3CH1B 3NACL 3SOBH 5B39B 1WTLA 1FAIH 2NY5C 3V0WH 2C1OA 2WBJC 2Y5EA 1FZOA 5DD0H 1PY4A 4JANB 4AIOA 4X6BA 3WNOA 5BZDA 4J23A 5D70H 4GXVH 4NCDA 1LO3L 3SN6N 3TV3L 1I8IA 3MGTB 5IB3B 1KLGA 1FYTA 1D9KD 5DSCB 3GFUA 2CK0L 2DQHL 4R7DB 3U79A 5CGYD 2DMCA 3FOLB 4JFFA 5I30H 3N85H 1IAIL 1P7KA 4CW1A 5HHOA 2GT9A 4U6XB 2DQUH 2O61B 1MRCH 3QCUL 4AIZA 5I1DB 4MJ5A 2KL6A 1FIGL 3W9EB 4HC1H 1CQKA 1NBZB 2N1KA 2J2ZA 4WWKB 5HYFA 1JYWA 3LKOA 1CL7L 3V7AG 1X7QA 2K3TA 4URTB 3RTQA 4MXQC 2DYPA 4RFNB 1TZIB 4MA1B 3DGCR 4KXZH 2EDWA 2AEQL 2QKIA 2VDPL 1XCTA 5FOJA 8FABA 3NN8A 1MVFA 3SCMB 3U1SH 4UTBH 1XGQB 4IIQA 4XVUD 3ARTA 1LO5B 1B6UA 2Z31D 2P49B 1T03L 1C08A 1BZ7A 1YEGL 2OQJB 4ZS7L 4KI5C 3SKMA 3MBEA 3RWHB 4ZDHA 1IQDB 1T7WA 5DJ2B 4RQQA 1NAML 4RIRA 2OK0H 2ZNXA 5TDNB 5D7JC 1OTSC 3QI9C 5E8OA 4XPTL 3HE6D 1BVZA 1VCAA 4FFVD 3HR5A 1GGUA 3HC0B 4D9QD 4FQXD 4DVRL 3OKLB 3WO3B 1ZGLP 1CDYA 2VL5A 1B2WH 3CFDB 1I1AA 1KIPA 4LPTA 5IF0A 1Q9WB 1R5WB 3VFMA 4MHHG 4HBCL 1DTUA 5E8DL 3PHSA 2VDLH 2BNQA 3QP3A 1NSNL 1IM3B 5D2LF 5FUCE 1T80A 4YDLC 3GSUB 4JFFE 4NZTL 1TTFA 4QLRA 1X5FA 3VDBA 4G7YL 3ARQA 5HHOE 4QHMB 1F2QA 1KFAH 4R8WH 2ICWI 3SGEH 1H5BA 3SBWC 1QSED 1MI5D 1U8MB 2V9RA 4K8RH 3GMRA 5FDWB 4KRNA 1IGJB 5DMGD 4P2RE 1ULVA 3AXLA 4FQLH 1I7RA 3RWDA 4XHQA 3EYVA 4JY5H 4QRTA 4WHYG 4GSDL 5H94A 4OZFG 3ARFB 1MREL 2OJEA 3CJJA 4ISVB 3ARVA 1J10A 2LTQB 5C0GA 3MLYH 2EH7H 4ZFOL 2Z8VC 1N7ML 1JL8A 1WCBA 3U83A 1P84K 2MHAA 4JZJB 3STBA 5DA0B 5EU6D 4CU8A 3EDJA 2AERT 2NTFB 5IR1B 1CD1A 5HDBF 3OHXA 4GG6F 3FRPG 4OIIL 4MNQB 3SHSA 4B0MM 5ADPL 1F4HA 1UKSA 2JIXD 5E99L 1U93B 1J0HA 3KWWA 5C6TL 2BMKA 2HTLD 3RUGF 3VGAB 1UYWL 4P3CH 5F6IC 1A7OH 4OQTA 3VWJC 1G7MB 3QHFH 4P4RB 3RWJB 3RKPA 2FIRT 4U31A 2OL3H 1FPTH 5ERWB 2W59A 1V7ML 4K3DL 4LSSH 1F90H 3TP4A 4FG6C 4N0CC 3TN0D 2HFGL 3P4LA 3GM0A 4ZQKB 3IDIB 4XCEB 5GGTL 5GGRA 3V0WL 2BNQE 4IJ3C 4DCQA 3VW3L 5F1OB 4BQ8A 1QEWB 3FONA 4H25B 3P4NB 3VDCA 2HT2D 5FO8B 4HPYL 4X7TA 2DLEA 3H9HB 3R4DA 4WCYH 3MRMB 4XX1G 3W5MA 5TE7L 1UEYA 3CU7A 4L3AA 4P46A 5L88H 5FUZH 1ETZA 4U1IB 2AKRB 4LSDA 5I8OH 2OYPA 2I25N 3MRPA 2CMRL 3SKJH 1I9JL 1VADA 5EUOA 1U95A 4YC2B 2DQUL 5T3ZD 3EZ8A 2FX8H 2WWMC 5IROA 3VRIA 3O6LH 5C0NC 4EUPG 1PFCA 3PE9A 1S7VB 4JVWA 4QWWC 2Z93A 1I4FA 3WFCL 1MF2L 2UUDK 4GBXD 1MUJB 4MA7H 4ZPVB 3ARGD 2HVKB 4AEIH 2ATKA 1EIBA 4U3HA 3ZYIA 4YNYB 1MFBH 1AE6H 4ORGA 5D7LB 5K9OA 1M7DB 4PRID 1GOFA 2ADGB 3CVHH 3GMNA 4KRPB 2VDNL 3KPNA 5HPOA 3CLFL 5CGMA 4GH7B 1PYWA 1J0YA 1BOYA 2PTVA 2BC4A 5IW6B 1EGJA 2X7LA 4ZOEA 4OGYL 1FIEA 1M6OA 4F7TB 4XTRC 5C0BA 2OJZH 4M5YH 1EA9C 2F5AL 4UI2A 3JTTA 3MOBH 2VXUL 3VGBA 3QDGA 3T3ME 1T1WB 3BT2L 1IMHC 2EDOA 4YHKL 1H15B 3NTCH 2Z9TA 4XPAH 3PXJA 1EJOH 1VENA 1RZGA 4X0KA 3IAQA 3CK0L 5I71C 5EUOE 3MSPA 3CVHB 1DBBH 1NGWA 4IOIB 4JM2A 3LZFL 1F6AB 4MD5A 1CFVH 4NZUH 4YXLL 2R0WH 4NUJB 4P2QB 5B38A 3GSQA 4DGYL 4PYHA 3TIEB 4U1GC 4L9LC 5IG7B 4Z7WB 2K9UA 2XWBB 1VEOA 4LCYA 3S98A 1RY7B 2XV6B 5DO2C 5EU3A 2KH2B 3FO9A 1QPXA 4X7DC 1HYSC 3S36L 3DPBA 2IPTH 1F13A 2P24B 4HGWA 4R2GB 1IEBA 4G9FA 4QXUL 3ZDYF 1HQRB 5CZKA 2VR5A 5EZOL 2HTKC 4PJDB 5I8EA 1TIUA 2WINB 4TNVK 1QZ1A 2FD6L 1KJMA 5FA4A 3D39A 2KZWA 5LVEA 3CGTA 2C1PB 4H1LA 2ZWLT 4Y7MA 2FRGP 4UDUA 1FPTL 5HDQH 1X6LA 3IU3A 5IBUG 2ZCKL 4XC1H 3UYRH 4PUBH 4F57L 1R5IA 4ELKA 1CT8B 2APBA 3FO1A 1GIGH 2GSIB 4JRYB 4L3ED 1DCLA 1S7WA 2X1XR 4L1DA 3C2AH 4XMLH 3QULB 3MTRA 3JWOC 1QSFA 2GITA 1TJGL 1QRND 1I9RL 2RIKA 3HCVA 2IAMA 3QO0B 2X41A 1ZA3A 2FEEL 3R8BB 4PJHF 1RK1A 1FC1A 4WU5A 5FYLE 3TPUA 4EKXA 1EEYA 1KLUB 1XGRB 3VCLA 4UNTA 5GRVK 1TMCB 3QDMA 3TYGL 4P9ML 5CINL 1EJ6A 2V2TB 1CGUA 4HIXL 5HD8D 4KZEH 4MX7B 3T8XB 5L7XL 2OS7A 3ZKXC 3NBNA 4XHJC 4F7PA 3D0VA 4KZDH 1W0YT 5JTWA 4I0PA 5FUCC 3K0WA 4PRBA 4OLWH 4Z9KB 2BVYA 4NQCA 2WWKT 3EJJX 5EC2B 3SE8H 2XWJB 2NY3B 1YYML 3OKMB 3DVNB 3FQWA 3VFPB 4QHNA 4YBLC 3DBXB 3HMWL 1Z9MA 4G9FE 1WZKA 1QHPA 5IUSA 5K9KA 1KIRB 5J57B 3RTQC 3D39E 5CS7A 4HIJB 5C0IB 4HS8H 4PJ9A 7FABH 5TPWL 1QD0A 2YBRA 2VIRA 4L8SB 4IIQC 1GAFL 3U30C 2GFBB 5DJXA 4YZFE 3JWDC 1GGCH 4NT6A 4X9GA 3S37X 1NGQL 3MBEC 3RNKB 1N0XL 1LEIA 3ORJA 1QSFE 3MBXL 1PX3A 4NDMB 3L7FB 2FECL 5FKPB 