3EYUL

Pfa1 fab fragment complexed with ror2(518-525)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
218
structure length
218
Chain Sequence
b'DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords If kappa light chain
publication title Structures of Abeta-related peptide--monoclonal antibody complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 55
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2008-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eyuL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eyuL01
3ARGD 1WSST 1ZAGA 2ZCLL 4NRXA 4R2GB 1P7QD 5DS8A 4F8QA 4HCRH 3KPPA 1U2CA 4M6ML 3VG0L 2EDLA 3AXLB 3WEXB 2ICES 1ZT4B 3IFLH 3L3KA 1RI8A 2YSSB 2AABL 2R0ZH 4MA3A 4XPGL 3JWDC 4Z0XA 4YBLC 5D7KE 1G9NL 3C6SA 1P69B 1S8DA 4ZSOE 4CW1A 3KHOA 5D71L 1B0RB 2SEBB 4JFYA 1YDPB 1YMHA 5DJ8A 3NA4A 4U0RC 2P8PA 3HHRB 5D72H 5IFJA 5FKPB 3A6BL 4IS6B 3ARED 3C9NB 4P9MH 2NZIA 1IC5L 5D7LB 4ZAKA 3I3DA 3AFLA 1A9BA 1T1ZB 4OZ4B 5JQ6L 2HJFB 2CLZB 3GSRB 1MI5A 3EYQC 3DSFL 1JK8A 3P4LA 3QEQD 4GMSH 4RGOH 3L5WB 2P1YA 4E5XA 4Z7WF 5C0JB 1RIHL 3HAEA 1FZMA 2VC2L 3VXSA 4Y4HC 5EN2A 3IJYA 1MFBH 5B22A 1AFVH 4GBXA 4LDEB 1WEJH 1S9XB 5KVDL 1ONQB 4D9RD 1N6QL 1J1PH 3RPIA 1GXEA 2HYMA 3KYAA 3QIBD 1CD0A 4HC1H 3K2MC 5INCB 3CZJA 3DXAB 3M8OH 4U7MA 4HZLA 2IBZX 1LE5A 4L9LB 4PV8B 1FAKT 3BT2H 4BFEA 5CHNB 1K3IA 1F42A 4AH2B 4KKBD 4IIQA 3EJZC 4LPTA 2Z91B 4P48A 1M6OB 5F7LB 3SKOA 3T1FA 4KI1A 1UKTA 5D1QB 1G7JB 3MYJB 1F90H 1UH2A 3IT8D 1TPXB 3QIWA 1JJUA 1MFCH 1CFSB 3IRPX 2YMXH 4RAVA 4C83A 1LDPH 1NC4A 4TUJB 4WEBL 1GCFA 2W9EH 2WIMA 1UM5H 4PRAA 4JQXC 5IVXE 2JB6A 4K2UH 2IAMB 5ACZA 2RFXB 3HR5B 3O6MH 3RGVC 2HMIC 3V7MA 2X1QA 3MBEC 1FNLA 4NC0B 3N85H 4JLRA 3TA3D 2MKLC 3EZ8A 4IRZH 5BZDA 1ORSA 1ZT1B 3DX7B 4AQOA 1MREL 1QLEH 4NQEA 5EU6E 1XIWC 2H26B 1OF2A 4PJXA 4LIQE 1UJTA 4MAYC 2VJXA 2YD1A 1YN7B 1BFTA 1XAUA 3KYKL 1A3LL 5SWQA 1DDHB 1S7VB 3EOTL 3MXVH 3QQ3B 3G04A 1NFKA 1HEZA 1M05B 3KYOB 3MFFA 2J5LB 4QRUB 3SPVA 1F4YH 4PS4H 1WICA 3OKLA 4JG0H 3O3EA 4DW2L 1I3GH 1V7ML 5CMAB 5EZLB 1X4YA 4EN3B 4Y16B 1PZUB 4LLAA 2NY1B 3HC4L 4NQVA 2R1XB 2LAAA 1LP9F 1DANU 2D7PA 3BPCA 3F62A 3GKZA 4LLVA 4FQXA 3TYFA 4MQXD 4P2OA 4PJFE 1Y6NR 3D69A 3MRQA 1LVEA 5EC2B 5IB5B 3MJ7B 4WI8A 3CVHB 1EGJH 3TO2B 5DTFB 3GRWH 1CICC 4NNXA 5GS0C 1I9RL 1YMMA 2IQ9L 2OSLA 1QBLL 1J5OL 3GKWH 5GGTH 1RJCA 3FQRB 1SY6A 4KWUA 4L3CB 4LSRH 4GRWE 4FQHB 1C7TA 1N3NA 5FHBL 3QO1B 4KK6D 3CFEB 3V5KB 4RGNE 1S7XB 4MQSB 3K7UA 2DQHL 3VXUB 4YPGA 3QDGB 1JPST 3FB5B 3U9PH 3FB7B 2ZPKH 1IC1A 4ZXBC 4UT9H 3ARSA 1JGVH 2DQDL 4HBQA 5EIQA 3C60C 1UB6B 1JGDB 3U0PA 1EHAA 3W0WD 2APBA 5SX5K 2MMXA 2BCKA 3SY0A 3WD5H 1J87A 1JPTL 3O3AA 3HR6A 3WFDH 3WFHB 2HLAB 2JELH 4DZ8B 2OQJA 2OTPA 2LAGB 3QZWG 3P3YA 4DK6A 1T83C 3GSQA 3UAJD 4FQJL 4LF3A 1FGNL 5IBUG 3UTZB 1QLFA 1MJUL 5GRWA 1OT2A 4N0CC 1K8DB 3NACL 3IU3B 1MIEL 5EOQH 5C0DA 4CVZB 1FLTX 4PJ9C 5IB4B 2D0FA 4OLVL 4F15C 4WI2A 3S36L 1M71B 5JDSA 1HXYA 3QFJE 1I1AA 5CBEA 4X6FA 1KB5L 2CQVA 2ENSA 1EIBA 4JZOB 1MCLA 3I6KA 3OHXA 1KLUB 5DJAB 1MELA 1VA9A 4NIKB 4RMWA 1G0XA 1T1YB 5HGBA 5DHVB 4NKOB 2FH8A 4M7LL 3S4SA 3GUTA 1IKNC 5CD3B 2ARWA 5JZ7C 1R3HB 2VIRA 3MRNA 1P7QA 5DD0H 3CZFB 4YDIL 4ZUUB 4NKMB 3Q3GA 1KJ2B 4Y5YB 3QFDB 4GKSB 5ETUB 3TH2T 5E5RB 5L8KB 4LEXL 4XPHH 3WN5B 4YHKL 3VFWB 1JWMA 2NY2C 2XTJB 1ZWIB 3PGCA 4MNGA 4HPYH 2DICA 4NKIH 5B39G 2C4XA 3ULUF 5D93B 3BKCH 5IKCB 3MLWL 1QVOA 5ADPH 1AO7E 1ADQL 1I7RA 4LSQH 4U1NA 4GW1B 1UWEL 4C57C 1EA9C 4U7KA 5GGRB 2PYED 5TFSL 4FXGB 3VXOA 5E6YA 4FXKA 2AJVL 3C87A 3MROB 3H9SB 1E0OB 1S9VA 4OLWL 4M43H 3QEQA 1DSFL 3G9AB 4KHXH 2UZXB 2W38A 4HF5L 4JRXD 4M1GH 5GGVY 5GRJL 5I1LA 3DX8B 3DRTA 3IDXH 5E94A 2V5YA 5I8OH 2Q8BH 3LQAC 1N6VA 4X80H 4LSSL 4PJGF 4DAGH 1I9IL 1R5IB 1T80A 4RSVA 5DFWH 3QIBA 4GG6B 2ICEA 1JYWA 1X5KA 4PRPD 5ID1B 1MRCH 2I26N 4K3JH 2JCCF 1CLZH 3D39B 1HHGA 4AM0B 3OF6A 5IMMB 2WLZA 2DM2A 4OF0A 4P2YA 3GO1H 4KGLA 4OCYH 1PSKH 5T5NF 1YEHH 2IANA 2QQKL 2OP4H 3BH8A 1MCEA 3ILQD 5BV7L 5ALCH 3VGAB 5KANI 1BVKA 1QSZA 5ITBH 3KPSB 5E2WL 4XRCB 3HPJB 2DYPB 4XC1H 3VI4E 2XIDA 3BD3A 1J05B 1QSFD 1EEYA 5E7FA 4GRMB 3I75B 4MA7L 2A6JA 4M6NH 3TA3A 1MQKH 1PGRB 4RX4D 2HTLD 2CJUL 2NY7H 3DVIA 1P7KA 1ND0A 1U8NA 4KQ3L 5E24E 1U91B 4ZFGH 4Y4KB 1JI2A 4HPOH 2C1PB 4OZGE 2F5AH 4D9LL 4IRSC 5AAMA 1V8HA 2BP3A 4YE4H 1K6QL 4XNZB 1MCFA 5C7XL 3U6RA 1KOAA 3V7AG 5E56A 5KZCD 3V4VH 4EI6A 2EH8L 4HFUH 3M17A 3TCXA 4NQXA 1LK2B 1FVDB 2IGFL 5DK3A 2F54A 5HGAB 3FOLB 4ZS6D 2AEWA 2DQEH 5ICZA 3BQUB 4GSDL 5GGQL 3HS0A 4P59L 4POUB 5EBGA 2R0KL 1KENH 5EZOH 5CFHA 3O8XB 1WISA 4OM0H 3SKMB 4GAFB 3I84A 4BFIB 2NY5H 2UWEA 4HIHA 3SJVD 2WBJC 3AU1B 2Q7YB 1OGAD 2YZ8A 4JM2F 2B0SL 4MSWB 5C0AE 4X98A 5BO1H 5DUMH 5FGRA 1FSKC 4FZEL 2XICA 5IF0A 4OF3A 5TDNA 1QFWM 3OKMA 4LHUB 1S9YA 1UB5A 3KPLA 3SDCC 1OQXA 3TJEH 1AGBA 5IMOB 1M7XA 5C2BL 2GUOB 5CZXD 3QUKA 1MNUH 3IS0X 4RMVA 2AXFA 4MCZB 4JHWL 4O2FA 3L3HB 4EOWH 1AE6H 2DKUA 3KJ6L 1IGYB 1RFDL 4M48H 3L3IA 5DVMA 3EYFA 3ALPA 4PBXA 4XXCA 2NTFA 3QI9C 1FLRH 3ZE2F 4NQUA 1KCRH 3RNQA 2IF7A 3IDNB 1CQKA 1AGDB 5F44A 1IEBA 5J1AB 1IVLA 4NT6B 1NH6A 2PCPB 2R15A 