3EYUL

Pfa1 fab fragment complexed with ror2(518-525)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
218
structure length
218
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords If kappa light chain
publication title Structures of Abeta-related peptide--monoclonal antibody complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 55
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2008-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eyuL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eyuL01
2DICA 5C0EA 1CICD 5JDSB 2QSVA 4G42A 2E6JA 1MWAA 1B0RA 3LIZH 3MGTA 5F8QC 2XQYK 5I1LA 2XG5A 5TPWH 4HWEL 2ICES 3QDJB 1YEIL 3BIKA 1HILA 5DD6A 2A9NL 1H3WM 3LS5L 2ADIB 1NUGA 4OCRL 3WUWA 3DV6B 3U0PA 4YH6A 1AKJB 5HY9B 4XCEB 3VFPB 5CCKL 2BNUA 2WUCH 4PB9H 3NABH 1JF1A 4Q6IC 2W65A 1T5XB 2IEPA 3T3MF 5E8NA 4G80B 4TOYL 5E7BA 2O93L 1G0YR 4OF5A 5EOTB 2XKUA 3GBNL 3UYRH 4P4KB 5E95B 3C6SA 1P5UA 3NN8B 4EI5D 5HHOB 5K9KA 4RFOH 3MRIB 3VRLF 1A7QL 5ILTH 2PW2A 3RTQD 3FO2B 2BK8A 1YMME 4RZCB 2ESVB 4HUWB 1PYWA 1X5YA 3SE8H 3MBEC 1VFMA 1OPGL 4R8WL 2Z31C 3LQAL 3VFUA 3VXME 1I1YB 5DURB 3O3BB 4APQC 5LBSH 4ZS7L 3BJ91 4XWGH 3MFFB 4PFEA 4F7MA 3ARFA 3C5ZC 4L9LC 4P9HH 2UZIL 2Y9RT 3DROA 1UWGH 2LQRA 4U1NB 3IS0X 3QQ9D 2C4FU 4Y16A 1S9KC 4F2MA 5BXFA 3QJFB 4JHWL 1SBSH 4WWKD 5FUZH 5ADPH 1FZJB 1VPOH 3KYKL 3MRGB 3C5SB 4CVXA 3TA3C 1P7KB 4HKBA 1XAUA 1N5AA 4NNXA 3VGDA 1SY6A 1FGNL 4GAGL 4XT1C 1NBYA 1ADQA 4G9FD 2OK0H 2FJHA 5D7SL 3W2DL 4ZPTB 5EC1B 3TYFA 3P30L 4UQ3B 3DO7A 5IJKA 4KQ3L 1IBGH 2FX8L 3LEYL 3S3SA 2IQAA 4M03A 5FDWB 3IDXL 5DT1H 5D70H 4YBLB 1QLEH 3MLWL 5SWZA 2MCPH 2EXYC 3BP7A 4OCWH 3TWCH 1KEGL 2EXWD 4QHKJ 3VMPA 3VI3E 1WGOA 4DTGL 4G6KL 5J06A 1C7SA 3BEVB 2Z35B 5D2LB 3Q1SH 1OSZA 1G7IA 1AE6L 5D72H 2ENYA 3BZEA 5A16A 2CK0H 3PNWA 4NO0B 2YWYA 4JFFB 3ILQD 1A7OH 2EZ0C 3U0WL 4GKNA 5F7EL 2Q7YA 2WBJA 2X1QA 3ARDA 4C58B 1TZHB 1I9IH 1JHKH 3SGEI 1S7XB 4B0MM 4Q9BA 3F7YB 4LLWB 1J0JA 2VLJB 2E7LC 4JFYB 5F7LB 3GGWA 4P99A 3RJQB 4O00A 4JB9H 3G5ZA 1ZA3A 1YYLL 1J8HE 5J6HA 4JJ5B 4Y19B 3PDOB 2ICCA 4NN6B 4Z7WE 1OF2B 3E2HC 1UACH 2V5SA 1N3NB 1UEYA 4FFZL 5C0FB 4J7RA 2V5TA 5HYIA 3DRTB 2VMFA 3FZUC 5T1LD 2Z8WC 1P4IL 5DA0B 5TDNB 4OZ4B 4P4RB 1A64A 4DKEL 1XGUA 1IL1B 1H3TA 1NGWA 2W1NA 2IH3A 1RVFH 3I02A 1D5MA 5E2WL 1U8JA 4XAWL 5MERB 4YZFE 5J11B 3QEUB 4OZHB 3UTQB 1N4XL 1MCFA 