3EYUL

Pfa1 fab fragment complexed with ror2(518-525)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
218
structure length
218
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords If kappa light chain
publication title Structures of Abeta-related peptide--monoclonal antibody complexes.
pubmed doi rcsb
source organism Mus musculus
total genus 55
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2008-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eyuL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eyuL01
2IPTH 3T3ME 4NO3A 5DUML 4OZ4A 5BZDA 3X12B 4PLJC 2ZSVB 3I50H 5KN5B 4P2RD 3TT1L 3DURB 5J9PB 3WJJA 4N8VA 2HLAA 1IGYA 5BXFB 3HMWH 3VCLB 1OGTA 5IFHH 1CICD 1T03L 5JHDD 2NY5C 3K4DA 4XNXH 4MA7L 1MNUL 4Z5RA 2CKBA 3AROA 2AEPL 2XKNA 3AVEA 4PJXA 4A6YL 5KVEL 4Y1AA 1FYHB 1GL4B 4K7PX 3CFDB 3GSOB 1INQA 4OV6F 9CGTA 2IGFH 4GMSH 2PTVA 1QPXA 3BZEB 2XRAH 1A4JB 4F7TA 5J11C 3OX8B 4J3VA 3C5ZB 3DJ9A 1RI8A 1UWEL 3QHFL 3BSZH 4NZTL 2W9EL 1T1WB 4P9MH 4QRUB 1A7QH 4LSQH 2XTJC 1Q9WB 1B88A 3SDXB 3DARA 1PZ5B 2YD4A 1RMFL 1F3DJ 1MRFL 4KK6D 4QRPE 5FYJD 1LMKA 1CGSH 5DUPH 5C7XL 3VH8B 4H1LA 1EAPA 4OFDA 2OBGA 4X7FC 5D4QA 5HSFA 3MLUL 1N6VA 5E8EB 4EN3C 4XP9H 2BOCA 1EV2E 5DJ2A 12E8L 3BH8B 1XR8A 1J7VR 1U8HB 3ZHDA 1BVLB 3HAEA 4FMKA 4PJXE 4UOW1 2KZ1B 3T0EB 1NAMB 4Y1AE 3X11B 2VAJA 3B9VA 4C55A 4PJGB 2QHLA 1HEZB 3CX2A 1KJ2A 3F7RA 5CWSA 5T5NG 4QYOA 2NLJA 3L7FA 4YBHA 1NANH 1I9RL 3V0AC 5LAXB 1G7JB 1V7MH 3QQ4B 4YXHH 1MUJA 3U9UB 4F57L 5CGYD 3ARBB 3LQAL 4KY1L 4L3EA 3P73B 4XNQB 5DFVD 4NKOB 2ZOLB 3VFUA 5D71H 3QEGH 3NCCB 3ULUH 4HJ0C 4WU7B 1FVEA 2X6MA 1U91B 1LK2B 2AJYH 3UBXA 4DFHA 5DMJB 1S3KL 2JCCB 1JNJA 4LF3A 4R3SA 2JLLA 3MJ7B 1YDPA 3EO0A 4IRZL 3UO1H 3B5TA 4DVRH 1F6AB 1YNTB 4X7TA 5GRVK 3CH8A 2FJGA 1JNNH 2VXSL 4RDQF 3I9GH 4XMPL 4PJAA 4WENB 2AJXL 1Y6NR 3D0LA 3VWJD 5DRXB 1M6OA 3SGKC 3K3QA 1QO3A 4P4KB 5EZLA 1DTUA 1YEEH 5D7JB 3ZKNC 1AIFB 2AGJL 3NACL 4OCYL 2XZQL 3PWUA 4RNRA 2Q7NA 5I6XC 4F7PB 5DJ6A 3G5ZA 2C1OB 2P45B 4L3EE 3HB3C 4JO3H 4UAOB 1CE1H 2IG2H 4ZODA 5TF1L 2H26A 1DQLH 4WWKB 5BV7C 3DI2B 4RA0C 3MXWH 1PBYA 5GS3A 1L6ZA 5JOEA 3CDGA 2IADB 2VLJA 5CILH 1E6JH 2HTLD 4I8DA 3ZDZF 5DQDH 5I76B 7FABL 4PJEF 4YXKL 1YEDA 2FJHB 2XY1A 3C60D 1WEJH 3L3DA 1NCAH 4IRSA 1OSPH 3T0EC 3TBTB 2DJ4A 4JVUA 5D2LB 5CD3A 2VQ1B 1G9MC 1GYAA 5LG1A 3T0DA 2XWTB 4PJAE 2W0FA 2Q87A 1X5AA 2IPKB 4YAQB 2VQUA 1J05A 4MCYB 5E2TH 5FCUL 4Y4HD 2XA8H 2CDGB 4HKBB 1NMAH 2EDNA 2BXYA 4HBCH 2C4XA 3VWKD 5GJTL 4G8FA 3PL6D 3LRGA 5J4MA 3S9DB 3Q1SL 2R1YA 2VDNL 3Q2CA 5GZNC 1CBVH 1AQKH 5JOFB 1EJ6A 2A0LC 2VLJE 4LVEA 1JPTH 1T5XB 2BRRL 4XVJL 5EPMB 3CXHK 1ZT7A 3L3IA 3BOVA 3SCMB 3S37H 3FOMB 3M1BB 2OR9H 4ZXBB 3IT8D 4H0HB 3BN3B 4Q0XH 1FFNB 4OKDA 2YEZB 3HZKA 3UPCA 4P3WA 1IL1B 3M17B 1JN6B 1EMTL 3E8UH 1DBAL 4AEEA 2HLFD 3KPSD 5IF0A 4Y4KD 1U8NB 2EYTA 1Y18B 5E99H 4X0KA 4X7EC 5GISL 2FGWL 3NCYS 3VMPA 3VFVB 2GUOA 3QDMA 2VDOH 1UYWL 3GHEH 1TZHB 1Q9KA 1CE6A 1MOEA 1T22B 1BQHG 4LQFL 3WIHA 4WFHD 3TVMA 1H8OA 2FEDD 2XWJA 3DROB 3HCVA 4ZPTA 2R8SL 1BEYH 5TFSL 3IVKA 3B43A 1JNLH 2AV1B 3RZCC 5D70L 4HGKC 2VL5A 5BVPH 4K71B 3WKMH 5J56B 4N0UA 4WDIB 1PLGH 5F93C 3F65A 2APBA 4U33A 2D3VA 3ZYOA 3BZ4A 3SDCB 4QNPF 5IQ9A 5J6GB 4MJ6B 3IDGA 3MV9B 3C8HA 5IV2B 3EOTL 4LLMB 3QIWA 4OZGB 2F74A 1GGIL 3O9WB 2O61A 3U4BH 3V7AE 5F6IB 1JFQL 3QDME 3GNML 1HKLH 1I8KB 5CUSL 1KEGH 4BA8A 1WC7A 2ZG3A 4DN3L 3DVFA 4O02H 5JQHC 3KPLB 1T4KB 2R0ZH 4WTXA 4OUUA 4P5MA 3VXQA 3D9AH 1FZOA 4ONGH 3QQ3B 4ZS7H 5D6DA 5I1AA 1KYOJ 4P99A 4NNYA 5FUZL 4N0UE 1G6RB 2YPVL 4X7CC 2X9XA 1VPOH 5DR5H 3RU8H 5GRVL 3GM8A 4NGHL 3DHJA 1OM3L 4HC1H 3EDFA 5BRZD 1TZGH 2R1WB 4KVCH 2QEJA 5I1HH 1JIBA 2PYED 5FM8A 3BEVA 1R3LA 3O3EA 1SJHB 5FYJL 5KVGL 4GAGL 5ETUA 3GHBH 4A2MA 3BHBA 1KN2L 1FL5B 3IJHA 3LQZA 5DZOA 4PB0L 4BZ2H 2VITA 3RX5A 3ARBD 3IXTB 3VXSB 2Q86A 2EC8A 4IMLB 4J3WA 2BC4B 5LGJB 4TUJB 2R2HA 1J8HB 4JO4L 1MHHB 3CFEB 1V7NH 3WUZA 4OF0A 2K1MA 3L95B 2B1HH 2EICA 4WW2B 2IH1A 2UY6A 1A1OA 3GMRA 5EO0B 1GGBH 4LGPB 3TA3A 1T04A 1FAKT 2ESVE 3JWDL 3D39D 3OKLB 4OD2A 3KJ4B 4IS6A 5TDNA 1CFVL 1I3UA 4QGYA 5IFJB 3FQXA 4IDJL 5E2UH 5I8KL 4I18A 5GGVL 3L1OL 3TV3L 4HKXA 4L4VD 1CDGA 3IFNH 5HGAA 4TPRH 3LS5L 2Z92B 3K80A 3ILQD 1HHKB 2X44D 1U36A 4XC3H 4P4KD 1C1EL 5D7JD 4M8QB 2VLLB 2FYYB 2FO1A 2P5WA 2PTTA 1JZ3A 3GKWH 3HN3A 5GS2H 5GGSY 3FB8B 5KZCB 1NGWB 3S3JA 1IEHA 1XT5A 3JWNC 3ZDZE 5I1KH 4HIEA 5IEKA 5JPMB 1U8KB 4WWKD 4CW1B 3BPNB 3Q5YA 5FOBB 4JO1H 3JTSA 4FQXB 2VDML 3ZO0A 4XT1C 1NL0L 3CFJB 1IC1A 4PY8J 5ENWB 4NO5B 1QVOA 3N50A 2OJZL 3HA0A 4U2ZA 4K94C 5HGHB 3SDDC 1ZT4B 4P3CL 5IGXH 1JK8B 2E6QA 3TEUA 1GXEA 1QSZA 2YHGA 1BX2B 4RGNC 2PO6B 1P2CA 1UH4A 1FIGL 4MVBD 2LU3A 4YHPB 3ROLA 3WJLC 4HD9A 2FO4B 4NQEE 3T77A 3V4VH 5CJXA 5HHQA 3RL1A 3S35L 4JJHA 3IU4L 4KTDL 1ROWA 3PP3H 4LEOA 3D85A 3L3KB 1AGDA 4LSDA 3LSOA 3W0WA 3RAJL 3OAZK 5HHOA 3FFCD 4LSUL 1T0MA 5ERWA 1KCRH 2R1XB 1JNHA 2P5WE 5JA9A 3ZHKA 5HHNB 2FSEA 3OR6B 1EGJH 1QFWL 3ARDA 35C8L 3BYTA 4YK4B 4Z7QF 3CMOH 3J8F7 4JHAH 1ZV5A 3SDAA 2DWDA 3P9WB 3QZWG 3WHE1 4QXTB 3DVNB 5IVXF 3KJ4C 3MBEB 4F2MA 1ZLVK 3SCMD 1N5AB 4OZIB 1IAIL 