1ZLSH 1M05A 1TVBB 3EDFA 5I1KH 3J8F7 1I7UB 1FVEA 1FDLL 1IZJA 4LHUG 1S7RA 4HGKC 1FNEA 4RGMC 3B9DA 2AV1B 1XGTB 3IKKA 1SY6H 3VXOA 2D2OA 1K8IB 3BQUB 3GJEA 2AABH 4LMQI 3H3PH 1I1AC 1KBGL 4KU1A 1JP5A 3SDCA 4MB3A 3QNYB 3S4SB 4OM1L 2CRIA 1UZ8B 2A38A 4L4TD 3T0EA 2QSCL 2YHGA 1KPRA 4NQCE 1H5BC 2JCCF 4D9LH 1ITCA 1FHGA 1RIVL 3HLAB 3MYJA 1V7NL 4KC3B 1Y6MR 25C8H 1IGCL 3QEQB 4NYLB 1LQSR 3U0TB 3GSNH 5F7UA 4AEHL 1ORQA 5HDLA 4BSWA 1U3HD 1WC7A 3LEYL 3CAFA 3UP1A 4ELMA 1E4KC 4GQ9H 1PVHA 2IGFH 3CXHJ 4LCIL 3V4UL 4N8VB 2V6HA 3CXDL 3H2WA 3WXWH 32C2B 2IPTL 5HHXH 1OGAD 2Q76B 3CDCA 4JFEB 3NIFE 4OZHE 4M61B 2VN7A 4DAGL 4PP2A 3BZDA 1CXEA 1G7PB 1RIUH 3UAJC 4OUUB 4X6DF 3TVMA 1F4WH 3REVB 1JZ5A 3LKNA 3BGMA 3OPZL 2DKSA 4NQSB 3WUWB 4XWGL 1NC2B 3PWPD 4DKEH 4XGZB 1PKOA 4NBZB 1GIGL 4EI5A 2GEEA 5CFHA 1KB5H 2Y07H 3VXUA 1ZVHA 1MSPA 2A6DA 3QDJB 3MLTA 1SJHA 5C0EB 3VG0H 2RFXB 3FQNA 4NSKA 4WDIB 1J9CT 5ESAA 1T4KA 1A6AB 3IFPB 3PGFL 5J6HB 5IWLA 3T0XA 2D0GA 4LF3B 4JREB 1Q72H 5DQ9A 5FYKD 1FO0B 2JB6A 3S7GA 3QA3A 1NGYB 3EJZD 4I5BB 3WFEH 2F74B 1M71B 4HMCA 4K3HA 4U1HA 3BW9B 4P46C 4LVHC 2CKBL 3VGFA 3H0TA 1CR9L 1IEAB 1NDGA 4G43B 4HS6B 4KROB 4ELME 3GI8H 1ES0A 4J7RA 5CEZH 5DMYA 2AV7B 4J12A 3VFUA 5GGVH 2O5XL 3CZFB 1AY1H 4JRXB 5ACZA 5F7EL 1KT2B 5ABDE 1KB5B 3BYTA 1BVLB 5IQ9B 2SEBB 5IROC 3Q5YA 2DQEL 1G84A 4LHUD 5LQBH 4P9HL 2B4CH 1I7TB 5F9DC 3CFIC 1G7QA 3MCLL 4I0CC 1F58H 2F58H 3CFJA 5GS0C 1Q9KA 1QOKA 4P3WA 4PJ8D 5TH2A 1HXMA 4HT1L 5E8NB 4RGNC 5IJKC 4NZRH 4YQXL 1CFTB 1F8TL 3VRJB 1AD0B 1OQOA 2H26B 2NNAA 4UUJA 4UT6H 1IAKB 2FIKA 3A6CL 5I9QB 3U9UB 3L3OB 1GGCL 4MNHB 3SO3B 3VXUE 2NY1C 3OG4B 3QRGL 2H3NA 2ARJA 4HF5L 4NQVB 3EGSA 3P73A 2EDLA 2ZOLB 2FZ3A 2ESVD 2YA1A 5FEBA 1AGFB 4GOSA 4ZMAT 3MYZA 5IMMA 2OTWB 4MA3A 3RWGB 1FJ1B 4BH8B 4NCC2 4ZD3L 3FT4B 4TULL 3ULVH 1K85A 1JGEB 1J8HD 3IF1A 1FBIH 1BQLL 4TPRH 5ALBH 4EIZC 5IVNA 3FO0H 3QZWG 2YXFA 2FJGB 4JN2A 1GGTA 4EZMA 4WTXA 2WBKA 4IHOA 2H8PB 2V5RA 2CDGB 1SYVA 1JCKA 4AH2A 1B9ZA 2E3VA 3SDAB 2AGJH 3OJDA 4DN3L 2VITB 1IC5H 4WFED 3WIIH 5E6IA 5EOQL 4JM2C 4YE4H 2XZCH 4Y16B 5IB4B 3BPCA 2Y5TB 1BZQK 2IGFL 2P48B 1WWCA 3X3FL 3QEGH 2JELH 5IVXF 5E4EC 1AP2B 1PDKA 3IT8D 1YNTB 1H0DA 1KPVA 5CMAB 5GZND 2M2DA 3CFCL 1QNZH 5IEKB 1RUKH 4CN1A 1DE4A 3C08H 5CD5D 5GS1B 5C3LD 1ZOXA 4EI6A 2HN7A 3W39A 5GXBB 5KN5A 4LCWB 3UX9B 1F6LL 1TQBC 2B39A 5KW9L 1T66C 3CH1A 3QIBB 1YA5A 5B39A 1NFKA 1FL6B 5FGCB 3IETB 2J88H 4MHHI 4LASL 4JANA 2KQNA 1PLGH 1RI8A 4GRWE 3BP6B 1A8JH 5KVFL 4G8EB 1SJVA 3MGTA 2EZ0C 5IB3A 4Y19B 1OCWL 4MYWB 4U1MB 5BW7A 2WANA 2XA8L 5DSCA 4R7DA 4RNRB 3FOLA 3VG9B 5I1CH 1N64L 4U6XA 1IC4H 2O61A 3EYOB 5I1DA 3TGXA 2F5BL 2IAMC 3PIQB 3RDTD 2DQJL 1S9VB 3OXSB 3W9EA 5I6XB 4QY8B 1NBZA 5EOCH 4WY7H 1FV1B 3D18B 1AGEB 3QNXB 2O5YL 5T5NF 1XGYL 1KCLA 3LHPL 3NIDF 4MXQD 1TZIA 4N9GB 1T5XB 2NX5B 4IS6B 3EFDH 1ZSDB 1CTNA 5JMOC 5GRUL 2COQA 1AR2A 3SCMA 1EFXB 1JGLL 4I0PC 1XGQA 1RJLB 2B4CL 1LO5A 4FQPA 4HMDA 2OQJA 3WLBB 4YWGL 5FHBH 3RWHA 3DSNA 1IQDA 5DJ2A 4FP8H 4PJBF 4O5LH 5D1QB 3HI6H 1OD7A 5TDNA 1EK3A 2CLVB 1C8PA 5D1XB 5D7JD 1OTSD 4WHTB 4OF7A 1YEIH 3E6FB 4PJ9C 2B0SL 2DTML 3HC0A 1P7HL 5ICZB 5JIPA 4ONFL 2ZUQB 3VA2C 3WS6A 1EHAA 3OKLA 5KSBB 4WW2C 1G1CA 4I0KA 3CFDA 3C60B 1ZXQA 1G0DA 1D6VL 1Q9WA 1R5WA 1ZHNA 2IMMA 3ZL4H 1FZJB 4F9LA 3GSUA 2HJLB 3U0PB 3FMGL 5ISZE 1IEHA 4QHMA 4UV7H 5A2KH 2MSPA 2EDKA 5HGHB 1U8MA 5FDWA 5FO9B 1IGJA 2DIAA 4WFGE 4Y4FD 1L6XA 3TESA 4X4ZA 5C08D 3RJQB 3ARFA 2X44D 3C09C 4ISVA 3P9MB 4F7CB 2HA1A 5DT1H 5BRZD 2MQ3A 5DK0B 3SDCC 5TQ2H 4LLYB 1PG7W 1T20B 4DK3A 3VXMB 1JWSB 5F89B 4JZJA 3WIIL 4HULB 1E6JL 1RV6X 4I2XB 3ZDZE 2NTFA 3T0EC 5IR1A 3RAJL 2DMKA 4ODTH 3ZDXE 4LU5H 4MNQA 5J12B 4Z7OF 1VKXB 5BV7L 4OAWB 1VPOL 1JHTB 1U93A 2X4OB 4UTAH 4UB0L 4OCWH 1G7MA 4P4RA 3P3YA 3VWJD 5HYSG 4KH2A 3RA7L 3RWJA 4B5EA 3KLHD 3E2HB 1WFOA 5ERWA 4MD0B 1OPGL 3DARA 3X11B 3CMOL 4FG6D 4N0CD 1MCIA 3G5VB 3IDIA 4ZQKA 4BK5A 3JVGA 4AG4L 4XCEA 4RMQA 3CSBA 1I3GL 1QEWA 4QOKB 4H25A 5AAWA 3P4NA 3TVMC 4PRPD 2WUBL 2P42B 5FO8A 4M93C 1YEEL 3H9HA 2BY2A 3UPRB 3MRMA 4O4YH 4YDJB 4AL8L 4EI5C 3QAZB 4LAJH 5T3XD 4JZNB 5CJOL 5GIRB 3MRBB 5LGHH 4U1IA 