1Q9LB 2BNRB 1ZT4A 2EIDA 2HWZL 4MA1B 4HLZH 1XR9B 3NACH 2EDYA 1G9NL 4W68A 1IAKB 2XOTA 4XXCC 1NANH 1FFOB 1HXYB 4KKLC 3W39A 2OL3A 4UTBL 4EBQL 3CH1B 2AAVA 3U7WL 2CKBH 5ALCH 2X70B 5T3ZD 1YEEL 1IM3A 2R2HA 1PKQE 4K2UL 4OZHF 2QHLA 4XVJL 1C7TA 3X11A 3LKQB 4X6DF 2YS4A 3ARSA 4BQBA 4R97C 4OZFB 4M93C 1MCKA 5JR1L 5HYJE 1IGMH 1TTGA 4JFPB 2P5WE 1ZE3C 4UAOB 5D71H 4HT1L 3RUGE 4QRPB 5T1KA 1EAPB 1MCQA 1FCGA 3RGVA 4OLZH 4KDVA 4LCYB 3GRWL 5GS0D 4TQEH 4K8RH 2DI9A 3OTTA 1XF1A 4QOKE 2K7QA 2YUVA 5I1CL 1CT8A 4KRPC 4PPTA 3U36B 3VI4E 1FORH 1W0VB 4JRXE 4RGND 3VG0L 1XFPA 3TZVB 5GSVA 5JQ6H 4PR5B 2VXUH 3P77B 5FIEA 2ZP0T 3EYSL 4LRNL 4TTGA 2HMID 3ARFD 4GS7C 2NQCA 4IOIB 2F5AH 2ERJC 3VXUB 4CAGA 3EOAB 1YN6A 4G8EB 3H7LA 5KANI 3LKSB 1ZOXA 4PJ8A 4JFHD 3KPSB 4Z7OE 2E5EA 4Y16D 3RVTD 2VLKD 4LMQE 1UKSA 2GJZA 4PV9A 1AY1L 4NC2B 4RDQF 3D39B 2BCKA 3IFNL 1NDGB 4E41E 2WMPA 1R3IL 3BWAB 1M71A 3BYYA 1LP9E 3NTCH 4FXGA 4OF7A 2C3VB 1BM3L 1BFOA 1UYWL 4L29A 3NPSB 3IDGB 1AR1C 1RV6X 3PQYE 2UZXB 3S4SG 5C0AB 1EX0A 5GJTL 4ZFFA 1TQCC 1A9EA 4HK3N 5CEXA 5LGHH 4MJ2A 3P4MA 5C6TH 2FSEB 3DX7B 4RGNE 3HAEB 1MJ7L 3SKJH 1IGTB 3GMPB 4RAVB 3DVIA 4R4BB 1HH6A 4PG9A 4A6YB 4XCFL 2WIIB 3HI6L 5AUMB 5T33H 3VFWB 2O5XL 1G7HB 3CH8A 5SWZD 4RWYH 5FGCB 1H0DA 4EUPG 3WFDL 4PJ7B 4MNQE 2DD8H 3GJEA 4XNUL 5CIPB 4HJJL 3CVHL 5AD0A 5TE7L 2PYEA 4FXKB 4G43B 5C0IB 4HLJA 4R4FL 5EU4B 3ZHKA 1X5KA 1F97A 3NFSL 3ZTJH 1BF2A 4LVOC 1B4JH 4CVZA 3NZ8B 1NC4B 5M95B 2UYLA 4U6YB 4PJDA 2HFEA 2R0WL 3KDMB 1N7MH 3ARDD 2Y23A 5D7IE 4L5FL 3TNNA 2FX7H 4YFDB 4DEPC 2R2CA 4FG6D 1UH4A 4P5TA 4UU9A 4WW2A 2YRZA 5EZOH 3QCVL 3LPFA 4IM8A 3AU1A 1R5IB 4HS6B 2Y36L 3SPVA 5CMAA 4NGHH 4X7SH 5FF6B 2EIEA 3TT1H 3KR3L 1P4LA 3I9GL 4MD4A 1GZQB 2R0LH 4ERSL 4F9PA 2A9ML 4I18A 5DSCA 1VFUA 1JE6A 3JWNC 1ACYH 2GKIA 1DLHB 4AG4H 5HGBB 1LK2B 4IMKC 5I6XC 4FQJL 5D7JB 4JFZL 3ULUL 4WI6A 1EEQA 4HUMB 5TDPA 2EH7L 4LNRB 5I1GH 3G6AA 1D5BB 3HLAB 3HG1A 1R3LB 2Z91A 4RAHA 1DBBL 1MAKA 5DTFA 2EDXA 4QWWD 4MDJA 4NO5A 5DUMH 5IP4A 4JPIB 3UYOD 2DQJH 1HYSC 4PYGA 2O61B 4PUBH 5CP7A 1FZKA 1OSPL 1JGLL 1Q72L 4KPHL 3BOVA 3U83A 2FR4A 1F3JA 4LLMA 1BZQK 2O5YH 3MUZ1 2IPTL 5ALBL 5IVZA 5I30H 3P4OB 2BJML 2VDPL 4UI2A 4Z7QF 4F7CB 3FQUB 3SDXB 4H0GA 3F65A 4NJ9L 2AXJA 2XXMB 3SDDB 2ZUWA 1YECL 3C60C 3BPCA 4GMTL 3QNYB 3FOLB 4FNLL 4M61A 1AGFB 1HHIA 2DLGA 3L3OA 4LGSB 4B7IA 4ONFH 5EU6A 3PGFL 