3EYUL

Pfa1 fab fragment complexed with ror2(518-525)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
218
structure length
218
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Abeta-related peptide--monoclonal antibody complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords If kappa light chain
total genus 55
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2008-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eyuL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eyuL01
4XCNA 2X2YA 5INCA 5EU3B 4ZNEA 4WJ5B 1FAIL 3F5WB 5GGRY 1BQLL 4HZLA 5EU7C 1J18A 5GIRB 3LKSA 4BQ8A 2Y1VA 3EOBB 4KV5E 3KYOB 4N8VB 5C08B 5IVZA 3R0NA 4GKNB 4HK0A 5CIPA 5D2LF 1GGBH 2HJFB 3RVTD 4JKPH 1MFAL 3QJFA 4P5KB 3WXVH 1JCKA 4IRZH 4ZS6C 4UTAL 5F9JA 1S7RB 1FNFA 5HHVH 1BPVA 5B4MC 3ZKMD 3NCYS 3QISA 4AENB 5KSUA 5BRZE 4F33A 4I3SL 2B4CC 4OCMC 2VISA 3TC9A 3JV5A 3HN3A 4QRRB 5DMKA 3FCTA 4XMLL 2HYMA 1INQA 5BRZA 5E94A 1CL7H 1NGXB 2OP4H 4APQA 1T83C 5D7SL 4PJ7B 1OW0C 4OI7A 2Q1EA 4GRWE 4NQDD 4HUUA 3W5NA 3SDDC 2PYEB 3GSNA 5BO1L 2BMKB 3B2UC 3DXAD 4Q0XL 1H8NA 2AEQH 4D8PA 3B5GA 5ICXA 2FX7L 4XVSH 1F6FB 1P84J 2E27H 1UXSA 5FO8A 4LCCA 1EAPA 2M2DA 5E8OA 3S34L 4G80B 1HILB 5DMGD 2R4RH 3CFBA 3MLYH 1WAAF 3B9KA 4P0DA 3HMWL 4F8TA 2FH6A 2XICA 4KZDH 4F2MA 1BBJA 2VR5A 1CICC 4HFWA 1CGXA 5LAXB 1MWAB 4U2ZA 4QRRE 3MCKB 2GCYA 1AQDB 3BD4A 5E9DA 3WLBB 1FV1A 2NY6D 1Q9LA 1JFQL 1CIDA 2UZIH 5DYOB 3QO1A 1MRDL 2F8OA 2CPCA 3QXAB 3ZE2F 1KLUA 4ELKA 3EDDA 1A7NH 1C08B 2HMIC 1CE6B 1HZHH 1IEAB 1J0JA 1KN4H 4FQLL 4JY4B 5DLMH 3AM8C 5C0RH 1JZ3A 1ZHKA 3K4DA 3DHMA 1AI1H 2XTJC 5SX4H 2E9IA 4ZO7A 3TYFA 4NRXA 4GW1B 3BVNA 4HFWB 1URLA 3K8KA 1RUAL 4MNQE 1IC7H 1SJEA 4QTHA 1QRNA 3CX5J 3NGBC 4X98A 3VFTB 3VMPA 2CR6A 3CFBB 1Q38A 3HE7C 3MOBL 2A83A 1I85A 5KTEH 2AK4E 4LCCB 3F6IA 1E6JH 3V5KB 2UVEA 2VDQH 3NIDE 4S1RH 3UAJC 1RIVH 4CBPA 1C12B 5TDNA 4BZ1H 2QQLH 1JPTL 5HYIA 4YDKH 5DJZB 5LBSH 1YEEH 1NGPH 5KANI 4W4NA 2L7JA 4WGWB 5C0CD 3L3GB 5SV4A 1SQ2N 4I0PB 35C8H 2R1YB 3HAEA 4ODVL 4HK3N 4NBYB 2ZWLT 5IG7A 1UKSA 2E7BA 5B39A 4R26H 1DBKL 1F97A 3W0WD 3IDXL 3TZVA 3X3FL 1G7HB 5DMYA 2DD8L 5DMKB 3L5WB 4LSPL 1U8HB 3LVEA 4LCWE 3TO2B 2DQDH 1JMXA 2H1PL 4H0GA 4NN5B 1XF5B 3TNNB 1S5HA 1ZK9A 3SDYL 2UYLB 1YDPA 2Q8BH 4H88L 2IBZY 1WFNA 2ARJB 1CBVH 4OM0H 5H37G 2F15A 2A6DA 4NUGH 4O2CA 3X13A 1TJHL 2BFVL 4MQXD 4I5BA 3HI5L 3TN0B 3CSYB 5E4IA 5LGHL 5HVWA 1H8SA 3M8OL 3L7FA 3O6LL 1WK0A 4RFNC 4AEHL 3O3AB 4MNGB 1AP2B 5FYJH 4NNXB 4JFFE 3BESR 5LWYL 3I50H 4TYUA 5GZOC 2CRIA 3F7QA 4PB0L 5E5UB 3OR7A 1D9KD 1U8IA 1K4CB 1EDQA 3WS3A 1FIGL 4IRSB 1MFDH 2ITDB 2VXQH 5SX4I 4A6YH 2G5RA 1F4YH 4N8PA 5EU5B 4F9PC 3KPNB 4Y1AD 4XBPB 1X5AA 3DPBA 4WW1B 4P5MA 1CGVA 3MLVH 2HKHL 3D5OF 4N8VG 5E4EC 1Y6KR 5F88A 1OSPH 4E0RB 2OTWA 3VG9B 3IDMB 4P2OA 4YQXH 1QOKA 5IB3A 4P9ML 2DI9A 1LNUA 2C4FT 4WU7B 1A7BA 4L9DA 1LO3H 2APFA 5D7KE 4HFUL 5EIVA 3FO2B 1IAOA 1VPOH 3C2AH 1G6RB 3BEVA 1MJ7H 3TT1H 3K8MA 3VFWB 4NRYB 4PJ8D 4GUPB 1QFOA 5F6IC 5HPMA 5JORB 3O3EB 2P24A 1OW0A 3VMOA 5KBNC 3VXRD 4BSWA 2C3WA 4DFIA 1AE6H 1S9XB 3MV9A 5FEBA 5IVXE 5BZDB 4NFCA 5GSVA 1HWGB 1N6UA 1E4WL 2BSTA 1M7IB 3OB0H 1OAYL 4I3SH 4JLRB 3T8XA 3IFLH 2WV3A 1FZJA 2R56H 4UUJA 5ICZB 2X4PA 2NY2B 2XWBA 1AD9B 5I15H 4J3XA 2NTFB 3VFGL 5GS2H 5E5RB 2P43B 2H6PA 4XB8A 4LARH 4P4KD 5T5NG 5T1DH 2MTPA 5MEQA 2EYSA 4QRQB 1X5LA 3QPQD 2D7PA 4M03A 5D2NC 5M94B 2FX7H 1R3LA 3BQUC 5E6IB 3OKNA 3QPXL 1FG2B 4UT9H 5DA0B 1LE9B 4U7KA 2C3HA 3SKOB 5T1MB 3QIBA 5BZDA 3IXTB 2IFFH 2VLME 2X70A 2D7QA 1FYTA 4CVUA 3QUMH 3BO8A 3TWCH 4TUKH 4JHWL 5ISZA 5I1EL 3LCYA 4TUOA 1MY7A 2F5BH 4X9GA 4YHLH 3R8QA 5F7HA 1S3KH 4MB3A 4GUPA 1AXTL 4R3SA 5JORA 2Z35A 1A6PA 2BZDA 3KYNA 1QBAA 4PJGA 3GSOA 1DQDL 3L5XH 5C09E 1T5WB 3VWKD 3BWAA 1NQBA 2P5EB 4OF6A 4NO3B 3O45A 5FYLD 5EOQL 5GJSL 5HVHB 1XF4A 3SEPA 4NO5B 3IFPB 5I71C 2FYYA 4GRLA 5EUKA 3WN5C 1QSED 4PJAF 2XN9D 5IBTH 3RNKA 3NIFE 1DBAL 1Y18B 3ZT7A 2V9QA 4XI5D 3QT2A 3RTQB 1OL0A 3QUYD 5L0QC 4S1QL 4Z5RA 1CDCA 1M7DB 4XRCA 2X40A 2IAMB 4R97B 3TJHC 3KPNA 4F7MB 5AG9A 2XY2A 2MCPH 4QRSA 1SJHB 3MOAH 3UTZB 4JPVL 1E27B 4UV4H 3UPRB 4K7PY 3MRPA 1KFAH 4HK3J 4IHOA 4Z78B 2VE6A 3I3BA 3QQ9C 3MNZB 3KPRB 4YXKL 1RZFH 1YYML 5IROA 1OAQL 4HWUA 4XWGL 4LLYB 1X5IA 3SGKA 3DX8B 5SV3A 5KTEL 3L95A 5E6IC 3RX7A 3MRKB 5JXED 4NC1E 2HVJB 3NCMA 2VDPL 3T0EE 4K3JH 1I3RA 4HMCA 2V7HA 4NRZA 1MHHA 3K80A 4F57H 2BVOB 1YQVH 5F6HI 5CGYD 1BX2A 3ZKMC 5E2TH 4KK9C 4JHZA 3VFOB 3PABA 5D1QD 5C0JA 2BOCB 4LCWB 3CFEA 2CUMA 1T0NA 2HFEB 4M48L 3RY5A 2R0WL 1AJ7L 3VFRB 3L1OL 4MD5A 2I9LB 3RVUD 5M7QA 3M17B 1S5HB 4HKBA 3EUUA 2ILLA 3HRZB 3IDXH 4O4YH 1WBYB 3ZYJA 1ZGLM 5FCUL 4PGBB 4B53A 4P2RD 2BNQA 4JB9L 1IGIL 3GBLA 1RFDH 3FRPG 1VFOA 1DQJA 4FFVD 1A7RL 4LMQI 1EH9A 1BFSA 1HQRA 3FFCA 1ZLSL 1UB6A 5MP6H 3KLSA 2ZCKH 1HEZA 2WBJB 1P4IL 2EXYD 4LVHB 3NFSL 3CUPB 4KGJA 3DJ9A 3EFDL 4MNQB 5LGHH 4HJJL 5BV7B 3VFVB 3IGAA 4Y89A 1ZLUK 5DRNA 2Q7YB 3O2WL 1KJMB 4JFFD 4LSDA 3U79A 2QQNL 4A6YA 5DJ0A 4NKQB 1NDMA 2WK2A 2PW1A 5J1TC 2VXUL 1BQHA 4AYFA 3QWRA 5IJVA 5CKAA 3R06B 4HX1B 2VXQL 3U7AA 1HHKA 3V7AE 5E8PB 5CZXD 4D9QE 2ENSA 