3T3MF 2PR4L 2C3HA 1J0HA 2ZUQC 3CFDA 1CVSC 1S7WA 1TTGA 4PTTA 3O6KH 4OD2B 4U1LB 4QHMB 4ZD3L 3P0GB 1BQUA 4KUZL 1DQJA 3OL2A 4BZ1L 4UOJA 4HKJA 5JW4N 1WBYB 1EO7A 4TVPL 2OR8A 5B38A 2MKWA 3UTSE 5HYSA 4HW6A 2GJ6A 3NIFF 1XH3B 3X12B 4U2ZA 4Z6AT 1U8HB 4XHQA 4WIQA 1L6XA 1YY8A 2GJZB 2Y72A 5EB9A 5BCAA 5HYJD 4X4YB 5BXFA 1U8KB 2DLEA 3PP3K 4HQQL 5L8LB 3O2DH 3NABL 4NQCB 5LXGL 1YZZA 1VFBA 3VWJC 4LDOB 3WNOA 3O9WC 4LPCA 3U4BH 2NX5D 3RTQB 1RVFL 2BHUA 1U2HA 4OD3L 1KTRL 2ICWB 4PLJC 4BZ2H 3GMNB 4DQOL 3U36B 1FV1A 2J88H 1AGCA 2WUBL 5CZKA 4XCFL 4MXWH 2GT9B 1NANI 1F11A 4MJ6A 4HS6A 5AD0A 3TN0B 5ISZE 1YEKL 5KSAD 4I5BA 2PO6C 3LH2L 2HFFA 4P0DA 3QUZC 1EH9A 1NEZA 2CXGA 4XBGA 4EUPB 3DX6A 2EDTA 5TE4L 3I2CL 1EJOL 5FGBA 1RU9H 5FUOH 3TBSA 2MCPH 1VFMA 4O5LH 1KB5B 3QHFH 2QSTA 5J11C 2XG5A 3L9RB 2B7DT 2PYEA 4HUVB 4MD0A 4I3RH 3BKML 5D7SL 3S5LG 3EFFB 3Q5OA 4X9FA 3OJMB 4OLXL 4LFHG 3MCKA 3MJ8A 4UQ3B 4IRJC 3QUML 2DIBA 5SX4I 3RU8L 1QEWA 3TVMB 2R69H 1VGKA 2XKNA 5EIVA 3QEHA 5T5FL 3L3JB 4JRXA 5GZNC 4ODTH 1PG7W 4U6HA 2I24N 1IM9D 3HAEH 4ODWB 5I8KL 1Y0LA 2BOBB 5C09A 5I9QC 2B1AL 4XNUH 3BO8B 3QO0A 3SGJA 4HSQA 3TWCH 2ID5A 5DJDA 5HGHB 1FAIL 2JJSA 4WHYH 1JHKH 4KVCH 4PB0H 3KPOB 5K9QI 2DLTA 2HFTA 2A77H 2W9DH 3E1F1 4Z76A 4N9OB 2X1OA 3SDDC 3TNNB 3V6ZA 43CAB 2PN5A 5F9JB 2IQAB 2ICWI 3DETD 2ADJB 3MRHA 3QUXC 4S11A 2KZWA 3WCYA 5CIPA 3UO1L 1Z5LA 1MH5B 5F3BB 3QNZB 5E8NA 3RDTC 2VZSA 1P9MA 3ULUC 3WLWC 1F3JB 1J1XH 4I48B 5GS1A 4UT6H 1A02N 2VXVL 4B50A 4PJ5B 5IHZB 2H45A 4LEOA 1I1RA 2D0GA 5HHVH 3IJSB 1DQLL 3WIHL 2VXSH 2BSRA 5D2LE 4TNWF 4Z7UB 4MGXA 5C08D 5D2NE 3RWGB 1T04A 4WNQA 1T7ZA 1W8NA 4MLSA 5BV7B 2FIRT 5FO9A 3NIDF 1KG0A 4NM4H 3OPZL 5E6IB 4YR6A 3A6CH 1IC7L 1EO8L 2FJHA 4O2CA 5F8QC 2FX8H 5F7DA 3QG6B 5A16A 1WAAA 4NO5A 3CFIC 4LRNL 3LVEA 3TZVD 3OKEB 1LK3H 4NC1C 2EYSB 3MTRA 1BX2B 3FO0L 4HKZB 4ELME 2IFGA 4LVNC 4RNRB 3REVB 4BSWB 1U42A 4HD9A 1FYTB 2DQJL 4NN6B 4ACPA 3KDMA 1FP5A 3RUGA 3VGHA 1OGAA 1QYGH 5DMYA 3BP7A 1BOGB 2PUQT 4GAJL 1CF8H 1N7ML 4WI6A 3WJJC 5HDBE 4ONFH 3U7WL 4E41E 1CG9B 4L8SC 3D87B 3O45B 4HDIB 4PJHB 3GSWB 2EH7L 5EU7E 3WXWH 2A73B 4ZO7A 2LABA 2WWKT 1IGTB 3SDXE 3WL9B 1E28A 3REWA 2AV7B 2H1PH 3FFCA 3HE6B 4H25B 5T3XE 5K59F 1EFXD 5IR1B 5T1LB 4RAUA 3MRMB 3O4LE 1CLCA 1FFNB 5E8EB 1HHIA 4Z7VE 1ROWA 2IBGA 1DBAL 2BVQA 2HLFC 4FQCH 3N50A 2X9XA 3SO3B 4BSVB 1KEGH 1AKJB 1FNSH 1UXSA 2DQFA 3T0ED 1KNOB 4WDIA 2BNQE 1TJIL 1LO2H 1DE4A 4ZPTA 5MP6H 1KJMB 2X40A 3T2QA 4PB9L 4P2RE 1UEMA 4HHAB 4QF1A 5DXWA 5C0BB 4X6EB 3STZB 3BPNC 2F74A 2B4CC 4HJ0C 4LLWA 2EYTA 3AMKA 4PIRF 4OI8A 3FZUD 2RBLA 2VE6A 4NC2B 3ARFD 3C5ZB 3KPMA 1NPUA 1OAKL 1ACYH 5JHDA 2NY0C 1FDLL 1S7UB 4MHHG 2UVEA 3NFPA 2D03L 4ODSL 1QA9B 4NFCA 1BFSA 1A4JB 1I8MB 1U41A 5HI5D 4FABL 1LEIA 4XH2B 4P5TA 1KIQA 1AGFB 1CU4L 4JM2C 1YNLL 1URLA 2YN5A 8FABA 3VFOB 4ALAL 4QRRE 4I0PC 4N1HB 4ORGB 3ZSTA 5E9DB 1MFEL 4OZIA 1MJ8L 1N64H 4PJBE 5SWZE 4APQA 2XN9D 1UYWH 1A6ZB 2FL5B 1ZLUK 3SBWC 3BN9C 4DN4L 3G5VA 1O5DT 1C1EH 3KPNB 1HZHH 1VPOL 5HHOD 3PL6C 1KIUA 3NFNB 3W2DL 2B39A 4XPTH 1WF5A 2NX5A 5EOTA 4WU5A 3OR6B 1IGJA 2RCSH 3ZE1F 4PY8I 5GJSH 3IKCA 1DL7H 3DX9A 1U8OA 2ESVE 2Z92A 3NZHL 3P4MA 5IJVB 3MRRA 4YBQC 1VESA 2WBWB 5KSAA 3BE1L 5FFLA 5JPMB 5DZLA 4XGZA 2XQYG 4L8CB 3FN0L 1NLBL 3UXFA 5L2KB 1HHHA 5DQDH 1FJ1B 5E2VL 3ARPA 5HDLA 3PDDA 1G9MC 5BRZE 1IAIM 1BZ9B 3T2PA 5AWNH 5BS0A 1NBZA 1CZ8L 3MXWL 3VFMB 3U7AA 1HILB 2OL3A 4PJAB 4U05A 1FL6B 4FFWC 4K07A 4Z8FL 2XXMB 2BDNL 4U3XA 1NGXB 3GIVB 1NUDA 4A6YA 3FB8B 1VGEL 3CLEH 4DKEH 2VDKL 3MRPB 1PG7H 3B9EA 5GISL 3QAZB 4ZDHB 4KPHL 1AR1D 1PW3A 4NJAL 5CAYB 1OHQA 3I02A 4M62L 3MUZ1 3D9AH 1T2XA 4QGTA 2VLRD 2VLMD 2Z9TA 4HXBH 3H3PH 1SEQL 1D6VH 4KTEH 4WGWB 5FYJH 1G7QB 3VH8G 4OZHB 3U0TA 1Y18A 3MV7E 1CDYA 5L0QB 5TDOB 1YNTA 2R23B 4UQ2B 3EIFA 4DKAA 1OTTC 3EYOB 2NY6B 2X1XR 1WFOA 4I18A 1D5IH 3QUMB 2UV3A 2DF3A 1A21A 4MD4B 3EJJX 4I0CC 1SM3H 2VAAB 4YHLL 2DL9A 1QR4A 4R2GD 3LRSB 4GG6F 1MCCA 3GBNL 4KGJA 4ZFZA 4M93C 3LEVL 3DROB 1TCMA 3R0MA 1QNZH 3RJDA 1RUAL 4JFQB 4PJDA 5I15L 3DGGB 3FQTA 1FNGB 1MFDL 3ES6B 5IGXL 4YUEL 2VXQH 2H3NB 3WHXB 1BP3B 4MNQA 3S3PA 2NLJA 3MACH 3RRQA 2DKMA 1EDQA 2AXJA 2VSCA 5CEXA 5IBLC 4Z9KB 2F19H 3VXQA 2XT1B 3CC5A 1KJ3L 4X6CE 3B9KD 3HZKA 4LLQB 1KCUH 2R9HC 1ZVSA 1KPRB 4JG1L 4KK9D 3BZFB 5KG9B 4PGJA 2GYSA 5D7LD 4C59B 5D4QA 3MNWA 3OAUH 3BD4A 1LWRA 4PJ8B 1NGPH 3DUHA 1CGYA 1GOFA 4RGMB 4P2QA 4GG8B 2VDMH 5DLMH 4TSAL 3MLVH 2I9LA 4YX2L 3LMJL 1UVQA 3TZVA 3DIFB 1CXFA 3TCLB 3PWPA 1BQHG 4DWHA 1U8JA 3HMXA 1YEGL 5E2TH 3MGOB 1H8NA 2VQUA 1JHLH 4NJ9L 1CDIA 1XCTB 5GS3A 4FQXC 5HHXH 2XI9A 4BH8B 4KI5D 3FONB 1KIPA 2XWTB 1JCKA 3LKNA 4R7NA 3U82B 3LCYA 4X9HA 3FT4B 3VXRE 5FUZH 5IESH 1HOCB 3ZKXC 5MEQB 5KSUB 4Q9RH 3G6DH 3E2HB 2PETA 2MCG1 1DBBH 4ISVA 1K2DA 5FO8B 2VXUH 1H3UA 1D6EA 5D1QD 5B21A 2BMKA 1KYOK 2C1OA 3L5XH 5JOPE 4TSCL 1NEUA 1OGTB 4L4VB 5DDHA 4JKMA 4LSUL 4DKFL 4WV1A 2OXGA 4U1JA 5KSBB 5LWYH 4NM8L 1ZANH 32C2A 2X4QB 3T0EA 5CGYD 1GZQA 1RZ8B 2EXYC 4X7SH 5ID0A 1PG7X 4S2SA 2GITA 1F3DJ 1J8HB 2CO6B 2X6MA 4JO2L 4N9GB 1KTLA 5H94A 3V5HA 3N1QC 1VADA 4R0LB 5SWSE 5T33H 2Q3AA 2IAMC 4UOW1 4EBQL 1TVHA 4G6MH 