1WZ1L 2AKRA 1EH9A 4CVZB 3EYQD 1B3JA 3ZE1F 1UB6B 2YD5A 3M8OH 2Q86B 2DN7A 2WWMD 2Y36H 2VLJD 5C0ND 2Q8BH 3V6ZB 1KC5L 2MOVA 1S7VA 1XZ0B 4XP6H 4NN5C 4QWWD 3RRQA 2C4FU 2OP4L 4Q9QL 1HSAB 2HT4C 1MUJA 5DZOA 4ZPVA 2KPNA 4U2YA 4ODXB 3MXWH 3PP3H 2HVKA 4JVUA 4Y2DB 5GGUB 3KPSD 1UZ6E 4CMHC 4YNYA 1NC4D 4PJGB 2J8UF 1IFHH 5D7LA 4OBRA 1U8NB 1M7DA 4RWYH 3WJJC 1NMAL 3ZYZA 2ADGA 1CWVA 3ARDB 4FP8L 3WD5L 1BEYH 2FGWL 2P8PB 3T2NH 3FFCD 1GYAA 3B5TA 5IW6A 5F9OH 2PR4L 5K9QI 1YEIL 4F7TA 4Z77B 5FYKU 4XTRD 2RB8A 3FTGB 3T4YB 1FVDB 5AYUH 2W0KA 3EOTL 2X4QB 1YPZF 3K46A 4MXVE 4Y1AE 1T1WA 5CJQL 5F97E 2BHYA 1H15A 5DTFB 1UT9A 4QGYA 2XN9B 2PYEE 2VWEE 1CF8L 4OLEA 4LSVL 4APQB 1MNUH 3CVHA 2FCBA 5TF0A 5I15H 4IOIA 1F6AA 3LY6A 1WK0A 2UZXB 4JHAL 2ADIB 4NUJA 5EBLB 4P2QA 5IHLB 1NUDA 3QQ3B 5DT1L 3TIEA 5JR1H 4R90H 3BRFA 2NTSP 5IG7A 2VDMH 1WV7T 5TQ2L 4EXKA 4Z7WA 2XWBA 4R0LB 1JI1A 4PS4H 2C3VB 2HH0L 3RKDC 1TETH 2YUZA 4OB5L 4YAQB 5DO2D 1KYOK 1KV3A 4EN3C 4PTUB 4BQCA 2E8YA 1G9MH 5ANME 3G6DL 2P24A 3QFJB 4B53A 1BFOB 1BD2E 2W92A 1X5KA 1FRGL 2IFGA 5E6IC 4Z78B 1A4KB 1HQRA 4G80B 1D6EB 1CFNB 2IFFH 3KGRA 4PJDA 4RMWA 3WKMH 2HTKD 2WINA 1QSZA 5DC4B 3EYSH 1RJYB 5D6DA 3HC4L 1FZKB 1ZT4B 4TNVF 5EC1B 5I1LB 2C1PA 1KEGH 1HH9B 3OAYH 2EH8H 4AY0A 4WEBH 4DKFL 1EHLH 4LSRH 4ZNEA 2BVEA 1WIOA 1CT8A 3C2SA 2GSIA 4JRYA 4MVBC 3QULA 5I1HL 5F88B 5CBEB 3NCJH 2ORBH 2P5ED 4W4NA 3U82B 1NEUA 3BKYH 1OAQH 3QR2A 1UKQA 1JF5A 5AG9A 3QO0A 1HZHL 1WICA 2R29L 1SJXA 3MJ8B 3MLUL 1AXSB 1KLUA 1XGRA 3O9WB 5FCUL 4Q97A 5DHVB 4P2QE 1H3PL 3BPLB 4M1DL 3K3QA 4ZAKB 5BW7C 3MFGB 2V2TA 3JZ7A 4MX7A 3T8XA 1FYTD 5C86A 2FSEB 4XHJD 1KG0B 5I8KL 3UEZA 1P5UA 2ZUUA 3GMLB 3S96B 4XC3H 4IOSD 2NXYB 5EC2A 1PG7X 2XWJA 3OKMA 3DVNA 1FL3B 5GRVL 3A6OA 3VFPA 1DL7H 5LGKA 1D9KB 3OMZA 4PGEB 3DBXA 4KY1L 5IBTL 4WWKC 5IMLB 2JJSC 1HWGB 5D2LB 3P4OB 5BOZG 1KIRA 2UV3A 3E0GA 3RTQD 1RVFL 4HIJA 5D7KE 5C0IA 4RFNC 4MA1C 4XBGB 2DYPD 3NCYP 2E6PA 5GISH 1OTTC 5I74B 1J0IA 3SCMC 5IB1B 3O6KH 5JOPD 4L8SA 4PRDB 3AS1A 2LE9A 2WZPD 4ZNEE 5IT2L 2GFBA 4JY4B 1ZLUH 1BBDL 1BM3H 4K55A 1AD9B 4XPBL 3TT1L 3RNKA 4NRXB 3MBED 4FFYL 3AM8A 5DEZA 4NDMA 4FFZL 5IFAH 3U46B 3L7FA 1LDPL 2GTWB 2Z31B 1F02I 1HSBB 5FKPA 5H37H 4NO0B 2D0HA 3UJTL 1A22B 3C6LB 1TVBA 1I7UA 4GG6B 4N0YL 1O0VA 3EJYC 3S5LB 3HG1B 1H9VA 1N0LA 2AV1A 1XGTA 3WS6C 3BQUA 1K8IA 5D6CB 3G08B 4KVCH 3WE6B 3N1FC 1MCOL 3RUGB 4P23C 3HE6B 3S4SA 3QNYA 4GAFB 1JNLL 1UZ8A 3UYPA 4F9LC 1P4BH 1MAMH 4PLOB 5HHMD 4ERSH 5EOTB 1F4AA 4RAVB 2AW2A 3HLAA 1Z9OA 3O2WH 3QEQA 4NYLA 3WKNA 1EV2E 3U0TA 4XI5C 4OGXL 5D2NA 1AO7E 3I3DA 1KOAA 1XR8B 3ARFC 1MRDL 2LTQC 4I48B 4N8VA 3SQOH 1HKLL 1V5JA 1SY6A 2XTJB 32C2A 3QH3B 5F3BB 1D5ZB 1KN2H 2Q76A 1OY3B 4JFEA 3GRWL 4JZJC 1REIA 3TWCL 3JUYA 1XF4B 3W5NA 2N7BA 4M61A 5C0AD 5M94B 1G7PA 3BO8B 1JHLH 1RIHL 4PJ5B 4OUUA 4PGZA 4G3YL 4ZTOL 5KSAB 3REVA 3LPFA 4XMPH 3L5IA 5EU6B 3WUWA 3BEWB 4NQSA 5L0QC 1NC2A 1DEEB 3QXAB 2Y7QB 5IJVB 4C55A 5DHXB 4XGZA 4EVNB 1HNGA 4BQ6A 3GI9L 3S37L 4HK3J 3BP4B 3QDJA 2JIXB 4NJ9L 4WGWB 4ODVH 2AJSL 5C0EA 2RFXA 1IBGL 4WDIA 1OAQL 5B38G 3JVGC 4PJFF 4TVPD 1EZVY 1ZHKB 3TBSB 1A6AA 4ZXBB 3IFPA 3RU8H 5J6HA 3G6JB 5T3ZH 5M95B 4YXKH 2V9QA 3H3BC 1ZAGA 3K2UL 4LF3A 2P46B 3LDBB 2BRRL 3W2DL 3TN0B 4JPWH 2ZUTA 1FO0A 4JY6B 5MEND 3RFZC 1TNNA 1NGYA 1T0NB 4I5BA 3DRTB 3QEQE 2F74A 1M71A 2PTTB 4L29B 3BW9A 4G43A 5D2NE 1IEAA 4HS6A 5DD3H 5E9DE 1VGEL 1T2JA 3BX7C 2AV7A 1ROWA 4HEME 1AGBB 3P30H 3CZFA 4KRLB 4JRXA 4YC2C 1BLNB 1CS6A 1KB5A 1KT2A 1BVLA 1FORH 5IQ9A 2SEBA 4H1LG 4YDVB 2WBWB 4JFEE 4KK8C 4IDJH 3U9PH 1I7TA 2G75B 4NRZB 4CL7A 4WHYH 4Z7QF 2AJYL 5GS0D 1FSKB 2ZSVB 5E8NA 3ALXA 3IDMB 3VU2A 4RGND 5I2IB 1P4IH 1CFTA 5E00B 1GC1L 3VRJA 1DQML 4E41B 2H26A 1GOGA 1I1FB 1W8OA 2N56A 1BFVL 1IAKA 1IQWH 5KG9B 4HUXB 4MDIB 3U9UA 3L3OA 2Y6SC 4MNHA 5SWZD 3QDJE 4KRPC 3ARGB 4FQQB 4NQVA 2ZOLA 1IGFH 5DK2B 3MACH 1AGFA 3K4DA 5JXEA 4RBPH 2OTWA 4F37F 3RWGA 4BH8A 1FJ1A 4OD2B 4LP5A 2YPLE 1WIPA 2XT1B 5C0BD 2UZIL 3FT4A 5C2BL 1B4JH 1JGEA 1NCCH 3TFKC 3W9DB 1NL0L 2D7TL 3OJ2C 1KNOB 1YJDL 3QDGD 2FJGA 4YHPB 4YH6A 4LP4A 3PWJB 3BUYB 2LVCA 2JB5H 4YHIB 4LSPL 1MIEH 5FXCH 2H8PA 2CDGA 