1B2WH 5T1KD 5GISL 3TYGH 5DDHA 4PJ9C 3FN0H 1FVCA 2B5IC 4M5YH 4AH2B 1KB9K 1TNMA 3I75B 3ZKNC 1EEZB 1EHAA 3SDXF 1HI6A 2V2WB 4GMSH 1U58A 3V4UH 1MFBL 1BQUA 3VMOA 3FO1B 4PJGB 2LVCA 5F6IB 5MP6H 2C1PA 2DF3A 3ARBB 3QIBC 2FCBA 2EDEA 1I7ZB 5GGSY 4OZGA 2UUDH 2M2DA 4K9EH 3G08A 3CXHK 4HK0A 1P2CA 5EUOE 4X8XA 1D5IL 4OLUL 5T3XD 1GIGL 4QYOA 1DSFH 2NY3C 4EI6B 1ZVYA 1R24A 4PJEE 4YHOH 5DRXA 1JPTH 5IBTL 4ZG1A 2IADB 4PJ8D 5BZDB 2PO6A 4PJGF 4WY7L 1RJLB 2X9WA 3FT4A 2XWTA 4G3YL 3BVNA 3UBXB 3E3QE 3IFOB 3NGBC 4XHJC 1MLBA 1UZ8A 4F9LC 4QRRE 3O4LB 2P8PB 3EOBB 4G6ML 5JMOC 3QUXA 3LHPL 4HJGA 3WYRA 5E8PB 4N8CL 1MJJB 1OAXH 5GS1C 4Y5VC 3CFBB 5DUPH 5FDYA 5ESQB 4GXUN 5K93A 4LKXB 2ICWI 1KIPA 1IC7H 1OCWL 3GSXA 4NRZB 4D0BB 3TFKC 1G1YA 1F02I 2B1HL 2ZCLL 1YQVH 3NIDE 5TFSH 5C0NC 3Q5TA 3WIHL 1ED3B 2NYYD 5J13C 1HQRA 4BZ2L 5L7XH 4FZEH 3UAJC 3H42H 5IVOA 2VXQH 2C4FT 2PYED 5JW3L 1BIIB 4S0TD 1KPVA 3ARYA 4EN3C 3Q6FB 1WBZA 3QDGB 2VL4A 4X4MA 2BNQA 2E7MA 3GSVB 1VADB 2FATL 2E8YA 2X4RA 1S3KH 1IEHA 1G7MA 2IAMD 4JFXA 3LB6D 4GUPA 2AS5M 1KB5B 1JHLL 1LK3L 5JORB 6FABL 3N50A 2B7DT 4XCYA 1OL0A 1PG7W 3WS6A 1CD1B 4BKLA 4K94L 3F5WA 5TJWK 2DQUL 3H9SB 2Y5TB 3BO8A 5EWIH 4BJLA 5KVEH 1L9MA 3AMKA 1G7PA 2DKUA 3S9DB 3AAZA 2ICWJ 4NSKB 5T1DL 1OGAB 5HHME 3S4SA 1D5XB 3TEUA 3U9UA 3QO1B 1EMTL 2NY6C 1XZ0A 1S9XB 2VZVA 3BGFB 3SY0B 1ZLVK 5F96L 43C9B 2YXMA 1PZUB 1J5OL 4LASH 1FNSH 4K7PX 4R2GB 3X14A 2WINB 2ORBL 3ARED 3EJZD 3TT3L 1MQKH 1M05A 2BHYA 1FSKC 3M07A 3O9WA 5FYJE 1AHWC 4EUPA 2OTWA 3HG1D 3OQ3B 4X6FA 1BJ1H 1RULL 3FHQA 2VDKL 3C9NA 4PJDE 4PJHF 3MOQA 1CICC 2H2SD 3WN5B 3SDCB 5JUEL 1ONQA 1S7RA 5D5MB 1TJGH 4OFYA 1CDYA 3IFPB 3WNMA 1BD2B 2R23B 2VKWA 4K9EC 4RNRA 1VKXA 4KVNH 4R4ND 4DZBB 5IQ9B 2K3TA 5HVHC 4KWUA 1K85A 2X4PB 2CRZA 1I85C 4P3CL 5DC4B 5E6ID 4R90L 1KUMA 3EDDA 5D5MF 5AZEH 3MOAH 4KHTH 5TE4L 3RWHB 3ES6A 2ZWLT 2XFXA 1OGTB 4EQ2A 2Q76A 1AJ7L 4JHZA 3NIFE 3MBXH 5EU6D 2GT9A 3L3JA 3B5TA 4PP2A 2VXVL 4NZRL 4A2LA 5FA4A 1KTDB 4RMVA 4PY8I 4XCCL 2ZNXA 3D87B 4HX1B 4ETYA 1SYSB 1CR9H 4TVPE 1CFVL 4NO2A 4BH8B 1AI1L 3SDAA 5MEQB 2VDLH 2P24A 3KXFD 4G9DA 5EU3B 3D85B 2D9QB 5E4EB 1DQJB 3E6FB 3EYUH 5DK2B 4GJTB 5DJDB 4IRJD 4NQDB 4LCCC 1OTTD 1V7NH 3ESUF 4XMLL 3V6OE 1Y6KR 3ZHDA 1CS6A 4BUGA 5IMLB 4D8PB 1RHHA 3GSQB 1CF8H 5H37G 1K6QL 1AR2A 2XTJD 4NWUL 2PTTA 1QO3B 5D7LE 3IETB 3IJYA 4ZTPL 4WFFE 5D1XB 3BRFA 1OB1B 5IR1A 