1DBML 1DP0A 1WITA 2AQ2A 4K8RD 1JYXA 3SDAA 4XWGH 4M00A 1W72A 4HK0A 2HT4D 1NCCL 3T2OA 2FB4L 2A9ML 2I9TA 1EV2E 2PXYA 5T3ZL 3JV4A 4NHCL 2P5WA 4PGDB 1AC6A 3B5GA 2Q87A 2X4NA 3E6HB 1E4KC 4LK4A 5HD8C 1YEFL 3AMLA 1DQDL 1YN6B 1UCBH 5ALCL 5CINH 4AIXA 3JV0A 1T1XB 1NCAH 2CKNA 4P4RB 4G9FB 3L3DA 4EN3D 2J5LC 3AS3A 2VLLB 1NFIA 1RJLB 5E8OA 5L2JA 2NY1D 4O02H 1MCHA 1OP3K 2XA8H 4LBEA 5JIHA 4XNMB 2XN9A 2CGRH 3LS5H 5I1KL 4U1MA 4Y16C 4M8QA 4JREC 3OGCB 4HPOL 1BAFH 3MRDA 2Y06H 3CSYB 3R1GH 1Q72H 4G80B 4RFOH 1OAZL 4LQ1A 4Y1AB 3FO9B 3OKDA 1IAKA 4MB5A 4ZTPH 2CIKA 4GUPA 4MB4A 1ZGLM 4NQDE 3U7YH 4BQ8A 3NN8B 4XBPB 3VXUD 4NO0A 3K8LA 3P30H 1B3JA 1KENL 3QDGD 2FJGA 3WXVH 1RZKC 2VABA 4YDKL 2HJLB 4XHJC 3HUJA 4X6DB 1DVFD 4YPJA 2OZ4A 1FFPA 3Q1SH 4JPWL 1ZK9A 3QUYB 4OF7A 4XTRD 1Q8MA 2EKSA 4KJWD 5EO9B 2OJZH 1OP5K 1BJ1H 4C56E 3FO2B 1H3WM 2EE3A 4M1CD 4DCQA 4M5YL 2QSCL 1FO0H 3EOYG 5FYKD 5F7FA 4A2MA 2FEDD 3MV9A 4O00A 2R29L 4JPIB 4NWTL 5TPWH 4N0UE 4MDJB 2DWEB 4HWBL 3X11B 5D6DC 3LQAH 3D85D 5D96B 2VMFA 1IL1B 2QADD 4PJ7A 1S7TA 1JN6A 3TBVA 1DN2A 2OI9C 4GMTL 4AT6A 4U1SB 1WWCA 4G8FB 1ES0B 5JR1L 2V9QA 1X7QB 3RNKB 1ZKAA 2HAZA 3FCTB 4OGXH 4XMKL 2IPUK 5DD1L 4LKCB 3QNXB 2NY3C 4J3WA 1GAFL 4MXQC 1TZIB 3WDJA 1FVEB 1AXSA 4DOHB 5FOBB 5IW6B 5D70L 3ZHLA 3V0VA 2X4PB 3FFDA 2XYCA 3MFGB 2G5BA 5IHUL 5C6TL 2VDLL 1H0DA 3NTCL 4ZPVB 5IIEA 3P0VL 3MV8E 1BVLB 1DLFH 3QPQC 4U1IB 4K3EL 4PRIE 5CIPH 4FTVA 5MEPA 3WEXA 3TNMB 1Q1JH 5DQ9B 4KJPD 3HI1B 1X5AA 3ARDB 5F7WC 3QRFM 4UIMA 5EO1B 3TA3C 3C08L 3FQUB 2XTJD 4Y5YC 4MWFB 5HY9B 1HDMB 3VFRB 3G5YB 4KKAC 1G6RA 3FN3A 3F7VB 4JAMB 3DVGA 5I1DB 3G5ZA 5I19L 5ICYA 1QHPA 5CJXA 4B53A 4Q74A 2E9BA 5JXAH 3B9KA 4X9BA 5D93C 1WV7T 1Z9OA 3RY5A 1M7DA 5D7LA 2YPLA 3ROLB 3ZKSD 5D5MB 2VITA 4QXUH 1UWXK 1GHFL 4DVRH 5GQBA 2O5XL 2V2WA 3BDBA 4OAWB 3RVTC 3HZYB 5JW4Q 1BWWA 4OCWH 2KL6A 4Z7UF 2Q20A 4F7MA 4MXWL 1XR9A 5HYIA 2DBLL 4TQEH 1S9XA 4NP4H 2NPLX 4P57A 1UGNA 3GSNA 3DARA 3PDGA 1HXMB 1OTUC 43C9B 2WSKA 3TM6A 1T03H 1F4HA 3U2SA 5D7KD 4OZIF 1MUJB 1XFPA 3D39D 3EYSH 5DURB 2HVJB 2DIAA 5FDWB 2BNRE 1NSNH 2CDGA 1KGCD 2ZP0T 4AH2A 1HH9A 1MI5E 1C5BH 2Y07H 3DHMA 5D7JB 4KXZH 3S3SA 2ADGB 4F58H 2DLFH 5I6XB 5CD5D 3TEUA 5F3HB 2DI7A 4HWEH 2FD6H 4F7CA 1S5HB 3UX9B 5KVGH 2DYPD 5E5MB 5SV4A 5IFHH 3MUGA 1FZKB 4OQTH 1YQ2A 1JF1B 5J13C 4LCIH 3VGAC 4I0KA 2RFXA 4PUBL 3S88L 5F7EH 4P9HH 4YHPA 3WUWB 3D0VB 4D2NA 3T09A 3DX7A 1U9KA 2CKBL 3IYLW 2YS4A 4WW2A 1RUQL 2J4WH 2JK5B 5GIRA 2Q76B 5EH1A 5DJCB 3FQWA 2D7MA 1JGLH 3ZO0A 4Y4KC 1JF5A 4X4XB 3F7QA 4G6JH 1CK0H 4UDUA 5D6CA 4QCIB 4OF6A 3U1SL 3I50L 3ARXA 1PYWB 3C5SB 4QRUA 5B4MD 2V2XA 4PRHA 4QXTA 2J6EH 2Z31B 3RGHA 3BQUD 3ALXA 2VL5A 2VLJA 5E1AB 1L0XA 3O8XD 3P9LA 5EZLA 4O58H 5ELIA 2AXHA 5I74C 5CEZD 1VSCA 2AEQH 4NQEE 4PJXE 4QTHB 1U3HD 4JKPH 3OQ3B 2VRAA 4HAGA 1QSEE 1N59B 2YBRA 3EUUA 3OAZK 4GKNB 4U4BA 2Z35A 1ZLVK 3BWAB 1KPVB 2EEBA 3D1MC 4LHUD 1TETH 5EU6D 1A7RH 2J8OA 4I8DA 3WKMH 3ILPA 2FHCA 4LPXA 3VFGL 1IEAA 3V6OE 4BQBA 4L3CA 4DTGH 1EHLL 2J8UB 3D2UA 1S7SA 3K3QA 3PQYA 3L7EA 2C7UB 1Z2KA 3IRZA 3VXUA 3R06B 5DRZB 4ONGH 5T1MA 3V6FB 3H6JA 3KS0H 3GI8H 5FGBC 2YKLH 4JY4B 4PJDF 2XWJA 4UU9B 1DVFA 4G7YH 4KZDH 3EYUH 5IOPA 4I3SH 3PIQA 4S1DC 3HZVB 1UACH 4Y88A 5GJTL 3BEVB 4GAGL 4L3AA 1QYGL 2DRUA 1F4XL 2JKXA 4MCYA 1YMME 2IALB 3NIGF 4QNPF 4IOFD 3NA9H 5EU3A 4PYGA 2ATKA 3MODH 4AIZB 4U6YB 3MJ9H 5F96L 4XMPH 3FQNB 3NBNA 1DFBL 4GLRH 1T66C 4PPTA 3D85A 3D18B 4JFEB 3LKQA 3EO0A 5DMIH 4MJIB 4HMCA 3RWIB 3TT3H 4AZ8A 4G42A 3GMLA 1A7QL 5GGSY 4GAYA 3X14B 2P48B 1LD9A 3PJSA 4PJAF 2E8YA 3SGJC 4OD1H 4RGND 4AMKH 2NR6D 4JFPA 3E6FB 4P4KB 4OCRL 3CDYA 3VGFA 2IMNA 4G5ZL 1S78D 1JL8A 3FKUS 1BJMA 4YH6A 1T0MB 1KLUA 5DJAA 4XI5D 3BGMB 1GIGL 2ORBL 4DKDC 3G08B 3UBXB 3ZYZA 4PY7B 4YK4B 5CEYB 3F12A 4HIJA 4ZUUA 2AXGA 5GRVL 2RB8A 2NXYB 4WO4B 2W59A 3P77A 3BJLA 3EGSB 1CDBA 3AC0A 1DQQB 1UM4H 4UV4H 1T2JA 4OLZH 4OZHF 1TXKA 1P9MC 3T4YB 3ROOB 3TN0D 1K4CA 3H42H 1LO4H 3CU1A 3SKUD 1DEEB 5GS1C 4Z5RB 1YYML 5CCKH 4QHNA 1D3CA 2Y6SD 1NFDB 4WTZA 4F37K 4Q9QL 4OLYL 1A7NH 1I7TA 1A1NA 5KTEL 3S9DB 4JHBA 1JTPA 3BEWB 2Q8AH 4RMRA 4P99A 4AEHH 3T3PE 3PHQA 3TBYA 3CXHK 2VKWA 3P11H 4GH7B 1BD2B 3P73B 3QFJD 2CD0A 2AGJL 1OARH 5FA4A 4RWYL 5FV1L 3PWUB 1AQDA 1QRNE 3J7HA 5A3ID 1AGEB 4OGAC 1NAKH 1A0QH 4L3EB 3LHPL 2FRGP 3JWDL 3EHBD 4KRPD 1X44A 1X3DA 4PV9B 3TVMC 2C3VA 2G2RA 3QDJB 1KULA 5I30H 1D9KB 1LNUA 2PW1A 2Y25A 1JGUH 2XNAA 2A0LD 1XZ0B 4F9PA 1G1YA 3D39A 1SYVA 3GJFK 4DN3L 1YEJL 4LASL 2VDPL 4ZSOA 4LGRB 2V6HA 4PGZA 3WLBA 3HNTH 3QEQE 1AO7D 3ZDZE 2OS7A 1QFPA 3O3DA 2F8VA 2UYLA 4ZUTA 4R4BA 4TOYH 2M1KA 3WFEL 4TYUA 1P84J 2IFFL 2LQRA 4BUGA 1MAMH 1RJYA 5FYKU 4OFDA 1HYRC 1F5WA 2D31A 1J05A 1UH4A 1G7IB 3BISA 3L5HA 4D9RE 3QXAB 2HTKC 3PF2A 5FYJE 4LCUA 1WTLA 1T0NA 4JFHD 4OLUH 2IH3A 4KK8D 4FQLL 5EO0B 3MREB 1BLNA 1UQSA 4WI3A 5MI0C 3VJ6B 4F7PB 5CBAB 1KTKE 1JUFB 5KSBF 5DO2C 1IMHC 4AYFA 3QHZL 4CADA 2P44B 4LGSB 2F5BL 3WJLA 1JWUB 4PR5B 2ZOLB 4Y7MA 3R0NA 1U95A 1CD9B 5E6ID 1FIEA 3VD3A 1NGWB 1PEWA 5I66A 5J7CC 1A7OL 4NN7B 1ZLWK 4WI9A 1UZ6E 4G8EA 5KS9A 4R8WH 4P5TC 3BQUA 4YAQA 2XXCB 4QO1A 1G0DA 4EJ1C 3CMOL 4ERSL 