2RQ8A 4ZXBD 1W0WB 5C0RH 1E6OL 1WTLA 4FFWD 4P46B 1LO2H 1MJ7H 1XF5B 3Q6GL 4JFZH 4CL7A 3HLAB 3IF1A 3KPQA 2EKJA 3OSKA 4HUVB 1WICA 2H32B 4HUUA 4BELD 2DJSA 4NQXA 1CFTA 3NA9L 3CZFB 4H26B 4CNIA 5I17B 3F6IA 5C0IA 3W0WE 5HHOE 4LVHB 3F7VB 1J0IA 2C3VA 3MUHL 2DIAA 4GW5B 3THML 3T0VA 2GSIA 5IHZA 1R3HB 2AEWA 4FFVD 3BPNC 5F7MC 1NPUA 2V5MA 5DRZA 5BQ7A 3KXFA 3MLTA 4LRNH 1A6WH 2BVOB 1IKFL 5KVFH 2B20A 3QCTL 1NC4B 1FFQA 1M1SA 2YK1L 4M48L 4QNPE 3B9KD 5CJQL 2PF6A 2PO6C 3P0VL 5T3ZD 2G9HB 4ORZC 1CS6A 5LKNA 1JGVH 4WUUA 1T0NB 4FQHA 4CKVX 3QT2A 5GGTA 5KSBF 1ADQA 2X70A 3SDCD 1HDMB 1OP9A 4P3DA 4Y4FA 2R0WL 2A83A 1IGTA 4ETQA 2CRMA 2G2RA 2Y9RT 1KXVC 3DX9A 1A7PL 4JQVC 5C2BH 4JHBA 2X7LB 4LLWA 3TNMA 2OMBA 1U8JA 1S5IH 3O9WD 4XVSH 1ETZB 3VFPB 3TBWA 4AIZB 2PXYB 5DJ8A 4YK4C 5D96B 4C59B 3SDYH 4YHYB 1JMXA 5ACZA 4HIXL 2Y1VA 5HPMA 4GBXC 1S7VB 4KROC 3HZMA 2EXYD 2FX8L 4U6YA 3K4AA 1NBQA 5KS9B 2BNRD 1NUNB 5C0AA 3KXFE 1GGUA 3GSVB 4MQTB 4Z9KB 2BCKB 3FMGH 1D9KB 2AXHA 1KPUA 3QXDA 3G5XB 1FZJB 1JGEB 3DXAB 4MJ4A 2C3XA 4X6FB 4NM4L 4DZ8A 5MEOA 1L7IL 1MFDL 3LEVL 4MJ5B 5LVEA 2H3NB 5FAAA 5T1LB 3T4YB 4K8RC 2JF1A 3QH3B 5EUKB 1KYOK 4QWWD 1HSBB 2ADGB 4WO4C 2X10A 1LK3H 4KGLA 1NAKH 4Y16D 4YZFF 1AQDA 4XNMA 4XI5D 5DFWH 4D8PA 5DVNA 3QUXC 2AP2A 3X3FL 2ZG1A 3LVEA 5MEPA 1FO0L 5LGHH 2NY1C 4NJ9L 5E2VL 4OBRA 1I1AB 5EFIB 1X5KA 1F4XL 4PY7A 2XWBA 3VXSD 3BJ91 3SKMB 3KJ6L 5C0AE 1AGBA 1J8HD 2H9GB 4I9WD 4ELKB 5AZEH 1E27B 2OTPA 4OQTL 4NYLB 3S4SG 2E8YA 4NQCD 4OZHF 2NW3A 2JB5H 5GGQL 1Z3GH 4HKZA 4GKZA 4XPBL 2I5YH 5GQBA 2GHWB 4Q9RH 3DSFL 3MNZA 5K9JH 4DGIH 4UNTA 2IQ9H 5TQ0L 4BQBA 2NW2A 3O8XB 3ZMRA 3TIDB 4XWOD 5JQ6L 5C6TH 4UUJA 3QISA 3MRFA 4PYHA 1KN4H 2APWA 2ATKA 4ZYKB 4XMLL 3BD4A 3RWCA 3ULSB 4LLAA 4F33B 2WV3A 5JPNB 4G6FB 2W60A 3GUTA 1H9VA 4LASH 3ARGA 4Y19D 4HULB 2N7BA 4S1SH 4OCLC 4PV8A 5ALCH 4HCRL 2QSCL 1UKSA 3VW3L 3LRSA 1D9KC 5KVDL 1OGAD 3R8BB 3U9PH 2ATPA 4NKMB 1BIHA 5L2KD 1VFAA 4FQXD 1YJDC 4XNUH 5DVMA 3PDOA 1OT1A 3ZE2E 1KXQE 4JLRA 2OP4L 4JKMA 1TQCC 1TIUA 4CVXB 3SPVB 5F9OL 2BVPA 3IDXH 1AP2B 3BJLA 4NHCL 4AH2B 2RJMA 2EDLA 1QFPA 2XFXA 4QTIH 2X4TB 1EEUA 4X4ZA 1JPGB 1QFWM 1RUQL 3HR5B 2Q8BH 5D1ZA 3P9LA 2UUDK 1N0XH 3QPQC 1Q1JH 2BOBA 2DBLL 4RIRA 1DN0A 2MHAA 4Z7QE 1RZIB 5DO2D 5DVOA 3O3BB 5B39G 3TCLB 2IAMD 1I1AC 4B7LA 1MQ8A 5EIIB 4JCLA 4MNQB 2O5XH 4R97B 3BIKA 4ZO8A 5FO8B 3N85L 4TSCL 5DD3L 1IAIM 4DW2L 1OLLA 4X5XA 2P5EE 1K85A 4YGAB 2A6IA 4LCIL 2X09A 1JGUL 2XKSA 1JPSH 4GRLA 3WEXB 4PRIA 5KSBA 4TRPL 1LNUB 1FLRH 3GBML 3MV8A 4ZAKA 1BZ9A 5D5MF 2KKQA 1DQQA 4HLZG 3UBXI 3IETA 1JHLH 4JZNB 3RIAF 1B9ZA 4NZUH 4P9HL 3SE9H 3VGGA 2DMBA 4P46D 1EJOH 5F72S 2H2PC 1YMMB 5FV2A 3DBXB 4D2NA 3QUMA 2X4PA 4YX2L 3IRZA 1ZVHA 3GMPA 4NOFA 5DT1H 5TE4L 3TT1H 4POZD 3CK0L 4TVPE 5JLZB 3OKNA 2WZPD 3O3AB 2IBZY 4MA7H 1HH6B 5TGBB 3VGAB 5C71A 3SGDI 2MNUA 4HK0A 1WZKA 2AEPH 3ARFB 5KOVC 4A6YH 5KVEH 4L3CB 3EIFA 4JHZA 5J1AA 3QRFM 1XF1A 2DQEL 4NRZA 1R24B 1KPRA 2C3HA 4OFKA 3BPOC 3FQUB 3I6GA 3BRFA 1RZ8A 4FXKA 4HT1L 4KKLD 4LCYA 1YC7A 4MNGA 4PRIE 3X14A 5KSBE 1UWEH 5E03A 4POYA 2FBOJ 1Z9SA 3MV8E 5MERA 2VZTA 1UACL 3WXWL 3GB7B 4WHDA 1DQJB 1VEPA 3ALXA 4EUPH 3QG6A 4WI7A 5DVLA 4X5WA 5C7XH 5I0ZA 4YFLF 5IMOA 1N6UA 2R9HD 2LU4A 3UX9B 1NSNL 3JVGC 3MLUH 4XXDB 2ARWA 3A0OA 1BZ7B 4FHBD 3I6KA 3TN0A 1EDQA 3QEUB 3PWVB 5KSUB 4Z18A 2A6KB 1DVFA 1HXMA 4PRPD 4E9LA 1MREH 1H8SA 1LE9B 2GT9A 3W11C 4JREB 5T3ZL 1AXSB 2WP3T 3IU3A 2X4RB 3DMMD 1FNGB 5FGBC 3UPRA 4NPYB 4OZHA 5HYJB 2DBJA 2DLEA 4MD4B 2ZWLT 1EEYA 1FH5L 3GSWA 5CJ5A 1I9RH 2P7TA 4MA1B 4MNGE 2GAZB 1XGQB 4S2SB 1HH9B 1QSEB 4F57H 3LQAH 1IRAY 4BFGA 4KY1H 2I60L 4YZFE 3U82B 4OI7A 5EBLA 1OW0A 1HYSD 1FN4A 2HP4A 2BSRB 2DI9A 2R2EB 1YY9D 1JTTA 5FHAL 3IAGC 4LCWA 3O6KH 1S3KH 3QPXH 2BY1A 3IFOA 3OR7B 3EAKA 1IGML 3QFJA 1JF6A 3NFSL 3LB6C 5DMIL 4IRZH 3Q5OA 3H42L 2QQLL 2EDHA 2BNQE 3MYZA 1MCQA 1T21B 2MKWA 3MRCA 5B38B 3WNPA 1DDHA 1S9XB 2VXSH 4ZUVB 1S9WB 5HHMB 2AJXH 5K93A 3PWNB 3MMEA 5DSCA 4DCQB 4OZHE 3GMMA 4U0RB 5ISZA 4PJIF 1R5VA 2QADB 4F7EB 1G7IA 3FQNA 1MLBB 2X4OA 1CXFA 3MRGB 5DD0L 4D9RE 5DD5L 3LHPL 3NACH 2AGJH 2XZQH 5B8CB 2B4CH 3PWJB 2AQ3A 4X8JB 3T4AB 1I4FB 2NNAB 1QZ1A 2RCSH 3V4PH 5E5MB 3VFTB 3TYFB 4ZOEA 4JFYA 1ZLUH 4D9LL 5FF6A 1OTTC 4Q9QL 1XCQA 3C9NA 4UNVA 2WIIA 3O8XD 1ND0A 1KG0A 3RY6A 1Q72L 2HFGL 4LCWE 3RGVA 1MI5D 5DZLA 1MHEA 4PGDB 4LHUD 3Q3GB 3L9RA 3QFJE 3Q6FA 4JJ5B 1MFEL 4G6FD 1XF4A 3ZTNH 3U83A 3VDBA 4XGZB 3WO3B 5JORA 4RAUA 4K23H 2DI7A 1HHHB 2CKNA 2VDKL 4EDXB 5CEXA 4LLQA 1T2XA 1VA9A 4U6TA 1RPQA 1YEJL 5E8DL 4Z7NF 1H3UA 1NGQL 5ISZE 5D5MA 1I7RB 2AJZA 3V6OA 2X4NB 4IRJA 1WFTA 3WUWB 1FV1A 2YMXL 1FC1A 1QFOA 1QRND 2XG5A 4XXCC 5E6IB 3TBSA 4EQ2A 4BFEA 4O2FB 3L5JA 4NUGL 4JM2B 3VFWA 3OB0K 4Y89A 5GJTH 2VIRB 3Q1SH 2VDNH 5BJTB 5CGTA 5A2FA 3MRBA 1T66C 3L6FA 3ES6A 3BN9C 1AXTH 1BF2A 2XN9A 4PB9L 4PJFB 4Z78B 1TVHB 2BRRH 2A73B 3M8OL 4XVJH 1KB9J 1U42A 4V1DB 2GTWA 3WE6A 2P24A 4FQCL 4EVNA 4ZFFB 2Z91A 1FC2D 1AJ7L 3LEXA 1ZHLA 3C5SB 3U0TB 3UAJC 4UBDC 5ID0A 2NX5A 4PLKC 3KPRB 3HR6A 1JPFB 4U0RC 1OF2A 3OKKB 3RNQA 1GGYA 1EMTH 2IQAA 1FRGL 3BIAX 4XCEA 3V5KB 4NN6C 5D5ME 3V6OE 2V2XB 2X9WA 