5FOBA 1MH5A 4P4KC 4ZNEE 2FX9H 2NXYD 2IMMA 4IMKC 3CXHJ 1X4ZA 1ZT1A 1B0RB 3MLVL 2HKHH 1ZANL 1SJVA 3PDDA 4M93C 2HT2C 2R2HB 1KB5B 1VCAA 2AJSL 3G5ZB 1X7QA 1CFNB 2YN5A 3HRPA 3W9EB 4KKLC 1KLGB 3RDTC 2X4UB 1M4KA 2D4FA 3DV4A 1JZ2A 1JI2A 4HIXH 5J6HA 5E6YA 3DNKA 4WV1C 3IDIB 3TT1L 3MLTB 5D7LB 3PHOB 4C56E 1M6OA 1FG9C 3HE7D 4P2QD 1TZIA 1YEHL 4C83A 2C1OA 5IMMA 4KKAC 4RA0C 4MD0B 1KJ2A 2YRPA 3WIIL 1RJLA 4JFQA 4OFDA 3AU1A 3SJVB 5JDSB 3PWNB 4EOWH 1T22B 2H8PA 4ONHB 3SO3C 1ZOXA 4O5LL 4KVCH 1IZJA 4CMMB 4DGIH 4FQQB 1EO5A 2H8PB 4M4PA 3OHXA 5C0AE 2YD4A 1CE1L 4P48A 5JHDA 2PYEA 3GSNB 3ULVE 1Q8MA 3BZ4A 2EDJA 3QZWG 4L4JA 4R7NB 5IGXH 1RAMA 3PHOA 1UG9A 3BSZL 4NUJB 4LQFH 5HI3C 3V4UH 1J1XL 3SGEH 1OVZA 5I0ZA 2FGZA 1WWWX 1VADA 4N9GB 3CZFA 4QRRA 4XNUL 2PKDA 5GHWL 4OSUL 4P2QE 4C59B 1I7ZB 1LD9A 3WNPA 1DFBH 4QXUH 3QUMA 4RNRB 4HXBH 1B88A 2VAJA 2WLZA 3TVMA 1FFRA 4WFGD 1KPRA 4JFDD 2BRRH 5DFWH 5C9JB 1OP3H 4PS4L 3QUML 4KK6C 8FABB 3OKEA 5I1EH 4MCYB 3W2DH 1FNGB 3L9RB 1DP0A 3UO1L 3KYOA 4N8VA 4LU5H 3BP6A 3BPOC 5GIRA 4R0LB 5EBWA 5BVPH 4HZLB 2H26B 5I8EA 3C60A 1MHPH 4YHZL 3GNML 1WIPA 1NDMB 3ARFD 3SDDB 4JFPA 5IV2A 1MNUL 2DLFH 3PXJA 4X99A 5I1LA 2ZSVB 3RGVC 4DVBA 1OSZB 4DVRH 2FD6L 1D5BA 1R3HB 2Q6WB 3TBTA 4QRPD 2QSCL 2VUYA 5GRWA 1A6UH 3NCFB 2YXFA 1TZHA 3QDJE 2E6PA 5T1KA 4WENB 1KIPB 4UOW0 4ZXBD 3H9SB 3DIFB 3FQUA 3WNLA 5TQ0H 1PLGL 5D8JH 1UACL 3DECA 4Z77A 4ZUVA 2CSPA 1EJOH 2BJMH 5KZCD 2WBJA 5D5MF 1YY9D 2O5ZH 4M5ZL 4IIQA 2MCPL 3O9WA 4W68A 1Z3GL 1UM5H 2ATPA 5CGTA 2F19H 4WO4C 4AY0A 4F58H 2W0KA 2WM0A 5E56A 3BISA 3MRQA 2VC2L 4TNVF 1CLYL 4FFYH 5KW9L 4U1LB 4Z9KB 5CP7A 1RZFL 3QO0B 1JGLL 1UZ8A 1YYMH 1CTOA 3V0AC 5EORH 1JTPA 2NZ9C 3CFDA 4JFDA 3HUJE 1CTNA 4I3RL 5LG1A 1EBAA 1T3FB 1IT9L 4HT1L 4IDLA 3WD5L 1WBYA 1BZ9A 3VFNA 3LH2H 1K8IB 4KKAD 3JXAA 4K3JL 1ITBB 5E8EA 5HI4C 2I9LA 2I60L 4DKEH 4P3WA 2KPNA 1LMKA 3DMMB 3HZVA 3OKKA 2WUBH 1JPST 4WFGE 5DQ9B 1IL1B 1QR4A 2W92A 3G6JE 1I3UA 1FQ9C 1MUJB 2V7HB 4YO0B 3L1OH 5FYKU 1NFKA 4NWTH 2IANA 3K8LA 2HLAA 4EVNB 2DL2A 5JHDD 4X9HA 3SCMC 5HXMA 5HDBF 4AH2B 3IJHB 4F7CA 3BAEH 2FWOB 1T1ZA 1T4KB 2IANE 3KXFB 3X14A 1OTSD 3S35X 5GISL 2HLFC 4LF3A 3BN9C 3BMVA 2VMFA 3ZKNC 5MHSD 4LCUB 3U0WL 3LN4A 1ZA3A 3MNZA 1WJ3A 3L3KB 3CXDL 3RDTD 1MLBA 4KDTA 1LHZA 2W9EH 3KPOA 3DRQB 4M6ML 4CVXA 1A47A 4XMKH 5IBLC 2DLIA 3O6FD 4O2EA 5A2LH 4FQJL 1N8ZA 1U8QA 5MP6L 1QSEA 2ZCKL 4PJ9D 3MZTA 3RL1A 2VDMH 4GAYA 1GGBL 2IAMA 4M7KL 3GUTB 3DV4B 4NO0B 1R3JA 1A64A 1WWAX 2E7MA 4N9OB 1G1CA 3QHZL 4HGMA 3OPZL 1MY5A 1KB5A 2WP3O 5BV7H 3GI9L 3SKJL 1XF3A 5FM4A 5DC4B 1XF4B 1OP3K 5J13B 3DWTA 3VWKC 3F12B 4E41D 1HDMB 25C8H 5C09A 5ITBH 2QQNH 5TGBA 4TSBL 3W0WE 3ARFC 1GPOH 4LPUA 3K74B 2XWJA 2Y7QB 3VRJB 2Z91B 3I75B 4KK8D 3PP4H 1AY1H 1MEXL 4RGOL 3QDJA 2F53B 5T1KD 4HG4J 3ZKXB 1TENA 2XT1B 4GS7B 1T04A 5C0BD 3NIGE 1INDL 3PDOB 5IW3A 1QPXA 4U1KA 3QDGB 2OZ4L 2I26N 3C5ZB 2CRZA 3PV6B 1E28A 3LS5L 5CWSA 1QRNE 4R90L 4QGTA 5EWIH 4PRNB 3KPSA 3HI6L 3FB8B 3SE8L 3VJ6B 1D5IH 3FMGL 5IVOA 1V7ML 4P5TD 1RVFL 4M7ZB 1A8JH 5JHDE 2PTVA 1U8LA 4QRQA 4RMRA 4DCQA 3U2SA 1ORQA 5CSBA 1GGTA 4YXLL 5MEQB 3QEGL 3MRDB 1PG7W 1AXSA 2VZTA 4YGVB 2XXCB 4M7LT 1KXTB 5CEXB 3OXRB 4TNWF 5HD8C 1TQCC 4V2CB 2P5WD 2HG5A 1Y6MR 1KUMA 4EOWL 1CXEA 2FX8H 3RRQA 1QEWA 1KCRH 4XXDB 5B21A 4I9WE 3H3PL 1BF2A 1KN4L 1WGOA 4FQLH 2BC4A 4X7EC 3VG9C 1NFIA 1XF2A 5C0AB 4M1DH 3LDBB 3SBWA 4UTBH 2MQCA 5IFAH 4GT7A 5I1GL 5FDYA 43C9A 4KK5D 1FN4A 4R9HA 3SCMD 4TULL 1NANH 4NNYA 1XGRB 5K9KB 2FEEL 4GKSB 1PZUB 4RFNB 3LB6C 5E8NB 2MHAB 1YY9C 1MHHB 5IB5B 4NRZB 5FYKH 3QB7C 4G6JL 2EDBA 3BEVB 3LPGA 1FORH 4KJYA 4JN1L 4ETQA 4PJXA 1CG9A 1DSFH 1NBZB 4PJEE 1ZAGA 1NFDB 2YUZA 1U3YA 5D7LE 1OCWL 2DDQH 1A1OA 3RWIB 4NQSB 3S7GA 2EIBA 4M43H 2P7TB 4P5TA 1ZT7A 4FG6D 4NZRH 3TV3L 4YEFA 3KPRA 1CD8A 4HJGB 5F1KC 2J3SA 1F42A 4PV9B 4U1SA 4YDKL 1A6VH 3P9MA 3TM6A 1YNKL 2ICEA 3CVHB 1YEKL 3DBXA 4L8SA 5K93A 1UADC 2EKJA 3SGEI 2XYCA 4LBEA 5IW6A 2KL6A 4UT6H 4J23A 2ICWB 4R26L 5DJAB 2DLFL 1UM6H 3QI9C 2DD8H 1C5DA 5I16B 4LGPB 5JXAH 1KCVL 1TVBA 3RWCA 4OZHB 3NA9H 2DQDL 3V5HA 1CG9B 2DKUA 1J9CT 2H1PH 3HMXA 4ETQB 4IMLA 4ZTPL 2C9AA 2GAZB 1KIQA 1NEZB 2DL9A 5F7YC 4MA1B 5HDBE 4Z8FH 2Y36L 4I5BB 3NCJL 1RMFH 2VLKE 2Z35B 1Y6NR 4O2CB 2ATKB 4M5ZH 1C5BL 1R5IB 1O7SA 2X89D 4DZBA 2AEPH 3QP3A 1MQKL 5BVJA 4M00A 2X42A 2NY4D 3TZVC 5KW9H 5CJOL 1AGDB 1XF5A 1JHLH 5DD3H 2NX5E 4I3RH 3HCVB 3F7VA 2JK5A 4JRXA 3C5ZC 3LKQA 3LH2L 5B3NA 1KCSH 5D9SA 1MCIA 2XG4A 1DBML 3CSGA 5EZLA 4UNTA 2H6PB 4KU1A 4R4ND 1FIGH 1QFWH 1UEYA 3CNKA 4GBXD 1FZMB 3LKRB 3BQUB 4GSDL 3HAEH 3LRHA 4FQIL 5IBUG 1QPPA 1ZT4B 3GJFK 4JY6B 1D5MB 4LCIL 2YN3A 4IDJL 1P2CA 5JW5B 3LMJL 4JFZH 2GT9B 2EIZB 1GVIA 1MJUH 5E8DH 3BE1L 4OCSH 5I74B 1HINH 3VXQA 4NOBA 2A83B 4OGXL 2QJDA 4WDIA 1H15A 2B1HL 2CDFA 1DQML 1S7XA 3PQYA 2ZPKH 3MUGB 3TPUB 4RAUA 3FONA 1MREH 3FTGA 1VPOL 2P24B 1Q9WA 2D7OA 4YDLB 4ZSOA 3QH3B 3BKJL 3GBMH 3D2UD 2IPTH 3EYFA 2Z91A 3V6OA 3C9NA 5FHBL 1FSKB 4U1MA 2NCMA 3LKPB 5DTFA 3VWJC 3E6HB 2ZUXA 1OTUC 4PJCE 3FO2A 3RWDB 1L7TH 1W72B 4KDWA 1H0DA 4FQ1H 1GYAA 4LRNH 4Y7MA 2V5SA 2YD1A 3G5XA 5J89A 4KK6D 1I8MA 3QIUD 2GK0B 