2CDEB 4DGIH 3O8XA 1OAYH 5F9WB 1YQVL 3U83A 4NN5B 2HG5A 5LKNA 3SKMA 1GC1H 4KMQA 2CKBB 1U3HA 1FYTD 5AG8A 4NBXB 2DTMH 1TQBB 4APQC 1CE1H 5IVXA 4OKDA 4LSPL 3AU1A 1XF4B 3CXDL 4XVTH 2QQNL 5HGDB 1TNNA 3MR9B 3MRGB 3HNSL 4EIGB 1FE8L 4KAQH 4OJFH 4U6VH 7FABL 4LHUA 5HI3C 4G8GB 5EUOA 4LNRA 5EU6A 2D7QA 3VXNB 1CCZA 3Q48A 5JPNB 4X5XB 4GRLB 5EZJB 3S96A 5JW3H 4Z7NF 3OKOA 3HE6D 3VXMB 5DRWA 1S7RA 4OZFH 5T1LD 4Z7QF 1QBBA 3GJFB 2Z4QA 1E4JA 4QRQB 2LU3A 1R3LA 2KUTA 4BH7A 4I2XA 5KSAC 5JUEL 1MHHA 3KXFB 4GQ9L 1INEL 3P0YL 4P3WA 1IGYA 2BRRL 4EVNB 1AKJD 4L5FH 3QRGL 5DHXB 5CZVH 1FORL 4H88H 4IMLB 3BIBX 2GTWA 1G9MH 1YEEH 2JJTC 1SJHA 5GRVK 3ARUA 1Q0YL 1OAXH 3OZ9H 2A6KB 4WUKL 2CUIA 3GMOA 5C70A 1MCQA 5C0BD 1MCWM 1AGDA 4PTUB 3V8OA 2CSPA 1A6VH 2PCPA 4UNTA 5DR5L 5IG7A 1NGQL 3UTTE 5GS0L 1PLGL 5C0AD 3PDOA 2HH0H 1F58L 3R8BB 3C5ZD 5J0BA 3V0WH 3SGKC 5ANMB 5ITFB 3VMOA 3CDGB 4F9LC 3TYGL 6FABH 2DD8H 3B43A 1A5FL 4R4FL 5HDQL 1QP1A 1QD0A 1U58B 3MV11 3G9VA 1FBIH 5T5NG 3OXRA 5TQ0L 4X0KB 4YHNB 3QG7L 3ARTA 1MCIA 2R8SL 3W0WE 1CXLA 1R3IL 4DGVH 3VWKC 3IJHB 5E9DD 4JO4H 5F1OB 1KIRB 3FOMA 4FG6D 1U8KA 2NW2A 2HFEB 2HT2D 1MHPH 3W11C 2EIZB 4JQIL 2IPKA 1NMBH 3F7PC 4G6KL 4I18C 1ZLSL 4N8VG 2E8ZA 1KLGB 4XBEL 5FF6A 4G6AC 4D94A 4PP2A 3QPXH 3JVGA 4X7TA 2VH5H 4BK4A 3VFSA 3O11A 3AS1A 5TDPB 4FFZH 4ODHH 3V5DA 3JTTB 2BHYA 4LPUA 4TVPD 3EDKA 2GT9A 1MJJA 3DRQB 3PWNA 4KVNH 4J6RL 3L3OB 3TN0A 1AXTH 2WIIB 1UZ8A 1VFAB 3MCLL 1QBAA 1T6VN 4QTIL 1AIFB 3P4NA 1HSAB 1I3RB 4J3XA 1LEGB 1P4LB 5D1ZB 3GJEB 5E99H 1G7PA 2BSED 4JO1H 1RZJL 3ULVF 4CMHB 2HRPL 4WW2F 5CSZA 3G6JB 3D3VE 2RGSA 2XZCL 3QFJA 5HHME 1P4IL 4UTBH 4UQ3A 3QDMB 3VRIA 1I8KA 4UB0L 4YXKH 1VACB 2ZSWA 2Y7QA 4LCWB 5I18H 2X1WL 1CT8B 4DZBA 1Z9MA 5I16A 3L3JA 2A2QT 3LKRB 3MGTA 2UZIH 4JRWA 2BFVH 2IMMA 1UH3A 1P2CB 2OYPA 1CLYH 1T4KB 4QRPD 5CJOL 1GOGA 2BOBA 3O6FB 1V3LA 1XGQB 5MENE 4KHTH 4QOKB 3QAZC 4TNVK 4Q2ZB 2FZ3B 4B7LA 4M61B 5C0ND 5DVOA 4OV5B 3B83A 5ISZD 3C8KB 3V6BR 3VW3L 1ZHKA 1AI1L 3K8KA 3KPOA 3NCEB 1XF5B 1YY9C 1NCWL 3T04D 2Y9RT 2EE6A 3BSZH 4NO3B 3KLHC 1IGFL 2CMRL 1JNNH 4OCXL 1AO7A 3TT1H 4DGYL 4FOMA 1BECA 4OZFG 5F9JA 5EWIL 4AEFA 4O9HL 4YQXL 2X4UB 5T3XL 2YC1A 4ZYKB 1MWAA 2NY6C 1TZHA 3ZHDA 3S34L 4YBLB 2ZUWA 5F3BA 5HXMA 2ERJB 3CSBA 5F21B 5D1XC 5I1EL 1Q0XH 4YIQB 5F9AC 5J9PB 4MAUH 1ZHLB 4K94C 4PRPE 4MXVE 1TVBA 3RZWA 4XB8A 3H9HB 1JE6A 4YGVA 3U46A 3UTOA 3GK8H 4LSVH 4KROD 2V7NB 4KRLB 4OSUL 5DD6A 4KTDH 3WFBL 3ESVF 2PW2A 4QHLB 3LEYL 4NZRL 4Y5VA 3SDAC 4AK1A 3RFZC 2AJUL 4K8RH 2ARJB 3MJ6A 2B2XL 4XAWH 2H6PB 2PXYC 3EFDH 5LGHL 2M2DA 1K8IB 2BOCB 4UILH 3SKJL 1KJVA 5J4MA 1MLBA 4LAQH 2MQ0A 1QSFE 15C8L 2NZ9C 1B0GA 2GCYA 4JJ5B 4PRNA 3WIIH 4HS3B 2NNAA 3HFMH 5EG6C 3VXTA 2FWOB 3QIUA 3HB3D 3QXDB 3OKEA 4PJ8C 3PWLB 2DWDB 4HKZA 1EEZB 3REVA 5BJTA 3X3GL 1CL7H 3MRKA 1C5CH 3W9EA 4UV7H 2GK0A 5IW1B 1INQB 1GYAA 3K80A 5ERWB 2IADA 5FYLL 2AV1B 4K23L 2XKSA 5I1GL 1XCQB 5FA3A 5DWUH 4ZFFA 3FRUB 3UJJL 2WM0A 1BEYL 3HC3H 1FL3A 3KJ4C 4UDTA 5IVNA 3IF1B 2ZUTA 4OZGA 3CVHH 3WL9A 4A2LA 3STLB 4MX7B 4PJEB 5T1LA 3SE4A 4HGWA 5EZIH 1QUNA 5DMJB 1RUPL 1FFNA 5E8EA 4L4VD 4YC2C 5IHBA 1U93A 2P8LA 3B5HA 2PF6A 2IPTL 3MBEB 4Z7OF 1RZKH 1MRFH 3CFCH 1CTOA 1UJ3C 5HYEA 2AJ3B 2EYRB 4LVEA 3SJVE 3BP5B 3IVKB 1JHTB 2EC9T 1LMKA 1OGAE 4UMGA 1XIWB 4NBYB 1WZ1L 1DQMH 1J8HD 3OMZA 1MCOL 2X4RA 4LAJH 3ZYJA 4H1LG 1PKQB 5H37H 4DUXA 2ZCKL 1A1MB 3ZDXF 1NBQA 4B5EA 4HAFA 3V4UH 2BVUA 5FM5O 4KV5F 4IMKA 5JLZA 5DJ2A 3I6GA 5C0AA 4R0LC 1NSNL 4XP6H 3QULA 2PTTB 2R56L 5IT2H 1CLOH 5I8EA 2V2TA 1JYVA 1F6AA 5F93C 1KB9J 1QA9A 2DQCL 1FPTL 3L6FB 5K9OB 2JIXB 3BKYH 1AR1C 2CLVA 3WNNA 2BY0A 1FVCA 1ZV5A 1TJGL 5B8CA 3O6LH 1I1YB 4Z77A 2E7BA 4I4WB 4J8RA 4G9FD 4CN1A 4XPFH 1RJZB 3VFOA 3TLRA 1KEML 5C0IB 5LGKA 3N1PC 1N4XH 3BH9A 4HKXA 3UC0H 4ONHA 4WTWA 1KN4L 3ZKQD 1A6ZA 1OD9A 2FL5A 2X05A 5J06A 4XVUC 5D7IA 1NBYA 1Q9WA 3OTTA 3HN3A 4PY8J 4P2RD 3GHBH 1C08A 5FCUL 2OTUA 2BNUA 5DHVH 3KLSA 4JPVL 4U6TA 3WE6A 3AS2A 1J1OH 4IDJL 4NQSB 3C5JB 4OI7A 5K9KB 1KJ2H 4HUKB 1FZJB 3NFSL 1CDCA 4MA8L 3BD5A 4WI5A 4X8XA 4JRYB 1CFBA 4ZXBB 1YYLH 3B6SB 5IWLC 2VLKE 2FYYB 1JPSH 3GMPB 2WWKO 3CH8A 4HUUA 5HYJE 1AH1A 5I76B 4PLKC 4I77L 4R90L 3K4DA 4YHMH 1KC5H 4K7FB 1RZIA 2XQBL 5CJXC 3UJIH 1RZFH 1WLHA 4U3CA 1AD9B 3B9KC 4U1GC 2R4SH 4Y5XA 1BZ9A 3BGFC 2XRAH 2NX5E 4MZ3A 2PYFA 4Y8DC 3LN5B 1B6UA 2HJKB 3IDMB 4JZJA 1V7NL 2ZCLH 3PGFL 4Y4FB 3CCHA 3ME0A 1B4RA 4Z78B 2YA1A 5IROA 4M6MH 3VG0H 4F3FB 1SHMA 3LQMA 5SX5H 5EU4B 2CDFB 4D3CH 2O61A 2AEIT 4J2XA 2AABH 4PJ9B 4XPGH 4MMXC 3ZDYF 4QRPA 4QRTB 2P42B 1G9NH 3NH7L 2OBGA 2EXWD 3MLZL 1B88A 2ESVD 5D96C 3MSPA 4GO6B 3QSKB 5D71H 4NQTA 3ZYIA 5ISZA 1G1CA 1I85C 3ZT7A 1EBAA 3QQ4A 1WBXB 3QWRD 5TGBB 2ED8A 5D2NB 4UQ2A 1XEDA 3A6BH 4OQ1A 4JFFB 2KQMA 4N0RA 4LPWA 1IC5H 2EICA 4N5EC 5JQ6H 4XP5L 1XF1A 3NOIA 5BRZD 5JIPA 2VAAA 3DSFH 3LRSA 2AK1H 5EUKB 3OR7A 1HYSC 1E6JL 2NY2B 1RIHH 1VCAA 3QXTA 2VC2H 4KMTL 3ARDD 4M5ZL 1U92B 3O0RL 2HVKA 5KVDH 1OPGL 1N6QH 1YPZB 2H3NA 3ULVC 3MLXL 3U0WL 4WW2C 2QV2A 5KVFL 2BZDA 3DTXB 4M3JA 1R3KB 2OX5A 4JGJA 2ITCB 5I17A 2I60L 1NCNA 4LKXB 3MV7D 3PABA 4OM1L 4UINL 1MCBA 1A4KA 6CGTA 