2YPLD 4JRYB 2DQCL 4I2XB 3L3JB 1BJ1J 1UYWH 3O2DA 4LSPL 1ZHBA 4QT5B 2HFFA 3HE6D 1UJ3C 5GS1B 3VMOA 3RY4A 4LQFH 4OKVA 3MRRA 1T89A 3R0MA 4QHNA 3MGOB 1Z9MA 4KZDL 2ICEB 4YDLB 3REVB 2R8SH 3FO2A 4UT9L 2XN9E 4OD3H 5HI5C 1X44A 3N1MC 5H2BA 3BGMB 2XI9A 2DMKA 2WWKT 1KIPA 4D0CB 1LDSA 3WFHA 2BSED 4ZSOA 5GGUA 3ARFD 1P4BL 5DRNA 3ZDXE 1IBGL 4Q2ZB 3T1FB 5JR1L 2PTUA 3QUZB 3RKDC 3EOTH 5ESAA 43CAA 2YD9A 5HI3D 3O3UN 1KXTB 5E6IC 4QRPB 1T80A 4OZFB 1JFQH 3GNMH 4JM2C 1NFKA 4OZ4B 2Z31D 5CUSH 5A40E 1HILA 5K9OB 4EUPA 1KENL 1P84J 4JQIL 4DN3H 2HLAB 1IGYB 3U30B 2CIIA 1K5NA 4JKLA 5DZNA 5JXED 1OGTB 2OI9B 3MUJA 5DRWA 1AO7D 1KIQA 4JRXA 3RVXD 2CKBB 1A9EB 2EKSB 2VWEC 2X89A 3BVNA 2YZ1A 4R4FL 4JZJC 4DVBA 1J0JA 1ORQA 1PKOA 5FUZH 4Y1AB 4G6JL 3CLEL 5HYIA 3G9VA 3I2CL 4QHKI 1INQB 2YPVH 2YXFA 3MUZ1 4YXLL 4NGHH 4ZSOE 3MJ9H 4F7TB 1OM3H 3QXAA 4Z7WF 1U6AL 1T1YA 1I1YA 5IVZB 3ZYIA 3K81A 2DDQL 2BMKA 3GMNA 5FYJH 4GAGH 1MF2L 3FN0L 4GG6F 3QDJA 2NY7H 2FJFA 3BW9A 1FE8L 1KN2H 4PB0H 1EAPB 2GFBA 1QSED 5EWIL 3ROOA 3G04B 1Q9OA 4JDTL 2FECI 4OTXH 2DD8L 2BOCB 2BK8A 4JO4H 3VGFA 5TF0A 4JRXE 4MA8H 1XR8B 3BWAB 3S34L 4N8PA 5DLMH 3HAEB 3ULVL 1BVKB 3N1GC 3JWDH 3DO7A 3B2VH 4WFGD 2B39A 1F4YL 1SY6L 3RI5K 1CFVH 1F97A 1KJ2B 1D5XB 3CSYB 1MFAL 5CWSB 1CXIA 5D1QA 5I8KH 3QUZC 3L7FB 5GGVH 3L1OH 3TV3H 4DWHA 1F2QA 2X1QA 1RFDL 5HHMD 3DWTA 4M03A 1MUJB 1MEXL 5CCKL 4L3EB 1I9JL 1T1XB 2E5EA 4EQ3A 3QDJE 1C8PA 5BOPA 3DYOA 3EFDL 1P7QB 5IB1A 4NT6A 1YECL 2ICWJ 3AMKA 1RU9H 1RIUH 3WJJC 1J0YA 5C8JA 3U30C 1FVEB 4U1MA 3RTQA 3WFZA 4FTVA 1UKQA 5F6HI 3UBXB 3ARQA 5AAMA 1IAOA 4LF3B 4R3SB 1A6ZA 1H3GA 4UDTB 5C9KA 4GS7B 1MCJA 1J18A 3S6CA 4DN4L 3EO0B 3B3IA 3WS3A 4R96A 1NL0H 4MQXD 3QEHA 5LBSL 4ZO6A 4HX1B 1X3DA 1MVUB 2FJGB 4NO0D 4P3CH 3D0LB 4I3RL 1M6OB 2E3VA 3PWLB 5F7YC 4LSSL 5B3JF 1QO3B 1CLOL 1FIGH 5EZLB 3BQUD 1H3WM 3QIUC 4ODWA 4PG2A 4GKNB 3PWUB 3S35H 3IU4H 4PLJD 2K7PA 5DJ6B 4OGZA 3G5ZB 3RAJH 3H0TA 4KPHL 5I30H 4LSUH 3MRPA 2BHZA 1ZLWK 3AM8A 1NMCB 1QUNA 3MA7A 3PQYD 5EO9B 3RWJB 1U3HA 3IGAA 1XIWB 3MYJB 3CDGB 4HF5L 2VLJB 1WWBX 5J1SC 1NGYA 1K4CB 5C0ND 5DJXA 1ZMYA 3RVWC 4MSWA 4HIJA 1A8JH 3L3DB 3WL9A 3UTSA 5IJVA 4IRSB 3QWRA 5EU3A 1MJJA 2J5LB 1TCRA 4LCUB 3HNVL 1RUPL 5DUBB 1E6OH 5ITBL 2Q1EA 4G6ML 1J05B 2FCBA 1UA6L 4P59L 3KPRD 3Q6GH 5E00B 1XFPA 2OZ4H 5I74C 5DQ9A 3BRDA 2VR4A 3UZVB 4ZFGL 4F9PA 1OWRM 1EO7A 5KOMC 3NA9H 1CDCA 5H94A 4JRYD 4G8FB 1U2HA 4N8CL 2R1YB 1HHIB 2ORBL 1OSZA 4LLYA 3ARED 1ZT7B 1CL7I 2GI7A 3L3IB 3MLWL 5IG7A 1W0YT 1ZWIA 4ONFL 5DWUL 2ZCHH 5JOPD 3UTSE 3I6LE 1EHLH 4JQXA 1WT5A 4X9BA 3QCTH 2AJVL 4KRLB 3HZKB 4M48H 4Z7WA 5HI4C 3PV7A 5DJAB 5EN2A 4CN4A 3P0VH 5F9JB 1N6QL 3RDTA 1WIPA 4HUWA 4YC2B 2Z9TA 3HUJF 4D94A 3G08A 1CXKA 3B5HA 4X0KB 4MX7A 1D3CA 4GG6A 1H5BC 5L8LB 2GUOB 2HT4C 3QDMB 4OAWB 2OXGA 4H88L 2G5BA 5EBMA 4KVNH 1Q9KB 1CE6B 1E4XL 4ODTL 3FQWA 2A9NH 4M5ZL 1PYWB 4JPIB 2F5BL 1A14L 4P2RA 3TVMB 4OCRL 3MV7D 4KUCD 2XWJB 3HCVB 4ZPTB 4N90E 1CICA 5JHDA 5KW9H 4UILL 2CLRA 3SEPA 3MZGB 4PJHF 4HIXH 3MOAH 4MJIB 1BM3L 2FX8H 1YPZF 4IRSC 1I7UB 3U48A 4N0UB 1ZT1A 1RHFA 3X13B 1PAMA 1QQDA 3F5WA 1R5IA 2J5LC 1OY3B 2IEPA 1P84K 4X6EA 1G9NC 4Z7WE 3LIZL 4NM4H 2AEIT 4LLDA 1L7IH 1MFDH 3LEVH 2UVFA 4XCYA 3U0PA 3IDGB 1K8DA 1BP3B 4QCIB 5DXWA 3RWDA 1PGRB 1QFUL 2FD6L 3HB3D 3QIWB 4J3UA 4MB5A 1L0XA 5HHVH 4GG6E 2O61B 3H3PL 1BFSA 3KLAB 3MQIA 5HDOA 1MFCL 3QULA 3GO1L 5L9DL 3S88L 1NGXA 1WC7B 4WI3A 1KTKE 3NTCH 4P2RE 1G0XA 2WUBL 2R4RL 1SBSL 3X3FH 4OUUB 1FO0H 4P5MB 4KKNA 5E2VH 3VXQB 5JHDE 1IC4L 1FZOB 4APQD 4QKXB 1F4XH 4RBPK 4WV1C 1KCKA 2FHCA 2ESVB 3MRIA 4LSRL 3KJ6H 1S7WA 4PJCF 2JJSA 2B8OT 5DK2A 4MD0B 5SWZE 5HPOA 2GJZA 3T2NL 2AJSL 1JF1A 4G3YL 4YC2C 5FO7A 4NC0B 1JRHL 3WO4C 3O41A 1FVCA 3BEVB 1FGVL 5E4EB 5GS0L 5GGQH 1FNHA 1R3LB 1UZ8A 3O3EB 1V3MA 4XPBH 3DSFH 5ETUB 1IGJA 3EUUA 4MXVF 1A5FH 1WVZA 4G8GD 4AEHL 2A6JA 3T2PA 1K6QL 5JQ6H 3LQZB 5FYJE 2VITB 2A0LD 3OAZH 1RZJC 2Y6SD 3DV6B 2RAMA 3QDGE 5E1AA 5JIPA 4XMLH 5I1CL 4P48A 4PJEB 1O5DT 1O7SA 2DQUL 5D7SL 4CMHC 3ARZA 1P7QD 1Q9LA 1X4ZA 4HCRH 1RK0A 2H6PA 4U1LB 1A1OB 3VW3H 4HAGA 3TA3B 1S7QA 3QB7C 2IF7A 1VEMA 5KVDH 3RIFK 4OD2B 3T1WA 4IS6B 5TDNB 5SX5K 2APVA 3VWJA 1FFRA 3FQXB 1ZLVH 5TE6L 4I18B 2WMPA 2OP4H 4NQEB 2LABA 3IKKA 5ANME 3MA9H 4KJPD 3QIWC 5F9OH 4DEPB 3T09A 4Y2OA 3RWGA 5HGAB 2OCFD 4JY5L 4FRWA 4J3XA 5IHUL 3DUSB 3VXUD 4G6AC 3HE7B 1QHOA 1GGCL 1D5IL 1IC7L 4HS8H 5DC4B 1RUQH 2P5WB 1G7PA 4W6WB 2YKLL 4NKDB 4B53A 3LN4B 1UH2A 2UWEF 3VG9B 5FYKU 5EU5A 2BVUA 3DVIA 4Y5XB 5GRXG 2QR0A 3P9MA 2YRPA 5D6DC 2QHRH 2VN4A 3C60A 1J12A 4Z76B 3INUL 1XIWD 3N85H 4TSCH 4DGVL 2CIKA 1HOCA 4DW2H 3DX6A 2H2SD 1QVOB 1U8OB 4IIQA 3EO9L 3A6CL 4ZUUB 1OP5K 3KYOB 1DL7L 4LCIH 5I16A 1UQSA 4M3JA 5B21A 3D18A 1P2CB 1PEZA 1HWGB 3HHRB 3AXLA 4TRPH 1P1ZB 3T77B 4E0RA 1CN4A 3GBMH 4G43A 2ADFL 4Y4HA 4LEOB 2AXFA 4PR5A 4OGYL 2KQMA 3LSOB 3W0WB 1A47A 4P9HH 5HHOB 3S98A 3OKEB 1T0MB 2WAHA 1ZVSA 5ERWB 4WJ5B 3VWKA 2Q20A 3PL6A 5J6HB 1IM3B 1CDHA 5DYOA 2LE9A 3CK0H 4HWEL 2CK0L 3ARDB 3DIFB 4NZRL 4K3JL 5D2NE 3MXVL 2IANB 3GSNL 2DWDB 2B0SL 3GRWL 2QQQA 1NUFA 5LGKA 4UQ2B 3EGSA 1U0QA 2DTML 3TPUB 3UTTB 3D2UB 2DQEH 4KKBD 