1FVCB 3TNNB 1NJ9B 4WI9A 4A2MA 3SDAA 1U8JB 5ACMA 2VITA 3FOMA 4CJ0A 4P59L 3ROOB 4HW6A 1YNLH 4Y16A 1NGPH 5IB4A 5GGRY 4HFUL 2Y5TA 5E2JA 1SBBA 4Y8AA 1GSMA 2FBJL 3BHBB 1ZMYA 2XYCA 2OR9H 2HFEB 3BMWA 1JGUH 4Z0BH 1AP2A 1ZANL 2V7HB 3EIFA 3AS3A 1YNTA 5CMAA 3SE3A 2BDNH 3GBMH 3BP7B 3ECBB 3H9SE 5IEKA 4HLJA 4UT9L 3RVTD 1RHFA 1Z3GH 1U3YA 5GS1A 5TQ0H 3PWUB 4R2GC 4JQVA 5CEZE 4LCWA 4ONHB 2DBLH 4PREB 4EDWH 2LU7A 5L6YL 1CLYL 5EU5B 3QIBA 1T1YB 3O0RH 4GJTB 1FL6A 4S1SL 1A6WH 3IETA 3BEVB 2AK4E 3QXDB 3GEWB 3GHEL 3D39D 1DANT 4JFQB 4P49A 1J0ZA 2DQFB 1F4YL 3BP6A 3BESR 5KZCB 4G8EA 1DBJL 3FQRB 1MPAL 4Y19A 4U1MA 2EZ0D 1YEHH 5FYJL 3GIVB 4RNRA 3V4PH 4J3SA 4U4BA 1IC7H 4PJAB 5T3ZL 4KMQA 3C9NB 3ILQC 4WO4C 3IFNL 3ZKQD 3KXFB 3EYOA 1RD6A 5A2FA 3PIQA 5IEHB 1S9VA 3OXSA 2IAMD 4QY8A 2CUHA 3ARBB 1FV1A 3D18A 1AGEA 3QNXA 4FQIH 3EOYG 5JIHA 5I1EH 4IM8A 5DD3L 4D0DB 1QRNB 1XEDA 3QDMD 1CBVL 4N9GA 1T5XA 2NX5A 4IS6A 1JZ8A 4XVTH 1ZSDA 4LPWA 5I1IH 3FCTB 2DWEB 3ULVE 2X4TB 3VA6A 4OFPA 1QSVA 3P0GB 1EFXA 1OW0C 3CUPB 1RJLA 3RVXD 4GW4B 4I0PD 5FFLA 4J3OC 3BWUC 3FHAA 1UC6A 1YUHB 3WL9B 3WLBA 2NY3C 1OB1B 1BJ1H 4YHOH 4X8XA 4M6MH 3D9AL 2BY3A 2DTSA 4LCWE 3VXTB 1EO5A 2IH1B 4S10A 5D1QA 2CLVA 2ICWJ 3T0WA 1JV5B 5FGCE 3BE1L 1HIMH 5D1XA 4WHTA 4UMGA 1YYLL 4PB0L 3WYRA 1SM3L 4GMSL 3VMPA 2P5WE 1J11A 3E6FA 5D7IE 3B9VA 1AFVH 4PJ9D 1TPXB 5ICZA 4ODBD 3IRZA 4JCLA 5KSBA 1S5IH 2BNRE 2EE3A 2MPAL 4L8SC 4Y19E 3C60A 2XQBH 3AGVA 2Y1VA 1ONQB 1KTKE 4TNWK 1W72L 3KHOA 1FZJA 4LSUH 4F33B 1JF6A 2HJLA 1S78C 3U0PA 3RHWK 4FFWC 3AM8C 1A47A 1P9MC 5HYJD 5HGHA 4UOW0 1D5IH 5FO9A 5GS3A 5HI3C 4JAMB 4LRNH 4N1HB 1WT5A 4GO6B 2QSQA 3ZHLA 4G9DB 4MJ2A 4FZEH 3W0WD 4X6DB 1FC2D 5GGQH 5LBSH 3BQUC 5DMKB 3P9MA 3MLVH 4X9IA 3NH7H 4F7CA 4M7ZB 5EU7E 5DK0A 1TTUA 2YK1H 4LLYA 1T20A 1Q9LB 3SDCD 3VXMA 1E4XL 1NEZA 1T83C 3GSVB 4GKSB 4BSJA 3TM6A 1JWSA 5ESVB 5F89A 3WFHB 3WXVH 1U36A 4I2XA 3C8HA 2FATL 2QL1A 3T0ED 3K8LA 4KTEL 4XVJL 3LMJL 2YRLA 2NY4D 1EZVX 3IS0X 3FAXA 4O2CB 2XKUA 3WNMA 4YHZH 1VKXA 4RWHA 4OAWA 1N3NB 4XNYL 1JHTA 2W65B 3D25B 3K4ZA 4Z0BL 2X4OA 4L4TB 1K3ZA 4QT5B 2BJMH 4NHUB 4KJWC 4P5MB 4ZUSB 4QTHB 1JMXA 4Z7UE 2CO6B 2YD1A 4DQOH 1CGSL 4P0DA 3MFFB 2ZPKH 4MD0A 2N7AA 3D85B 5CCKL 5IP4A 4WW2F 5JLZB 5KSBE 4XNUL 3X11A 1U3HB 4U6TA 5TFSH 3G5VA 1QFPA 3IJSB 2DMBA 5J8OA 1KIQB 1YEJL 4QOKA 1OGAB 3HE7B 1UM4H 4N90E 4JO2L 1NKOA 2YUWA 1QBLL 1BFTA 3MXVH 1RU9L 1EAPB 3UPRA 4YDJA 3PV6B 1LO2L 1NCDH 5FYKH 5IGXL 4OD3H 4EI5D 2V9TA 4JZNA 1IGML 5GIRA 1DLFH 1Q0YL 3MRBA 2VLMD 2IG2L 4CVZA 2RJMA 1JE6A 1UB6A 3GSXB 3VXME 5EBWB 1LK3H 1X5XA 2Q86A 4F8QA 2DQDH 5J9PB 3TF7C 3V6ZA 4WI3A 2C3XA 2YEZB 2UY6A 3C5JB 4I2XE 5E2TL 1XZ0A 1A4JB 5F9JB 1A3RH 5TGBB 9CGTA 1HSAA 3UTSD 1WEJL 3QQ4B 2Y06L 1UFUA 2HT4D 2WUCL 4BH7B 4BYHA 4ODXA 1KCUL 4MSWB 1GVIA 4Y2DA 5GGUA 4KROC 3I6GB 5GJTH 1CE1H 5B39G 4FRWA 1MAKA 4PJGA 2OMNA 3GJFB 3FJTA 1U8NA 1L7IL 4G7VH 2P8PA 4RGOL 1CVSC 1NFDE 3N1MC 3M17B 3HR6A 2VYRE 4WUKL 1ZA6B 1RZKL 3HRZB 3VD5A 3C5ZD 4PV8B 4QOKE 4Z77A 1QG3A 4X80L 2YN5A 3FTGA 3T4YA 3MGAA 4WJ5B 4IRZH 4LHUB 1FVDA 4HWZB 3MMEB 1QTYT 3RY4A 2X4QA 4H8WL 3DVFA 3M1BB 2XNAB 3NFSL 2Q3ZA 4ZS6C 5I9QC 3IXAB 3QIWC 4XPFH 1U42A 2A6JB 2AJUL 5DTFA 4PJ8B 3REWB 1JPSL 1MJJB 1SYSB 4YUEL 3W82A 2XN9A 5F7LB 3OAUL 3E1F1 3I2CH 4APQA 1PZ5B 5DRXA 2R2HB 3MGOB 4JDTH 5JXEC 1JFQL 3ARRA 4LLUB 2H2SC 1CGWA 2ADIA 5EBLA 3KS0H 3OKYA 3NIGF 3QQ3A 4JGJA 3ABZA 1CLZL 5FECB 4R0LA 3MPCA 2C3VA 4HWEL 4LVNB 4YAQA 3RKDD 3D48R 3LD8B 3Q6FB 4PTUA 2NY0B 4EN3D 4LCUB 5J13B 5IHUH 4PJGE 3NABH 3BGAA 3SDAC 4OCSL 1O7SA 1BFOA 2IPKB 3IFLL 4MXWH 5E94B 3TIDB 3NAAH 4Z78A 1A4KA 2IQ9H 3GBNH 1IC1A 4G80A 1D6EA 5E6ID 1CFNA 4HD9A 2F15A 1CZ8H 1NLDH 1RJYA 1FZKA 1ZT4A 1INEH 5FIEA 5EC1A 5I1LA 4KK5D 4OD1H 4K9EC 5F7FA 3BKMH 4C54A 1HH9A 2ZG1A 2NY5H 5DI8B 5TFSL 3SE3C 1QRKA 4NPYB 3T0DA 2UWEB 2V5TA 2EECA 5GS1C 5F88A 3VFOB 5CBEA 5SX5H 2AQ3A 4HIHB 4J3VA 3LS5L 5HHVL 4JQVC 3TH4T 5HVWA 3A6BH 3X14B 2XN9E 5JHLL 4Z7NF 1VERA 3QIBC 1Y18B 1YQ2A 2LABA 2P1YA 4PLKC 1PJ9A 4KMLB 1UWEL 1BAFL 4HZAA 2W0LA 1IAMA 3MJ8A 4PB9H 4GRWF 1XAUA 1AXSA 3O9WA 1FLRL 2VLKE 1J1XL 5DHVA 4PJBB 3F7QA 3UROR 4ZAKA 