4QXGL 5I1AA 1MHCB 2R2HA 4LARL 4PJFF 3ULUL 1DCLA 4WEBH 1FFQA 4QXWA 2KDGA 2BNQB 3B3IB 3VRLE 3JTSB 1A9EA 2Q86A 5TF1L 4F37F 1OT1A 2VWEC 5F7KC 4GRWF 1MREH 3HG1B 3VRJB 5F72S 4YWGL 4H5SB 3VFPA 3BMVA 1HHKB 1HI6B 3L95A 4KUCF 5C08E 3ZSSA 1Z0MA 1QLRA 2XWTA 5K9JL 1F13A 4Y19B 3UJTL 2EDNA 2KZ1B 3SEPA 3RVWD 5MEQA 3ECBB 2Y1VA 3KYKH 5DMKB 2BSSA 3GSOA 1A3LH 4HUWA 35C8L 1U8PA 2E7MA 5D2LA 2DS4A 3EOTH 1OW0A 1RUML 3G5XA 3VCLA 3VFVA 4AEIL 2EDFA 1LQSR 4JKLA 3Q2CA 4HCRA 3W5MA 2J8HA 4QWWC 2CR6A 3TO4D 5D7JC 1HSBB 4DW2H 3ZZ1A 2R1WA 2HT3C 2BY3A 5ALBL 1V7MH 1UKSA 4ETQB 4PLOB 5I6XC 2X4QA 1RZ8A 4GKZB 3S97C 1N8ZB 1NANH 2EDBA 3HC4H 3WFZA 1J8HA 1FNEA 4IRSB 5C07B 2MHAA 4R7DA 4XTRC 3IXTB 4D0CA 5GRYA 5EC1B 4ELMA 2AKRA 4HUXB 3DV4B 4OTXL 2OR7A 2YXMA 3GSVA 3IFPB 2W91A 4LOUC 5GRXG 5IM7A 3RKPA 3HMWL 2DLIA 4PGDA 1I9RH 2IQ9H 1QBLH 1J5OH 3E6HA 5F71A 4IOIB 4O2EB 1VB9A 5CUSL 5SX4H 5JOFB 5FHBH 1MCRA 2EDEA 4YXLL 4XWOD 1FNAA 1YEDB 2Z31D 3SDXA 4MZ2A 5DEFA 2DQHH 3IDIA 4WCYL 2BRQA 3QZWA 5IEKA 3O4LA 2WBJB 3C2SA 2QL1A 2YZ1A 5FHAL 1XGPA 1RJLA 3RWFA 3SKNB 2DQDH 3V8CA 1P6FA 2BERA 3K1KC 1FSKB 2D0HA 2B5IB 5FGCB 1GL4B 1NDMA 4F7TA 2F53B 4ODUB 2B4CL 4HIIA 3SDCB 4HC1A 4NUGL 5DK0A 1NAML 3BP6B 4FQ1L 3LSOB 3VD7A 3BRDA 4YHIB 4F33A 1HHJA 1A7PL 2ADIA 1JPTH 4I3GA 4P2RA 1MLCA 5SWSD 1D5XA 4GKOA 4N8CL 5IB3B 4BQ9A 1WJ3A 4X5LA 1K3ZA 5EIIA 1PVHA 4V1DB 5KOVC 4DUWA 1BPVA 5LAXB 3T4AB 4K7PH 4JANA 4FQJH 1FGNH 3RI5F 4NRYA 4XXDB 3QI9B 3ZKMD 1FN4B 4ENEC 1MJUH 3HC0B 3NPSC 3NACH 1MIEH 4JEGB 2IH1A 3F7YB 4G3YL 4E42B 3EDEA 1JZ4A 4OLVH 2V5MA 4EUPH 5BQ7A 3S36H 2FGWL 1L4IA 3FL7A 2GKIA 4NKDA 1KSRA 4AEEA 3P40A 2OLDA 3BDYL 1KB5H 5B39A 1K4DA 1U8MA 1ZOXA 5HHOE 2ZUQB 5I0ZA 4H20L 3QJFA 4QRRA 3FO2A 4PJBA 5HYFA 5SWZA 4NBZB 4DFIA 4RQQA 3O2VL 3VU2A 1A6PA 2A74B 4M7LH 1FNFA 4MDIA 4YDIH 4LFHD 1LP9B 4MDJA 3ULSA 1OB1A 5J89A 4KZEL 3TV3L 4U1KA 4MD5B 1GSMA 4LEXH 4MJID 5KN5A 4YHKH 4FHBD 5ENWB 3LPWA 4G8FA 2VR5A 3G6JF 3HUJE 1ES0A 5AUMB 1WUNT 2FHBA 1X7QA 2ESVA 4KTYA 1W2KT 5IV2B 4XP9L 1CFQA 3MLWH 4P4KD 4F9PC 3VWJB 1A6TA 3HNVL 1ADQH 1H9VA 1UWEH 4JO3L 3O9WB 3NIFE 4HIEB 3SCMD 5C2UB 3HE7A 5TFSH 1N5YL 5BVPL 3MRJB 1J7VR 4MJ5B 2AJVH 4RMQA 3IGAA 1EGJA 4UIKL 4OLWH 5BRZA 2XPGA 5DQJA 4HMEA 1C16A 1X5HA 1DSFH 3RP1A 4ZPVA 5GGTA 4PJ7E 4WHTB 2AS5M 4WO4D 5JTWA 4OZGF 4HF5H 4KU1A 1I8LA 2PO6B 3IXAA 3MRLA 3QH3A 1OD7A 4MA1C 5GRJH 2YD5A 3IDYB 4K3DL 4FFVC 2EECA 3TNMA 4M9OA 1XF3B 1PAMA 3ARDA 2VLRE 4FZ8L 2WV3A 1FFRA 4DJMA 5GS2H 2H8PA 3BUYA 3FQUA 1I75A 4LSSH 1I9IH 3WYRA 2CH8A 1D5ZB 2H2PD 4OUUB 4JFXB 4GW5A 3C6LA 4WUUB 3MUY1 4Q6IC 4IRJB 4PJIB 8CGTA 4PJCA 2QQKH 4L1HA 2VZ1A 5ICXA 3UTQB 2GFBA 1G7LB 2VQ1A 3MV7A 5D5MA 5BV7H 1JMZA 3QWQB 2ITDB 5E2WH 3QPXL 2X4OA 5I9QB 4RFNC 3QR2A 2JJUA 3SQOL 3DUUB 4TRPL 2EE9A 5DJZA 1BFVL 2WW8A 1D5MA 4MA7H 1ZGLB 3GMMB 5IQ7L 1Y6KR 5DHYA 3NCMA 1U3HC 1D9KD 4PRID 2GSGA 2CJUH 4L29A 3PWVB 3U9UA 4KQ3H 3S7GA 2QKIB 1PFCA 5F88B 3D6GA 5DYOB 1LO0L 4D9LH 1K6QH 5D7LE 1OWRM 3S36X 5C7XH 3GMQA 5DFVD 2PNDA 1U8LA 3S37L 5AZEL 5E8PB 3IFNL 3RWCB 2EH8H 1KCSL 3L7FB 1FG2B 3RVXD 3RDTB 3V9FA 2IGFH 5KSVA 3TO4A 3ZT5A 4GSDH 5GGQH 1A14L 4JFOA 4P59H 2R0KH 1ZSDA 3DO7B 3KPRB 5MERB 3QQ9C 2FX7L 4JFDB 1ZA6A 4EUPG 2P8MB 2ED9A 2DLHA 4KI5E 1XGRA 4K9EL 1IZJA 3DXAE 5E7BA 4PG9B 4WHDA 3FT2A 2B0SH 4GS7C 5JHLL 3W39A 5FM4A 2Q6WB 5DEGB 5E08L 4DVBA 4FZEH 2UUDK 2Q76A 1UKQA 2VISA 2H2SD 1YA5A 5EA0L 4BKLB 1CDHA 1CD8A 3VFNB 3Q5TA 1SY6L 1ZHNB 3VXRA 5C2BH 2GW5A 2BC4A 5EBWB 3SGEH 3QHTC 4PJGB 3U4EB 5AG9A 2BNRD 4QYOA 4Y2DD 4L8DA 4R4ND 2P7TB 4JHWH 1BBDL 3CUPA 5C0EB 4LVNB 2C3WA 2Z31A 3QNYA 3MUHL 2HP4A 4P5MA 2JCCB 2HN7B 1VKXA 3MO1A 1B2WL 3KJ6H 1C5DA 1RFDH 4KQ4L 2R2BA 5C9KA 1ZTXL 2AK4B 5J3HC 3VFUA 2DQTL 1F8TL 1GOHA 4RGNC 4NN7C 3GI9L 5I2IB 2WP3O 2JJWA 4PGEA 1S78C 2ADFL 4B7IA 5HPOA 1JNHB 2C5DC 4HKBA 4P3DB 1IGML 1G7HA 3BWAA 2DDQL 4AENB 2PR4H 1TQBC 4G8GD 4YO0A 2CIIB 5HHNA 5SWSA 1R5WB 2MQ3A 3H0TB 3JVGC 3GMRB 4N8VB 3EOBA 4LCCB 2EDXA 4GRLD 3TIEB 4AY0A 1NCTA 4ZD3H 3VXMD 3JUZA 1HE7A 3M1BB 4KUZH 2J8UA 2DI9A 5CSBA 5TJWK 3VXPB 3T0AA 4BZ1H 2OJEA 1IQDB 1ETZB 3RA7L 2EZ0C 2R4RL 3X13A 4URTB 4TVPH 4D0BB 3KXFD 3CFKB 3V6FA 4W4OA 1EVUA 1DEDA 4OFVA 5ACLA 3LV3B 4ZS7L 1YJDC 5DT1L 2YHGA 1A6WH 5E00B 3BPNB 4LGPB 4N0YL 1NAMB 5GGSB 3SQBA 1JWSA 4HQQH 5E4EC 2CR3A 1A3RL 3BEVA 1HQ4A 3X3FL 3GSUB 3QYCA 3ELAT 5FCSH 1EFQA 5LXGH 3DURB 2P5EB 4EI5A 3ARBB 1NGZA 1JVKA 2NY0B 2FJFA 4U6XA 5F1NA 7CGTA 1T22B 1MCJA 3S5LA 4U6YA 1CD1A 3HLAB 2H32B 5EBMB 1RVFH 1TIUA 3MV8B 2AJZA 3INUL 4OD3H 1A7BA 1BIHA 3RJQB 3VXUE 4DQOH 4OFYA 4LLYA 3HI6L 2WUBH 1KELL 2BVPB 1X5JA 2FLRT 2WLYA 1FFOB 2HFGL 3D18A 4KRPC 4XCFH 3QDGE 5HHPB 1CBVL 4I0PB 1H3PL 1YEKH 3LH2H 3TBTA 4NQDA 4GXUM 1IZKA 5TE4H 4TTDC 1EJOH 1EZVY 3OKNA 3ZKND 1I9JL 4BELD 3GHEL 2A0LC 4U31A 4R96A 2NQCA 1QQDA 3AROA 1VFOA 4KJYB 4JM4L 2W65A 5L7XL 1JPGA 4WV1B 5CKAA 3PL6B 4XX1G 5FYKE 3SCMA 3BKMH 5D7SH 4NRXB 1T0MA 2WWMD 4P49A 5T1DL 3KPPB 4OLXH 4ZTOL 5E8DL 4XAKE 3G08A 3QUMH 3RU8H 3MA7A 4C56A 1UA6L 2DLGA 5D9SA 3L3KB 4U33A 4WJ5A 5F9OL 4MA3B 4WO4A 2FBJL 4Z0XB 5T5FH 4G7VL 3RWEA 4OZFB 3H2WA 1KCVL 5KJRL 3C6SB 1DQQA 2VR9A 3U48A 