1P9MA 3ARGA 4CW1B 3PWUB 5CLWA 2R4RH 2PO6D 2W9EH 3WIIL 5I1KL 2KUTA 3DV4A 5DR5L 4WI5A 3THML 2AEQH 2R1YA 3GB7A 3GUTB 3EBAA 1EUTA 1UWEH 4WDIB 3ME0A 15C8H 2V7NB 3GO1H 3KPOA 4MJ5B 1TQBB 3H0TA 3ZTNL 4JGUA 4LPUA 2WWMC 4TTDC 5FYJU 2A0LC 2A6DA 1MHEB 4HS8L 3GI9L 3HUJB 4NKMB 1TIUA 4HIHA 4QRTB 5L6YH 1NMBL 1TCRB 4MMZC 3T2OA 5I76A 1R3HB 1D9KA 3F12B 1ORQA 1ZLSL 5B22A 4MAUH 3MRCA 1F4YH 1A5FH 3QUZA 3WHXB 3T2NL 3QIUB 5FCSH 4O2CB 5ESAB 2BHUA 5J9PA 3TBYB 1W72B 2Z8VC 3LH2L 3MRDB 4MAYD 4OQ1A 1T7VA 5F1OB 5DWUH 1QSFA 1JGVL 4R7NA 3HMWH 1DEEB 4N0FA 1SM3L 3S88H 3HUJF 2X4OB 1KNOA 4YBHA 1I4FB 4P3DB 3ZE0E 3VDAA 1OOAA 1QSEE 1IAMA 5C0BB 2J8UA 5FM8A 1WZ1H 4OLYH 2BNQD 1H3GA 4J23A 3K3QA 4AM0B 5CD3B 3U6RB 3NA9H 4IHOB 1F13A 2WAHA 2MQ3A 3OKOA 3NFPB 1BAFL 1Z9LA 1EHNA 4QTHB 1PG7H 4XPFL 5HPOA 3QSKB 5IIEB 5GGUA 1I3GH 2ZOKB 3KYAA 4NN7C 5DFVD 2BVEA 1KLUB 3DHJA 5I8OH 4Y4HA 4L3CA 5IUSA 1BX2B 4HULB 4P2RA 5DUBB 2XPGB 4PTUA 1IGCH 3X12A 4ODXB 4K23L 1A7RL 4M7ZB 3VWKA 4DKFH 4ONGL 5L0QB 4FABL 5I1HL 2JB5L 1I7TB 2I07A 5IB4A 1YA5A 1CFBA 1MJUL 3CXDH 3QHTC 4I5BB 5ELIA 3O9WD 5INDB 1NCCH 5ADOH 3GRWA 4KTEH 1CLCA 4OAWB 4UQ2A 3RVWD 3GNMH 4WFGD 3OL2A 5F44A 4NFBA 4PV8A 1AXSA 4R0LC 4OFYD 4XX1G 1FL6A 5KOMC 1IE5A 4NM8H 2JK5A 5GS2H 2Z93B 5CKAA 3P4NA 5J1AA 3OKMB 3BXNB 3T3PE 3LN4A 3X3FH 3BRDA 3CSBA 4WNQA 3UJTL 4ZOBA 1IVLA 3HTLX 5HYFA 4NBXB 4DZ8B 3RWDA 2AEIT 4PY7A 4Q6IB 4HDIB 1Z0MA 1N8ZA 2FWOA 4NP4L 2P49B 1N6VA 4HG4J 4MNHA 2H8PA 5GS3A 2GJJA 3BZ4B 5CJQL 1VACA 4U1GC 4XVUD 2PR4L 1YJDC 4HV8B 4OGXH 2GFBB 2GCYB 4AL8H 4RGNC 3FN9A 3L5WB 4U6TA 4OIIL 1LMKA 5FKPB 5F70A 1CFNB 3MX0A 3MBEB 4GG6A 4QEGA 1GAFH 2Z31B 3SDAD 3BH8B 2NMSA 3ESVF 4YBQD 5FUOL 3B9VA 1PG7X 2J4WH 5GGSA 3R0NA 1DL7L 2OI9C 2WQRA 4L9LB 2YD3A 2VNCA 2R8SL 1ES0A 5JLZA 4KRLB 3VDBA 4JY5H 4Q74A 5ESVA 5MI0C 2ZOLA 3QFJB 1F45A 5I1DA 1JYXA 2DQTL 1A6WL 2XZAL 4LOUD 5FM5O 2PF6A 3CVHA 1QR4A 3MV7B 5CGYD 4Z7UB 5DJ8A 5DQ9A 2D7NA 5FUCE 1AFVH 1HCFX 5DJ6B 3TH2T 1XCTB 2R15A 3SGEH 5FCUL 4U3HA 1FNEA 3KS0J 1VDGA 1EO5A 3TA3B 4TRPL 1NCTA 2D7TH 3JZ7A 3NH7H 4NKIH 4Z7NF 1G7QA 2VDQL 3IF1B 3PWVA 3RHWF 5F7MC 2CJUL 1GL4B 2A83B 4MA7L 3VFVB 1CYGA 1YNLL 1B6DA 3INUL 5KAQF 4Z7UF 3GJFH 3RVUC 4O9HH 4I48B 2B1AH 2O5ZL 1ZT7B 3V5KA 1D9KD 3MO1A 5JQHC 4UILH 4JFQB 4AIXA 4P2QB 3IJHB 5E1AA 2ATPB 3MLVH 4PGEB 3QUZD 2KZ1B 3EYFB 4ZOAA 1L0XA 1NLBH 3P9MA 2AJXH 4P2OA 5BRZA 