2PXYA 1N64H 2D03H 5EZOL 5SWSB 1E4WH 5SWZD 4UQ2A 5FGBA 2R1XB 2Z4QA 1JWMA 4D0DB 1R3JB 1JJUA 1N6QH 3WE6A 3QG7L 1G7LB 1BREA 25C8L 3IF1A 4TSBH 3FFCD 4GAYB 4MJ6A 4ELMB 1AR2A 1GPOL 1OT1A 5DO2D 4NJ9L 3MRNB 3MTRA 4MAYB 3VFGH 4F3FB 1NMCB 5J4MA 1FZOB 3ROLA 3DUUA 4LARL 3C09C 5CJQH 3IT8D 3STBA 3OR7B 3UTTA 1YJDH 3L3KA 2MMXA 2PXYD 1YPZB 1QLRA 4HXAL 3DGCR 4K9EL 3RAJH 1LP9A 2OZ4H 3GSXB 4HIJB 4R7DA 4ALAH 2LV4A 3KS0J 3OWEA 2VLLB 3LZFH 5E8OB 4RFEB 5EBMB 3LS5H 1XIWC 2LTQB 1JBJA 3C8KA 4R90H 3LRSA 4YHKL 3HG1D 4YFDB 4PYGA 1TTFA 3HI6H 3SE8H 2IFFL 4WEMB 1MIMH 4Q74A 4TUKL 1WWBX 1MCSA 1D6VL 2IEPA 3X13B 5KSBF 2B2XL 4G6KH 4MHHG 3LD8B 5TF1H 4ZFOA 5CEYB 2CDEB 2DJ4A 4ZOEA 3P4LA 2W0PA 5GS1B 2W65B 3F65A 1X5FA 3VFNB 2X4RB 2NY1D 5L0QB 5GJSH 3OAZH 2Q3ZA 3BD5A 4CMHC 4M8VA 1AC0A 5IMLA 4J3TA 1U0QA 2EYTB 3MCG1 4U1LA 1I1RA 1GGIL 1ZVYA 5F9JB 5GZNC 3KYKL 4PLOB 3JTTB 3IVKA 3QJFB 4P5KA 1G7IA 1N4XH 3ARPA 4XPGH 4OLEA 4HS8L 3SDCB 4ETYA 3VGHA 4JPVH 1ED3B 1EZVY 3U9PH 2XACC 1S9VA 1KPUB 4G3YH 2NTSP 4DN3H 4FFWD 1JYVA 1T89A 4KQ4L 4DQOH 2MCG1 3FB7B 5DK2B 4HF5H 4POZC 4XP4L 4P3CH 5T3ZE 2DDQL 1IJ9A 4FTVE 4P9HH 3ZMRA 1QSEE 2EC8A 1ORSA 1Z9MA 4I48B 2VDPH 3TV3H 5DURB 3SDDA 4PLJC 5DXWA 2C1PB 4QWWD 4NZTH 1MLCB 4Q6IA 4MS8C 2BSRB 4Z7NE 5JXEC 1S7TA 3AFLA 2KQMA 4Y4KB 5KS9F 1RJZB 5E2TL 1LDSA 3U7WL 3WEXA 3MO1A 3ARED 5IKCB 3WXWH 5HHOB 1AJ7H 2OXHA 3ULSA 5FGSA 1WC7A 4NQCD 4KI5E 3T2PA 1YECL 2OSLB 1UM6L 4NN5C 3MV8E 4ODXB 1OQXA 3SGJC 1WFOA 1FYTD 2RGSA 4YC2C 4RWYL 5JXAL 2X5PA 1U3HA 3NA9L 4WWKC 2EDNA 3R0MA 1FZKB 5F7EH 1FV1B 3L3JA 4HKZB 3VXSE 3QNYB 3NCJH 4H0HB 4N0UE 2J6EA 1B0WA 4HUMB 2X4TB 1OPGH 4LEOA 2CH8A 4QRTA 3MV01 2VZUA 4EI6A 3IXAA 4YWGH 5JZ7C 1XCQB 2VDLH 5I73B 4JM2C 2R69H 3MBEC 3TESA 3FQXA 3EFDH 1MIEL 4U1IA 4WUUE 5EFIA 1FVDA 5DGQA 3UTSB 3QNZB 4G7YH 4Y16C 5DD3L 4ISVA 3EYVA 4ODHH 2W0FB 1N7ML 2JLLA 4Z7UA 1EMTL 2E6JA 5HYQB 2VWEE 1TNNA 1XIWB 4BM7A 4FMFA 5L2KA 2VXUH 3KWWA 5EU6E 5IMMB 5JIIA 4EDWH 2QHLA 1S8DB 3P0VL 3OAYH 1LGVA 1ZLWH 3MLSL 4Y2DA 1RZ7L 1ONQB 4P46D 4YJZL 4JM2A 3MJGX 3MCLL 2V5MA 3QUZB 1A7OH 1U2CA 2FX9L 4HZAA 3LMJH 1AKJB 1C16A 1MCHA 1NCWL 1A21A 2R1WB 3DETD 1MJUL 5E8DL 4MAUH 2FATH 2VDNL 2OBGA 4OGXH 2AJSH 1T2QH 5FO9B 4M4RA 5KJRH 4JQXC 1MFBH 3H9YA 4G8GE 4NZJA 1FHGA 1P7QB 4HWNA 4PJHE 4BQBA 1ZKAA 5IVZB 1P7KB 3BKJH 3JWOH 1F4WL 3VXNB 4YHML 5DEGB 1Q1JH 3D0LA 2D2OA 3F5WA 2MOVA 2JIXA 5MHSE 5GSRB 1FFOA 4XBGA 5E5MB 1NBVH 4M6OL 4Y16A 2JB5L 4A6YB 2DAVA 2R2EB 3OKYA 3I84A 2OL3B 3RA7L 1BFOA 4KAQH 2IH3A 3P11H 5JPMA 5BJTB 5I0DA 1F4XH 3T0AA 1B6DA 3TH2T 4MNQA 1MPAH 4Z7VB 1N6QL 2VSDA 2XZAH 1CE1H 5E7BA 4F7EB 2IPKB 4GRLD 3ULUL 1RZ8A 3FKUS 3GZKA 4HUNB 1ZSDB 2P4AB 4MA8H 1HQRB 1I1YB 4U49A 4ZXBB 3M1BB 5I1KH 3PJSA 3VRIA 4LLMA 5HGDA 4H8WL 1AGBA 3R4DA 4OZGF 4CGTA 4QXGL 2BNQB 1A6ZA 4GKOA 4RGND 4AL8L 3QSKB 4C56A 4L3AA 5HYJB 4OI9A 3L3IA 2D0GA 1CK0H 5HHXL 4K8RH 3D9AH 4P99A 1S7VA 5HYSB 3IB4A 3ZLQC 1UXWA 3GIVB 1TPXB 4U1NA 4U1JA 4UINL 5TF0A 3KPRD 2EE6A 1VACA 2HFTA 3S3SA 1WQVT 5FUOL 1CFBA 3QRFM 4LU5L 1IGJA 3LN5B 3Q6GH 4LSTH 1HHGA 4PGEB 5EIQA 3RHWK 5TQ2L 3EJZD 1ZGLP 2ADGB 5HGGS 3OJDB 1NCUA 3OJVC 4GH7B 4ONGL 4ZYKB 1MNUH 2GJ6B 2OQJB 4IOFD 2DQHH 1P4BH 1BJ1J 2BX5A 3OF6D 4PP1D 4PJ5E 2CMRH 1F13A 4GRWB 4OCXL 2AXHA 2FD6H 2FJGA 2V2XB 3KPQB 3SGDH 3RJDA 5KN5B 3QUYC 3MREB 4DUVA 4EXPX 1AIFA 1DQTA 4U6XA 5IB4B 3OKMA 3GSWB 1BFTA 3TJHD 1TIUA 1G9MH 3T65B 1A3LH 3AGVA 4NFDA 2BVTA 4HS8H 4Z7UF 3DETC 1FO0L 2R23A 5FV1L 3FFDA 1NBQA 2CIKA 4OIAA 3KPMA 2IQAA 1SYSA 2VLMD 1OTTC 1DLFL 3E3QE 3SKMA 2VC2H 1SEQH 2OTUA 1IM9A 4G6ML 3ESVF 3VG0L 5I75B 1AXIB 1GGUA 2ZG3A 4X6CA 4ZFFB 4Y5VA 4HF5L 2R0KH 3CDYA 3L7EB 4P3CL 1IQDB 5JLZA 1AHWB 2QADD 4HT1H 3O45B 5CZKA 2VQTA 5F7DA 3DUHA 3QDAA 3WJLA 4WUUD 4K23H 1N2RB 2VLJA 5DJYB 2HRLA 5JW4R 1W0YT 5ADOH 1QBMH 3F58H 2WBKA 3MXWL 4AQOA 2YWYA 1FBIL 4IM8A 1IEBA 1B2WH 4EIZC 2BSSA 3LKOB 4D9QD 4BQCA 3EW3B 5ADPL 4BFIA 3ZHDA 3LPFA 1FYTB 4OCRH 3P3YA 5F97E 3VWJA 2ADJA 1VFAA 2IJ0C 3E6FA 3O8XB 1FG2A 4H20H 5EZIL 2HFFA 3O3BA 1U58B 1SEBB 2KKQA 2EE3A 2RR3A 3UZVB 1ZWIB 3REVB 2B8OT 3KLAB 2J6EH 1B0GB 1EPFA 1A0QH 3QIWD 4M1GL 2AJVH 2XPGB 4YDIL 4M6MH 2VNCA 2R4SH 4XMKL 4W81A 2NX5A 2EIEA 3QXDA 1A5FH 2HTKC 4QT5B 1AO7A 5D7KD 2VDLL 4YDJA 5F7MC 1T66C 4XNMB 1MIEH 5BXFA 2AJ3A 4JLRA 4KTEH 3GJEB 3OPZH 2BNQD 1ZGLA 1M7IA 1VGKB 2NR6C 3UTTD 4E5XB 4M9OA 4UV7L 1OWWA 2CIIB 4PY8I 1FP5A 2F58L 3O4LD 1CFVH 4XH2A 2VLRB 3OAZK 5CBAA 3KLDA 2CLRA 3P0VH 5B8CA 2FL5A 1MEXH 3G08B 3EYOB 2C3GA 3L3OB 3TYGL 3DURA 2J88L 2AI0H 5SWQB 4WU7A 4JQVA 3FO1B 1H3GA 3V6OE 2P42B 3FRUB 4G42A 3QIWA 1FRGH 4PBXA 4HLZH 5JQ6L 4N1CA 4WTWA 4QNPF 1QLFB 1LDPH 1EFXB 5MERA 1WT5A 2FSEA 5EWIL 1A2YB 2DYPA 5C07E 3N85H 1I1AC 4L8BA 5GJTL 3AB0B 4MCZB 2JB6A 4JQXA 4XBPA 4L3ED 3BRDA 3TN0D 4WHCA 4YXLH 3BHBB 3QEGH 1HNFA 3SJVD 1F4WH 1BLNA 4Y0GA 1Q1JL 4IRSA 1AGFB 3GSRB 4XCFH 1GOGA 3ZE0E 1BD2E 1NBVL 2YA0A 4XC3H 1AH1A 3D0VA 3EJZC 5DS8A 1A4JB 4LCYB 5DJ8B 1JK8B 3RL2B 5F7KC 2FX8L 4MA1C 3EYSH 3RA7H 3TCLA 2QV2A 2A6IA 2YBRB 4DAGH 1KCRL 1P84K 3RX5A 4FTVA 2QR0B 1HXYB 1NCTA 2IBBA 3U0PB 1A6AB 1G84A 4MJIA 1U8PB 4M1DL 3U82B 3WL9B 5B38A 