1ZLUH 4YLQT 1S8DB 4CW1B 3MOAL 2Z93A 5I8KH 1HWHB 3P2TA 5M7QA 2B1AH 4LLDA 1JRHL 1DBKL 3MRCA 2R0LL 4JFYB 4Z5RA 3SGDH 1QTYT 1YMHB 5DJ8B 5F1KC 1NFDA 2P8PB 4M1DL 3RY6C 1Z9LA 4WWID 1FAIH 5LBSL 3VD5A 1IKFL 3KYNA 3KNBA 4Y5VC 4ZAKB 1A9BB 2Y36L 2V5SA 1C7SA 2L7JA 1NBVL 4GQPH 4ELMF 5D1ZC 1BOYA 1JK8B 2H9GB 3P73A 4KKNA 5J57B 1V5JA 1YPZF 1TVDA 1U36A 3QDMD 4D9QD 1FZMB 3VXSB 1FZOA 5EN2B 2XFXA 3OBAA 4GBXB 3UO1H 2X70A 4EXPX 2G9HA 1QFUL 3QIUC 2XTJE 3NCCB 2EIEA 3RPIB 1O0VA 1AY1L 4KDVA 3MOBL 3O6FD 1HNGA 4PRIA 1A1OA 4HZLB 1LE5B 2VXVH 1QO3B 5IP4A 1GVIA 2EDJA 4XC3L 2JF1A 4Z7VF 4IIQB 4JKWA 2JTDA 2CUHA 3SKOB 1DQLH 3WIHH 3T1FB 5FKAA 2ATPA 4RZCA 3CVIL 5H35A 1FL5A 3QIWB 4PP1C 2X4TA 3O2DA 5IFAL 3H9SE 3TP4A 3BZEB 3WDHA 5D8JL 4RAVB 2GTZA 4C83B 4OCSL 3RVVC 1X9QA 4OCMC 5J1SC 5EBLA 4M93B 5IB2A 1NC4B 1HQRA 3OPZH 2X4SA 1PX3A 2JB5L 1IC7H 1EO8H 4PRAB 3SE4C 2JB6B 4YEFA 3LIZL 5CP7A 5ACZB 1JYNA 1IARB 1T1WA 2F8XC 4JLRB 4HH9A 4LRNH 4QRSA 5BZDB 1G7IA 1ORSB 5F6HJ 1QRND 3FO0H 1BM3L 4D3CL 1OF2B 1J86A 4GG6E 3KYMA 4LMQI 2DQJH 2D4DA 4JQVA 4JVUA 3D39E 2ERJC 4CU8A 1TJHL 4JR9L 5FO7A 5C0CD 1KGCE 4H1LB 2BVOA 4GAJH 3TJHC 1N7MH 4IMKC 5KVEL 5SWQB 3BESR 2IBBA 3U7WH 5I71B 3G04B 2I25N 1HEZB 3EYQD 1BF8A 2EH7H 3MFFB 3SPVB 2ZJSL 1JWUA 5TE7L 3KPSE 3EOAA 3O3EB 4NZJA 2BNRA 2C3GA 4Y2DA 3B9AA 4RDQG 3RIAF 4Y4HD 1AHWA 4CMMB 4LSDA 1DBAH 1VENA 1OL0A 4NQVB 3FO1A 2AK1L 2W92A 3BPCB 1EEUA 3BZ4A 4QEGA 1WIOA 4LLVB 4FQXB 3TPKA 1QR1A 3TYFB 1TJIH 1V3MA 4PB9H 3D69B 1PJ9A 3MRQB 3LOWA 4ZOCA 3ZKXB 1AJ7L 3OKKA 4WWKA 3EJZD 4J4PC 5FYJD 2ZZUT 3NCYP 1I8IA 4HT1L 1YMMB 2OSLB 4CAGA 3OGOE 3OB0K 1N3NB 1OAKH 5FB8A 1FDLH 5KS9E 2D03H 4ODSH 4YPGB 5DVNA 4FABH 3RGVD 2HMID 3QXWA 3MBED 2CRIA 4QRQA 5TH2A 4YZFE 5CEZE 3E3QE 4NDMA 2NCMA 5DRNB 3U0PB 1CU4H 3U4AA 1YNLH 2BCKB 1XGUA 4ALAH 3O2WH 1MFEH 3SY0B 2D9CA 1MJ8H 3K8MA 4UTAL 4XNXL 2HKHL 3B9VA 4MAYD 3O3AB 4GXVL 5EUOE 1R3JA 4M7JL 1N2RB 1H15A 4PTUA 4Y5XC 4DN4H 3RL2A 4S1SL 3GGWA 2OQJB 1GGIL 1VPOH 3W2DH 1QSEA 3GSQB 1WC7B 1H3XA 3NZ8B 5ITFA 1QLFB 1RUKL 1BQLL 3CDGA 4Z18A 4I2XE 3UYRL 4LSTL 2GSIA 5C0DB 3NZHH 4M8VA 1GGCL 4CL7A 1EK3A 1JNLL 3DMMA 3V6OA 5J12B 1H8SA 1HXYB 3BE1H 3MUJA 1I1AB 3IU4L 5CBEB 5JW5A 3FN0H 4MB3A 1NLBH 3BX7C 1H5BC 4M6OL 3TC9A 3I6KB 3OHXB 3HI5L 4JREB 5LCVL 5HYQA 5E2VH 1JZ2A 3WIFB 5HGBB 2N56A 3GUTB 4BFBD 2AQ1A 2VIRB 3MRNB 1P7QB 4X7DC 3VH8A 1CICD 1CZ8H 1OY3B 5J6HA 3MXWH 4CDGC 4N0FA 1B4JL 4Z8FH 3EJYC 2BDNH 1SYSA 2Y4SA 4UUJA 1OP3H 1WBZA 4RA0C 1FIGL 1VGEH 4QHUB 2VDKH 1JWMB 1A22B 2LVCA 3UTTD 5GISH 1HH6A 4TPRL 4KPHH 4X6CF 3BIKA 3PGCB 4MNGB 3IETA 5C9JB 4H0HB 4JRYD 4NJAH 4ZXBD 1I7ZA 2R0WL 1GGBL 1QVOB 3C60D 4ODVL 1IM3A 1PY9A 4M62H 1I7RB 4U1NB 1K5NA 1PZ5A 1DN0B 4KROC 3UZEA 3B4NA 1EHNA 1SEQH 3PNWA 4NQCE 3VXOB 4OFPA 2E6PA 4W81A 5FECA 3E8UL 1S9VB 4NCC1 2VZTA 1QBML 3FHQA 2XG4A 5I1LB 5FUCE 3H7BA 3SHSA 2O5ZL 4YHLH 3AY4C 3GBNH 5FK9A 5E94B 3RHWK 2OI9B 3LEVH 4ZODA 4N0CD 1E4XL 3EBAA 1OP5H 1LE9A 4WENB 1RUAH 3O3BA 4K7PL 5I15H 4Y4FC 3BXNA 4PJIF 4PJ9D 1ZHBA 3BW9A 2ICEB 1CL7I 1MFDH 3O6FA 5IGXH 4YUEH 4WI4A 1MCKA 1HHGB 5L6YL 5MHSD 2FO1A 4W6YB 2EO1A 2NY3B 1RQ5A 4LNVA 3RZCD 3N9GL 1BQHA 1B6DA 4M61A 4JN2A 2IANB 2B1HL 3BH8B 1JZ6A 5T1KB 1KJ3H 1OP9A 4Q0XL 2WAHA 4XPAL 4JDVA 1BVKB 5JZ7D 1SQ2N 4JG1H 3NCJL 3BVNA 4YNYA 5IVZA 1RZJC 2RIKA 1P1ZB 2P24A 3NGBB 1EEYB 2A6DA 1IAOB 5D2NC 3ARGA 4N1EA 1L0QA 2XZQL 4WU7A 4Q6YA 3D3VD 3FT3A 2A6JB 4S0SD 4TSAH 3TA3B 5HHMD 4YX2H 3LMJH 2HA1A 1QRNA 1P7KB 4I13B 4IJ3C 1AQKL 3LKOA 4GXUN 1LDSA 1ND0B 1U8NB 5A2JH 4KKCC 2P4AB 3IDGA 2O26U 1YEGH 3D0LB 3H9HA 4NJ9H 1T6WA 1P5VA 2V7NA 1MSPA 3U6RB 5C0CA 1L7IL 4JVPA 5CLWA 2E5EA 1XGYL 3ZYOA 1IGIL 5MEND 1NLDL 4NQXB 2AEPL 1MY5A 4M02A 3WNLA 2F54B 5EU5A 1K8IA 3AREA 5ICZB 4YEEA 3HS0B 5GSRA 4TSCH 2E7CA 4Y4HA 5EU7C 3BAEL 4ZUSB 5ESQB 4LSUH 4DKFH 4W70A 1JRHI 3BDXA 4ODBD 1S9WB 5HI4C 2UWEB 4NM8H 4EDWL 4HIHB 1X6LA 4JFHE 2F58L 4PJ5E 4X98B 4JO2H 1JI1A 5E03A 5IF0B 5IW1A 5TDNB 3OKMB 1UWXH 1S9YB 4YHZL 1JPFA 1UB5B 3KPLB 5AYUL 3HG1D 4EBQH 2AV1A 1U8IA 3MBXL 4GJTB 5SV3A 2VXTL 1DBMH 3BKJL 3H7LA 5E1HB 2VAJA 3JBG7 4Y19D 1W0WA 4U1HA 1NCCH 2FB4H 2A9MH 3ARYA 1CGTA 3H8NA 4TSBL 3AAZA 5T3ZH 2I5YL 2AXFB 4NHCH 3RAJL 5HJ3B 3B9DA 3GB7A 4O2FB 1YEFH 1DQDH 3STLA 5J13B 4U2YA 3L3IB 3EYFB 4NNPL 2NTFB 4JFZL 3RGVA 3CSGA 3RNQB 4KDTA 1FYTE 3TPUA 2EYRA 1R24A 3E0GA 4X6BA 4JE4B 1IEBB 4PRDA 2V9RA 5FYLD 3MYZA 4MAYA 4DUVA 4XX1E 5I1KH 3CFDB 2YPVL 4RFEA 1MFAL 2XWBA 4PJHE 2W9LA 1F2XK 1S7WB 1UCTA 4L9DA 5ILTL 3MLYL 1K9TA 1UXWA 2NYYC 4WHCA 5C0GA 1DQJB 5JORB 4W4NA 1OAZH 1Z0NA 3RPKA 4HKJB 3HPLA 3RWDA 5M95B 2GEEA 2VDNL 5B38B 3ZL4L 4HJJL 3K4ZA 1RIUL 2GJ6B 1IQWL 1N26A 1NL0L 3QA3A 5I74B 1YY8B 4KJQC 1I1YA 2OR9L 1XR8A 5BXFB 5LQBL 2WBJD 5C0BE 4YDKH 2OMBA 4P5KA 4JPWH 1Q94A 3HRZA 3WS3A 2F53D 1XGTA 4MNHA 3SDCD 1U8QA 5CSGA 4HWZA 5MEOA 2P49B 3HE7C 1CICA 4M5YH 2QSCH 1CE6A 2B5IC 4CUCA 1ODAA 4YDJA 3BP4A 5HPMA 4A6YL 4KKLC 1FV1B 1AGCB 2IPUG 2QTEA 1N0LA 2EKJA 2FHFA 2XY2A 3B2UC 2R29H 1F11B 4NWTH 4HS6B 5AD0B 4JGMA 4I5BB 1I8LC 4LCYB 2HFFB 4NPYA 2ZCHL 4HWBH 1ULVA 3UTTA 1NEZB 4XBGB 5K9KA 3DX6B 3EAKA 2FBOJ 3QWOA 5C0FB 1RULL 2YWYA 