4F2MB 5HYEA 2FH8A 4DK6A 2DQFA 1GC1L 4AEIH 4NUJA 4LPYA 2YOCA 2C4FU 3HUJE 3KPSA 3QDHA 2F8VA 4MHHG 4Y4KA 4PGEA 5A1AA 2OSLA 3LEYL 1UACH 3MRMA 3WXWH 2DOCA 4CNIB 5JHLL 2VO5A 2C3VB 4KI1A 1I3GL 4HJGB 3VG9C 1CU4L 3B8YA 5F7UA 1W0VA 4PJHE 4JAMA 2ZSVA 3HI5H 4K7PY 5J9PA 5DRZB 5BQ7B 2R0LH 3MLTB 1F00I 1U8PA 3BGFB 5FXCH 25C8L 4Y7MA 2YD7A 4YLQT 4MJID 3TZVD 4YDIL 1FZMA 1JPST 3CFDA 1FH5H 3GSOA 5CJXC 1XR9B 4FQHB 4L3AA 3KPSE 4DKEL 3BZEA 4P49A 2F53B 3CSBA 2W92A 4YGVA 4X9FA 4Y4FB 2A83B 1IGTB 3SOBL 5DEFA 3EDEA 3DX9B 2VKXA 1T1WA 4ONHA 1U8JB 4X98B 4WFHE 4RFEB 1CDBA 5GIRA 1EX0A 3VJ6A 3WLBB 4TOYH 3ARDC 3RUGF 3W9EB 5DJ8B 4HG4J 5FHAH 4ESKA 4N1CA 1AXIB 3VH8A 3L5XH 3SDAC 5HPMB 1H15B 2WWMD 3HZMB 1LQSR 4U6YB 5C0AB 4OIAA 3DPBA 1ZEAL 3NFSH 4RGND 1UWGH 2LVEA 3H42H 3FT4A 1K3IA 2QQLH 5H35A 3QXDB 4P23B 4ZOCA 5IVNA 3NCFB 3FB7A 1IZKA 5IWLA 4NN5B 4DZ8B 1BVLA 5BRZA 5MEOB 3SQBA 4HXAL 4XNZB 2F54D 1NAMA 2PYEA 3OV6A 4YFLI 4DTGL 4WI9A 4R7NA 5BV7L 4OQTA 1UGNA 5DJCB 2R15A 4PJGA 1UB5A 3WDIA 2R4SH 1OWWA 4MXVE 5DD5H 5AEAA 1Q0YL 3ARVA 4TTDC 3JV4B 4G6KL 3FONB 1AQDB 2NR6D 4EDWL 4XNMB 1BQUA 2DQHL 4D8PB 3ARBA 2UWEA 3JSSA 3KS0J 4AT6B 4YHLL 4M6AA 2D7NA 4NKOA 2UUDH 5MEPB 3OJDB 2JK5A 5K9QI 1I85A 4WU7A 4CBPA 4PY7B 2XWBB 1U91A 1LK2A 3ULUD 2JCCA 4LLUA 3BGFC 1AGBB 4GW1B 3D39A 1MFEH 4KMTH 4OLVL 1F58L 3MJ7A 3DECA 3WFDH 2VDKH 2EIDA 1F6AA 1YNTA 5A3ID 3C2AL 1R0AL 5BRZE 5B3NA 5E8DH 1BFVL 1AGFA 1NGQH 5DS8A 2PYEE 4L4VA 4HKZB 4HLZH 3ZKQD 1XF2A 4Y4FC 4M6ML 3MRKB 3Q0HA 4PJGE 3VD9A 3BDYL 3UZEA 3EDDA 4B41A 3I3BA 2NW2B 2I07A 4NQED 4P4KA 5D7JA 2ITDA 2APXA 4UUJB 1KTRL 1WAAF 3MRFB 1SJXA 3IDJA 4F7PA 5I73C 2ATKB 2UWEE 2CGRH 3RWCB 3HE7D 2C1OA 1OAQL 2DQGL 3QA3B 4YUEL 4I48A 2N7AA 4WWKA 3GUTB 4PB9H 5E8PB 3ARGB 2D4FA 2BP3A 4PV8B 3M8OH 4ZFOA 4OIIL 5IVXB 4X7SL 3LRSB 2P5EB 1A21A 2W38A 4FQCH 1JGDB 4JZOA 2VL4A 1JVKA 5I76A 5ADPL 4OM1L 1AJ7H 4OQ1A 4W70A 3D39E 2ATPB 2R29L 1VFAB 4NN5C 1YEFL 3BFOA 4OLXL 3LS4L 5D2LA 2P8LB 1FRGH 3WIFA 4QXUL 4JGUA 4XP4L 2MKLC 3NZHL 4JFXA 4L4VE 1C5DB 1KTLB 2UY7A 3TBVA 1M7XA 1QTYT 3BP5B 2EO9A 3ALWA 2D7TL 3MBXL 5EG6C 3FQTB 3FFCA 2GTZA 5DGRA 2IC2A 3GIZL 3TJEL 8CGTA 5T1MA 5D1ZB 4FQLL 4HAFA 3P9LB 4PRBA 5E56A 2BOBB 1HNGA 1QHPA 1P7KA 1DN0B 4HKBA 1GIGL 2MHAB 3OJ2C 4FQPA 4WTZG 4XHQA 1DBKL 4KZDH 1YN7A 3BIKB 1PSKL 4UT9H 4RAVA 5DI8A 5F7FA 1OAUL 5I15L 4YPGB 4X5XB 2JKXA 4GXUN 1JYXA 2IAND 1ITCA 4Y2DD 3SCMA 3HC4H 3M1BA 1E4KA 4PS4L 4ZXBA 1P4BH 4EKXA 4GRLB 4PLNC 2HYMA 3CDFA 1MCHA 4PRIB 4YHKL 5KSBB 3J7HA 2LTQB 3UTTD 2DKUA 3D2UD 5D2LE 1FFNA 5JR1H 4MS8C 2KBGA 1IL1A 2AQ1A 2B1AL 4ZAKB 4BSVB 2MMXA 4P5TD 4OLZL 5MEND 2CUHA 1YMHA 3BAEL 3QUXD 5AD0A 1U8NA 4G9FB 4KJWC 3FFCE 2X4PB 5I66A 3RUGA 2NY1D 3VFVA 3GMPB 4LVOB 4QXGH 1MCSA 2W91A 2ICCA 4Z8FL 4JQIH 1OTUC 1TZHA 3H9HB 3GK8L 4TULL 3OKNB 1T22A 1OAXL 2MQ0A 1KCUL 1BHGA 1N64L 3VRLF 1MELA 3DROA 1II4E 5IMLA 2OMNA 5IBTL 1IGCL 4RISH 2AV1A 4NRZB 3I2CH 3B9KA 4K7PH 4YXLH 3FN9A 4WDIA 2IBZX 4FXKB 4KHTL 1TETL 3BKYL 1U6AH 4LCYB 3EYFA 5IB4A 4MNGB 3NAAH 5DJDA 3SDCA 2DDQH 5MERB 1S7UA 5ESVA 2IJ0C 1CQYA 1MF2H 3FN0H 1PX3A 2D0FA 4L4TD 4LLMA 1NEZG 3NABL 5DD1L 5D1ZC 1EVUA 5IIEA 2F53D 4OZGA 3U46A 3O9WA 2X1PA 3RUGE 5F97E 2IPTL 4JDTH 4KDTA 3I50L 3O4LB 3TN0B 1KLFA 2BNRA 4O2CA 3UTZA 1DVFB 1D6EB 1SVCP 2BVEA 2BNQB 4IEFB 2GT9B 3ULVH 4XP1L 4GW4A 1R5WA 1F4YH 1SY6H 1EO8H 4GRLC 4OZHB 4HG4K 1CIUA 1MFAH 3L3OB 5T3ZE 5J06A 3WFBL 3GSWB 2XQBL 4QRQA 4P23D 1JTPA 2B2XL 4K9EH 2P7TB 2E9JA 3DO3A 1RFDH 1XGYL 5I1IL 1W72L 3ZE0F 3BSZL 1I9JH 3NA4A 4KJQC 3MLYL 4NC1E 3T3PF 4HS6B 4P9ML 4XX1G 4Y16A 4AIXA 1NKRA 3EFDH 3UYOD 1GZQA 2YUWA 1ZK9A 4OZGE 4P2QE 3NPZB 1HCVA 4YNYA 3O11B 3OB0H 1VENA 4KK8C 3L5HA 1CGSL 5DQJB 3IFOB 3OKMB 1YEIL 4WEMB 4YWGH 5E95B 3VXSA 3QFJB 1A7NL 1E4WL 4IMLA 4X6CF 4DN4H 2BC4A 2BNRE 5LGJA 4XP9L 1J8HA 1I8LA 3CFEA 1DSFH 4HGWB 4U6XB 2V17L 1JJUA 1S7RA 1WBYA 3MRCB 5IM7A 2HRLA 1CGVA 4KHXL 4WW2A 4KK5C 3VRIA 2D7QA 3MMEB 1B2WH 1DLFH 5GXBB 5ISZB 1HYRC 4NQCA 3ULVF 3OKLA 1R5VB 3QWQB 1CLOH 1G7IB 1B6DA 2AQ2A 3FQNB 5JW5A 5IFJA 2BERA 3UJIH 5F71A 4HWUA 4LCCA 5H37G 3JV6B 3PDGA 3VI4F 3IDIA 1QOKA 5BO1H 3C8KA 4BH8B 1WAAE 5E2WL 3B2UC 4GG8A 5F7LB 3ZT7A 2EDYA 3IJYB 5LXGL 5JZ7C 5FF6B 3C9NB 2NY4B 3L7EA 2WIIB 1F02I 1KG0B 2X42A 1XGUB 3KYNA 3RGVB 3A67L 3TN0C 1LP9F 4Y19A 4C56D 3ULUL 5L2JB 2YN3A 4EEEA 3RWFA 3FB8A 2DMCA 3L9RB 3VXSE 3V95A 3T0BA 3T8XB 1U93A 2ZKHL 3Q6FB 4R7DB 5GS2D 1OGAA 1XF4B 3LZFL 5JPMA 4CW1A 5L2KA 4FQXA 4FXLA 3UO1L 4DVRL 3RVUD 2P5ED 1NCTA 2B5IB 3HNVH 3PWPD 4LLQB 4YBQC 5HYSG 5D5MB 1JNNL 4NQCE 3I9GL 5ITBH 2AJZB 5HGHA 5DHVA 1UA6H 4IRJB 4J3SA 3U79A 5J12B 4YHPA 5DURD 4ZFGH 4LIQL 2NTFA 1OW0C 3BZDA 1Y6MR 3FJTA 3L3KA 4I77L 4N8CH 4WVRA 1UWXH 3VFSB 1JHTB 1MCPL 2ORBH 1DQLL 2IAMA 3ES6B 3CD4A 3EKCA 4HEME 3P0GB 2XN9B 1KULA 5AG9A 3W11D 1TJIL 4Y19E 4GRMB 5GRYA 3MLWH 3P4NB 2Q6WA 3WE6B 5CILL 3LKQB 1E6JL 4ONFH 5DWUH 4LNRA 3JWOH 2Z91B 3LEXB 3BO8A 2MQCA 1OGAE 2YUZA 5ID0B 5L2KE 1NCAL 2AJVH 3U0WH 3WS6C 1OSPL 1OF2B 3RNQB 4PGBB 3VGBA 3DVNA 4PV9A 1P9MA 2IQAB 3QUKB 2EE3A 3V5HA 3BPLB 4YR6B 3O2WL 5T3XL 1GCFA 5E24E 1Z6JT 1JZ6A 5E2TL 1XF3A 4H88H 4P46A 