1YEKL 1KN4H 5E2WL 4H5SB 2EDHA 2FSEA 3HFMH 3CFBB 1KG0A 3RPIB 4U7KA 1U2CA 1JNHB 3CC5B 5KS9F 3GMLA 5F7KC 3S96A 3T0AA 4JR9H 1CN4A 3P0VH 4ODUB 2EC9T 1FL3A 1N5YL 1D9KA 4PGEA 4S0SD 2MCPH 5I6XC 5JHDE 4WEMB 4M1CC 2F53B 5IMLA 1MCWW 1EFQA 2BY1A 4WWKD 1I1RA 5D2LA 3P4OA 1LP9B 3HNVL 5K59E 1EO8H 4TYUA 2P47B 3WIHH 1D3CA 1QFWL 4XBGA 3RDTB 4MQXC 4JN1L 3RVWC 1FGNL 4K23H 3IB4A 3B8SA 1OTTD 1EX0A 5KVDL 5IB1A 4PRDA 3SCMD 4LLDB 2C26A 5KJRL 2VXQH 4JY4A 4XPGL 1SEQH 3O81A 1AD9A 2ICCA 3TBTB 3B9KB 1U9KA 2HWZH 3KNBB 4NRXA 4TQEH 1RAMA 5CZXC 1YQVH 2NLJB 3V0AC 5BV7B 3HI1B 1ZTXL 3IGAB 4JO1L 5KSVB 2DQCH 5D1QC 2BVPB 3U46A 2GTWA 2Z31A 1HSBA 3D3VE 5D1XC 4NO0A 1N59B 4ZSOE 3C6LA 4LMQE 1MHCB 1UCBH 3MJGX 5D7SH 1JK8B 3THML 4GG6A 2AJXL 3S5LA 3QZWB 1NGZB 3HG1A 1OARL 4X6EB 1RUAL 2NPLX 1TZGH 5D6CA 3G08A 4MJIB 2BERA 3WE6A 4L8DB 3C60C 2R2EA 3SJVD 3MOAH 3RUGA 4LOUC 3HE6A 5GGTA 4P23D 3STLB 3P77B 4NN6B 4I8DA 4UIMB 4FNLL 3VRLF 4OM0H 1K3IA 3WHXB 5EOTA 5HTSA 4RAVA 1RULH 1GHFH 3KR3H 4QXTB 1K9TA 1UADC 3EUUA 3PWLB 4Q0XL 1J88A 1IARB 2W07A 1WT5C 5BCAA 3A0OA 5D2LE 1DQDL 1H3UA 4XI5D 5GRJH 1V3KA 1XR8A 3QUXD 2NY2D 1EEZB 1PG7L 4I48A 4IDLA 5AZ2L 4JGUA 1CE6B 4WVRA 3QH3A 5F3BA 4Y4FB 1D5ZA 1V3MA 1T7VA 2B5IB 4DVBB 3DHMA 4A6YH 1XF4A 3BDYH 4QEGA 3BO8A 5GRXG 4Q9RH 5LAXB 5BRZB 1OLZA 2F19L 4PJ5A 3STZB 5CKAA 5KSAA 4OD1L 4MNQD 1I8MB 2L0DA 2WAHA 1U3ZA 4ZUWB 4NC0B 5C0RL 5EU6A 3Q6GH 3TCLB 3BEWA 4YIQB 4XAWH 1DEEA 2X89A 3QXAA 5J0BA 2Y7QA 4F15B 5IJVA 3QBTB 4HWUA 3DRQB 1JPST 4KKLD 4EVNA 1B90A 5HDBE 4GG6E 3QISA 1RK0B 4LIQH 3BP4A 5E1AB 2JIXA 1WTGT 5SX4I 4RSVA 5T3XH 2EIBA 1U8OB 4K3EL 3X3GH 4EEEA 3RUGE 3B9AA 3UPAA 1ZHKA 3TBSA 1F4XH 4ZXBA 3G6JA 4D9QE 4Q7DA 4PB9L 1LO0H 2WK2A 3MA7B 2R4SL 3TN0A 4JY6A 3WFBL 1AI1L 3BJ91 3F7VB 3WS3B 5D72L 3KJ4B 5HVFB 1T0NA 3DRTA 2ED7A 2PTTA 4L29A 3QAZC 4XRCA 5CD3B 4OCLC 3RIFK 4CBPA 5E2UH 4QF1B 1AGBA 3N06B 1T7YA 3LEVL 1QSEE 1BLNA 3P0VL 4P5KB 4IBLT 5T1DL 4X6CB 3A67L 4YDVA 1S5HB 1P4LB 4KKBC 4BZ1H 4JZOB 2AXFB 3PWNB 4KK8D 3KDMB 4PD4J 3KPLB 1HKFA 4RCAA 5I1JH 2G75A 2YMXL 5L2KD 3MNWB 4NRZA 2FJFB 4OZGB 1S7XB 2CJUH 3MODH 4KK9C 5HY9B 1PAMA 1QA9B 5ELIA 2ZSVA 2V5MA 3CXHK 3MV11 5EU6E 3IDMA 2FB4L 4Y2DC 3CVIL 4KAQL 5I2IA 1NKRA 5E00A 2LVEA 1L4IA 1UWXK 3QCTH 1MFCH 4NKIL 1FH5L 4E41A 1DVFD 4K3JH 4RMRA 3L5XL 5T1KB 5KG9A 4HUXA 4MDIA 4KTYA 5JW4R 5FHAH 2Y6SD 2QBWA 5D7LD 3MRRB 1HN1A 5GGSB 3ARDC 3ARGA 4FQQA 4YXHH 3L6FB 3KPSB 4KDTA 5DK2A 5DD5L 1KIUA 1AIFB 4OSUH 2VB5A 5T5FL 4OD2A 1MEXL 3PL6B 4O00A 1ZT7B 3BAEH 43C9B 2H6PB 1MCKA 5B4MC 3W9DA 3TFKD 1KXVC 3V7AE 1KCVL 4R4FL 2HMIC 3FFCB 3LPGA 1KNOA 2DD8L 2X40A 4YHPA 4NGHL 5F21B 3PWJA 3BUYA 4GMTL 4NUGL 4YHIA 3I6KA 3KPTA 1FVCA 3TNNA 1NJ9A 1YECH 1U8JA 3MLRH 6FABH 1C12B 2OTUB 3OZ9L 4M8VA 4KTDH 4LL9A 3ROOA 4OLVL 5BS0D 1QPPA 4JPVH 5E08L 3FB5B 2DDQH 5GRWA 4Y89A 3BHBA 4JFHD 4LGPB 2VZ1A 3TPKA 1AQDB 2HFEA 2R2CA 4R0LC 3LN9A 4JO3H 1JI2A 2XY1A 2V7HA 5F93C 5BO1H 1TQCB 2MMXA 2W9DL 4X7FC 3SDYL 2QQKL 3BP7A 3ECBA 3VD7A 4E41E 1MJUL 3HI5L 4YHYC 4CJ1A 4HHAB 5A43C 3NFNB 4P4KC 4DUXA 3PWUA 4ONHA 4PREA 4XPHH 5EU5A 4TUKH 5IIEB 1T1YA 2VXVH 4P3DB 3LEXA 3K80A 1IAIM 3BEVA 3PXHA 1DQJB 3KAAA 3QXDA 1QO3B 3J7HA 5D7KD 3S4SG 3VGHA 2QQNH 4JFQA 4NOFA 4PRIE 2DQFA 2B7DT 1AXTH 2ZUYA 5AZEL 3FQRA 1ACYL 1B6DA 1NLBH 3O4LB 3AY4A 3ZDYE 5L9DH 4ZUVB 3M07A 4PIRF 3GIVA 1T6VN 4JRYD 4LPCA 4PJAA 3V52L 3C9NA 4WO4D 2YKLH 5AWNH 1OAYL 3HNTL 3KXFA 4Z8FL 2BOCB 5FM5O 1J1OH 5IEHA 12E8L 4DN4H 4N8VG 1EO7A 3PHQB 3ARBA 4MQ7B 1PGRB 4AENB 2GJZB 7CGTA 4G6AD 4RA0C 5I66B 1GGIL 4Z76B 3CSYB 4JFXB 4D0DA 4DK6A 4PJCF 1QRNA 3BPLC 1NCNA 3DX8B 4ZAKC 2LFGA 2AXJA 2Y23A 3FCTA 2DWEA 4Z7WF 2X4TA 5D1ZB 2R69L 4PJHE 4FXLA 1RUML 4YDKL 3CUPA 2D9CA 4GW4A 4TSBL 4HSQA 2NXYC 5I1JL 1X5GA 1C1EH 1YUHA 3WL9A 1IT9H 1OB1A 4PJXB 2NY3D 4H88L 3IAGC 2FNBA 1FNFA 3VXTA 2ZNWA 1FNSH 1R3LB 4F7MB 3G5XB 4PJDF 4BK4A 3WFDH 2D4FA 1JV5A 2YPVL 5LCVL 1JPTH 4GKNB 1FGVH 4E0RB 2AK1L 3I75B 5FHAL 4XX1E 3DTXB 4PJEB 4YBLB 3TBWB 1H8OA 2EDQA 5I74C 1XIWB 1FFPB 1FNGB 5DR5H 3MLXL 2IJ0C 4M7LL 1ODAA 1VFAB 4OTXH 5J6GB 1ONQA 2AQ2A 2VRAA 4WTWA 3GSWB 4F33A 4M1GL 3Q2CA 4CDHA 4XXCA 1E4WL 