1KXTB 3OAZH 3C8HA 4JRYA 4GMTH 3QI9D 1ZLVH 1EXUA 3C60A 5JR1H 3EW3B 5E9DE 3WUWG 4PGBA 5I76A 1JV5B 2PYEB 4XMKH 4XPBL 4MD0B 5BVJA 3C6LC 5D7IE 1EMTL 5DD1H 3MCKB 3MJ8B 3W0WA 1AD9A 1GAFH 3EYVB 3W81A 4JN1L 1BIIA 4UOW0 1VGKB 3QXVA 2XKNB 4ELKA 3QEHB 5D70H 4JRXB 1RV6X 3IDMA 3MNVA 5DJ6A 5FYJU 4U6HB 1BBJB 5IHUH 5C6TH 3NTCH 2VDLH 3LKSA 4TVPE 3P0VH 1Y0LB 3C2AL 4M7LT 5C09B 4K3EH 4QNPE 1V3KA 1GGTA 1OSZA 3CH1B 3QO0B 4E9LA 4MS8D 5L2KE 3C08H 3ARQA 3WUZA 2P47B 3RZCA 3D5OF 5DUBA 1UT9A 1WFUA 5I19H 1XF2A 2VLKD 1A6WL 5IBTL 3VWJD 2FR4A 4Z76B 4K3HA 2VR4A 1WBXA 5TGBA 3V6ZB 3O9WD 1IKNA 4PJAE 1KFAL 3MRHB 3IDUA 1OWWA 5C3TA 2COQA 4PLJD 5E8NB 3S6CA 1GHFH 1R0AL 4LHJB 3L5IA 4D0DB 3KLAA 3D3VA 2O5XH 4M7KL 5KOMC 1PBYA 1NC2D 2LV4A 4J12A 4KY1L 1A6AA 2PO6D 4QRPE 5I1IL 3QUZD 3WS6C 5GS1B 4TULL 3FQXA 4TN9A 3HMXL 3T2NL 4LEOB 2DBLH 5GSVA 1MCPL 2AJSL 2BSRB 2GAZA 4OIIL 3IDYC 3CLFL 4OZHE 4KK5C 5FOJA 3T0WA 3JSSA 4L4TD 1Q9LB 4L8BA 4P46D 5FO9B 1KG0B 5MENA 3QP3A 5H2BA 4CJ1A 3F6IA 4YR6B 4O2CB 4FFYL 5CJQL 5F7DB 4IDLA 5A1AA 1FO0A 4PJXF 5A16B 3TFKC 3P9MA 4LKXA 4NO5B 1IFHL 3CFBA 4OUOA 4C58B 1KTDB 3OAYK 1W0VA 1MHCA 4ZO6A 3ZE0F 2BY2A 3KDMB 1GH7A 2DAVA 3RUGB 3OKYA 4K94L 2QR0B 4EXKA 4PUBH 4OT1L 3S88H 4X99B 3K4AA 1WTGT 1YUHA 2CKBH 2EC9U 4X8JB 3HG1A 1W72L 1RUQH 1HI6A 4PRPA 1MHEA 1E28B 5DJYA 3REWB 3FFCB 3DWTA 3SDDD 4ZG1A 3K2UL 3D25B 5CGMA 5DA0B 3QUXD 3UBXG 4ZUWA 5CILL 2BVQB 3MRIA 4Q97A 1E4XI 3U1SH 3FN9A 3FAWA 3RDTD 2QHRL 3I50H 2CLRA 1UXSB 2DQFB 3ULUD 3C09C 3NAAL 4WDIB 3WLWD 5INDA 1DE4B 4ZPTB 2D9QB 3GJFH 4W4OC 4C4KO 3KPRD 3PHOA 4NHUA 1E6OL 1QSFA 4ETQA 2V7HA 3HCVB 5JIKA 1MVUA 1BJ1J 5JIIA 4JFDD 1KXVC 1N8ZA 5MI0B 2WNGA 2F74B 1YECL 3LKPA 3MX0A 2EYTB 4RX4A 5I8CA 1HCFX 2VE6B 3FMGL 3KPMB 1ZT7A 3DSNA 3MC0A 4EI5C 5JHDB 3EDDA 4Z7WA 3NFPB 4N68A 2YPKB 1ZEAL 3VFGH 4KDWA 1A2YA 4L4VE 4LQFL 1LEIB 4F2MA 4P5TB 1KIQB 1YEIL 1WCBA 1EHLH 8FABB 2K9UA 2ZNXA 2DBJA 4OZIB 3MLRL 1J8HE 4APQB 3HZMA 4XNYL 2VYRE 3T0VA 3RVUC 1PKOA 4LU5L 5LGJA 2E3VA 3SJVA 5GJTH 4GAGH 1UENA 5DI8A 1ZLWH 1F4XH 5EOTB 4YHIA 5F89A 4WU5B 4G6FD 3O41A 4PD4K 3LN9A 2ZSVA 2MTPA 2GQHA 1B90A 2G5RA 3IKCB 3UDWA 3DX9B 1U8OB 5IB3A 2FIKA 2Z92B 3AGVA 2YA2A 5F96H 4WFGD 3P4MB 3MRBA 2HLFD 1DFBH 3MRRB 4YDVA 2DQGL 5KSAB 2BVYA 1MFNA 3EO9L 2ZOKA 1IRAY 3T65A 4XGZB 3I6LE 2VL4A 4G9FE 3JUYA 3GNML 4XXDA 3QI9A 4LCCC 4OQTA 1A7QH 1HHHB 1J9CT 4H26A 5HHQA 3DBXA 4EDXA 3L5JA 1IEHA 1I4FA 1EX0A 2FATL 4E42A 4OCRH 4HJ0D 4X4ME 5BS0B 1T5WA 1NBZB 1UM6L 3T08A 3PXHA 4G5ZH 1G6VK 5C8JA 1U3YA 4AJ0A 4H0GA 2P5ED 4A6YB 1GIGH 1RK1A 2NY0D 4Y1AE 2ORBH 2N7AA 2W0FA 4JGUA 1LP9A 3ARBC 4P23C 3STBA 1IGCL 3B2VL 5IQ9A 3I02B 5DC4B 1JIBA 5J6GA 3WDIA 1WWWX 4JM2D 3LS4L 5AEAA 2J6EA 5B3NA 3AUVA 1ZXQA 1Q9KA 3VWKB 3MJGX 4NSKB 4FQQA 4I0PD 2A6IA 2FCBA 3GSXA 1G6RL 1KT2A 5AUMA 1YYMH 4IOSD 2YD2A 4POZC 1OAQL 4X6DE 5H8DA 3U0TB 1Y18B 3SN6N 4Q9QH 4HJGA 1YNTB 1YC8A 1YNKL 4OLYH 3SE8L 2NY4D 3X17A 4F7EA 3BN9D 2VLKA 3GBML 3O2WL 5KTEH 1NDGB 4I18B 4K55A 3VWJA 5HYJA 1MJ7L 4PRBB 3PL6D 3O9WA 2NTSP 4G8IA 5DFVC 3RWHA 2VUYA 3ARVA 1FC1A 2MPAL 4MJ2A 1X5GA 4ZFZB 5CWSA 3MNZA 2AGJH 3QXUA 2UZYB 1MIML 4HK3J 5JXEC 4RWYH 1NJ9A 4WV1C 1CIUA 3LN4B 5CP3H 4PJDB 1MEXL 1TITA 1Q9OA 1NC2A 4YBQD 2XTLA 3FQTB 1N5AA 2PO6A 3LHPH 3QUZA 1ED3A 3JWDH 1M4KA 1T3FA 4MNQB 2NLJB 3V4PL 3GSNL 5DJ0A 4JPKL 5CEXB 4HX1B 3VXQB 2EO9A 1JP5A 5HBBA 3HZKB 1V05A 2DMBA 5I1CL 4XZUA 1UZ6F 1ZVSB 4L4TA 1Z3GL 4P46A 3QJHA 3EDJA 4DN3H 1YEJH 3MNWB 1A64A 4LASH 2VDPH 5FIEA 2NXZC 4FFWD 4OKVA 1AP2A 4P2QB 4K71C 4G43B 3VGBA 2I9LB 4ZAKC 3SGEI 2J12B 3MJ9A 2IBZY 4F57H 1UVQB 5GZOC 3TZVB 3CK0L 1AHWC 4JHZA 2ITDA 2J2ZA 3WFEH 2IFFH 3PWPB 1RK0A 3KR3L 4NNYA 1U8JB 3UEZA 2Z8SA 3WSQL 1J0YA 3DUUA 3K74B 5F70A 5DRXA 1IM9A 5DVLA 1KIPB 3LKNB 4GBXC 3ULVL 2IC2A 2BVTA 4YDLB 1I1FA 1GZPA 4FQLH 2YD4A 4WWKC 4GW4A 1UFUA 1OTTD 3IDJA 1SBSL 5GGUA 2QKIA 3FTGA 3O81A 5DJXA 2A9NL 3K81A 3T0XA 1RZGB 5DYOA 4PJCE 4ISVB 1K2DB 1S3KL 1D6EB 2UWEF 3SDDA 4CNIA 2CPCA 4MVBC 1P6AB 1NCBL 2BMKB 2C1OB 3F6LA 3OXSA 2Z8VC 3QHZH 5D5ME 3V7AE 3A67L 1IBGL 2EEDA 3QUXA 2IG2L 2F5BH 4IIQC 5E8PA 5DDHB 3L7FA 2VDQL 3P9WB 1NC4D 1FG2A 1J12A 4U1JB 2I07A 3KS0J 4EKXA 4J1UA 3ARWA 3QIWC 3RHWF 5IUSA 3PG2A 5D1XB 1A7OH 3T8XA 4HULB 3T0EB 1MOEA 5ID0B 1AD0A 2GITB 3LB6C 1KTLB 4HUMB 1BGXL 4ERSH 3CMOH 5H94B 4XCCL 3F5WB 3RWJA 1YQVH 1VADB 4R26L 4RISL 2APFA 4YHYC 4D8PA 5IMLA 5IBLD 4UZGA 3SDAB 4W6XB 1W72B 4CVXA 4LSPH 3CXDH 4NOBA 2QQNH 2I9TB 2PXYB 1EJ6A 3JV4B 2P5WB 2R9HD 3AM8A 2X4NB 3HNSH 1FE8H 3RX7A 1CGVA 7FABH 2WUCL 2Q3ZA 1TMCB 5A2IH 2FX9L 4YHOL 5C08A 5A40E 5I71C 5AAWA 1CFTA 2CO7B 3L3DB 5F97E 2WQ8A 1T20A 2WZPD 1NFIB 5E8OB 5L2JB 3DMMC 5JUEH 4GQ9H 1INEH 3P0YH 3WFCL 2BRRH 4LBEB 4PG2A 4ZQKA 3LQZA 2XN9B 3QRGH 4FQXD 1FORH 4IHOA 4U1MB 3OJDB 1BQSA 4HFWA 2XV6B 1TLKA 1Q0YH 4WUKH 3MRDB 3WJJA 5HSFA 1TFHA 4L8SA 4P3CL 3KJ4B 4K9EC 5FYKL 2W0LA 3BYYA 2WWMC 4P2OC 3MLUL 3DXAD 3OKDB 5DR5H 1HINL 1G9EA 1IAKB 1NGQH 5GS0H 1PLGH 2CIKB 4GUPB 2D7TL 5DK2A 1F58H 5JO5A 3T77A 4YC2B 1KF9B 4XCEB 3GMRA 1MY7A 3TYGH 4MQ7B 3VDBA 1NMAL 3WO3B 4JHAL 4NO0B 1UJ3B 1A5FH 4R4FH 1EFXA 3VXPA 2EXYD 2FJGB 1WWBX 