1ZHBB 3DOSA 2EECA 1E4XH 4ODTH 4OKVB 1T7ZA 5IW1A 2F5BH 5SX4H 1A14H 4JFPB 2H1PH 4OCRH 3RY6C 1R3IL 4QHNB 4OJFL 3V0WH 3QUYB 3RGVC 4HBCL 4G9FD 5C0BD 3FO2B 4PP1D 3UCRA 2YUXA 4HWBH 3VRLE 5I19L 3RRQA 1U95B 2ZNXA 5H2BB 1JPTL 1MRDL 1CVSC 4K8RL 2VAAA 1L0QA 1I8IA 4DOHE 4JDVA 5IUSA 3EHBC 3WFHB 4A6YB 4ZSOB 5GGUB 2ADIA 5DRNB 1BFTA 4Q0XL 4ZTOL 3EJJX 2HMID 4IRJC 2QQNL 4GAJL 5ESAB 43CAB 4R0LA 1UXSB 3U4EA 2G9HA 5J12C 5D1XD 1BOGA 4OBSA 1IGFL 1M4KA 5E99L 2P42B 5ALBH 5FOJA 1MFCH 1KEML 1QFWI 2MFNA 1HILB 3KNBA 3GO1H 4EUPB 4DKAA 4PBXA 3S88H 1OAZL 4TUKH 2AK4D 1WQVT 5ICXA 2WUBH 2X7LA 1AKJD 5EZIL 5DRWB 5CKGA 4YH6A 4X6CA 4JRXB 1KB5L 1IC4H 1ETZA 3VFPA 3LKOA 4PRPA 5L7XL 4HIIA 1BEYL 2KDGA 4DVBB 1ORQB 4B50A 1DEDA 3AS3A 1QKZL 1IAII 1S7VA 3O4LD 3DLQR 1FSKB 1N0LA 3DMMA 3MROA 3MUY1 5KS9A 2EXWC 4YQXL 4ZUSB 5FECB 3GSVA 3H3KA 3IRPX 5MHSD 3T2NH 2BCKA 4G3YH 1T1YB 1I1YB 1SY6A 2EDBA 5C08D 3AAZA 5AYUH 1JGEA 2A6DA 1FGVH 4O9HL 5GS0H 4M3KB 4X6FA 2BMKB 3RI5F 1A3LL 3QDJB 1CYGA 4FXGA 2FJFB 3BW9B 4BQ6A 4HW6A 4AEHH 5JA8B 1KJMA 4AG4L 1T3FA 5FA4A 1T66D 2Y23A 3MOQA 2GFBB 4OGXL 1T89C 4MXQC 2DQTH 1ZLWH 3N9GL 1WK0A 2ADGA 1LP9A 5I1CH 2IH3B 4U1GB 3W82A 5D7SH 2BSSA 1F4AA 1TVBA 4X6CE 1JE6A 1YN6A 1MCWW 1H0DB 3UAJD 4UBDD 4PRPE 4RGMC 2VLRD 1RZ7L 4ONGL 2J88L 4ZS7L 3ZLQC 4RMRA 2QQKL 3LDBC 5KS9E 3SKMA 4MB3A 5A16B 3ULVE 4PIRF 5D1QB 5TE6H 1VPOL 3DETC 3BD5A 4M43L 4ELKA 5M94B 2DAVA 1C5BH 1TZGL 1KUMA 3VI4E 4KVCL 4NYLA 5DA0B 1YNLH 2NY2B 5GRJL 2ED7A 5IHUH 5JNYA 4GLRI 4M1DL 1GPOH 4OF7A 2FX7L 1D5IH 1IC7H 2HH0H 5IBUB 5IB1B 3GHBL 2CK2A 2Q76A 5C8JB 4F7MB 2YKLH 1IGIL 3V0VB 4U1MB 2IMNA 3O8XA 5FDWA 3TIDA 1J1XL 3P30H 1LP9E 4BZ2L 1MI5A 3BP4A 3GSQA 4U1SA 1BD2B 4LHUA 1REIA 4R90L 2X4UA 3D6GA 4PTUA 2NY6D 3INUH 3WS3B 4DGVH 4R96B 3HZYA 1E28A 2VR9A 3QEHB 1BJ1H 1FSKC 3FZUC 3EO9H 3UTQB 1U8QA 3A6CH 1CXEA 4GSDH 3QNZB 2AEQH 4QEGA 2NTSP 4NKMA 5IBLC 4ODWB 1QRNA 3OAYK 4HPYL 1YNKL 4OGYH 4CVXA 2VMFA 3SPVA 2NY5H 3CU1A 4HH9B 2P48B 1AP2A 2CUMA 1KJVA 4OSUL 2WQRA 3MRPB 4WFFD 4TPRL 5GZOC 5TPWL 3NIDF 5EU7E 3GJFK 4HS3B 1U3HB 1GOFA 3IGAB 4XC3L 1TPXC 4ENED 2WLZA 4RMTA 4HWEH 1NGYB 3WNOA 3K1DA 3R1GL 1MI5E 4NZRH 3D25B 2C26A 5DJXB 1YYML 3MXVH 2CLZA 3GSNH 2JE8A 3WL9B 3UTSB 3GRWH 5IJVB 1KCSL 1N8ZA 3O3BA 5B4MC 3QIBB 4NQTA 5EU3B 1RIVL 3D1MC 2DTMH 1TCRB 4KAQH 2E9WA 3QR2A 1JWSA 4G80A 3WSQL 2GSGA 5D1QC 3S3SA 5FFLA 3VGDA 4EI5B 4XTRC 1LD9A 3EO1A 5F1KC 4PFEA 2YPLA 3LKPA 5DMGD 2OXHA 3BYYA 5J7CC 4KTYA 4NOBA 1LNUA 2JTDA 1QRNE 1KFAH 2AXJA 3HE6A 5JHLH 1SYSA 2ARJB 2Y7QB 1UM5L 4NSKA 3RTQC 1AR1D 4K3EL 4JZNA 1I3GH 3QHZH 4MDJA 1SMAA 1CU4H 1F6FB 3F12A 1GRWA 1IVLA 4NO2B 3RVTD 3K46A 1KCRL 4LLYB 4X83A 2WSKA 4HUNB 2E7MA 5IG7B 1RJZB 1YEKL 4QOKD 1YY8A 3QUYD 5JLZA 4M61A 4RBPH 3BKML 3CMOL 4R2GB 3OZ9H 5TGBA 1MCKA 4Z7WB 5E70A 3ARFA 4YDIH 3RVVD 5EN2B 2D4DA 4U49A 4HUWB 1A02N 1QEWA 1R24A 3KPMA 5CS7A 3G08B 1EJOL 2HKHH 5KSAB 4GG6B 4MX7B 4DKEH 2YPLE 3VDCA 2G5BB 4HFWA 5EBMB 4KRPC 3AM8C 4JFZL 5CMAA 2Z31A 1U3HC 4P2RB 3GB7A 1SEBA 1N4XH 3B9DA 4W6YB 1A1MB 4ERSL 3RZWA 4JG1L 5JXEA 1CICB 3UMTA 5JHDB 1AO7A 3W2DL 2CLRB 4HIHA 2NY0D 3KLSA 1AC0A 2VZUA 4XXDA 4PRAA 4JFHD 3QJHB 1C7TA 4GQPH 1BZ7A 3F5WB 3DRTA 1R5IB 4JPVL 5SWZB 5FUOL 2HG5A 3PWVA 5KSUA 2P43B 1A6WL 1X5HA 4OFIA 4X6EB 4BKLA 3QIUD 4LLDB 4Z0BL 5SX5H 4HXAH 4XCYB 1AXSA 3U0PB 1T5WA 1K8DB 1MCDA 4DTGH 1EEZA 2X4RA 3V52L 5BV7H 3BISA 4NPYA 4P2OB 4F9PC 1Q0YH 1LE5B 3GDBA 2LU7A 4G6KH 1XGQA 4NQVA 4EDWH 5KANI 4J3TA 5F9WC 2DQHH 1HH9A 1QSEA 3QDGB 1NGXB 5HHXH 3FQRB 2EYRB 5C2BL 3T65A 3JXAA 4G42B 4KUCF 4ZFOL 3QCUH 4OI8A 1S5IL 4M7JL 4BUHA 1AO7E 5HD8C 4GJTB 4XVSL 3EJYC 4IJ3C 1UXWA 1X5YA 1OAKL 3IS0X 4JQXC 1DBMH 1WT5C 4ODUA 2DYPD 1ZGLA 2OQJA 4OLVH 3BI9X 3ZKMC 1F58H 2UZXB 5F96H 2YWZA 4IOFC 4Z7UF 1JWUB 3RDTC 1OP5H 4H5SA 4JO2L 5ANMB 1R0AH 3C2AH 1T21A 2FWOB 1BFVH 5JDSA 1UZ8B 3RIFF 4QHLA 4LGSB 3NIGF 2W9DL 4M6MH 1IGJB 4HPOL 3BDYH 2ZUSA 4N8VG 5CINL 1Q0XH 1RUKL 2K7QA 4F7EA 2A6JB 2OR7A 4M02A 3MRGA 3NZ8A 4LKCB 5B8CA 2HJKA 2NY2D 3KHQA 3PWJA 2MPAL 1QSEE 5E1AB 4X8JA 4W81A 1LK3L 1CICC 2NNAA 1JP5A 1OAQH 3VFTA 4YUEH 3TYFA 2DLHA 1Q9LB 5HDLA 4M7ZC 1TQBB 5E08L 2DM3A 4XPHL 2H6PB 4OIIH 3VU2A 5HI4D 5ACLA 1S7QB 3DYPA 1J0ZA 5ADPH 4OM1H 2GJ6B 5FO9A 1OB1A 1RSFA 1BD2D 1FNLA 4WFGE 4BSJA 2R29H 4F3FA 3Q3GA 3HS0B 4NO0A 4M7LL 3VWJB 3C09B 5F3HA 4OLXH 3LS4H 4BH7A 4JCMA 4M6OL 5ITFA 4QXUH 3BQUA 1IC5L 4XP4H 2QTEA 3NZHH 4H1LG 5HHME 4NDMB 3MCLL 4KK6C 2JB5L 1XEDA 1WJ3A 2D7TH 1Z3GL 1I7RA 3KDMB 4Q9RL 5JW3H 2X4NA 3HNSL 5K9JL 3PQYA 3NIDE 3GIZH 1G7PB 3TJEH 3C2SA 1WGOA 3K1KC 5I8EA 4K2UH 4C83A 1S78D 5E5RB 4L1DA 2V9QA 5EU5B 5D2NB 3QNXA 4HBQA 2QR0B 2V2WB 1KN4L 2VH5L 5K9KB 1PSKH 3C60B 1PY9A 5BJTA 4U2YA 1OAUH 1FNAA 1ZANL 2ED8A 5I15H 2CIKB 2JJSC 4LASL 3SGEH 4Z78A 3GSNA 4U6HB 5ALCL 2A73A 5I16B 1UQSB 2Q7YA 3QIBD 1AD0A 3HUJB 4UU9B 1NC2B 1I9IL 4YHKH 4E0RB 4XNUL 3H7BA 1ODAA 4G43B 4Y4HB 4Z7VF 3KPRA 1JPFA 3O0RH 2B1AH 2AXFB 3OKKA 4OLZH 4EI5D 1QBBA 2EIBA 3IDXL 3UBXG 4JN1L 4IMKA 3V5KA 3TYGL 3HMXH 5C0FA 1ZVSB 4JRYA 1JCKA 1ZSDA 3VWKB 3PQYE 4I2XA 5DYOB 3L3JA 2ITCB 1QLFA 2YA1A 4Y5YB 2C3WA 4PJHB 4QT5A 5GS1A 3GK8H 4TULH 