3CD4A 2H9GA 2VYRE 3BZEB 4PTTA 4ZFZB 5F3BA 2DKSA 4I8DA 3GGWA 3V9FA 2O61B 2ARJA 3H42H 4G6JH 1FORL 5ICYB 2YZ1A 1T21A 1UM4H 4OKVB 3G04A 1G7QB 4U6YB 1CK0L 4JO2H 3VFMB 5D71L 2NQCA 4XPTH 4BK5A 4NZRL 4PJFE 3AS3A 3N1FC 4R4BB 2GTWB 5JZ7D 4HUXB 3SDAB 1CDJA 4Z7WF 1KENL 2R1YA 2X1XR 1XFPA 3TIDA 4RCAA 3EJYC 5TDOB 1OM3L 2Y9RT 2AEWA 3F8UB 2PW2B 5IVXB 5TQ2H 2VH5L 2Z92A 5ID1B 5FDWA 3KJ6L 5C09D 1S5IL 1T2JA 1A4KA 3C6SB 5HHMD 3U4AA 3DRTB 2M26A 5I6XB 5JHLH 4Y4FC 3T04D 3DHJA 1L0YA 1UA6H 4KUZH 4KKBD 4X9IA 2UWEA 4ZTPH 5FKPA 5MENB 3KNBA 5D1ZB 4J12A 4EDXA 3B5HA 4JJHA 4J3SA 3C6LB 2Y36H 3MUHL 3FZUD 2NY2D 1KYOK 2AJXH 4XNQB 3QUXD 2O5YL 4QHNA 4AIZA 4LVEA 1MCJA 2OX5A 1ZHKB 4GQ9L 3LS4L 4EIGB 1JNJA 5IESH 1BQHG 1I1FA 1UWEL 4XP6H 3CDCA 4QOKB 4RQQB 2FGWH 3JV4B 1PYWA 1EXUB 1XGUB 3VFPA 2FDBP 1NGQL 3WJLC 2ZUTA 3EKCA 4ZPTB 1BF8A 3TH3T 2JCCA 4U33A 5FFLA 5KG9B 1AQDA 3JWNC 4Y88A 4GLRH 3MFFB 5CP3A 4CADB 3MBXH 5T3ZD 5J12B 5HI4D 1F3RB 1V7NH 3B6SA 5C6WH 3TO4A 1RK0B 2NXZB 5LAXA 2BY2A 1MHEB 3G6DH 1B2WL 2X4QA 1CLZL 3TF7C 1X5JA 4NJAH 1OY3B 1JGVH 4IDJH 5GGVY 5ERWB 1LEIB 3AMLA 3IU3A 1QO3A 4KZEL 1BGXL 5GGSA 1HQ4B 3KDMB 4OCSL 5EZIH 4NN7C 2CO6B 1KEML 1MI5A 2V7NA 4LOUC 4Y1AB 4Y8DC 5I1JH 4B5EA 2H32A 3MRBA 4ZD3L 4UOJA 3QIUB 1MREL 1ZHBA 3JTSB 1IQWH 3ZKND 2YEZA 5JA9A 3H7LA 3GRWA 5D96B 5DD5H 2YSSB 1D9KA 3UJJL 1FL6B 3QQ4B 4HUUB 4PJIB 2IPTL 4PJAE 4JAMB 4J2XA 4LVOC 5K59F 3ULVC 1A5FL 2FEDD 3PE9A 4Y5YB 3MMEB 1NC2D 3VD9A 1Y0LA 2FO1A 1UWXK 4PJ9C 4MSWA 5F7NC 4FQ1L 1KG0A 4TVPH 1NGWB 1R3IL 3VXUB 5ID0B 4BUGA 2VISB 1N64L 5K9JH 2FH8A 5C2UB 4N0FA 4JPIB 4HHAB 2YD6A 3PNWA 4J7RA 4WTXA 5IQ7L 4RWHA 5C0DB 5D2LB 4P3DA 2X1PA 2BP3A 3P77A 4FQPA 4HK0B 4D0BB 1NC4D 4KJQD 2WQ8A 3C08L 3FQWB 3LKNB 2IAMD 1J87A 4PJDB 2V17L 2NXZC 3NMEA 3D39D 4MDIA 4OGZA 1G7PA 4YH6A 3SKUD 1HXMB 4PG9A 4JDTL 3OTTA 3BKCH 4IIQC 1CFTA 4MQSB 4WI9A 4XAWL 3RDTA 4OFYA 4PD4K 2GI7A 1CT8B 5JOPD 1ZTXH 1FL5B 2JTDA 3QEHB 4YPGB 5H35A 4JKLA 3LD8C 5AD0B 4K3EH 4XPHL 5EU7E 1HH9B 1EO8H 4Y4KD 1JPGB 1RHHA 1KIUA 1MJ8H 5IK3A 1ADQL 3TA3B 4N5ED 3H9HB 5ANME 4F7TA 4XCFL 2BVYA 1VEOA 4NQVB 5D6CB 4Y5YC 5T3ZH 5I2IB 1L0XA 2JF1A 2JJVA 3NCYP 2K3TA 4L4VE 3KPLA 4XC3L 3U6RA 4Z7NF 5I1AA 1I1AA 3BYYA 1CF8H 4KROB 4UDUB 4E9LA 3WDHA 2BOBB 3S4SG 5FA4B 4UIMA 4WIQA 3TBWB 2YPLA 3LQZA 4DAGL 5FGRA 3MRRB 3O6KH 3QWOA 1CLCA 1UENA 2PTTA 4K7PL 5HGAB 5C3LD 1XGQB 3IJYA 4N0CD 3BXNB 4LPCA 1TJIL 3ARXA 4XPFH 4XPGL 1LO2H 2A0LC 4G43A 4L8CB 3IDGB 1QTYT 4RBPH 4F15B 4DK3A 4XPBL 2ENYA 3DROA 3NCEB 4X80H 5DD1L 2UV3A 4LFHG 4G8IB 4JREB 3VWKA 2OZ4A 3QG6B 2OJEA 2DLHA 3CPLB 2APVA 2E9WA 3AROA 4PJAA 4ODUB 4BA8A 4OJFH 1UFUA 2MPAH 1JV5B 1PZ5A 2ZUSA 3VXOB 4DZ8A 1JWSB 3LQAL 4PJFA 5IT2L 3IDYC 5ESQB 2AJUH 3QFJD 1OB1B 3I6KB 3FAXA 5IEKB 1OM3H 4FRWA 1AGEB 3VDAA 1DVFA 5F3HA 3D39B 3GO1L 5BW7C 5I66A 2ERJB 3KJ6H 3S3PA 1A9EB 4NGHL 4R96B 1C1EH 3VE0A 2ORBL 4EEEA 2Z31B 3L6FB 4P23A 3Q1SH 1Q9KB 2NW3A 5FB8A 4HKJA 5HHQA 1LEKA 3QQ3A 1NGZA 4FNLL 3RIFF 3JUZA 3W39A 1LK2A 1YN6A 1HOCA 2X4SB 5F7EL 1CR9H 4H1LH 3PQYE 3ZL4H 2B4CH 3D25A 2AJXL 3PL6B 2DWDA 1MCNA 1QUNA 1XT5A 4WY7L 3O11A 3LS4H 5IESL 4PTUB 1XGTA 5CJXC 3REWA 2QEJA 5CKGA 1JHKL 2VXSL 3V6FA 5JXEA 3WBDA 1SY6H 3LPWA 3U0TB 4HUVB 5CMAA 3DXAE 4G9FD 5C07A 2XTLA 3IETA 5CP3H 3DUSA 5DVLA 2LAGB 3CC5B 4LPXA 1G7MB 3VU2A 3AXLB 1DUZB 2DLTA 2WWMC 2ZOLA 4BH8A 2A38A 3U36B 1G9NH 1V7NL 4ONOA 3HZYA 4YHIA 1RZ7H 3MRHA 4GOSA 5C0GA 2APTA 2HJLB 2NXZD 3TLRA 3QCVL 1MCQA 1NEUA 3QJHA 5J13C 3HR5B 5CFHA 2H32H 3I9GH 5D2NE 1BZ7B 1PGRB 2P5WB 4NYLA 3GRWH 5LQBH 2QLVB 4OCLC 2EIDA 4L4TA 4KKCC 2IH1B 4JM4H 3LAFA 5TJWK 1X5XA 2NNAA 5J1AA 3SDXB 3FQRA 3AMKA 4BZ2L 4XP9L 2DI8A 1SVZA 2YPKA 4GW5B 3RU8L 3ZDZE 1KBGH 2D0FA 3D85B 4LDLB 2F54E 4QHKJ 1U92A 1UEMA 3HUJA 4V1DB 1RZGB 4XP1L 4PY7B 4MA3B 2DIAA 3DSNA 3F7RA 3P11L 1AR1D 2P8LA 5EA0L 1CU4L 5DRZA 4JRYB 4WFFE 4PREA 4AIXA 1OD7A 3QWRD 4ZUUA 3NH7H 5C0IA 2UZXB 5DO2C 3IFOA 2Q7NA 1WWCA 1YEDB 4L4VB 4NKMB 4OIBA 4JEGB 3IETB 3RWJA 4MA8L 2V2TB 3U0TA 5A16A 4HUVA 5IB1B 4PGDA 5F7FA 5D72H 4J3UA 3M07A 4Y19A 3DMMD 1T20A 1Z6JT 1ZVSA 3BPCA 2V2WA 5C0CA 2IQ9L 2YPLE 3BW9B 4P2RE 2EC9T 3T0BA 4NQEB 1ZVHA 4L4TD 5DD6B 3NTCL 4YK4B 1PY4A 5EO9B 4UINH 4JZOA 4ZSOE 3VXMA 3TFKD 3TPKA 1XZ0A 3UYPA 1IAIL 3LIZL 4GO6B 2FIKA 1CDHA 4LKCB 4PJDE 2YUWA 3W9DA 3Q6GL 2NLJB 4LNRB 3K4AA 2P46B 4LPTA 4LSVL 3L6FA 4P23B 1I8LA 1MFCL 1DBJH 1IAKA 2CK0L 4KI5D 4DKAA 3JWDC 2IALA 4OLZL 3OB8A 2IPUG 2EDFA 5IHZB 1J0ZA 5MEPA 4P46A 5ESQA 4R2GD 2B0SL 2J7LA 2YZ8A 5DI8B 3QA3A 4DZ8B 1TVHA 2R8SL 4NC0B 1TJIH 1F6LL 1HKLH 5KAQG 4PRIE 3GMLB 1CDBA 4JRXE 3L3DB 1FO0H 3Q2CA 1OP9A 3LV3A 4PJAB 3T2QA 4Q6IC 1CFQB 4QF1A 2EDQA 4BH7A 4QRRD 5I30L 4OAWB 4G8EB 3WHXB 2HAZA 4YFEA 4X0KA 5F1IA 4UT7H 4WO4A 3RKPA 2DOCA 3ZE1F 2F5AL 1WZ1L 5E2VL 1X5YA 5L7XL 4HH9B 3BGMA 4K23L 1MVUB 3OAUH 4D0CB 4HV8A 1XR8B 3L3HA 2VWEC 3EHBC 5ADOL 3ARBA 4J3VA 6FABH 4HD9A 3B5TA 1N59B 4N0RA 1IGCL 5CINL 1FBIH 4YBQC 3IDJB 2UWEE 2EH7L 3VH8G 1XEDA 3O8XD 2XV6B 1I1AB 1C1EL 3DV6B 1U95A 2W60B 2PN5A 5CS7A 4YE4H 1KXVC 3S4SB 4OZIE 3ARFB 3K46A 5GRYA 1CGWA 4U4BA 3HE7A 4P2QA 5FOJA 5GGTL 1Z5LB 3SGJA 4H1LA 4GQPH 