1YN6B 4FFWD 1QBBA 3RHWF 3KXFE 3B2UC 4XVUC 2DOCA 5JUEH 2Z31C 3HS0B 3SO5A 3C6LC 3CDFA 3QG7H 4HAFA 4JAMA 4L3EE 4UINL 2J6EL 5HI3D 5EN2B 4G9DA 4G8GB 3ALPA 1FLTX 1XCQB 4X6DA 4PYGA 3PHOA 3JV6B 3U4BL 5DMKA 3ZKMC 5MEPB 1QRNE 3BQUD 4OCYH 4KMTL 1T0PB 1Q9LA 5DQDL 4GKSA 3GSVA 3HE6C 2ICES 5ESVA 3WFHA 5ICXB 3O2DL 5E2VL 3BRDA 4RGMB 3HPLB 3RJDA 1UH3A 3U4AA 3OKKB 4RDQG 4GFTB 5A16B 3Q5TA 1RUPH 4O2CA 4PJFB 5E4IA 4JFDB 5I16B 4XNXL 1NCAH 4AQOA 3MJ7B 1A7RH 1N3NA 2R4RL 2W65A 3D25A 3KJ6L 4L4TA 4QT5A 4NHUA 1NBVL 1PY9A 4ZPTB 4P5MA 5DQJB 4ZUSA 5HHMB 4KJWD 4JLRB 4QTHA 3OJMB 4AK1A 5F96L 5C6WH 3MFFA 2JCCE 2XTJC 1BJ1J 3D85A 2E27H 4U6VH 3NA4A 2DICA 5JLZA 4HXBL 1U3HA 4FQCH 1FAKT 1XT5A 4OT1H 2Q8AH 1WWBX 3IJSA 1VSCA 4AZ8A 3JWOL 3PWVB 1KIQA 2IWGA 3DX6B 1QFUH 5KSAC 2QQNL 4TVPH 2W60B 1OGAA 3HE7A 3RWIB 3U7YL 3WSQH 1QVOB 5HHPB 5MI0B 5C0AB 5H8DA 3UJIH 2DRUA 1EAPA 3UXFA 3WIFB 4KJQC 4Z7VB 3PV6A 2E6QA 1YEFH 4X6DE 1YNKL 3PDGA 1EVUA 4O02L 4FQJL 1DQTA 3QXUA 3GSXA 4NHCH 2CK2A 4HLZG 4DN4L 4OF6A 2R1XB 1H3WM 4ZXBC 5J9PA 5JXAH 1JNJA 1N4XL 3UJJH 2YEZA 4X4XB 2ZCLL 3C5JA 2GYSA 4DOHB 1A4JA 5F9JA 3LDBC 3TN0C 5TGBA 1S3KL 1V3JA 1C7TA 3QQ4A 15C8L 3DUSB 1W0WB 1EDQA 3CPLB 4BH7A 5F7NC 4MSWA 4O51B 4OLXH 5DC0A 3IU4L 4L4TE 4TOYH 5GS0H 4JPKL 3I6GA 2HT2C 4RRPA 4KROD 4EBQL 5MENB 4JRXD 3GJFA 4G6ML 4NKQB 1FNSL 3RVUC 4JKLA 4LVHB 3JWDL 4G6KL 2ZUXA 4LSTL 4FHBD 4YDIL 2I07B 3M17A 3QPXH 3GHBH 4KUZL 4MZ3A 5D96B 1ZLWH 1ZA6A 4UNUA 3HRZA 4NNPH 4PV8A 1FSKC 2ICEB 1OGAE 4WJ5A 5JQ6L 4LHUA 4HWZA 3MMEA 4XNMB 1EGJH 3FKUS 3M1BA 2XNAA 1IKFH 1NCTA 2R0LL 4ZS6D 1MIML 3IXAA 4KGJA 3H42H 2A6JA 3QIWD 1Z6JT 2C3GA 3O6MH 4PJ8A 3REWA 1KCRL 1A0QH 1MJJA 1SYSA 2G60H 4WEUD 4Z95L 3PWPE 1D5XB 1INDH 3TO2B 4OLZL 5JO5B 5JUEL 2DWDB 4KDTC 1A5FL 1PZ5A 1U6AH 1KUMA 4JB9H 3MGOA 1CFSA 1Q0XH 2NXZD 2R2HA 5F71A 5IQ7L 3EDEA 1VEMA 1F3DH 3FB8B 4LLUA 5SWZB 1VFUA 1XF2B 5JDSB 2VC2L 3R0MA 4H26B 1F5WA 4N5EC 1K6QL 3R06B 1L7TH 5IFHL 1GJIA 3TO4D 3GMOB 3T2OA 4JKPH 5FECA 4OLYL 2LU4A 5C0FB 5B8CC 4PY7B 1FYHB 3KYKL 4HUMB 4POUB 3Q6FA 4S1RH 5EUKB 3T08A 1YY9C 5IV2B 1QBMH 4LCUA 1A7QL 5FYKE 3TC9A 1OP3H 1AR1D 3SDAD 1MCHA 1I9EA 4LKXB 2D7OA 3BKCL 4V2BA 1UM6H 2IPKA 4XCNB 5E94A 3T65B 3TIDA 1HILB 4PBWD 3F8UB 3OAZH 5C9JB 5I75C 1RZFL 4MAUL 2I24N 4PBVC 3CMGA 3MUY1 4OQTL 5JA8B 5E8EB 5FV1L 3HZVB 1UWGH 4H1LH 5DI8A 4DGVH 4OT1L 2BSED 4NPYA 2UWEA 4MA8H 4TRPH 3MLSH 2ADFH 5JOFB 1E4JA 5C6PB 3C8KB 1DQLL 3VFOA 4HIHA 2WIMA 1Q1JL 4J6RL 3X14A 1OAZL 5IVXE 5IB2B 4EQ2A 1Q8MA 3NOIA 1Y18A 3QIBD 3V8OA 3TBYB 1T22B 4JM4H 4PLKD 5DFWH 1TNMA 5I17B 2O5ZL 1X5JA 1RZJH 4NJAL 3I9GH 4M6AA 3VXSB 2VZOA 4JKMA 1UM5H 4PJBA 1TQBB 3AY4C 3IJYB 2ESVE 4NFCA 4Y19D 1OAXH 3BFOA 1H3XA 3BSZL 4H5SA 3LRSB 1C5CH 3CFBA 4HWBL 4CNIB 1W72B 4Y5YB 3RPIA 1JNHA 5EBMB 3CC5A 1J8HE 2I5YL 4GW5B 4ODUA 1JN6B 1KELH 3P0YH 5GGVY 4KVNL 4ZO9A 3KS0J 1G7LB 2XIDA 3ARBC 4Y88A 1IZKA 5SX4H 2F53A 1G9NH 1C5BL 2DQTL 4M1CD 2ED9A 5E0QA 1LP9A 1A7NL 4OLXL 2FX9H 3GNML 5DA4A 1OSPH 4LFHG 5TDPB 4EDXB 3MO1B 2XWTB 2OM5A 3RDTA 4YHMH 1SBSL 4JVPA 2NX5D 4WFEE 4JO4H 2FEDC 3RVWD 4O2FB 2A77L 1IGIH 4FQ1H 1Z0NA 1LO4L 1Y6KR 4LLDA 5HGBB 2UWEE 3VMNA 4FQHB 4ZTPL 3RWEA 2R0KL 3TBTA 3B9KA 3VFSB 3NIDE 4KHTL 4YJZL 3KNBA 4KKNA 2NLJA 1PZUB 5CZXD 3HI1A 5JOEA 3IGAA 5KSVA 2NY6B 1HH6B 2BVPA 2XPGB 4M62H 2PCPB 5D71L 5D1QD 1MFEH 4JHBA 3N1PC 4NO2B 1N59A 4JFPB 4X7SH 1MHCA 5JW4Q 1JK8A 3MRCB 1HINH 3QZWA 1NGZA 4X6EA 5MP6L 3QWQB 1TPXC 4WFHE 4JG1L 3ESVF 2F54D 2HRLA 3RIAF 4MJIA 4PJBE 4KKCC 4L8DA 1BF8A 1GCFA 1JPGB 1T2QH 4YGVB 3C60D 5FKAA 4LOUD 3STLA 4KHXL 3P77A 3QJFB 4TSCL 1I3VA 4UIMA 4XXCC 5EORH 4M6OH 4QXTA 5FYLL 5JW3H 3PWLA 4YBHA 5DHYB 1L9MA 1XF3B 2R39A 3IAPA 4LDOB 2ZCHL 3IDXH 4UAOB 1S7SB 4S1RL 1R3IL 3ZT7A 5FUOH 1QBML 1EEZA 3PP4H 3HMXL 3IS1X 3SBWA 1CE6A 4OBSA 4Y4FA 5K9JH 3VXMD 2YRZA 4DVBA 3W0WB 3OB8A 3BP5B 3VI4F 4QHKI 4XCFL 1J18A 3C09B 3CLEH 5BRZA 5LAXA 1J5OH 3STZA 2VDKL 2JJUA 2YZ1A 3P2TA 1MFDH 1I8MA 1Z9LA 1U8HB 4NKDB 4ZUWA 3CX5J 3TCLA 3UBXI 4YIQA 5F1SA 1A3LH 2BSSB 3DRQA 3OTTA 2DJ4A 3CCHB 5IVOA 2NY4B 1RK0A 5EWIL 2X1QA 5I0DA 1BGXH 5E1AA 4Z7OE 3TA3B 4MJIE 4P9HC 5ENWB 2BX5A 4E9LA 