3LD8B 1TQBC 1YPZB 1N0XL 1OAXH 3AREA 4L1HA 1KCUH 4LAQL 1Q38A 1N64H 4XCNB 4E42A 5CEYB 5CP3H 3D48R 2CMRL 1AGEB 2ICEA 3F62A 3QI9D 2O5XL 3EGSB 1VFMA 2XG4A 5IBTH 1IGCH 2J6EL 3G5YA 3VWJC 4AYFA 1TJHH 3N0PB 1G7HA 4NCC1 2DQFB 1JHKL 1EUUA 2XTJE 1TETH 3BKYH 2BXZA 3KPSB 4PGEB 1RVFL 4D0CA 4Y4KB 3MV11 4UDUA 4XB7A 5FHBH 1XGPA 4OF5A 1JPSL 1NDGA 4QHKJ 4BZ1L 5FGCE 2AKRA 3KPRE 2OSLB 1SYVB 2PETA 3MRMB 3OKYA 3ZTJG 4JFED 5BMFL 4GT7A 5DD1H 3QXTA 5KSAD 3SQOL 5I1DB 4JRYE 1KOAA 1ITBB 3MV7A 4NZUL 1INEL 4I2XE 2HTLC 2D2OA 3P11H 1W0VB 3C60C 4JAMB 5DT1L 1KACB 5K9OA 3EFFA 2VC2L 2MCPL 4PJCB 3R8QA 1FBIL 1U8PB 3HPJA 4IIQC 3R0NA 1I7ZA 5JOPE 3VI3F 1A9EA 4Z7UA 5ID1B 2EKSA 4CN6A 2FZ3B 3P40A 4XP1H 5E8NA 1FZMB 5CGMA 3IAPA 1FG2A 3MNWA 2YZ8A 5KVMC 3X17A 2EZ0D 5F7EL 3GIVA 5SWZD 3WFBH 1IQDA 4Y4HC 2XQBH 2ICWA 2B2XH 1RJYA 3NCJL 1FORL 1U9KA 4YGVB 1XGYH 5C0GA 1BGXL 1W72H 5I1IH 5DEFB 5I2IA 5IVZA 3MLYH 3VWKC 3PL6C 3UP1A 2ERJB 2NXZB 4P2OD 4ONHB 4YHNB 1G6RH 1NDMB 5GIRB 3VJ6B 2P1YA 3PGDB 3MV7E 2AXGA 1FCCA 4K94H 1YEIH 4APQA 3QDGD 3G04A 2I9TA 5J3HD 1KBGL 4HKJA 1KIRB 2LQRA 1A7NH 1FO0B 1E4WH 2EC9T 4YFDB 4K07A 5E5UB 3KYKL 3MNVA 4NKIL 3FT4B 5HXMA 5F6HJ 5H35B 2V17H 5E7FA 1KCLA 3BWAA 3FB7B 2JJTA 4Z7UE 4KHXH 1ZA3B 1MREL 4DUVA 5BRZB 4KQ3L 3KPOA 4JFOA 2EIZB 2HLFC 4G7VL 4JGJA 1BVKA 4Y4KC 5D93C 2PYEB 2Z4QA 4R7NB 5I0DA 4GRWH 1XMWA 5FV1L 3NIGE 1UB5B 4GOSA 4X9IA 3CSYA 1D5XA 4X99B 1MAJA 3V6ZB 3NIFF 2VXVL 4G8GA 3MSPA 1CLYH 4KI5D 3RPIB 1X5JA 5E2WH 2BJMH 2UWEB 2FEDC 5LXGH 1T1XA 1A7RL 4I4WA 4NCDA 4WHTB 3C08L 2ZNWA 5EU6D 2JK5B 1P7QA 2VLMD 3PDDA 3A67H 1UCTA 3O6KL 4LLUB 3AFLA 3QPXL 2ZKHH 3GFUA 1VHPA 3D39B 3LZFH 4UDTA 4YDJA 2SEBA 2CXKA 2YD5A 3PE9A 5JW4Q 3CFIC 4XNYH 5JO5A 5E9DD 1KV3A 1HXYA 4J7RA 4HX1A 4Z7VA 1CXLA 2GJ6D 1MVUA 1AGFB 3ELAT 4JY6A 4U1IA 4L4VB 5DS8B 4FQQA 1XF2B 2YSSB 3C5ZC 1J1OL 4OT1L 3PWLA 3VXUA 1UC6A 2I07B 2D7MA 4GRWF 4LIQH 2EEAA 4MZ2A 2ERJC 4G8GE 2ITDB 2HJLA 4WFED 3TT3L 1PY4A 4GKNA 1I75A 2B4CL 3IDJB 1GHFH 5IMMB 3STZA 4I77H 4PJ8B 3E3QE 2RCSL 2MWCA 3V4PL 1MCPH 4I48B 3PXHA 2GITA 5EO9A 3NGBB 1TJIH 3F7QA 4PJBF 3RWJA 4ZFOB 1XIWA 3K7UA 3MYJA 2E7LA 2GYSA 1K4CA 4JZOB 3ULUF 4LBEA 4N0CD 4CVWA 5IWLC 5CJOL 3KLHD 2RB8A 4LLVB 3D85D 3ZTNL 2XYCA 2ZCKH 3F7YB 4JPKH 3OKDB 2EDDA 2RHEA 4K23L 3WIFB 4Z7VE 5C09D 3U7YL 1B0GA 4LCUA 4L4JA 1LEIB 4JFXB 4G7YL 3TBVB 3O2WH 5T3XH 1C08B 5DUBA 3MRNA 1OCWH 1X5FA 1NC2D 3FFCB 3VXUE 3O45A 2GTZB 2V9RA 3ARBC 5E00A 5T1MB 4AM0B 4PJ9B 4PRBB 5IK3A 4I3SH 2IFFH 5D7LD 1IM9B 1P7KB 1R3IH 1ZHNB 3LKSA 1T20A 4OJFH 4J3OC 1I85C 1YN7B 3WNMA 1TVDA 4RAVB 4XAKD 5DI8B 5I19H 1HHIA 4OFVA 5JIIA 4ODHH 1AXTL 1G7QA 1NBVL 1MRDH 2OK0L 4K8RH 1L6XA 3MV01 4J6RL 2YUVA 2H32H 1I3VA 1RHHA 2J2ZA 2FDBP 5EBWA 1S7XA 3TO2A 4QHUA 5CJ8A 3EOYG 4ZTOH 4RQQA 2VZOA 3QCVH 3MJGX 3QWOA 2CJUL 2QQNH 4GAJH 5DJAA 5F9JA 1FYTE 4QRRB 1AFVH 4P4KC 1YMHB 4I5BA 5D7JC 5CIPA 2DTSA 5AD0B 1IGFH 5I66B 2ZUVA 3RUGB 2GEEA 1KEMH 3RX7A 4OAWA 1BJ8A 4MWFB 1OAZH 4UAOC 5EUOF 3ZL4H 4HMCA 4AL8H 2QKIA 1Z0NA 4WWKC 3ZYZA 5EZIH 1PYWA 3NGBC 4JPIA 3HC3H 2RR3A 3C6LD 5KTEL 1KB5H 2WIMA 4UINH 4XZUB 3CFBB 1LVEA 1NFDF 5L7XH 5C6PB 5IMLB 3VI3E 3IFPA 2IBBA 3CVHL 1QKZH 3HC0A 4OD3L 4L8BB 4MJIA 3P77A 3TZVA 3B9KB 3ZE1F 1I7UA 4YQXH 1WBZA 5T1DL 3X13A 4MVBC 1TZIA 3EYFB 3KS0H 5IB4B 2Y07L 5H37H 1RZJL 4O9HH 5DJDB 1S7UB 5ESVB 3MODH 4MD5A 5JXAH 1FFOA 1UFUA 2KL6A 1A3LH 1ZVYA 4QCIA 1W72A 4AG4H 5IIEB 4P2QB 3U46B 1XAUA 4OGXH 3FRPA 2V7HA 3N9GH 3KLAA 2HAZA 1ZGLP 1FDLH 2NXZD 1YJDH 3MLSH 1EHXA 2BNRB 2L0DA 4MMZC 2E8ZA 2Z35B 3O4OB 4O2CB 3UTZB 1WFOA 4UB0H 2KH2B 3PF2A 3ARUA 1RZ7H 4W68A 3SCMC 2J88H 4GW4B 1E4KC 1R5WB 4JKWA 4ZXBC 2QQKH 4MJIE 4U7SA 2ESVA 4MAUL 3O6FB 2F54A 4EJ1C 4JEGB 4X8XA 5CBAA 4MD0A 3BX7C 4QRQB 1RURL 5I9QB 3X3GH 3NFNA 3MJ9L 4M43H 4NRXA 3AB0B 3NIFE 1E4XI 2NXYD 3OGCB 1F90L 2WLYA 4X6DF 1J87A 2WBJD 1BZQK 1CFSA 5GRJH 5SX4I 4M1DH 4Y16B 3DVGB 4U31A 2FX7H 4R26H 4NJAH 4UV7H 5FK9A 1GZQB 1IGIH 2NY7L 4L8SB 4YNYB 1D6VH 4FFVC 4WY7H 4LPXA 5B39B 5F89B 3QBTB 2UYLA 1J1XH 3GSXB 4G9DA 4MQ7B 4ELMF 3TNNA 1FP5A 3DV6A 5FM5M 1RD6A 1PG7L 3KWWA 4R90H 3GBLA 4OTXL 4HZLB 4PJEA 2FGZA 1RIHL 3VXMD 3LOWA 1RZKC 2OLDA 4K71C 4RGNE 1S7RB 3B9KC 1WBYB 5IM7B 4MA8L 4O2EB 4U1LA 3VRIB 3N1PC 5DLML 3UROR 2C1PB 1ZTXL 4NQCB 4XPTL 3B2VL 5B22A 5BVJB 2W0LA 2F54E 3SDCC 4UMGA 1AGCB 2ZZUT 5JW5B 1N59B 4LCCB 5BS0D 5DMKB 2GY5A 4GRWE 4HPYH 4NQEA 1YNKH 3IDIB 4O4YL 3C8KB 4XPFL 1OTUD 1OT2A 3NOIA 4OSUH 3O9WC 1YA5A 5F6IC 4GG8B 5TPWH 4RWYL 3DUSA 3L7EB 3HE7A 4LFHG 1LDPL 5T1KB 3KYNB 1AE6H 2EXYC 4FG6C 1EIBA 1RIUL 1RU9L 4Y19B 3R1GH 4NKDA 4PJBE 2XQYK 3RWFB 1VFBA 1YYMH 3LN4A 4PJ8D 1QSVA 4R4BB 4B0MM 1U93B 1MJ8L 4Y5XA 5C0DA 1KCSH 3OG6B 4PJEE 2EIEA 3ULUE 1OGAB 2PW1A 4UIKL 1RIVH 3S35X 5L2KB 2XQYG 3HPLA 4M5YL 4Z76A 2R2CA 4I0PB 1JRHI 5GGRA 5TDPB 3S97C 1OTSD 3CU7A 3T04D 3TH4T 3GBNH 3WSQH 4S1RL 2R56L 3LPWA 1U8OA 1CZ8L 1JYVA 2XZAL 4EXKA 4ZUUA 3AB0C 3KYOA 5DHVB 3EJZD 3D5OF 4QWWC 2OTUA 2VUOA 5EA0L 4KKCD 4RSVA 1ZAGA 2NTFB 1P1ZA 3ARTA 4NQDD 1NEZA 4UTBL 2J12B 2C3GA 4TN9A 3T08A 1NGZA 4I1NB 4F9LA 4OFPA 1FL3A 2QJDA 1IE5A 1UM5H 3GGWA 4K3EH 2EYSB 5FYKD 1JZ4A 