5DT1H 1CVRA 3DMMC 4IOSD 5ESAB 4GRMB 4BKLB 1A0QL 1CR9L 4HUWB 3GMPA 2JCCF 4S2SB 4YDIH 3BQUD 4JN2B 1PG7X 4G5ZH 4JVWA 1N0XH 2RFXB 5CSZB 3CK0L 3SDAD 15C8H 4FXGB 5J9PA 2AEIT 1IMHC 4KDVA 2OS7A 4KTYA 5BQ7B 3DVNB 3UXFA 1J1OL 2YR3A 3G9AB 4U6VH 3RVVD 3CGTA 1IFHL 1HH6A 3MRCA 4Y5XC 5DJDA 5JW4Q 1MRCL 3HC0B 1R5VA 4UV7H 3EFFA 4AZ8A 2C5DC 2CJUH 5IOPA 5E00B 5D5MA 4YR6A 5AWNH 3MA7B 3WDIA 3C6LC 5BS0A 4YAQA 4FQ2H 3EJJX 2N56A 4X5WB 4ORGB 2ZOKA 2VITA 3CH1B 4MXWH 5FHAH 1CICA 2XQYG 3PHQA 3H7BA 2AI0L 4XVJH 5CZVH 5E0QA 5C0FB 1FVEB 3GMRA 4WI6A 4RGNE 2MSPA 2IGFL 2GJ6D 1Z9LA 1UH4A 1YNTB 1FRGL 3HPJB 3OSKA 1VFUA 3F7YB 3HC3L 2KUTA 4PJIA 1NLBL 5LQBL 5GGVL 2J5LC 3HA0A 3QQ9D 4OLXL 3OG6B 4C4KT 3VGFA 1ACYL 2VDOL 4PV8B 5IOPB 2NZ9D 3VFSB 4JZNA 5DHVH 3MACL 3AS2A 4NKOA 4BZ2H 2Y5TB 3NFPB 3Q0HA 1U93B 4WUUA 4WEBH 5ALCH 4B7LA 1P9MC 5EU6D 1KBGL 1LEIA 3PGCA 4X4YA 5BOZG 4NCC1 3MNWA 5ILTH 4KV5F 4FXGA 5AAMA 1ZHNA 2I9TB 4FOMA 5SWZE 3LN9A 4P2RB 4YHYB 3QFDA 4I1NB 5K33A 3BIKB 5F8RC 3X3GH 3RVXD 3UYRL 4ZUSB 5IW1B 4NIKB 2AGJH 3NH7L 3WKMH 4OZ4A 2AP2A 2ICES 5I8CB 1LWRA 5FM5M 4NP4H 3QFJE 5EPMA 4PRPB 4L3CB 5TH2A 3HC4L 3VGDA 3ZDXF 4HG4K 5INDB 1JGDA 2ITCA 3HPLB 4ZS7L 5F1SA 1F3DJ 5C0AD 5F7WC 1D3CA 5JOFB 4PRBB 1I8KA 1I9IH 1L4IA 5TDPB 5K9OB 3KR3H 4MNQD 3IDNB 5ANMA 5I71B 4OV5A 5DK0A 2APXA 4QXTA 5HDQL 1IC1A 2BVEA 5EBLB 4NM8L 5JMOC 5IM7A 4LASH 3C6LA 3IAQA 2G9HA 3UTTE 3W82A 4ZFGL 1KENH 1ITCA 4CUCA 5DSCB 3PIQB 4L9LA 2EYRB 3U4BL 2UUDH 1GHFH 2FNBA 2GHWB 4G6FD 5EU4A 3VD4A 5DMIL 5DJCA 3WMSA 4HBQA 1U93A 1EHNA 4JQIL 1J88A 1R0AH 3DSFH 3O0RL 3BFOA 3TEUA 3DI3B 2AK4D 1E6OL 4OLZH 4PJBF 4Y4FA 3QI9B 2PCPB 1D9KC 2PW2A 1FNSH 3GK8L 5IMKB 4NDMA 4XGZB 4S11A 1EIBA 3C6LD 3N1MC 2XRAL 3L3DA 4M7LH 4KUZL 2P8MA 5KVEL 4PB9H 2D7TH 4OLVH 5H2BA 1I3GL 3GSVA 2YMXL 3WFEL 2R8SH 2C4XA 2CDGB 1WBXA 5K9QG 3RGHA 3SCMA 5F21B 4JRXD 3GSNH 3PG2A 3AAZA 4QO1A 3HZKB 4PG2C 1IBGL 1JNNH 2MWCA 4LLUA 1FVEA 3GMRB 1QFHA 4DW2H 1OTTD 4PUBL 5HGBA 5I9QC 2DQFA 4XP6L 3I3EA 3MLWL 1CZ8L 3C5SB 4CW1A 4IOIA 1QQDA 2ID5A 1NGQH 1GZQA 5DJ2B 3HLAA 5MI0B 4XAKE 3JSSA 3BUYA 2UWEF 4DK6A 5T3XL 3WIFA 4HJ0D 1LE5B 3I02A 2B1AH 3CU7A 1S7SB 2VN7A 3FT3A 1QBLL 4K3GA 4X4ZA 5AG8A 4LLDB 5B4MD 5CHNA 1A9BB 3EOYG 3WXVL 2PYFB 4GJTB 3B9KC 2CRMA 4IRZL 3S96A 4U6HB 2XI9A 1L6ZA 3HHRB 3E0GA 5HHVL 1JGVL 2EDXA 5C9KA 3QUZC 1J11A 1JK8A 3BT2H 3KXFD 1K5NB 2EDLA 3V6OC 1V3MA 1A6TA 4MB4A 1MF2H 1CCZA 4I0PC 4NKMA 4X7DC 5C0IB 3VI3E 1DQQA 4ZUUB 2YKLH 5FYLH 4KJPD 1F58H 3UJJH 4CJ1A 2YD9A 1N0XL 1ES0A 1EX0A 4OD2A 2FB4L 2AEQL 1VGEL 3EOTL 5ACZA 4ZUWA 4PY7A 3DV6A 1SBSL 1M05A 2LTQC 1KIRB 2R15A 3HKFA 4GG6F 3N0PB 5E2WL 3VXTB 4H26B 4KZDL 2WWKO 3STZA 4GAFB 5E1AA 1QFWM 3BPNC 4Z7WE 5EOTA 4WHTA 4X7TB 4HULB 2W38A 4W70A 2H2PD 4HV8B 3M45A 3ULVL 1B9ZA 2HN7B 1GRWA 2FIRT 4QY8A 2CIIA 2DQCH 1FFNA 4BSVB 2A77H 4ZXBC 3T4YA 2FO4B 3C09B 1BIIB 1Z0NA 2EEAA 2CKBA 5CZVL 1A7NL 3G5VB 1RZIA 4QF1B 4LLWA 4TNVK 4ZUTB 4XAWH 3RWEA 4MLIA 4NWUL 2HTLC 1H8OA 3V95A 4QT5A 3QXDB 4X6BB 3G6JF 4GW4A 1OGTA 2XPGA 3UTPD 3D3VB 4OLXH 3U9UA 3E8UH 5DHVB 4CRPA 5MEPB 2NY3B 4L1HA 3REVA 4Z76B 3C87A 4YHNA 1ADQH 4I0KA 3B43A 2PR4H 2W9LA 5ESVB 1IC7L 2VR9A 3D85D 1GGYA 4KKNA 1IILE 3VWJB 1CF8L 2AKRB 2WMPA 4OGAC 2ZUQB 2CLVB 4ENEC 3CFJB 4PJCF 4GXVL 4QHLA 4K8RC 1YY8A 4NHUA 4PP2B 1FFPB 3NZ8B 1NGPL 3ARGC 3RZCA 3WKML 3BZFB 5DJYA 4U1HA 4XPFL 3RVUC 4PGJA 3MRMA 1SVCP 5KOMC 1FE8H 1FGNH 1NJ9B 1GZPB 3P9LA 2X09A 5C0CB 3LHPL 2BVQA 4X80L 4TTDC 3E2HB 1FH5H 4KJWC 2XNAB 2O5XH 1SYSB 2IQAB 3WV0A 3KR3L 5EN2B 4YHNB 5IEKA 5J12C 4P57B 4AEIL 3IJSA 1Q9OA 1NC2A 1E4XI 5GS0H 3U9UB 4YHPB 1MCRA 5GGQH 4HJ0C 2P1YA 5D6DC 3FT4B 4PJBA 2QADB 1G9MC 4UIKL 5IT2H 1TJHH 3K0WA 2A73B 4JFHE 2GIYA 4I18A 4WVRA 4Q9QH 1EHLH 5JR1L 3BKYH 1HYSD 2B5IC 3M8OH 5HHPA 1CDUA 3FQNA 4CL7A 4QYOB 4QEGA 2D31B 4K94C 1P5VA 2BVPA 3VGAB 1R0AL 1OAZL 1AO7E 3PL6D 1LO4H 2EICA 5LWYH 4Y1AE 1YPZF 1LP9E 1FNSL 3DOSA 2N1KA 5I19H 2XRAH 4LGRB 2I07A 4WWKB 1PEZA 1V05A 2D7TL 3O41B 2F9BT 1F4YL 3KVQA 2HLFD 4AG4H 2DLGA 4U1JB 3HNVL 4LPWA 4OQTL 4K94L 3ZYZA 3TNMB 2GEEA 1RUPL 3FZUC 1K3IA 3HR5A 5DC0A 3GSNL 2BNRA 3VXTA 3BRGC 4Y2DD 2J8UB 1A1NA 3CU1A 3STLA 3EYUL 4OUUA 2HT3D 4P23C 4PUBH 2IADA 3D2UB 5A3ID 1G7JA 4RZCB 5D93C 4JFOA 5JQHC 1SY6L 3U36A 4F9LA 3P9WB 2J1KA 3DVIA 1G7MA 4WNQB 3MV8B 5CD5C 2DM3A 2WBJD 3PWPB 2UVFA 5GGRB 1JNHA 5C0ND 1G6RH 1KPVA 1ZXQA 4YHOL 2YPVH 2G60L 4HKXB 4CN1A 4P2OD 3R8BB 1S9KC 1FDLL 5BJTA 4JANB 5ETUB 2ZUYA 4M3JA 1SYVB 2BXYA 4AT6B 1D5ZB 1BFOB 3N50A 3GB7B 3IKCA 3MJ7B 5T1LD 4PJ9A 4DEPC 1WEJH 4MMXC 3ARGD 1ETZA 1GIGH 3IFLL 4IJ3C 3BT2L 4PRID 3EO9L 3VW3L 1Z9SA 5CHNB 2JIXD 4Z7WA 3C5JB 5DEGA 2CD0A 5GPRA 3GRWL 3CJJA 5KS9A 1OHQA 2P8PB 3V7AG 4KRMB 3FN9A 4LHUG 3WNMA 4WUKL 2X7LB 2VABA 3ZTNH 1F3JB 4CW1B 4HPYH 3QQ3B 2NY4B 1MCDA 4JDZB 1VERA 3SE9L 3ESUF 4KROD 3G6AB 2BSED 2R1WA 1OP5K 3VE0B 5IROC 5CEZE 4FQXD 2EDDA 4LLUB 4MZ2A 4FXKA 4L9LC 5EUOB 3SKNA 3MMEA 4ELMF 4Y5YA 3I6KA 1OB1A 2ESVB 3TWCL 1CU4H 1VFMA 1DLHA 3MOQA 3RNQB 4FN0A 3N06B 1FGVH 2YXMA 3A0OA 3V4VL 4NQDB 4C56D 1FPTL 3ULVH 5L88L 1YMMB 4RBPK 1PDKA 4I3GA 3EZJB 4NCC2 1Q0YL 4Y4FB 5D72L 1I3VA 