4G9DA 5HDQH 4HMDA 2VABB 4UNUA 5TQ0H 4Z95L 3CFKA 4QT5A 1D5BA 1FFPB 3QG7H 3SGDI 2R8SH 2EKSB 3BRGC 1SVZA 3BI9X 3LV3A 1R3IH 3NCFB 4R6UA 2C9AA 2YOCA 2IAMD 3PV6A 5E00A 2HRLA 2QQQA 5EFIB 4O51B 1DUYA 5DD5L 2BSTA 3TBWA 4DCQB 3AS0A 4PLNC 5T3ZE 3HRPA 3PWJA 1M7IA 3MV9B 3BGAA 1LEKA 4JQIH 3DURA 3S3JA 4G6KH 1ZLSH 2P5EA 4XBEH 5HD8D 2VOTA 2A1WL 2J8UE 3ARFA 4JY6A 3GBLA 1S7TB 4FQ2L 3TBVB 3BPLC 3JWNC 1BZ7A 4LLUA 4JM2A 1JFQL 1HK6A 4J6RH 1T5XA 4R3SB 1V3JA 4ZNEE 3MCLH 5F1IA 5CJ5A 1F4WL 3CX5J 4QTIH 2XOTA 2VERN 3PV7A 3SBWA 4NO2A 4Y16D 2CK0L 3ABZA 5DZOA 1AXSB 4ZUVB 2OTWA 5J12C 3GIZL 1I1AC 2R1YA 5I1JL 3V0VB 1WFNA 2PKDA 3FFDB 4UBDC 1RZJH 3UZQA 5E2UL 2HRPH 2G5BB 5IIEB 1H0DB 4TUKL 2XZCH 3LDBB 4MXVF 1P4IH 4HS8L 1GGUA 5MEPB 4FTVB 4UB0H 5HHOA 3VFTB 3ARGC 4WW1A 2EIBA 4JFEE 4UIMB 4MJIE 3DUSA 4OZFA 3P4OA 4NWUL 4CU6A 2E6JA 1G6RB 4OV6F 1TQCB 3DVGB 3ZMRA 5CJOH 3G5ZB 4XHJD 3W82A 1N6UA 5ICYB 1Y6MR 5E5UB 1E4WL 5LJYH 3B9KB 3MLTA 4HV8A 1HWGB 4U1GB 3BGFB 1WQVT 3VW3H 1M7DB 1AI1H 2AI0L 2YPLB 3DECA 2VITB 1NCWH 4WFHD 1SEBA 2FO4A 2H9GA 1IGFH 2CMRH 2V2WB 3AREC 4OCXH 4KC3B 4DGYH 3KPQA 5EWIH 4LLMA 3TIDA 1I7UA 4O9HH 4YQXH 1BFOA 5T3XH 1DUZB 1CFNB 1F3RB 4F7MB 3S34H 1LO5A 1XR9B 4P57B 4XAKD 4NYLA 3MA9L 3GSNB 3QEUA 5I1EH 3JV6A 1NFDE 4ORZC 4X9GA 2WINA 3U2SB 1WAAF 1QO3A 3OF6D 4JZNA 3WFBH 2NY3D 4OSUH 5DSCA 2CDGB 1HH9B 2KQNA 2VLRA 4NUJA 3QIBC 4MXQD 3LEYH 4XVJL 5GGVL 5KAQF 4NZRH 4JDZA 3ZDYE 1BD2E 2CRZA 2IAND 4HGMA 5AZ2L 1FGVL 3OSKA 2X1PA 2AJUH 1FH5L 2VDRL 5T1KD 2B2XH 4M4RA 5LGHH 3RUGF 3BZEA 4XCYA 2E27L 4KKBC 4HG4J 4F7CB 1DLHA 3SKJH 2DQIL 4OFIA 3QPQD 3MUGB 3EO1A 1IAIH 4L3EE 4WEMB 5EPMA 5IMKA 5JW4M 15C8H 4RRPG 1HIML 4YHPB 3KVQA 4Y2OA 1X4XA 3QDJE 4X9IA 1FYHB 3NGBC 4KDTC 5CEZL 4LDLB 3AXLA 4KKAD 1ZT4A 3QB7C 4WW2B 3X3GH 1P4BL 2YSSA 2JE8A 3IAPA 5GIRB 3Q6GL 3ALWA 3FQWB 5FYLH 4C54A 4K23H 2Y5TB 5EORL 4XP1L 5I1GH 4H1LA 3UJJH 2LU4A 2HKFL 1B0RA 2DM7A 1BEYH 2SEBA 3CJJA 4UDUB 1YDPA 2EE2A 5D6CB 5HGGS 2YK1L 4LIQL 3PE9A 2F54D 5FKPA 2V2XB 4IS6A 4PRHB 4QXTB 3C9NA 3RVTD 3Q6FB 5A43C 2VL5B 2VLJB 4OZ4A 1T1ZA 2FEEL 2HJFA 2CLZA 1RUPH 3GSRA 3H9SD 3P9LB 3PHSA 4CMMA 1DZBA 2IPTH 2X41A 4WFFD 1SJEB 2WP3T 3L5WA 5C0JA 4YFEA 1SMOA 1OTUD 4HBCL 1WZ1H 2YBRB 1MCOH 2ZWLT 2Z35B 2ZCKH 5ADOL 1ONQA 4S1RL 5TE6L 3CPLB 1DBJL 2XZAL 3ILPB 4MQXC 2BK8A 5INCA 3VMPA 3DXAA 1IEAB 4L9LA 4PV8A 1P84K 5CHNA 1DR9A 3B5TA 3D2UB 5FDYA 2R56H 1S7SB 2Z91A 1M6OA 3PQYB 3L7EB 5D1QA 5T1MB 1G7JA 3MYJA 2DQCH 1FPTH 1CFSA 2GJJA 1MVFA 3KPSD 4KK6C 2GI7A 25C8L 2P46B 1TJGH 2XWJB 3LEXB 3UTPE 4TUJA 1DVFB 1HKLL 5DRNA 5IOPB 3PIQB 2QEJA 4GOSA 4XXCC 1KEMH 2IAMA 3HR5A 1C12B 2ZKHL 5B3JE 4MCYB 5C6WH 4XVSL 5E70A 5EU3B 1ZT1A 4G8GE 1KN4H 2ATKB 2A83B 5KBNC 2D3VA 1KBGL 1N2RA 2H26A 2QQLL 2MFNA 4Y4KD 4BQCA 1INDL 1E4KA 2EDDA 1CYGA 5EULV 5FCUH 4OB5L 3VXME 3D85B 1WC7A 4AG4L 2QADB 1YN7A 2EDKA 3EO0B 3LKQB 3SDYH 3WO4B 3NZ8A 4JPVH 1L0YA 1TENA 1WFTA 4G42B 5GRUL 3GMLB 4IDJH 4S1QL 4GAYB 1DDHA 4N90D 1S7VA 1LD9B 3KXFE 3QQ3A 4I9WD 3BHBB 2GJ6D 3NFSH 1M05A 3KYOA 3PJSB 4MA8H 3UAJC 3CU7A 2OK0L 4JFPB 2VDOL 2CRYA 1YJDL 4U49A 4I77H 5CMAA 4J23A 4R90H 5TQ2L 3RZCC 4EN3A 5BMFL 4Y16A 3V95A 1F2QA 3QEGL 2XQBH 3WMSA 2R1XA 4BM7A 3WIFA 4XP4L 1T2QL 1OSPL 2DQUL 3WHE0 3F12B 1X5LA 4HIJB 1TZGL 2AXGB 5ANME 3PUCA 3P77B 4EEEA 4FXLA 5EC2A 1V7NH 5IB5A 3W9DB 3MJ7A 3PGFH 2AJXL 3CVHA 3TO2A 1I1CA 1IC4L 1KCKA 5EOCH 5DTFA 4QHUA 1K4CB 2WMPA 3FQRA 1XT5A 3NPSB 4QHNB 1XMWA 4FQHA 5C9JA 2OM5A 4NZUL 3QO1A 3CFEA 3V5KA 1S7XA 4J3UA 1I7TB 3NH7H 1A1NB 3MLZH 2E9IA 4S1DD 3S35L 1DN0A 3QDGA 3FB5A 3PHQB 3TBYB 1IT9L 3FB7A 3BPOC 4KH2A 4LPYA 4XT1C 1OCWL 1UB6A 1PY4A 1JGDA 5FA4B 2DL2A 1AQDB 3VRLF 2C3XA 1UADC 2K3TA 1E27B 4XP5H 1T66D 1MWAL 2OMNA 1RHHB 5D6DA 1CGXA 2ICCA 3WFHA 1MF2L 2C3VB 2G2RB 2HLAA 4BA8A 1E6JH 1VFUA 1J88A 5C09D 4DZ8A 4FP8L 4YXHL 1WCQA 4NGHL 1LNUB 2X7LB 2PW1B 3WV0A 4KMTH 4M5ZH 3OB8A 1R5VB 2XNAB 1RURL 3UTZA 3O0RH 1OPGH 1MPAL 1SYVB 1K8DA 3IU3A 4CKVX 4ZSOB 3MLXH 3U0WH 1RD6A 4CVZA 3WLBB 5DD3L 5IB4A 5KVFH 1KV3A 5DEZA 1M71A 3NPZB 3U79A 3G6JE 2JJSC 3VMNA 5T1KA 3O3DB 4D9QE 2UYLB 3QDME 4L4JA 4NCDA 4JZOA 4ZUTB 5KW9L 4R4BB 4NQCD 2I60H 4LCWE 1RJYB 1CFVL 2BXZA 1R6VA 1P1ZA 1T1YA 2D31B 4MA1B 3ILQC 4OM1H 4UINH 5DHVA 4NKOA 1IAOA 3MV01 1U0QA 2AVGA 4JKKA 5CD3A 1R3HA 1CR9L 4QXGH 3RTQD 3CZFA 4LARH 3ULUH 4NKMA 4LCUB 1AXIB 1QFWL 1T0NB 1KJ2A 4Y5YA 4OGYL 1M1SA 3QFDA 4GKSA 2FH6A 4J3SA 5ETUA 4NZTL 2IH3B 5L9DL 4QOKE 1BLNB 1UQSB 3BOVA 3F58L 3WN5A 5TF1H 1RMFL 4UT7L 3VFWA 3THML 3D0LA 2X10A 4Q6IB 2HTLC 1ZWIA 4YWGH 4CADB 4U0QB 4BJLA 4HLJA 5IKCA 5K9JH 4V2BA 3UJTH 1LGVA 1U95B 4HXAL 4GW1A 5GGRA 5I66B 1ZVYA 35C8H 4RIRB 4FXGA 4OGAD 4G8EB 4N5UA 4QKXB 5KS9B 4YAQB 1RUMH 4RFNB 4RMUA 4AEIH 3MROA 3H9SA 5CGTA 2HG5B 4ZUSA 3TVMD 4ZS6C 5ESQA 2APXA 1S9WA 5C1MB 1U3HB 1OM3L 5ALBH 4BK5A 5IVXB 3DX8A 3LZFL 5C0CE 2V17L 3QCTL 2YEZB 2VZ3A 4M3KB 1CIDA 5EUOB 1J11A 1KN2L 4LNRB 1R5IA 5EU6B 4HIXL 4J3OC 4GG6A 1MRDL 4OTXH 3MRFB 5ID1A 3S96B 3FFCD 4AM0A 3OKOB 3QCUL 3SOBL 5DRWB 3UDWC 5IMMA 1S7RB 4CGTA 3HMWH 5DUPL 5HJ3A 2Z4QB 3UBXI 1CDJA 1WZLA 4PGCB 1R3LB 1S5IL 4BH7B 4I2XB 3MLPA 12E8L 1MHHB 2D2OA