3OKEA 5I30L 1EHAA 2IAMB 4WJ5A 4KKAD 5EOCJ 5HJ3B 5J6HA 1IM3A 1NFDA 4PJ9D 1Q8MA 1IM9D 1YEKH 1I8LC 2Q6WB 2BVQA 4OGAD 4AMKL 5FB8A 4LNRB 4DOHB 3BKMH 3BO8B 3DIFA 3CFCL 1QLEL 4XWGL 4WW2C 5FKPB 5JTWA 2IANA 4ORGA 4Y2DA 3B6SA 3MRQA 4UQ2A 3MREA 3TFKD 4PV9B 5GSRA 3BXNB 3TPUA 5E7BA 3V5HB 3UTTA 3D2UA 5DGQA 1ZS8A 1DANU 4LCCC 4P5TA 5MENA 1X6NA 4LSVL 4QXWA 3QO0A 3QUXA 1XF3B 3ETBF 3GI9L 1N2RB 2IALB 5T3XE 4QRTA 3OKOA 2OZ4L 5IW1B 4MAYD 4HZAA 4QRRD 1N7MH 5HBBA 4ERSH 4JG1H 1MY5A 3CSPA 2Z8WC 4GAYB 4H8WC 2DQDL 3OXRA 3W2DH 5F7DA 3SGJA 4HJGA 4WU5A 1NFDE 1FQ9C 1UZ6F 4KK5D 4OB5L 3I02B 2NY3D 1KB5A 1HHGA 4FQXC 2VAAB 4JPVH 1I8IB 4JDVB 5FUOH 3ZE1E 4ZO7A 3KPTA 1X4YA 2IANE 4RMUA 2ADIB 2ZCHL 3BRGC 2X41A 4LPTA 3KR3H 1F45A 4KK9D 4LPUA 1EHLL 4EIGB 1GAFL 4FZ8H 4Z0BH 2EH8L 3L3GA 4KV5F 4Y5VA 5D7IF 3UTTE 3V52H 2CO6B 4JB9L 4R0LB 5IKCB 3U4EB 2P4AB 3ZT6A 3ZDYF 5MENE 1BOGB 2V7NA 4E41B 1T83A 5JZ7D 1XR9A 2O93L 3VXRB 4L4TA 4WI2A 4A2LA 4GH7B 1JF5A 2AABL 4PREB 5JW4R 4XX1E 3NVQA 3O6LL 2F53A 5F1IA 3WNKA 4NRYB 3KNBB 5HVGB 3PNWA 4KVNL 5DO2C 5ICXB 4ELMA 1DQML 4U3XA 1NUGA 3A6OA 2A9NL 4PJDF 1MFBH 4RRPA 2XXMB 4X6CB 4X98A 4M7JH 4P2QD 5CHNA 4RFEA 1MH5A 5IESH 3WLBA 3W9EA 3LKOB 1A6UH 4PRPB 4HIIB 3CCHB 1OAKH 5GGTL 5KW9L 3MOAL 3LAFA 1H15A 2NYYD 3GEWB 3DMMB 3MROB 2RFXB 3H9YA 1P9MC 1F11A 5HYSA 2AK1L 1BPVA 3MBEC 4JO2H 4P23A 3AAZB 2A6DB 2E7BA 1F3JA 1H3VA 4YJZL 4X6DE 2J7LA 2W9DH 1MIEH 2WINA 1MLCA 4HPOH 3O6FD 4P46C 4FXGB 5CINH 4HC1A 1RUKH 1KJMB 2M8XA 5DJCA 3OAYH 1KSRA 1T3FB 4L4TE 4BK5A 1WCBA 5FA4B 2Z93B 5HHVL 4POZC 3TBYB 2F53E 1SMOA 2DQJH 2FIKA 2MPAH 4F8TA 3VFNA 1LP9B 1X5XA 4K7FA 3JV4A 4LVHC 4EOWH 4ELME 3FONA 3GJFH 5J8OA 2BSSB 2QLVB 3S5LA 1TVBB 3NTCL 5IFAH 2OL3L 5E08H 1YN6B 1YYLH 4AT6A 4XPHH 2M2DA 3OJDA 5DDHA 4P57B 4DKFL 4HJJL 5A2JH 1ZXQA 3WLWD 4M7LH 5CLWA 4KKLC 3FFDA 3I84A 4GW1A 3NN8A 3UTPD 3NCMA 4ZPVA 1EUTA 1VCAA 4M6OH 4HQQL 3HTLX 1KELL 1MCFA 1IC5H 2BY3A 1RAMA 1FNEA 4R6UA 2HFEA 1CK0L 3MCLH 5JNYB 4KTEH 5CD5C 5I75B 1I1FA 2R9HC 3HNSH 3MRKA 1KLUB 1A5FL 2Q76B 1BJMA 1YEGL 4IDLA 2CH8A 1MFNA 5FDWB 1OQOA 3FO9A 1MI5B 4RFNB 3BP4B 4C56A 3GSQB 3H7LA 3L3HA 3V2AR 4U1SB 2VH5H 4LHUB 2PXYC 4MCZB 5D96C 2X4UB 3EHBD 4YHYC 4PTUB 3HFMH 1ZANH 1SQ2N 1KCVH 3QA3A 5T1KD 3HZYB 1E28B 4ODSL 5E8PA 2I25N 2ICWI 2VZVA 1U8QB 2Y36L 2DM7A 5EO1A 4M9OA 5IVXA 1H3TA 5D6CA 2P5EA 1JGDA 3PWPA 5DF0A 1CGXA 4F58L 1A2YA 2BY0A 4XAWH 5FDYA 1I9IH 4I0PD 3WHXA 2XACC 5H8DA 5BW7A 2GCYA 3KHOA 3HG1B 3PHSA 5E8OA 3W39A 1O0VA 1QRNB 4HUKB 2P8LA 3MA9L 4JN1H 1KJVB 3TYGH 1LEKA 1C5DA 5FYLH 1KTLA 4AENB 1YY9C 3BP5A 5I71B 3FQTA 4HS8L 3FO1A 1IFHL 4NWTH 4M4RA 3BT2L 3TC9A 1WBXB 4C56E 2ZUQB 5EOQL 4PRNA 4XH2B 4LAQH 2A9ML 2CLZB 4LSTL 3WFCL 2CMRH 1N8ZB 1SJEA 2WM0A 4L8DA 2QHRL 1EGJA 4F7CB 1MHCA 2J6EH 4Q9BA 1JWSB 4G80B 4YPGA 4CVUA 2GSGB 5D72H 5IVXE 3MLVH 2CD0A 2R2BA 3TO4B 3PWPE 5D7IA 1JHKH 4FFZL 1LD9B 4P0DA 1RVFH 3EO1B 5MI0B 3T0WA 5C3LD 2YPLB 3LKPB 1W8NA 1CFBA 3C8DA 4BZ1H 4DJMA 1PKQA 2VXTL 3DGGA 2A1WL 3HE6B 5BMFH 2EDKA 5FYKL 4BSVA 1SYSB 3GMQB 4NSKB 3SQOH 3ILPA 3QFDA 1M7DA 3O8XC 4PJDA 4F15B 2DL2A 4MDJB 1INEH 1A9BB 2X1WL 4OF8A 3F12B 4G9FA 4NP4H 5C0BA 4DGYH 4ODVL 3SJVD 2VC2H 1UZ6E 2MCPH 2HVKB 3H9HA 1GJIA 1YY8B 2NPLX 4M61B 2DKSA 1FBIH 4MHHI 2XKUA 1S5HB 4MZ3A 4OZFH 4WW1B 1VACA 3QUML 2PNDA 3D69B 2YXMA 5F7EH 1QEWB 1WZLA 4KV5E 5D7IE 3KPMB 4LGRB 3B4NA 4NFBA 2V6HA 3NCJH 4ODXB 2F9BT 4ZUWB 3AS2A 5D1XA 3ZDYE 1FORH 4XHJD 3VFMA 4AEIL 1BGXH 4NN7B 2IPUK 4HFWB 3SE4A 1PKQE 4JFFD 5CMAB 5BCAA 3VE0A 1PW3A 2Z31B 3CFKB 1SEBB 4HK3J 2Q3AA 2N4IA 4XVTL 3RGHA 4OCXH 2AK4A 2H41A 4E41D 4PJDE 2IPUG 3VXRD 1AKJA 3KYMB 1AO7B 1Z9LA 4G9FE 3BZFA 4DZBB 4HIHB 5C0BE 1GZPA 2F8XC 1FL6B 4U1HB 2GIYA 1KBGH 1Z9OA 3V8OA 4R97C 4PRAB 2DIJA 3TM6A 3KYKH 2AERT 4NKIH 3DRTB 3HI5L 2WNGA 4R4ND 3HZVA 3O4LA 3QP3A 2HG5B 1IEAB 2R0LL 3P4OB 2UV3A 4HV8A 4J4PD 4N0YL 3NCBB 1D6EA 4BKLB 3VA6A 1M7IB 4WNQB 2BNQA 2P8PA 4KQ3H 5C08A 4H1LH 2FLBT 4G7VH 5HGDA 1T5WB 4J23A 1EEZB 2A2QT 3MLRH 1JTOA 3ULVD 1NLBL 3A6BL 3L3OA 2VABB 4HLJA 2D7OA 2VXVH 4NQVB 3UC0L 4F15C 3RWEB 4MXWL 4WHCA 1TXKA 2VB5A 3VD4A 2AK4E 4HS6A 1A7RH 3EYUH 3T65B 3QQ9D 1MCLA 3C08H 5B4MD 3SKJH 3U1SH 4PJXF 4U7KA 4QRSA 3GJFA 4TOYL 1UXWB 3O11A 2FBJL 5DQJA 2VLRA 3L5XL 3OKMA 1TJGL 4ODUB 5CBEA 1ZGLB 4HEPG 2J8UF 2OQJB 3VGAC 3EOAB 1XCTB 3ARFC 2OM5A 1IILE 1MCIA 3L5IA 3O4LE 3VG0L 1UWGL 4HGWA 5MHSE 4H5SB 4U6XA 5C08E 5JDSB 1S7TA 5HI3C 3ORJA 4QHLB 1NBYA 1J1OH 1S9KC 4OT1H 3Q5TA 5DHXB 5I1GL 5TH2A 1NLDH 1U3YA 5EIQA 2R4SL 3FHAA 3EBAA 1G7MB 1A3QA 3NZ8B 3TT3H 4D0BA 3HI1A 2HJKB 4KMQA 2FNBA 1H8NA 3JV6A 1EXUA 5F7NC 1E0OB 5JXEC 3GM0A 5E94B 4BH8A 5IROC 3RVXC 2DJUA 2R69L 3IJYA 1JL8A 4YIQA 4YHOH 1XGUA 2HT2D 4JKPL 3VDAA 4LMQE 3QXWA 2VLRE 5L2JA 4B5EA 5FO9B 1OB1B 1L4IA 4F3FB 3F58L 4NO0B 5CJOH 3T8XA 1AR2A 5EC2B 4KJYB 3WIIL 5F3HB 3U6RB 4JREC 4R7DA 3ARYA 1Z5LB 4KMTL 5IJKC 4BH7B 3ZKXB 1MY7A 5GGSA 3RJQB 2V5RA 5GGRY 4ETYA 5ITFB 3BQUB 3U7YH 3WFDL 4JKKA 5EOCL 4G7YH 3ZTJH 1AC6A 4BSWB 4MNHB 1PQZA 4MA1C 1YQVL 2HFTA 4XB8A 3PQYB 4IM8A 1F4WL 3HG1D 2L7UA 3KLDA 5I8EB 4C83B 4PJ5D 4QF1B 1RUMH 3DX7A 3QNXB 3W81A 2CGRL 4FOMA 