3QUYB 5F96L 4FMKA 3HFML 4KTDL 5IBTL 5D1XC 1ZE3C 1DBAH 4H5SB 2ZG1A 1EGJA 2D7NA 3PV7A 2DIJA 4Y5XB 9CGTA 3TO4B 4AMKH 4RAVA 2BNRE 3CSPA 2HH0L 2F8XC 2A6KA 1JL8A 1I8IA 2XZZA 3KPSD 1MJJB 3RUGB 2XZQH 1ADQA 2LQRA 4U7MA 4F7PB 4QXTB 2Y4SA 3MRRA 4E41E 1T0MB 2YD2A 4Y16D 2A74A 4L29A 3RGVA 1NAMB 1W8OA 1Z9OA 2VQ1B 3FN3A 4RAHA 1DBJL 3CAFA 5D2NA 5C0BA 1BD2D 3T0EA 3BH8B 5A2JH 3GMOA 1CFSA 1OGAA 3QFJA 4EN3B 4ZDHB 3FHAA 3MYJA 4JDZA 2XWTB 4F7TB 2VZSA 5KSBB 4OLUH 2DN7A 1X5KA 2X7LA 2YPLD 4UQ3B 5D7IA 4JG1H 3OF6A 2R29H 4JFEA 4GKZA 4K7FB 3GSUB 5SWSE 1YQVL 3PGDA 4GMSL 2B0SH 3GI8H 5D7IE 1YYLL 2Q8AL 1U9KA 4Q6IB 5KSAA 2A6JA 3O3DB 2CXKA 4OTXH 4YPGA 2MQ3A 4PJCB 4M48H 2E6QA 2C3VB 4LSQH 3WUWB 2MNUA 2UY7A 4GG6A 4J1UA 3OL2A 1DTUA 1HXMA 4PG9B 1U3JA 2J4WH 3NACH 2ZKHH 3HS0A 3T2NH 3BH9B 4WFHE 2O5XL 4UT7L 1SM3H 5IVXA 2A9NL 2ED8A 5D7JA 5IIEB 4NFBA 5EOCL 3LEVL 5B3JF 3P77B 3RZCC 3OAUL 4XB7A 4KXZH 1ZLSH 1DR9A 1KJVB 4D3CH 4GRWH 1P4IH 4WU5B 1JRHH 2ZJSH 1HHJA 1QYGL 3NFSH 5CD3A 2DTML 3I3DA 2VTFA 5GQBA 5T5NF 4LLVB 2IADB 1GC1C 4XBEH 5E1HB 3OKDA 1I9RL 1NGWA 3VXUA 1NCCL 4UB0H 1MCBA 4GBXC 1BVZA 2J8UA 4OLYH 1D5XB 3WFBL 3S5LA 4M02A 1JF1B 4TUJB 4GRLC 1KN2H 1OAZH 1LO4L 1U6AH 4HBCL 7FABL 2QBWA 5BS0B 3O8XC 4PJ8A 1O5DT 1FL6A 3QQ4A 5ALBL 1XH3A 5DEZA 1DUYA 4R0LC 3ZYOA 3KLHD 5D1ZD 5HDLA 2VDKL 5CAYB 1I4FB 4G9DA 4GFTB 2FZ3A 3BP7B 2ZCHH 2JJSA 4OM1L 1BOGB 2Q76A 4XZUA 3FQTA 2AK4A 2MFNA 3CK0H 3O6FC 5GGSB 4XPAL 1NBYB 4EQ2A 3IS0X 1JHTA 3EYUH 3FB5B 4POUB 1P1ZB 4HGWA 4WI8A 1IFHH 4APQD 1MHEA 4MQXC 3TIEA 3MV11 4U0RC 2A73A 1MRCH 2AV1A 1ZEAL 1YJDC 1WUNT 2HVKB 4HIXL 1UJ3B 5D96C 4PJBB 1RZKC 3ULUD 2CJUL 1KC5L 4UNVA 4KY1H 2OK0H 5ESAA 4BKLA 4XCCH 1LO5B 1MCPL 3IRZA 5EG6C 4X6DE 3MGOB 5I17A 3OXSA 3DVGB 5E4EB 5I1DA 2FLBT 5GXBB 1A2YA 4GAGL 4OF7A 2BERA 4KFZC 1IGTB 4FQ2L 3K3QA 1EHAA 5DGRA 5TE7H 1MCOH 3QNXB 3DXAB 1WCBA 3KG5A 4KHTL 2PYED 4O5LH 5HJ3B 1A1MA 4O51A 4PR5A 5JW4N 4MWFA 1A3RL 5I1HH 2F74B 4QTIH 3E6HA 4OFIA 5FKAB 4R8WH 3I6LE 5DTFB 1F11A 3HC3H 1TJGH 2BY1A 5D70H 4PJHA 3BZFA 4Z7QE 5CEZD 5GGVH 4XNZC 2PO6C 2YC1A 2NX5D 1J05A 4HS3A 4EUPB 1NCBH 1MVUA 2UWEB 1I7RB 1KTDB 4M1CC 3BSZH 4HH9A 4LQFL 3VFUA 2BCKA 1H15B 3GJFB 2QADC 3V0WH 4NZUL 3U46A 5JNYB 1CXHA 4WEBL 5ALCL 2VZ1A 3O6MH 4PJ8C 1T7VA 2GTZA 4RFOL 5ILTL 1A7PH 1AO7B 1FSKC 4ZOAA 3BQUA 4NQXA 1HHHB 2APWA 2EE9A 5JPNB 2G2RA 4PY8J 3P30L 3V4VH 3MV7D 4X6BA 4NQXB 4ZQKA 2GITB 3KLAA 3UMTA 2MQ0A 4JRXB 3WLWD 1GC1L 1WSST 5IHZA 3G04B 1Q0YH 1EGJH 4HGWB 4HC1L 4CN4A 2R0ZH 4NCDA 2PO6A 5L6YL 5FECA 5TQ0L 3NAAL 1UACH 3MGAA 2H9GB 4WI3A 1EJOL 1BOGA 1J05B 2Q86A 4HS3B 4RIRB 4JZOB 4JM2F 4U7SA 1UM5L 2GY7B 1A6AA 4DKFL 3TZVD 3WN5A 3D69B 3NN8B 4N5UA 2DWEA 1JPFA 3BW9A 2AJYL 4FFYL 1JIBA 2EO9A 4TUJA 5K9QI 5BZWA 2NW2B 4MMZC 1M05B 2PF6A 1HE7A 1MCKA 3MROB 3DI2B 2NY6C 4X7FC 5EH1A 3S37H 5KSVB 3CVHA 3NIFF 3FFDB 1TVDA 4M62H 4GAJL 4JG1L 4M7LL 3K2UH 4A2LA 2VAAA 3S6CA 1YEDA 5IJKC 2NY0B 4X6CE 2YMXH 4PREB 4ESKA 2WUBL 3S9DB 4QNPE 1N26A 1HN1A 2AABH 3JV6A 2P8LB 4MXQC 4LSQL 1OAKH 5SX5H 4NQSA 3OKOB 3QPQC 2AJZB 4HC1A 4FZ8H 5SWQA 4P49A 5GISH 4O9HH 5D7LD 2DWEB 2XKNA 3S8WA 3T2NL 3QXTA 3HZMA 3DARA 5CUSH 4P4RA 3U0WH 5IFHL 3UYOD 3FT2B 2AQ1A 2W9EL 3BP7A 3LEVH 1QHOA 1PY9A 4QHMB 2ADIB 4L4TB 5FA3B 5C86A 5JO5A 3WIFB 3WHE1 2ZP0T 5C0AA 1QBLH 1JN6B 4X6CF 2ZJSL 5KSBE 2PO6B 1FNEA 2FR4A 5H94B 2WIMA 3L3IB 4RDQF 1QSFE 4N0UB 1W2KT 5BV7L 3B9KD 3O6FA 3SKJH 1YNLL 4BQ9A 5D2NB 3W0WA 2E7LC 5DUMH 1NKOA 5CEXA 7FABH 4PLKD 1FL3A 2VB5A 4D94A 3T3ME 4IRJC 4HWBL 3Q3GB 1U42A 3BWUC 1LEGA 4F7PA 5CLWA 1H5BB 3QDHA 4F8QA 4ZAKA 4OQ1A 1F58L 5BV7C 4OM1H 2WINA 3ZE2E 1VGEH 1WVZA 2ZNXA 5BW7A 4YNYA 1SBSH 3WHE0 1B6UA 3RHWF 3INUH 5LGKA 3GJFA 4Y4HB 1QKZH 4Z7UE 1SJXA 3I6LD 1ZLWK 3QIUC 3D0LB 1RJYA 1U91A 5F72S 3RUGF 1MRFL 3O3DA 3T0DA 1HSAA 1K8DA 1S7WB 1K4DA 5CGYC 1YMMA 2OK0L 5KVGH 3K1DA 3THML 1R3KA 4LDOB 3T4AB 5FYKD 5L2KD 3W39B 2OI9B 4E41A 2A2QT 2H2PC 3QEQD 1UWGL 5FO9A 4TSAL 1S7UB 4ZDHA 4PJHF 4Y5VB 4ZFFA 1J8HD 5DEFB 2A77L 1Q9KA 1ROWA 2HA1A 2LAAA 1OGAB 4KKBC 4LHUB 1YZZA 4XNXH 3NCCB 4JVUA 4D9LH 3ECBA 3ECBB 4ODSL 3EO1B 4K7PX 1PJ9A 4I9WD 5ENWB 1DE4A 4MXVE 2CIKB 2QSQA 4NWUH 1JUFA 4PRPD 1NMCC 5I17B 4YFLF 1U8QB 1FYHB 4O00A 1QA9A 3RUGA 5L2KB 1PZ5B 3E8UL 3QDMD 1CXLA 2A1WL 3PP3H 4KKLD 3WUZA 1VA9A 1ZHNB 4ODUA 5SX5K 2W0FA 2X10A 3ILPB 4PFEA 4Z7UB 4JKWA 4ISVB 5H8DA 4X4YB 2Q87A 5JDJA 1IKNA 4KI1A 3UTSA 2BDNL 4QRUA 3ZSSA 4WFEE 3OJDA 4JQVC 2BNUA 4M43L 2WUCL 4QWWC 3FQTB 3B83A 1OARH 3PXHA 4PJ9B 4WHYG 4YK4C 5DWUH 4LIQE 3S35H 5B8CC 3AREA 4Y8AA 3P2TA 3QRGL 4ODTL 3ZKQD 5L9DL 1A6VL 1DUYB 4ZAKB 5DVNA 2AERT 3RY6A 5ITFA 5GGRA 1EUTA 1H5BA 4XCEB 4X5XA 4M8QB 1DLHB 1L7IH 1I85C 4LIQH 5EIIA 3MV8A 4HIEB 2Z31C 1AFVL 1T5XB 3OJ2C 4C56B 4LOUD 1RZKH 1GAFL 5GRJH 2LVEA 4XNYH 2J8UE 5C0FA 2LU7A 3VXRA 1QSFB 3OKDB 4JJ5B 5IFJA 1E4KA 3ZHKA 5D6CA 3S3JA 1RZJC 4ZAKD 2AXFB 5HI3D 4TOYH 3MQIA 2X1QA 5IKCA 1G9NC 3NAAH 1MOEA 5HY9A 1RJZA 4F7EA 2WP3T 4Z18A 1W0WB 1JPGA 3MA7A 1S7TB 4MJ2A 4XCEA 4YR6B 5KS9B 2B5IB 3BZDA 5H35B 5FA3A 5IIEA 1OAXL 2XA8H 4Q9QL 5GRUH 3FT2A 2ADFL 4TRPH 5CJOH 1XGPB 2R2EA 1KCKA 2QL1A 1UCTA 1HSBB 2NYYD 