2FIKA 1ZA6A 4XWOD 4U05A 5EORL 1JL8A 3W0WA 1AGDB 1QD0A 4GRMB 2JCCA 1RUQL 1CXKA 1QSFD 2WBJC 5TF0A 3MLXL 3RU8H 4MJIA 4O5LL 1WBYB 5C8JA 4FG6C 4GRWE 4RQQB 3JUYA 4JM2A 3T1FB 3OKDA 2XI9A 3MRKA 3QIWA 1E4XI 3GSRA 2FEDD 2VISB 5I1AA 4LF3B 1N5YH 2HFGH 2BMKB 1BZ9B 5F3BA 2D3VA 4IBLT 2F74A 2IGFL 2P8MB 1YEKL 4YWGH 4PGBB 2Q20A 3VRIA 5HI4C 1INDH 3QXDA 5JXEC 5HTSA 5KS9F 1U8NB 3OJ2C 5HD8D 3E2HB 1Q0YH 1VGKB 1F90L 2NXYD 4QNPE 4R9HA 4IIQA 4HAFA 3GSNB 3RGHA 4MX7B 4P2RD 3PP3H 2NX5B 3MRFB 3OGCA 3VWKD 2BVUA 3BQUD 1J0IA 3C5JB 5FYJH 4U1SB 2Q1EA 3REVB 1CXLA 1PVHA 3H9ZA 5IK3A 1QSVA 5DJXA 5IW1A 3WNOA 2D31B 3MNWA 4M8VA 1E4JA 1RZKH 3V4PL 2APXA 4DCQA 4JO1L 3L3HA 1CTOA 4HIJB 3MV01 5HVGB 3BAEH 4YFLF 1KPUB 3EFDH 4NWTL 3PHOB 3TIDB 4MCZA 3P3YA 4MQ7A 2GUOB 5DEGA 4PYHA 4LCWD 4XPGH 1ZHLB 3TJEL 3NBNA 3PGCA 3T2PA 1S7VA 2DQGL 2FB4H 2VABA 4NKOB 4U1HB 1JF6A 4UDTA 1T83C 4WRLA 5F1KC 4OGAC 4RDQG 5DYOA 4JVWA 3V0VA 2FZ3A 1TITA 2YXFA 4ZUTB 4DGVH 4F3FA 4X7FC 5LGJB 3P11H 5ETUB 5IHUH 2E7BA 1U42A 5LXGH 5E6ZA 1R0AH 3RHWK 4JHBA 5KSUA 4R97B 4M93B 3KPRA 2WUBL 3T0XA 1CL7L 2CD0A 4X6CB 2DQIL 4MHHI 4S1DD 4R7DB 5CEYB 2YUZA 4HMEA 4U6XB 3RGVC 4QXTB 5L2JB 1K3IA 1I7RB 5E9DB 1RU9L 2OZ4H 2VL5B 2VZUA 2UY7A 2ED7A 1S5HA 2QEJA 1E4KC 5HY9A 3VFPA 4TVPH 4Z78A 1MAJA 1BFVL 1RJYA 4XP6H 4YXKL 2V17H 3W5MA 3GKWL 4G80A 5EC2A 4KRPB 2XZQL 3GMQB 4X6CF 2XACC 4H25A 4EDXB 5HHOA 3VD9A 5I8EB 5I15L 3HAEG 1KJ3H 1MY5A 4OKVB 5EBLA 3CK0L 3QXUA 5TE6H 1R3JA 4FFWD 4RZCA 4HUWA 3OXSB 2PCPB 4OSUH 1NJ9B 2ERJB 4ZS6D 4JN2A 3WIHA 3O3BA 3AROA 4ZQKB 3FQWB 2YN5A 4S1RL 3CUPB 3BHBA 5IHLB 4U1NA 5CWSB 3TPUB 2XQBL 1G9ML 2DDQH 5CBAB 2F53B 3RKDC 4M1GH 1JPSL 1KN4H 2NY2B 4W81A 4DW2L 5MENE 3FB7B 3FONB 5DHYB 2VOTA 4XP9H 2R56L 3B6SB 2FHFA 4OJFH 1U92A 1ZSDA 1UEMA 2RJMA 5DFWH 5FO9A 2E9WA 1NCAL 1TQCB 3W9DB 3HPLA 3SJVA 2NYYC 4OLXH 1Q0XH 4Y88A 1T21A 5KVFH 1MFDH 3LKRB 5F3HB 2Q86B 3REWA 5C1MB 5ITFB 1PEWA 5IHZB 1RZJH 3EDFA 1PW3A 2HVKA 5EC1A 4P2OD 5BRZD 4UQ3A 2GSGB 1YDPA 3RWEA 3BIAX 1YUHA 1CCZA 3W0WD 5BS0A 1YYML 4D2NA 4NZTL 1IZJA 1F6FB 3ULUD 1RZKC 4LVOB 3IFLL 4MJID 1KG0A 3BEWA 1NEZB 1EPFA 4L4VE 3C2AH 4P5TC 4NT6B 2Z35A 4H8WL 5CBEA 4JM2D 3UZQA 5B3JF 5D2NE 5JW5B 1CGUA 3V0WL 1MFAL 4JKLA 4DEPB 2WP3O 1EJOL 4NO0A 1C5CL 4JFFA 4FS0A 4LU5H 3B3IB 3R06B 5JXAH 5J8OA 3K46A 2OXGA 2QSCL 5IBLD 1TZHA 3KPPA 5C9JA 3GIZH 3KWWA 5BVPH 1X6LA 1FNFA 