3VFSA 1JHTA 2YD3A 4PJAF 1JI2A 4QLRA 1NBVH 3GSNB 4YHMH 2OK0H 1AHWA 4LP5A 5J11B 4GRMA 4J6RH 3P4NA 3WBDA 5L88L 1ED3A 3LKQA 2Q7YB 2PYFA 2XTJB 1URLA 1AD0B 1ZHKA 4OLWH 2BY2A 3H7BB 1EBPA 1NANI 2VZ1A 5FGCB 2CJUH 4PGBA 3RA7H 4MA3A 2QADC 3TJHD 3TO4D 3QUKA 1LO0L 1G7LA 4EI6A 5DD6A 5C0FB 4WFFE 5B8CC 1ZSDB 3P0YH 4YR6A 4PBVC 1PZUB 4KRMB 4KH2A 2E7HA 1QLFB 5KSVA 2NMSA 1JGLH 5CKAA 2VISA 3AREB 3BPCB 4JFPA 4QOKA 5CP7A 4TTGA 5KTEH 5FGSA 4E42B 2W59A 3S36X 1EFXD 3QUYA 2NZ9D 3SO5A 1VADB 2JIXD 2OYPA 1HINH 1G1YA 3CVHH 4Z0XB 3G5YB 4JVWA 1CVRA 4M1CD 1N5YL 4EXPX 1U95A 4NFCA 1G7HB 4IOIA 5T1DH 3ZKXC 2X40A 3CMGA 4UDUB 4A6YA 2Y07H 4Q97A 4G8IB 1DFBL 1RZJH 3HC4L 1XGPB 3QO1B 5DK0A 4L5FH 1NDGB 3FCTA 1V8HA 1U92A 3GSUA 2AKRB 4JFDB 3VFOA 1LO5A 2H8PB 5DJZB 3IJSB 4MB4A 1DBJH 1NMBH 4G8EA 3DUUB 1MCCA 1UXSA 4YO0A 1K4DA 1WFUA 2VJXA 1T1ZB 3MV7B 2DICA 2DN7A 4JM4H 5ADOH 4O51A 5C0NC 5IHBA 1MHPL 1UWXK 3H3BC 2FEEL 4GQ9L 3REWA 3MC0A 4QXGL 3EFFB 4M1GL 4QOKE 2VLKD 2J8UA 3OTTA 3HPJB 3ALPA 3V5DB 3T2QA 1I7ZB 3HKFA 4S1QL 2HT3D 4Z7UB 1C12B 3FAXA 3D3VD 2EDJA 5E8NB 3VXTB 3QIUA 3O2VH 1FG2B 3MNWB 4MAUH 5ESQB 2BNUB 3T2OA 1KJ3L 32C2A 3UDWA 2YA2A 3GIVB 2G75B 4M7KL 4RISL 5I6XB 2VXQH 3O3DB 1IQDB 5DJYA 2ICWB 4K7PL 1RURH 1GC1C 1RJYB 4ZUSA 4PJIA 5FECA 2XPGA 1I8MA 5BV7B 5C0GB 1F90H 2I9LB 1AY1H 4IMKC 3NAAL 1NCNA 5T5NF 5I2IB 1CLZH 4DK3A 4CDHA 4HDIA 4ZD3L 3Q48A 3K4ZA 5GS0D 3PV6A 5GS1C 2OTWB 2AXGB 2ADJB 3AREC 1F8TL 2Z0BA 2MTPA 4APQB 1KLGA 2I9TB 4HKJB 1DQDL 1M05A 4YDLC 1PG7H 2IH3A 1CR9L 3MNVB 1A0QL 1RIHH 2DYPA 2J8UE 4JFHE 2CQVA 5GJSL 4FQIL 2AJ3A 5LQBL 4KU1A 1H0DA 3BE1L 4OD1L 3V8CA 2FATH 1VESA 3KPOB 4JFOB 1ZTXH 2Z4QB 4XPTH 2EE2A 1CTOA 1EO8L 4WWID 3MRHB 4LRIA 2KZWA 4PJIE 5A16A 1K3ZA 2QBWA 1TFHA 3U2SB 4K9EL 4G8GB 3MLXL 4M93B 4O4YH 2ZSWA 4XPFH 5F1NB 4R8WL 4HK3N 4JY4B 4RWYH 2ILLA 4I4WB 4UV4L 3WYRA 2HN7B 3LMJH 1LDPH 4X80L 3QEQB 3AS0A 4KUZL 4HXBL 4F7MA 3BEWB 3LH2L 1ZLSH 3V0VA 3RJDA 2OI9C 2PUQT 3IAQA 1KGCD 5HTSA 2GKIA 4YWGL 1MJ8H 2CRYA 2HWZH 2O26U 4YDJB 2SEBB 4UIKH 1BD2A 2XZCL 4M5YH 5JO5B 1HXYB 2Y25A 1DSFL 2AS5M 2VRAA 4S1RH 2R56H 1EFQA 1H5BA 5L8KB 2Y06L 4Z7VB 1CZ8H 1DUYA 3UTQA 2XZAH 1KNOA 4JY6B 4U1IB 4FQQB 1B2WL 1DLFL 3QNZA 1ES0A 4Z7NE 4H25A 3I3DA 4YHZH 5EA0H 4X6BA 1MJUL 3VXUB 5CZXD 3JUZA 4UTBH 2DKMA 3UJIL 2HJLB 4KI5F 1QFHA 3STZB 3RZCB 5BO1L 3ECBB 3RHWK 4HH9A 1VGKA 3MACL 2CR3A 1HK6A 4OFYD 4APQC 2GITB 3E1F1 5I1EL 1UB6A 4HS3A 4HWNA 4W4OA 3DTXA 1N3NA 4NHUB 3IDMA 3ZSTA 1MAMH 4AMKH 2Z8VC 4LBEB 3OPZH 3D25A 3CFCH 1QLEH 4XWGH 2JJTC 1DLHA 5C0JA 1BD2E 3GI8L 4PRDB 5IW6A 2V5YA 3FN3A 3QIBA 1MWAL 1MQKL 2FB4H 1G1CA 1B0GB 2UVEA 5DHYB 5I18L 3MRJB 1FYTB 2XTJD 1U8IA 4M93C 1Q94A 1LO3L 3MRNB 4LSVH 4EI5A 2FHBA 3O45B 3BP7A 3E6HA 3GI9H 2Y6SC 1X5IA 5AZ2H 3VFRB 3E3QC 3WXVH 5IK3B 1P53A 2ZPKL 4FZEL 1U41A 4WV1A 3LKSB 1T20B 4PRHD 2ARJQ 4MDIA 4EN3D 3CUPA 1CFQB 2ARJA 2Y7QA 2DQDH 1A3RL 3MO1B 2XNAB 3OGOE 4NNPL 2YD6A 4CUCA 4NO2A 3QI9A 2UZYB 1G7QB 4OB5H 2VOTA 4GS7C 5DEZA 3FL7A 4H20L 1LILA 1QSFD 1RJZA 2APTA 3WN5A 1RHHB 2A38A 4XP5H 5EBWB 1S7XB 4L9LA 4N68A 4CMMB 1OD9A 3CVHA 3JWOL 3TO2B 4QHUB 1GAFH 4KJPC 4RQQB 1WISA 3OBAA 3QSKB 2EH8H 3U0WL 3QWOB 4LARL 2VE6A 4JB9H 3ME0A 5EULV 1INDL 1RJLA 3K0WA 4I5BB 5CIPB 4W4NA 1S9VA 3GJEA 4JFEA 5SV3A 5KSAA 2AABH 5CSGA 3O6LH 4JFDD 1S7SB 4HJ0D 4X5LA 5KG9A 5HDBF 3MRDA 5IMKA 3HNTL 1C7SA 1DQMH 1NMCC 2QKIB 3EOBB 1HQRA 3PG2A 5C6WH 3B83A 5F7WC 1Y6KR 5INCA 1XIWC 2H1PL 5KJRL 2E7LC 5HY9A 1A1MA 3V0WL 4ALAL 1F2XK 2H2SC 2MQ3A 5GGTH 1ADQH 3IFPB 4HWBL 5CSBA 3MR9A 3HC0B 3P77B 2DWEA 3TZVB 4UQ3A 1WBZB 3QJHA 1TZIB 3C5ZD 5SWZA 2AK1H 2ED9A 1NFIB 2C7UA 4UI2A 1F5WA 3EDJA 1T6VN 4LPVA 3ZKND 2HVJA 4MD5B 1FFOB 3DUHA 1WSST 3MJ9A 4C4KO 3DV4B 3C6SA 1W72B 4QY8B 1DBBL 4JFEE 4U1NA 4P2OA 5I1LB 2V7HB 5L6YL 1LE5A 2F5AL 3BDXA 1W2KT 5GSVB 5ALBL 4XVUC 3QDGA 3SKUD 1KPVA 3FQRA 4TUKL 2OL3H 2EYRA 2CO7B 5AG8A 3SDDB 4GO6B 2ZOKA 5ELIA 4G42A 4RGNB 3ET9F 3T0ED 4DKFH 4KKBC 1DANT 4HJJH 3MFFA 3QYCA 1L7TL 4OLUL 3G6JF 3UYRL 5SWSB 2F54B 2J8OA 3SKNA 1H3PL 5CBAB 3LKNA 5ILTH 1CFNA 5GRUL 5LWYH 2ICES 4IOSD 4HQQH 3NFNB 4LDLB 4NRXB 1JWUA 1KELH 1EO5A 4GRWB 1UVQA 5ANMA 5AYUL 1CK0H 1HSAB 1CFSB 2FWOA 3MGTB 5HVHB 1YUHB 2AI0L 2XV6B 3VXOB 5FK9B 4N5UA 3M45A 4TVSa 5FA3B 5GZND 1YEGH 1NGPH 1HIML 3TWCH 1CQKA 5EU6A 2UYLB 4JFQB 1CL7H 4PJBB 4G9DB 4V2BA 3TVMC 3TNNB 4I0CC 1A6PA 4LKCA 5HHPA 2DQTL 2YC1A 4B7IA 4Z6AT 3PIQA 1SVZA 3KWWB 2CDEA 1QYGH 5CSZA 3HRPA 3QEQD 2WUCL 4ODSH 1XH3B 1UENA 5FGRA 3TZVC 5HDQL 3RNKA 2F58L 2G60L 2Y36H 1K2DB 1TTGA 5E9DA 1VSCA 2ZP0T 3I85A 4FQ2L 4FFYL 1L0YA 1S9YB 4F58H 2GJ6A 2BFVL 4OCWL 3HS0A 2HA1A 5B3JE 4NZJA 4XBEL 3SY0B 4NQSB 1CD9B 1C5BL 3VH8G 4O58H 4KI5E 1YNLL 4NDMA 2ZUUA 3ESVF 3WMSA 3MCKA 1GPOL 3KDMA 2HH0L 1BQHA 1IFHH 2X9YA 1NKOA 2WWMC 3JBG7 4HGMA 4RX4D 5EU6E 2VLME 3BT2H 1VFBB 4MQSB 5J57B 5EOQH 3RZCD 2A9MH 3P30L 4LSTH 3WFCH 2QSVA 5C0DB 5D2NA 3ZE2F 5EC1B 3GZKA 2PW1B 2V2WA 4FQ1L 5K9KA 3HPLB 3L5WA 1PX4A 1WFNA 5GGRB 4PP2A 3UEZA 1C5CL 1HZHL 5LCVL 4LP4A 5E9DE 5JDJA 1E4JA 1LGVA 4M7LT 1UCBL 4U6HA 1IAKB 4FFZH 5C09A 3BKCL 1CI5A 2GJ6E 4TVPH 1A4KA 4GSDL 2OTUB 1BQSA 2AEQL 1D5MB