2XKNB 2VDRL 5CEZH 2JIXB 1NAKL 3ZHLA 2H26A 3VXPA 5F71A 5KZCB 4HKXA 1DBMH 1P4LB 3DYPA 4U1GB 1FNGA 3K2UL 1IC4L 1IGFL 3RGVD 1KGCD 4LDEB 1QFWL 4JFEB 4NT6A 5D2LA 4XI5C 3P73A 5D7IB 4AG4L 5E9DE 2X9YA 1QA9B 3D6GA 4H1LB 1P7HL 4YHPA 5KSBA 2C7UB 1NCDH 1RUPH 1OAKL 1I9EA 4B7IA 1JUFB 1UT9A 5IMLB 4BSJA 1I1AD 1T7XA 3VXRB 3BE1H 4K71C 4W4OA 1HINL 1KB9K 1J0IA 5C0CE 5FAAA 5BZWB 2EDEA 5J11B 2YD7A 2EDRA 3BDXA 4HIEA 2BVQB 3HE6D 5EIIB 1WICA 4AM0A 3TNMA 2X05A 4M8QA 4V1DD 3T0XA 5J57B 4G7VL 5CIPH 1OTUD 1BQLH 1XR8A 2L0DA 2YEZB 5FHBH 2VLRE 4RIRA 3BX7C 2YPVL 3ABZA 3TBYA 3V8CA 1YY8B 4NHUB 1RJYB 4WO4B 3D1MC 3UEZA 5FM8A 3GKWL 3QUZD 4Y4HA 1F3DH 4G8EA 3WHXA 3C2SA 2D03L 4TN9A 5C6TH 3MRFB 4XC1H 1KTKE 2ED7A 3V2AR 3QEQE 4JFQB 1YNLH 4PBWD 2XTJB 4MD0A 1ULVA 4XTRC 4I18B 4YIQB 5HVGB 3FJTA 3MFFA 4CADA 3D3VE 1NCAH 3BGFC 4HKZA 3L3JB 1OTSC 4ZQKB 3ZSTA 1RD6A 4LKXA 3IF1B 4ERSL 4POYA 2E8ZA 3MRIB 3MRLB 2EDHA 1T03L 5SWZA 3DX6B 4WUKH 1F00I 4J4PD 3SKNB 5JPNA 4ZAKC 3JV4A 5F7LB 5BO1H 2GW5A 3EO1A 3BPOB 5ENWA 4HXAH 5CJ5A 2R2HA 4JFYB 3OZ9L 4WWID 5IBLD 4ZUTA 2E27L 4L3EA 3G6AA 4CAGA 5E24E 5EULV 5FYKE 1MFEL 3G5VA 3WFDL 1WIUA 3S98A 1BIIA 1HI6A 3TGXA 3JZ7A 2NLJA 4LNRA 3NGBB 1FNEB 3U46B 3T4YB 1YN7B 1MIML 3LKPA 1T6WA 4U6TA 2ZUWA 4U1HB 5HI5D 1XZ0B 1NFDE 4GS7C 3SE4C 2B2XH 2GJZB 1FFPA 5TF1L 3KNBB 1U91B 4XP5L 4IS6A 1FPTH 2CLZB 4BJLA 4Z7WB 5JW3L 1N5YL 1WFUA 3PQYB 4Y4FD 4R97C 3CFJA 1UWGH 2Z93B 4X7SH 4TSAH 2CKBL 3DO3A 2AQ3A 4YZFF 3CFKA 5DZLA 1SBBA 4LNVA 3MJ7A 2F74A 4YNYB 4Z95H 4KTDH 5E7FA 5JOPE 4D9LL 5DR5H 3NA4A 2NXYC 3MA9L 3QCTH 1R24A 1JRHI 3LKRA 3D39E 4L4VA 1ZV5A 1RZJH 1ZHLB 3WDJA 4AEFA 1NEZG 2HH0H 1G9EA 1AD0B 4D9RD 3MGOA 3PWPE 2QSVA 2KZWA 4MJID 3WO3B 3Q6FB 1FL3B 2A1WH 3LKQB 4RZCA 3F7VB 4WI2A 4DGVH 4DQOL 4OKVA 5LKNA 1A1NB 3STLB 5L2JA 3D85A 3QBTB 5GS1A 2VLJE 3K7UA 5H94A 4K55A 1F6AB 4YXHH 1OARL 5T3XD 3IAGC 1E6JL 3ELAT 4NZTL 1E4XH 2QQLL 5J11C 4O2FB 1IZKA 4ODTH 4QHMA 3GI8L 1KELL 5LBSL 3ZKXC 3U7WH 4G9DB 4NYLB 4EZMA 4OTXL 1KIQB 3V6ZB 1L7IL 5EOTB 2IBZX 35C8L 4O2FA 3WXWL 4LIQL 5D4QA 1LE5A 3PWLB 4YBLB 3JV0A 4X8XA 3VD7A 1GAFH 4LPYA 2HJLA 3V6BR 1A4JA 4LCYA 5DJ8A 3RL2A 2ICWA 3QHTC 3OKOA 3HMWH 2WAHA 2JJTA 2ZKHL 4MZ3A 4X9FA 5FUZL 3DUUB 3HZYB 4YHIB 3E3QC 2ZOLB 3AAZB 3S37X 2RHEA 5EOCH 2Q8BL 1PQZB 1VEPA 4OM0L 3WSQL 4L3EE 1HWHB 4NUGL 1G7LA 3IJSB 4H8WC 3L5HA 2G2RB 1JWMB 4FG6C 1RK1B 4KRNA 1JFQH 3VI3F 3MLXH 2ICCA 3MV9D 2UZIL 1T1YA 2DTMH 3HI5H 3RNKB 5C7XL 2PXYB 5I9QB 2HT4C 4LRIA 5DFVD 3IFPA 1I9RH 1NFDA 1CS6A 4UB0L 1KT2B 1YMHA 2DLEA 4JPWL 3LDBC 1QLEH 3I2CH 3S96B 3T0VA 5MEOB 5C0RL 1EMTH 3OR6B 3WN5B 2EDTA 1A9BA 5IB5A 3EYQC 1KTLB 4MD4A 4J1UB 2BCKB 3FN0H 3FT3B 5ALBH 5E70A 1BEYL 1KTDA 4QCIB 1IGFH 4IS6B 3MLSH 1G1YA 2JJSC 5DUPH 4QKXB 2ZCHL 3UTQA 4PJHB 3SDXE 4E5XA 4GKZB 4K7FA 1F11B 3ULVF 5FB8B 1A7OL 1T80A 3ALWA 4U3XA 2YHGA 1T1XA 5D2LE 5FKAA 3GJEA 1PEWA 2EIZA 3EBAA 3O2DL 3KHOA 1QRND 5TPWH 1T89C 3FO9A 1T2QL 5F3HB 3Q5TA 4JY6A 4S1RL 1UGNA 3O2DA 3PP3K 4JFYA 3EAKA 3OXRA 4PRPE 2ESVD 1ZEAH 3OGCB 2Z0BA 4O02H 3OXSB 2FJHA 3JWOL 4YHMH 3MRIA 1KC5H 4LLAA 3VD5A 5C0NC 2HWZL 5IBUB 5M95B 1GGCL 3ULUC 2GUOB 4ODVH 3T0WA 4DUXA 1WAAA 4KQ3H 2JB5H 4YIQA 1SEBA 4LLWB 1AE6L 1RUKH 3O8XA 3QXVA 5TE7L 1K2DA 3QDGA 3FB5A 3BKML 1R6VA 2IWGA 3TO4C 1EK3A 5K59E 4HWEL 4U0QB 3DROB 4XC1L 4XVUC 3UBXI 3RY4A 3HB3C 3H0TA 2YD5A 1F4XL 1YC7A 3SQBA 3SDYH 1R5IA 1IEBB 3GM8A 3VFUB 2R56L 2AK4B 3QDJB 4DGYH 2ATKA 4FFZL 4M7JH 5GGUB 4H88H 1CBVL 4Q9RH 2LU4A 3ULUH 2ZG2A 2G9HB 4JKKA 5FGBC 5DRWB 1INEL 1YMMD 1F45A 3UZEA 3BOVA 1IKFH 3FB6A 5DK0B 4H26A 1TVBB 5IB3B 3RNQA 4P2OB 2DM4A 4PGZA 2ESVA 3O6LH 2NY5H 4PRBA 1KIRA 3JWOC 1U8MA 1YNTA 1WCBB 2A9ML 5FYJL 3WFDH 1MFEH 5ACZB 2ARWA 4BQ6A 1CICB 5ISZD 4KMTH 4LLVA 4ACPA 1UKTA 1OLLA 4ORGA 3DVGA 1KCUL 2D0HA 5JA8B 5EU5A 2E7CA 4ZFOL 5DHXB 2NY3C 4A6YL 1FAKT 5FUOH 2F54D 2AK1L 4L8SC 3LQAC 1TNMA 1UWXH 4BYHA 4F9PA 3TIEB 5KN5A 1P4LA 4NNXA 1VEMA 5AZ2L 1A1OB 1P1ZA 2K7PA 4OB5H 4FABL 1FCCA 3BH9A 5EOQH 3L7FB 4ZOCA 1T7YA 4YQXL 4NNPL 4U6HA 4P9MH 3B9EA 3PWJA 1H3WM 2Y5TA 5DD0H 1MUJA 1PVHA 2ICWJ 5T1LB 3MA9H 3MLZH 2Q76B 4S1QH 5D1XD 4PJ7F 1M71A 1NMAH 1XGRA 4AT6A 1G9ML 1MJ7L 3C8DA 4PJCA 3ZTJH 1A3LL 1VACB 1RZJL 3IS1X 3EDEA 2G5BA 1XH3B 3MOAL 2EDYA 3GMQA 1X9QA 4DKFH 1KFAL 3V52L 2WW8A 2QQKH 4G6MH 3VG0H 2AJYH 5IHUH 2EO1A 4XWGH 1OAYH 1G7JB 1AGBB 3DO7A 3CH1A 3AS0A 1U8MB 2WWMD 3SCMB 1NAMA 4W4OC 1I1YA 4JAMA 3MX0A 4M62L 1IVLA 4KXZI 5I15L 4IIQB 4K3DL 3CCHA 3FB6B 1KJVA 5H2BB 3VGGA 4RA3A 4DCQB 4LAJH 4F57L 1YQ2A 5DRWA 2H32B 5H37H 5T1DL 5D5MB 3FB8A 3KHQA 3BGFB 5D7JB 1TFHA 3QEQB 4GLRI 4JHBA 2VKXA 2R0WH 5JPMB 4XMPH 4WI7A 1I9JL 2Y6SD 4RRPG 3QAZB 4O4YL 3RZWA 3QPXH 2BHYA 4UT9L 5ERWA 2BNUB 4X99B 4JY5H 1B4RA 4EBQL 2X4QB 4OAWA 3WUWA 1FFOB 3HI1B 5I8KL 4BH7B 4J4PC 2J6EL 1UCBH 5HHPB 2AAVA 2AJVL 4HQQL 4O58L 2UZYB 5DA4A 1JYNA 4S2SA 4Y4HC 1A7RH 3H3BC 5IM7B 3WSQH 4JVPA 3QDMB 8FABA 2I24N 4JREC 3NOIA 3NIGF 1DQDH 3L5XL 4KVNH 2DQJH 4ELME 5C70A 3GHBL 5B22A 1DBBL 3OB0K 5C7XH 5F6HJ 1I1FB 3BH8A 5C0BB 2I27N 3FO9B 1AKJA 2W1NA 4JPWH 4L29B 4LHUA 3RGVB 1WISA 2V9TA 1QLEL 3I2CL 5E9DB 1T0MA 4X83A 3MCKA 4I4WB 