3MROB 4H20H 1R5WB 4F33A 4LLWA 5C0CB 4S1QL 4Q9QH 1U0QA 2BVQB 3EJZC 1WICA 3TIEB 4CRPA 5I6XB 4BELD 4LL9A 4Y19A 3PDOA 3GMLB 2Z4QB 3HRPA 1OF2A 1E4WL 4ISVB 4UZGA 3ECBA 5I8KH 4PGCB 3SQOL 3GHEH 3AVEA 4JDVA 4OZ4A 4JKWA 1A3LH 3QCTH 4HBCL 2ZUTA 4N68A 4FXLA 4Q6YA 4LQFH 5CGMA 4OQTL 3QO0B 5LAXB 3LKPB 3V6OC 3QEUA 3VXTA 3WKNA 3UTQA 1PY4A 1Q9LA 2BNRA 4ZO8A 2DQDH 1HSAA 4X6DA 3HI5L 3DSFL 4OD1H 3TBVB 2VZOA 5C7XL 4M7LH 1C5BH 1K4CA 4XCNB 3VW3H 1IAKA 5IFJA 1DVFB 1FFOA 1HXYA 1V3JA 2Y06H 3D18B 3KPRD 4XRCB 3JWOC 4MVBC 1CGTA 1A22B 2NNAA 1L4IA 4X7TB 3C60B 4K55A 3KLSA 4DAGH 4U3CA 4X4XB 4XPBL 4GW4A 5SV3A 4QGYA 3G04A 4KRMB 3V4VH 5FB8A 4W4OA 4PJ9B 1EFXA 4KMTH 2OR7A 2B5IB 4OB5L 1AKJD 3F6LA 3B2VL 3CFCH 4FN0A 4BSWB 3IDNA 4WGWB 1X7QA 4QRPA 1T6WA 1EAPA 1F2XK 1OTTC 5EBMB 4LCYA 1IC1A 3QIBB 1EVUA 5HHOD 1SVZA 1EEUA 3ETBF 5DQDL 1T3FA 4WVRA 1Z9MA 4B7LA 5HSFA 4HF5L 1RZJC 3UO1H 1FHGA 1L0YA 5FYKE 43CAB 5FECB 2B8OT 2EDQA 3QP3A 3L3GA 2NY5H 4RAUB 3CDGB 1MFEH 2NY3B 4Q9RH 1T2JA 3MLYH 3FQXB 5DC9B 3KPRE 5IM7A 3RPIA 4GBXA 4HS3A 2YHGA 5K33A 1R3KB 1B0GA 4MNGA 1XF3A 1CG9A 1Y6MR 5LKNA 4IDJH 5C86A 2J5LB 3VU2A 2KDGA 3VXUA 5IF0B 3LD8C 3QUXC 3NGBB 3LKSA 4N9GB 1Q9KB 4TUJA 5EIVA 4KDTA 2YA1A 1TJHL 5IHBA 4LQ1A 1P1ZB 4NCC1 2X4NB 3LEXB 1GPOL 5GS1B 4V1DB 1S7QA 3ROLA 3V2AR 1JPGA 4RFNC 1CBVH 5E5RB 1NCDL 4NRYA 4NC1E 1QHOA 1F8TL 2C3VA 3SJVD 3VDCA 4K3DL 3OBAA 1OP3K 3ARWA 1KJVA 1JRHL 1F4HA 2MQCA 2F15A 5KVMC 3OG4B 4FQLH 3MUGA 1U3ZA 1IAIM 1UB5B 4DN3L 4MJ6A 3HAEA 3AB0C 5BS0D 3GMPA 4GRWH 2VB5A 1I75A 4R4BA 1OAUL 2AQ3A 4TSBL 3VFWA 3CFKB 4ZPVB 2H2PD 5DJ2A 4TPRL 1NQBA 4ODSH 3OHXB 3STZA 3T2QA 1M7DB 1CFQA 4EN3B 5CIPA 4Q2ZB 4I1NB 1S7UB 3FRUB 1FVDA 3VXQB 3GMMA 5EU4A 3DXAA 2Y6SC 1WZLA 4KV5E 4NO0D 4JFFD 4Y5YA 4JZOB 2JB6B 2YUWA 4J8RA 2XYCA 3RFZC 1KJ2H 3RWIA 2WWKT 1YY8A 3ILPB 2Y25A 1NSNH 5CS7A 4DN4H 1IKNA 1F4XH 2B2XH 1S9VB 4X5XA 1F58H 4KKBC 4OFVA 3QEQB 4L3EA 2W91A 1R5IA 3BUTA 5JHLL 3A67H 5IGXH 2GJ6E 3D25B 5FYKU 2IFFH 1MCPL 3C6LC 4WFHE 3WDHA 4Y19D 5J56B 3PDDA 1GZQA 2VWEE 1EBAA 2Z8RA 3RY6A 1MCEA 2NY0C 1FSKB 1RUMH 3HR6A 3X3GH 3KYMB 1TETH 1AHWB 1G7LB 2X10A 3ARQA 4M7LT 2BFVH 1MIMH 2WNGA 4M6AA 1LK2A 3QI9C 5H94B 4ZUSA 1CICB 1S7SB 3NCJH 3D69B 5ISZE 4LNRA 4ODWB 2EE3A 1KBGL 1Z6JT 3VFGH 4EXPX 4LSTL 4KK5D 4L8BB 4EEEA 2BNRD 2DBLL 4I77H 2G75B 1OM3H 1YEGH 4JPIA 1TZIB 1A6PA 2I26N 1MRFL 1FZMA 3OPZL 1FZOB 