1U3HC 1OAKH 1U8OA 3U0WH 3GSOB 4LFHD 1KCSH 2XXMB 4OGZA 5SWQB 4XBEH 2GCYB 2LU3A 1U92B 1A2YB 4KV5F 3HE7C 4FMFA 3MA7A 1X4YA 3MREB 1YMMB 3F7VA 3WS3A 1ERNA 3TZVD 1R3KB 5EO1B 3TCXA 5CD3A 2A74B 1OAUL 2VXTH 5JZ7D 1CDBA 1YEDB 2X1OA 4FZ8H 3U7WH 2VXSL 4QF1A 1DUZB 3MV7B 3CSGA 4P5KA 2VSCA 1MCDA 4H0HB 3GKWH 4PLJC 1A6UH 3OBAA 4X6CA 2M8XA 4G5ZH 3ZTNH 1S5HA 1P4LA 4XVSH 3ES6B 4JZOA 2AXFA 3PWNA 4KKBD 4ZUUB 3KDMA 1MHPH 5C08E 3KPLA 2VUYA 3MNWA 4O9HH 3S88L 5BRZE 2FJFA 1FCCA 4OZGA 3KLDA 4GG8B 1EHXA 5HY9A 3ZMRA 1QA9A 4BQ9A 2B1HL 5CBAB 3ZE1E 2UVEA 4XP4H 5ITBL 3MZGB 1MFAL 3HNSH 1S9YA 4OCRH 1A02N 4D9RE 4LARL 2NYYC 2CRYA 5CP3H 3RZCB 5T1KA 4DTGL 3WDJA 2UVFA 3UTSB 3D1MC 4NM8H 3MRRA 5GGSA 3ARDD 3T2PA 4I77H 3L6FA 3LKQB 3KPSA 5DMJB 5H2BB 4HIEB 4OFKA 4M7KL 1AIFA 3K8KA 2HRPL 3O6FB 4F58H 4QYOB 2J8UE 3I02B 3PL6A 1ZT7A 3ARUA 1CGVA 4JG0H 4BZ2L 43C9A 2H6PA 4TUJB 1N6VA 3FFCA 4KUCD 2HMID 4GRWH 1I8KB 4QXGL 1JGVL 2A1WH 5E56A 3C5ZB 1F6FB 3BKJH 4PJ8C 4ETQB 2WIIB 3MLZH 1WFNA 1LWRA 4R7NB 3DSFL 2OTUA 1YPZE 2CDFB 1NGXB 4LIQE 4X6CE 5T3XE 4N0FB 3FB5A 4XP1L 1G7IB 4LRIA 2XZAH 3ZLQC 1AQKL 3FT3B 1I1YB 3ULSB 5GSRB 1AQDA 2EE2A 2VTFA 3EFFB 1OD9A 2VLJE 4I18B 4UILH 5AAMA 1W2KT 4J8RB 3QNZB 3LD8C 5F9AC 2D7MA 4HPOL 1J1PL 2NY0C 3IDUA 5CSZB 3W11C 5J13C 2VABB 4BUGA 5EDXA 3H3KA 1U91B 4HHAA 3NFNA 2J4WL 4P4KD 2VR9A 3S5LG 3QFJD 1VACB 4M48H 2R8SH 5IIEA 2H1PH 4YFEA 3KPSE 4P3DA 2XI9A 3RX8A 5KS9B 4XCCL 4EN3B 4NN7C 3JSSA 4S1QH 1DQJA 1XR9B 1QO3A 5TF1H 3S97C 5HHQB 5C2UB 2X4RB 1UB5B 4X6FB 3O4LA 3HRPA 4KUCF 1CXFA 5HVGB 1UA6L 4ZUVA 5FB8B 4KQ3L 3LSOB 4RMSA 3FFCE 1GPOL 4U7SA 4PRAB 1BVKB 2EKSB 2VERN 1KJ2B 5EULV 2MKWA 5D8JH 3S35H 2GJJA 3EZJB 3MJ9H 4HUKB 5INCB 4DW2H 4GAGH 4ZFFB 2BOCA 2AS5M 2BK8A 1RZ8B 1QFHA 3R1GL 3PHQA 3BH8B 1TITA 1E6OL 1JVKA 4MQ7A 1OVZA 4AENA 2GJZA 4ZUTB 5I66A 5C0CB 4Z76A 3CSYA 4JFXA 3B8YA 2IPUG 3ARZA 5KVEH 5C07B 3U7WL 2BFVH 3DX8A 5IW1B 4ZAKD 1AJ7L 5EZLB 5D1ZA 3RI5F 3NCMA 1S7UB 3H7BB 3NCBB 4B7LA 3VXRD 1QQDB 4D3CL 2FH6A 2NXYD 3MUZ1 4PJXA 3WDHA 4XP5L 3AB0B 1S9XB 1T3FB 2ZUVA 1ZEAH 2YD2A 5EA0L 4PRHD 1JNNL 1R3LA 2VAJA 3HNSL 4F7MA 2A9ML 3G5XA 5K59F 3TNMB 3OL2A 2VH5L 1BOGB 2FH8A 2YSSB 4GKNA 4L8CB 1DSFH 4E0RA 3I75A 4KK6C 3RDTC 2H32H 5DUML 1Y6NR 3DTXA 4LQ1A 4PJEA 4XP9H 5F1NB 5IB5B 4QRSB 3TBWA 5K93A 1XIWA 3KPMB 2MQ0A 3RQ3A 3MLWL 5F6HI 3MRHB 1FFPA 1FNGA 3VXQB 1TJHL 1VFAA 4K3GA 1A1MB 2XACC 4O2EB 3BH9B 5J6GA 5DGQA 1MJ8L 2D9QB 3B9KC 5ALCL 1RFDL 3GSWA 4F58L 1VFMA 4CDGC 5BV7C 3B3IB 1YN6A 3L3JB 4CKVX 3GO1L 4LDLB 2NY7L 3B2UD 3HS0A 3CH8A 3ME0A 3V9FA 1QLFB 4NO0D 2VE6B 3C6LD 4PJ7F 5EN2A 4IRSD 4RISL 4G8GA 1XCQA 3F5WB 1A7BA 3HG1D 5FDYA 2P5EE 4ENEC 3JV6A 2C3WA 4M7JL 5CILL 5MEPA 3Q1SH 4EOWH 3ZKMD 1KEMH 2H32B 3WN5C 1X5IA 3N9GH 1LE5B 5ICXA 4NN6C 2VDRH 3ULUL 2ITDB 3HPLA 2DB8A 1NUNB 4WGVB 5ACLA 1N6QL 3OKKA 1JZ7A 2PW1B 4QXWA 5A16A 4BELD 5LKNA 3SJVB 3PV7A 4MS8D 3HC3H 1FYTE 4PJFA 4P23B 2ZJSL 4JFDA 5AUMB 5I16A 2WQ8A 5ID0B 1G6RL 4L4VB 4HJ0D 5EFIB 1J86A 1A14H 2B2XL 2EDTA 4ZPTA 4P57B 2OXGA 4JLRA 2W0FB 4K7PH 3EOBB 1MH5B 4Y4FC 4PJEE 2XTJD 4J1UB 1R0AL 2B5IC 4LQFH 3I50H 5I1GH 1E4KA 1OTUC 2P7TB 2NY2B 3QUXB 2GK0B 4FQ2L 4X9BA 1J05B 3PWVA 4ACPA 4S1QL 3G5YB 3OSKA 3DX6A 4PJ5D 3L9RB 4R26H 5KVGL 2DM7A 1FE8H 4NQXB 4DZBB 2W60A 5KSAD 3RWIA 1P5VA 5JOPE 1QVOA 4NO5B 2G5BB 5DRZB 5HHPA 1K2DB 3AREC 2X89D 5C0AA 4F15C 2CO7B 5DZNA 3WIFA 2VDOH 1WIUA 4Z7VA 4KJQD 5I18H 1J12A 4I3SH 1BQHB 3PGCB 4K2UL 4NQTA 2KKQA 3ARWA 2FX7H 4ESKA 5L0QB 4WI5A 1WF5A 4NWTH 3UZEA 1DUYB 3KLHC 1CXLA 2R1XA 4ZXBD 3FZUC 4X4XA 1FG9C 4DGIH 2X10A 2I60L 3NA9H 1KSRA 3KJ4C 3SE9L 1GH7A 4PJFE 3SOBL 3DUSA 1FAIL 1W0WA 3CPLA 4O51A 3VDAA 3OGCB 5DD0L 1DBMH 1DBKH 3BD5A 5HHME 4YK4B 5D70L 4GXVL 2VLRB 5MENA 4R4BB 2APXA 2WV3A 2AI0H 4ZO6A 1MY7A 3RVUD 1CQYA 4HCRH 3EYQC 2I07A 1OP9A 5I30L 3ZTJG 1LMKA 3N85L 4R97B 3QQ9C 3MOQA 1OT2A 1MRCL 5SWSB 5T33H 2ICEA 5F9WB 5CZVH 4HC1L 3KPPB 1JPFB 1MCSA 3KPRD 4XNMA 1I1CA 5FA3B 1KACB 5C0AE 5F1KC 5L2KB 5CHNB 4E41D 5IW3A 5L8JB 5E6YA 4Z7QE 2EICA 4N5UA 5A2IH 4PJIB 4P2OD 5IJKA 4Y4HC 3TO2A 1D5XA 4DZ8B 3U1SL 3K8MA 4UTBL 5JO5A 1DVFB 2DWDA 2VJXA 1B0GB 1QYGH 2X1WL 