3HB3D 1N59A 3SBWC 1GZPA 3P9LB 3QI9D 4KHXH 1S9YB 4E41B 5FO7A 4Z6AT 1R3KB 3T4AA 4EDXB 2FIKB 3QFDB 1X4YA 4RAVB 1T7ZA 4MX7B 2P8PA 4XT1C 2I9TA 2FEEI 3P0YH 1YUHA 1KTLA 4MD4B 3TYGH 5L8KB 4JRWA 1Q0XL 2J88H 4CMMA 1OAQH 3PGCB 3OR6A 3UTPE 5HHMB 4WW2C 1EAPB 3CDGA 3O2DH 2CLVA 1ZANH 2QHRH 1KNOA 1UYWL 3B8YA 1LVEA 2AKRA 3RI5F 3N1QC 1WBZA 4QRTB 1QKZL 1BVKB 5D5ME 1T1YB 4LVOB 2WINB 3AY4A 5LVEA 4NQDA 1KPVB 3TCXA 3RP1A 4LSSL 2VJXA 2GTWA 2HWZH 1CQYA 1GGCH 4NQDE 3ARRA 1YEHH 2B7DT 1U3HB 4KQ3L 3W9EA 4U6YA 5DRZB 3CFDB 3ARQA 1RUKL 3FRPA 1QNZH 2X89A 1JZ6A 1IAKB 4I13B 4XNXL 4JB9H 1BM3H 1RURL 4ODSH 1RSFA 4N0YH 5FOBB 4WWKD 5GS0D 4QOKE 5DFTA 4DGYL 5HVHC 5C08A 4M7JL 4ZPVA 1FFNB 5HYSG 2PO6D 3LKSB 3S97C 4Q9RL 3OGOE 5ELIA 5IGXL 4N1HB 2VLKB 1T1WA 1C8PA 2DQGH 5DZNA 1J1XH 1ETZB 3TCLB 1BZ7A 4Q6YA 3STZB 3HZMB 1ERNA 1V3JA 3L5IA 1UM4L 3GJFH 4XCYB 3IKCB 1I7TB 5KVFL 1KPUA 3O2WH 3P4NB 5EDXA 1KB5L 5IB1A 5EBWB 1ED3A 4KMTL 4PRHB 5J6GA 1QG3A 2BRRL 3ME0A 1BLNB 4ZODA 5F1OB 1KCUH 1JNHB 4JCMA 1UB6B 3Q6FA 4BH8B 3W2DL 4WNQA 3AXLA 4YBHA 2AK1H 3VI4E 2DYPB 4K07A 3WLWC 2HMID 4U1GC 5BVPL 3I85A 1LQSR 1R24B 2YOCA 3J7HA 1MHPL 3PWUB 1EA9C 4YHZH 5AZ2H 1YA5A 4OCWH 5D6DA 1RZGA 3AVEA 1KJ3H 1U3HC 5J6GB 4CVWA 4OZIB 4EI5A 1U92B 1RZKL 4XNYL 4F37F 4LSUH 3MZGB 4NNPH 3EYOA 1UA6L 1OLZA 2FL5B 1T0NB 2HFEA 2Z93A 3MLZL 1MCLA 1NPUA 1NMAL 3NN8A 2ZNWA 1PLGH 3Q5OA 3BZ4B 5D8JL 1EERB 4WW2F 1J10A 2GKIA 1BWMA 3CZJA 4UDTA 5JOEA 4D0CA 4LLDA 4CVZA 3BGMB 3RZCB 2O5ZL 2GJZA 3Q48A 2O5YH 1S7SA 4Q58C 2DQEH 4QHLB 4F58L 3I02B 4ZPVB 1ZGLB 4X0KB 3WNOA 3V52H 2YRLA 2AJ3B 5FECB 5BXFB 1NGZB 1LP9B 4TRPL 5IHUL 1KJ2H 4HKJB 2DQFB 1YPZA 4OIIL 4LVHC 4X6DB 3RKDD 2FGWL 3D18A 5DDHA 4CKVX 1IT9H 2SEBA 3RPIB 5C0GB 1NAKH 3BEWA 4JR9H 1E27A 3FT4A 3DX6A 3PF2A 1DN0B 1NUGA 4DKEL 1DL7H 3MRLA 4JHAL 1DN0A 1KLGA 2BHUA 4GW4B 2R1XA 1CLZH 1WTGT 2Z4QB 1HHHA 5DUBB 4AJ0A 1JMZA 4MA7H 2DM7A 1NCDL 2W0LA 1I9JH 2Q3AA 1BWWA 4XNUH 4GRLB 3ARDC 3RWEB 3MGTB 5GHWH 3JBG7 4X6DA 4NO5A 1AQKL 4HXBL 3QG6A 1GH7A 2P5EA 1FLRH 3CDGB 2N4IA 3CMOH 3PL6A 1ACZA 4ZD3H 1IQWL 4HS6A 3ULVD 1UJ3C 5IWLC 1JF6A 4O58H 2F53E 2HN7A 4G7VH 3UO1H 3UC0L 4TUOB 4NKDA 4EUPA 5DD6A 4FQJH 4UDTB 3NZHH 1QZ1A 2YC1B 1RQ5A 4NQEA 2XZCH 2Q7YA 5DRNB 1NMBL 5FO7B 3TPUA 3DX9A 4KVNL 3F62A 1S9YA 3GHBH 2CKNA 4MS8D 1DBBH 2WWKT 4M7KH 5IUSA 4M5YL 3OKNB 3GKWH 3IDNA 4MWFB 3ORJA 5F8QC 4FTVD 1A1MB 2IC2A 4O51B 4JGJA 4PR5B 3QEUA 3GI9H 3U6RB 3PWUA 4IRJD 1A6WH 5CCKL 3FFCB 5ITBL 4KHXL 2BJML 5I1DB 1U3HD 2J8HA 4UILL 1DQQB 7CGTA 4OFKA 2F19L 3OKMB 3H9ZA 1AY1L 2D9QB 3ZDZF 1AIFB 4NKIL 4U6XB 1EVUA 1T03H 2V17H 3O9WD 4JCLA 3HCVA 3BMWA 2XQYK 1D7FA 2C3XA 2M1KA 2AV1B 1Q0XH 3EO0A 3IKKA 2FECL 1UH3A 3HI1A 1I7TA 3OZ9H 1D6EA 3V4PL 4XCYA 3MNWB 1CFTB 3RQ3A 1JHTB 3WD5H 3X11A 4MD5B 2ADGA 2FECI 3UTSE 1W72H 2DQUH 3PABB 4WUUB 4QY8B 1K6QH 5IR1B 4XZUB 1FYTE 2NR6D 5HGAA 2XQBH 1UXWB 5JW3H 1W0WA 4IMLB 5HI5C 3QWOB 4NWTL 3V5HB 1MCWM 2Y23A 2OR9L 2P5WE 3C5SA 3TBWA 4N0FB 2ZSWB 4XX1G 4D9RE 1HCVA 3BAEL 2OTWB 1A6ZB 3N1PC 1GXEA 2NY5C 4TNWK 4IHOB 5D1QB 4Z78A 2NY0C 4ZUWB 2P47B 3O6KL 5I74C 2JJUA 3HZKA 4N0YL 4K7PH 1CD9B 4MVBC 3K4ZA 4UTBL 4IJ3B 2VL5A 5C2BL 2ITDA 1QVOA 5I1GH 4X5XB 4XRCB 4TULH 5ITFB 1DN2A 3GSVB 3WYRA 5J56B 1NUDA 2VDML 3MUZ1 3AREB 5FYKL 3AS1A 1BVKA 3LOWA 1M71B 2X1WL 3EFFB 5EUKB 5JTWA 3B9VA 5T1LA 1WBZB 4DGVL 3QHZH 1R5VB 2OMNA 5GRVK 1NBZA 3MRGB 5F9OH 1YC8A 2Y06L 1KNOB 5DJDB 4QRUB 2CK2A 4FP8H 2NZIA 3U30C 5L2KE 4DKDC 3UAJD 2NPLX 4YXHL 1KB5H 5E8NA 2MPAL 3EHBD 4LQ1A 5FV2A 1PG7L 1BFVH 1E4XL 3FQWA 3LKNA 4CJ0A 4NNYB 2EZ0C 3LQAH 1NSNL 2AV7B 1G0DA 3PP4L 5D7JD 5DSCA 2AJUL 5KSAB 4OGYH 3OG4B 1KELH 4RGOH 4N90D 3HLAB 4R4NC 1KEGL 4K71B 1YEKH 4ZPTA 3S36H 2BC4B 4JPIA 4G8FA 5IHBA 2NW3B 4OV5B 1EZVX 4OCWL 1RY7B 2ORBH 4UT6L 5F1NB 2XWTA 3OJMB 4F80A 5ID0A 1C16B 4EN3A 1H3PH 3HMXH 2P44B 1CFSB 4OLWL 3V0VB 3CFCL 4MSWB 1P9MA 1REIA 1KCVH 4FNLH 4R2GB 4XHQA 1T2XA 2ZUUA 1D5IL 3BN3B 3FMGH 5DEFA 3UDWA 1V7MH 3HUJF 2ITCB 5HYJE 2CDGA 1DDHA 5LCVL 1D9KB 3ZL4L 5C92A 3VXOA 4PJBE 3QDMA 5DJZA 1MCFA 1XIWA 4S1DC 4OZ4B 2FBJH 1MJJA 2E7HA 4TVSa 3KPSB 1C5BH 4NDMB 4XGZA 3SGKC 4WY7H 5E6ID 2V7NB 2PCPA 2NY7L 5FKPB 1JPSH 2AEPL 3MLXL 5GS3A 1MQKH 2BSTB 5KAQF 1V8HA 4PG2A 3UJIL 3KGRA 4N1EA 1K2DB 2DS4A 2EYRA 3CSBA 5AZEH 2RBLA 3QEQA 3PIQA 3FN0L 3KAAA 2WANA 1BEYH 4Q97A 3QNYA 1DL7L 1IAOB 5J0BA 1UC6A 5E08L 3UROR 1LEGB 3J8F7 3JWDL 5KSAC 4RMUA 3Q3GA 1PAMA 2J8UF 1X44A 1PYWB 4LCIH 4JN1H 4QOKA 4RQQA 4P46B 1C08A 1I8KB 4R6UA 4OD3L 3QCVH 3W0WB 3VMNA 3DO7B 3V0VA 4FXKB 1G0YR 1XF1A 2IALB 3VD3A 5HHOD 4P5TC 2B1HH 1PFCA 1Q9LB 1DQMH 1T1XB 2ZPKL 4LK4A 3CMOL 4G8FB 1N8ZB 4KRPD 4OBRA 1JN6A 2VABB 4LSRH 3UTQB 3QIBC 1J8KA 4DOHE 3ZKSD 2G5BB 5HD8D 5JO5B 3UTSD 2DQTL 2AV7A 2XZCL 3VXMB 4HAFA 5GZOD 1BBDH 5L8LB 5HPOA 3BP5B 1L7TL 1II4E 4LRNL 3RPKA 3UJTH 3VXME 3PWJB 3C6SA 3OBAA 3CIQA 4XP1H 3CSYA 4HWEH 4I77H 2AJZA 4NKOB 4JPKL 2EH8L 4JZNB 5E2UH 3VFSA 1PW3A 1T20B 5KS9E 4Z8FL 1A6WL 4FFZH 3QG7H 2Y07H 5CCKH 1AGFA 1RMFL 1RK1A 2V2TA 2HRPL 2VLJD 4XTRD 4JN2A 3BHBA 2NY2C 1U36A 1INEH 3PWPD 3ZE0F 2YK1H 1NGXA 4NKIH 5E94B 4OZIF 1YJDL 1Z5LA 5TFSH 1U8HA 2FSEB