1J1OH 5TPWL 5FUCC 5E2VH 4FFVC 3SE9H 4GW5A 4YLQT 3P4OA 4C83B 4F7CA 3VXRA 5JZ7C 1I8MB 4RWHA 3RTQB 3GSNL 2WUCL 1K5NB 3NABL 4PB9L 35C8L 1P4BL 2XKNA 1EFXD 4JZNB 4MS8D 5EIIB 3ROOB 1OTSC 3QUMH 3PWPE 5CSZB 3B2UC 3QNYA 3FOLA 4L8SA 1OAYH 1T1XB 1G6VK 2ADJA 1JI2A 2FO1A 4XNXH 4QRPD 1J0HA 5F8RC 4RFOL 2P46B 4RMSA 2AJYH 5DQJA 3N0PB 1A4KA 5ILTL 1EEYA 3U4EA 4X6BA 4XBPB 4HZAA 1DE4B 1QYGH 1L7TH 5KBNC 1MCCA 5E5MA 1JHTA 1OP9A 3M8OH 1IGFH 4LCCB 4P0DA 5J12C 3UPRA 3ARGC 3LRGA 1XGTB 2V9QA 5CGYC 3VGAC 1UGNA 4XWGL 3GMRA 2HN7B 1I7ZA 5DZLA 3RRQA 3C09C 4F57H 2L7JA 5KTEH 2I9TB 1DQLH 1G6RB 1KYOK 4GBXD 1FO0B 2VRAA 3G6JE 4DVBB 3VI3F 3SE3C 3VXUD 4G9FB 4PRDA 3TJHD 4AENB 1SBSL 5FUZL 3S6CA 1T66D 1E6OH 2GAZB 5J6GA 1IZKA 1VPOL 1LO2H 2LU7A 1RJLA 4WUUE 1J8HB 2QADD 3EYOB 4S2SB 3RZCC 4YK4C 5I66A 3IDUA 5KSAA 5D8JH 1DQDH 4Z7VB 4CMMB 2YUXA 1I8LA 2BC4B 2OK0L 3MLTA 3I6GB 3VFNA 1HOCA 3LN9A 4JGMA 4MA3B 3PL6C 1EO8H 2C7UB 1IBGL 3OAUH 2E6QA 1HQ4A 1PZ5B 5DT1L 4XGZA 5D70L 5HI5D 4P46C 2P1YA 3RWCB 2MCPL 3ZDYE 1GC1H 5IMMA 3CFIC 4NZDA 4OCWL 3TWCL 4Z7WF 1EFQA 4BH7B 1JWUA 1N2RB 1NCUA 3Q1SL 3L3DA 4JPKL 1D6EA 4ODUA 5D72L 4YDKH 3HNTH 1LO5A 1MH5A 2GK0A 4QXGH 2AQ2A 3WL9B 1UZ6E 1MFCH 4PS4H 4F7TB 1A7OL 3MJ8A 4K7FB 2E8ZA 4YR6A 4YZFF 5IBUG 3DXAD 1BIIA 1U91B 2AXGB 4MB3A 2F5BH 3RBSA 3RNKA 5HD8C 1JHKL 5J3HD 1D6VH 1AGBA 2NXYC 4Y4HC 4ENEC 1GGYA 4NN7B 4BFIB 4QO1A 4AQOA 5HYJB 3FB5B 4Q0XH 3VWKC 2P5WB 3R0MA 4JB9L 2R2BB 5JORA 3NCEB 2RHEA 3K4DA 4N0YH 1VEOA 1NGQL 4C56E 4L8CB 5GRVK 2C9AA 4PJAB 1MCNA 3O3DB 1UACL 1BOYA 4KUZH 3H9SA 3VCLB 2A6IB 4AIOA 4QOKB 4PJHA 1CE6A 1CFTB 3UPCA 5IEHB 4ONOA 1F00I 1XR8B 4ZOEA 1DQQB 1YNKH 5D7KD 1RVFL 2GSIB 1TNNA 2DTMH 4JRXB 4UT6H 4XC3H 3L1OH 3RUGF 3LEVH 4S11A 1WC7A 4G42B 4P49A 3SDYH 3DWTA 1MWAB 2WINA 4B53A 1B0RB 3MGTB 2D7MA 1LE9A 1A21A 2F8VA 1OW0A 3DXAE 1QFWL 3BIKB 2V5MA 3GMOB 2DLFH 1HILB 3NACL 4PLJC 3ULVE 3U0PB 3WN5A 3H3PH 4YGVB 2AK1H 5D5MA 3VRJA 2BNUB 1Q9OA 3AMLA 5EBWA 3VI4F 2W65B 5INCA 5LCVH 1WWCA 5ALCL 5E8NB 2C1OA 3TVMC 1OAKH 2EDWA 2QQNL 4DZBA 3O2WH 5KAQG 1LP9B 3MUY1 4L3EE 2YD6A 4OF8A 3H2WA 5B39G 3U4AA 5K9KB 3QAZC 3VXRD 2K9UA 1IGML 3JV0A 2VAAB 2YRLA 4U1GB 2ZJSL 4Z7OF 1PYWB 5EOQH 2DLEA 1T7WA 3B9DA 4LIQE 4OLZL 4RGNB 1SJEA 3VFUB 1QVOA 1ZLUH 4PB0L 1T89A 4YDIH 4NDMA 4O02H 1MY7A 1BWWA 1LP9F 3EO9H 3NAAH 5I0ZA 1UKTA 1WV7T 1A1MA 3U46A 5JW4Q 3DROB 3MUJA 5FYKH 