2YD6A 4C83A 4OZIB 3JV5A 3ARXA 3ZKNC 3G6JF 3FB8A 5SWZA 3K74B 3PL6C 4DOHE 1XF2A 5JDSA 4H26A 4MNGB 4UT7H 4D0CB 4N5ED 3R06A 4L5FH 3P11H 2OK0L 3NPSC 3LCYA 4TVPE 5CJ8A 3GMOA 2XQYG 5C0FA 4PY7A 1U2HA 5EUKA 3LAFA 2HP4A 3DGGB 2GSGB 5IV2A 1YY9D 3T2QA 3MA9H 3O3DB 5MENE 3QHZH 2EE6A 4LKXA 1B2WL 4XCNA 1UKTA 3T65A 1HILA 5C9JA 2DLFH 4HKJB 4WFFD 2VDLL 4OJFH 3OKDB 2OXHA 2B20A 1HCVA 4LRIC 4KDWA 4RFOH 4RAUB 5SV3A 3I84A 4KPHH 1I9IH 1KFAL 4R8WL 3DMMB 3RX7A 3E8UH 3FAWA 5DVOA 2WSKA 2IBGA 4K8RL 4JCMA 5BS0B 3B4NA 2FLBT 2MFNA 5E8EA 4FQLL 4CRPA 3HZVA 4JY5L 2KZ1B 1TQCC 5BOPA 5JOFA 4PJCB 3CZJA 3SDDB 3C8KA 3E6HB 5H35B 3F12B 3AMLA 4QHUB 4F8TA 3MLYL 2EH7L 2KDGA 3NZHH 1WBZB 1JRHI 4RGNE 1GGBH 1F2XK 2J7LA 5IB2A 3FQUB 4WHCA 4TTGA 3TBYA 1T22A 5CEXB 5I17A 1NMBH 4X99B 3SGJC 3V79C 1JHKH 3ZT6A 3VXSA 3VFGH 5SWZE 2QHRH 4U3XA 1MWAH 3BISA 1MHEB 2HAZA 5KZCD 1TTGA 3K81A 1E27B 5FCSH 3IJYA 2FBOJ 3V7MA 3LRSA 2FO1A 4P3CL 1A7OL 3QHFL 1T0MB 4CNIA 1W72A 4Y5YA 1WUNT 3D0LB 1PSKH 3PQYB 5EBMA 2OL3L 5C0BE 1ZK9A 1F3DJ 1K5NB 4GW5A 4LSSL 1F90L 4JHWH 2HLFC 3KXFD 1JN6A 4MDJB 2A9NH 3QDGE 1G7LA 3ARBD 5K9QG 3QEHB 2J1KA 2Z35B 2BHZA 5F7MC 4WO4B 5TDPA 4EDXA 3MO1A 2XWTA 2VZUA 1RUQH 1UJTA 1MWAB 1YN7B 5D1ZC 1FFRA 2FEDD 4O2FA 4WCYL 4FMKA 4M43H 5L88L 5FUZL 1RZ7H 3UBXB 2CGRH 3HZMB 3SQBA 5HGBA 4FQHA 1MLCB 3VFSA 5I8OL 3SKJL 2AP2A 2FX8L 3PP3K 3GK8H 5FGSA 3FN9A 3MV8D 1HH6A 5K33A 3O6LL 3PDOB 2XPGA 4LPUA 2PCPA 2QSVA 4MLSA 4X8JB 4NO2A 4NOBA 4JFZH 3F7RA 3QDAA 1OWRM 4JFPA 2RQ8A 3MRCA 5I76B 4NM4H 3VD3A 3SGKA 3I3EA 1IAII 1XIWC 5F7DA 1UACH 35C8H 4MA7L 5BQ7B 4WHDA 3GIZH 5GJSH 4KKCD 1JPGA 4YGVA 4HKBB 4L9DA 3ZO0A 4AEIL 3K1KC 5F1IB 4Y5VB 5ADOH 1KJ3H 3S8WA 4HIIB 1NCUA 3QJFA 2MTPA 4U6YB 4PJAF 1MFBL 1AE6L 1OL0A 2NW2B 1CL7I 1RHHB 4RRPG 3DIFB 4WW2A 3CVHL 1WAAA 4UT7L 2ZOKB 3DXAD 4OCXH 5DHYA 1XF3A 1KCKA 1M4KA 3TT3H 4W81A 1S7SA 3QEUB 1MCPH 5HHNB 5AEAA 4D94A 2OJZL 4M5YL 5HYJA 1K4DB 1N8ZB 5ICYB 3MOBL 4LAQH 5GHWH 5IKCB 3TH3T 4U2ZA 4M5ZH 4CW1B 3W0WA 3RGVD 3BP5A 3NTCL 4XPAL 1S7QB 1A7PH 1EJOL 3QDME 4P2RB 4M03A 5EB9A 3V5DB 1U8HA 4NKDA 1DBBL 2BSSA 1X5AA 4ZOAA 1CFVL 2APVA 3V4VH 4NZUL 2R0WL 3CCHA 3DV6B 5C3TA 2W1NA 3SKUD 1RURH 2EXWC 2RCSH 3O2VH 1YDPB 3B2VH 3D85D 3TA3A 1TZHB 5DJCB 5ENWA 3GSOA 2FHBA 4Q9BA 4I3RH 4G6JH 1NCBH 2E9WA 5SWQA 2GCYA 1JHKL 3N50A 1U92A 3OAYK 1A2YA 4WUUD 1MQKH 3HE7D 4ZG1A 4N0RA 3MREA 1WAAE 5DFVD 1YMMA 5MI0C 3MLPA 1GC1C 2AJVH 4B7IA 2PUQT 1R3KA 3WNLA 1OM3H 5EO1A 4M6NH 2A74A 1FO0H 2HKFH 1YEDA 5HDQL 1YC8A 1DUZA 3MV7A 5HYJE 3F58H 5CP7B 5I19H 4XC1L 3UYRL 1WZLA 4ZFGH 4PLJD 4PUBL 4OV5B 5F8RC 3ES6A 4LVEA 3W0WE 4ZUUA 3PDDA 3C2AL 4J4PA 4XMLL 5T5NG 1G9EA 4GG8A 2IQAB 5CBAA 4XB7A 1XF1A 2YD4A 1M1SA 2B1AH 3KYOB 2EO1A 5IESH 3T04D 1CD8A 3V6BR 2NYYD 3T0EE 3RZCA 1GL4B 1JWMB 5DMIH 4PGCB 3EAKA 3UTSA 4KZEL 3Q3GB 4Y2OA 1TJIH 3DX7B 3GK8L 3LKQA 4PP1C 4KZDL 1W0VB 4GAJH 3MCKB 5H2BA 4OLWL 4HIEA 3UC0H 5D96C 2YOCA 3O6FA 4GXUM 5DWUH 3SE8L 4QYOA 3I02A 4AT6B 3WJJA 4MCZB 4MD4B 2YD7A 4OLUH 1ZLUK 4TUJA 1CK0H 1MJ7H 2CDEB 1I8KA 2R15A 3C5ZA 1QKZH 2VDQH 1A64A 1CLOH 1MELA 4HS8L 5CP3A 2WIIA 3D5OF 4ETQA 7FABL 5AYQA 4LPXA 1ADQH 4PPTA 2G2RB 4TSAH 4R7NA 2CDFA 1NGXA 2UYLB 2OTPA 1J8KA 4LKCB 4N0FA 3QIWB 2VLME 4HBQA 5EZIH 1G7IA 4DUWA 1HI6B 2EYRB 4GLRI 3FT3A 2IPUK 4P99A 1H3TA 1I1YA 4LPYA 3ULSA 4JQXA 5GSRA 3EFFA 2NXZB 5GHWL 1ZLSL 5GZOD 4I18A 1VGKB 2FHFA 4BA8A 4J8RA 5I1KL 3QNZA 5EUOB 4HLZH 3AFLA 4K9EH 4YEFA 5CSZA 2LV4A 2NY0D 3W11D 2VABA 1SY6L 1WWWX 1EEQA 1U91A 3S3PA 3TO4B 4KJPC 3NIGE 2AABL 4PD4K 1KTLB 3UTSE 1R5VB 3H3PL 2Q7YB 4B41A 1QLEH 1VACA 4CN4A 3CFKA 4RZCB 5KS9A 4IOFC 4EN3A 1FL5B 1XR9A 2BHUA 2CR3A 5HHQA 3FB7B 2AEPH 4D9LL 2K7QA 3VGGA 1RURL 1XFPA 25C8L 2RCSL 3LIZH 1UB5A 4X6FA 5DC9B 3DYOA 3GSNL 4NC2B 2OMBA 3DYPA 3K4AA 5FB8A 5IHBA 1S8DB 3LSOA 1VA9A 5BMFH 4PRAA 1BVKA 2EKSA 4GQ9L 2Q6WA 2DQGH 1V3LA 3QUMH 1KJ2A 1JGDB 3WXWL 5INCA 4QTIH 1FFNB 5HHXL 1PBYA 1LVEA 4ZFFA 1RZ8A 4TTDC 3BH8A 3KYNB 1NH6A 3RVTC 3S3SA 1EEUA 1RIUL 1OOAA 2A83B 4ZUTA 5C0CA 4HG4J 2WP3O 4WFHD 4TVSa 4AMKH 1F4WL 3IDGB 5C07A 4Z7NE 1IRAY 1TXKA 5EZLA 3HUJF 4DKEL 1S7UA 4ZFGL 3RVVC 1ORSB 1QP1A 4Y5YC