5JOFB 3ZT6A 4FFYL 1FORL 3EJYC 4R96A 2OI9B 1T1ZA 2BY3A 4BH8A 4F2MB 5DMJB 5MEQA 2MOVA 5BXFB 5MI0B 2VXUL 1GC1C 4JRWA 3ARBD 5E99H 3SOBH 1IKFH 1DQJA 1RUPH 3E6FA 4I9WE 5DK2A 5DJDA 1XF4B 5D2NC 5IMLA 4D8PA 4E5XA 1ZHKA 2EDJA 1N5AB 4NNXB 3VXRE 1E4XH 2OCFD 3FAXA 3L7EA 3P73A 1FPTH 3JBG7 3LKNA 1AQDA 2FJHB 3PWUA 4YUEH 3VFMA 3TYFB 3K2UL 3DO7B 3OAZK 3FB6A 5EDXA 1UM4H 2IQAB 5KSAD 3K81A 5GGTH 4WDIA 5D7IF 5SWZB 3VXSA 4EJ1C 2BVYA 2V7NA 5GS0H 1RZ8A 2YD9A 3VXOA 3O4LD 5DVOA 3LOWA 3SKNB 4BYHA 1IGIH 12E8H 5C6TL 1OSZB 3SKJL 4NKMA 1X4ZA 3BZEB 4LP4A 1FRGL 4QRTA 2JF1A 5A16B 3PNWB 2XWJB 1TCRA 5C08E 3IYLW 1K2DA 4XBGA 1AO7E 4GKNB 4IOFC 2Q7YB 2WBJB 4JM2C 3WHXA 2DD8L 5J57B 8CGTA 2DQEH 3QIWC 4D0CA 3O0RL 3TBYA 4KXZI 1KCKA 2YK1L 3MRDA 3BN3B 3MJGX 2I60H 4DUXA 1B4JL 4N0UA 5I8CB 3IVKB 1M7IA 1I4FA 1N7ML 2GQHA 3G5ZB 4OQTA 1ZA3B 4I2XE 1KENL 4PRPA 3WBDA 1P6FA 2WW8A 2J8OA 3S36L 2VERN 3WFHA 4PJ5E 5EZOL 1CLOH 4AM0A 1MF2H 3U6RA 5CD3A 4HWZA 1V3MA 1XGUB 3DO3A 4YEFA 4NPYA 3WMSA 4JAMB 2IH3B 1CTNA 3QPXH 4NGHL 3A0OA 3TT1L 5IROA 5FKAB 5EZIL 1T20A 3TNMA 3WKML 3H9SD 1ACYL 1U9KA 4WTZG 1FLRL 4AG4L 2HTLC 3QDHA 4YHIA 2XPGA 3EDJA 4ODXA 4PRIA 1KFAL 1ODAA 1MPAH 5I1GL 3PV6A 2RR3A 1IGJB 5C0DA 2OL3B 4M8QA 4R2GD 4P9ML 1BFSA 4XTRD 3G5XA 1V3KA 5EUOB 3ELAT 1BIHA 1LQSR 2KBGA 1JTPA 1IM3B 2R2HB 2FH8A 1PQZA 4I3RL 3X11B 2DQJL 4ELME 3MRLA 4PJEB 2VIRB 4I0KA 4PUBL 1BGXL 2C3XA 2A74A 1EJ6A 2O5YL 5I30L 1UXWA 5T1KB 5GZNC 3RGVB 4QRRB 3OKMA 5EUOF 4GKZA 2VDOL 3T1WA 1BLNA 3S98A 1NUFA 2PKDA 5B4MC 3B43A 5C2BH 5K9QI 1X5GA 4NZJA 4PJEF 2EDBA 2RAMA 3DGCR 1CT8B 4Q6IA 4ONFL 3GZKA 2DMKA 2KZWA 3HNSH 2P44B 4B5EA 4NC1C 1B2WL 2IANE 3TYGL 3FN0L 3IAPA 4LEXH 5E4IA 1XH3A 5M94B 4R26L 2BDNH 4KJPC 2D7OA 4XPHH 5F7NC 4HV8A 3V4UL 4MXVE 1LDPH 2GFBA 1KTKE 3LN5A 4YGAB 1KCRH 4DGIH 5FKPA 1CFNA 1PBYA 1BMGA 5HPMA 2Z31A 4K9EL 4JG0L 1CDJA 4PV9B 1RUAL 3BH8A 3TO4C 4APQA 3D85D 3JV6B 1FL5A 2BCKB 4HUNB 1ZANH 1UXSA 3B5HA 3DVNA 1CLZH 1DSFL 3C5ZA 4N0CC 4L9LA 3NIDF 5FYLE 1JPTL 4FXGB 1UVQA 3MZGB 1S7TB 1MSPA 5GRVL 4PJXE 1NH6A 4L29B 4HLZG 5D1XD 1K8DB 1IQDA 2XRAL 5AG8A 4F37K 4S1SH 1LGVA 3MR9A 4ZFFB 5B39A 1A9EB 3W11D 5CEXB 5DJ6A 2J1KA 4PG9B 3MRQA 2IBBA 5HHMB 4GLRI 1M7XA 3TA3A 3E8UH 1YEFL 3VXSD 1RJZB 2YC1B 1H0DB 1OAXL 2PETA 3GJEB 5DUPL 1JGUH 2Y4SA 5FM4A 2ZZUT 2A83A 3VFVA 4NZUH 5KVDH 2VWEC 2PYEB 1IC7L 4H1LH 5FHBL 4H88H 4WFEE 3WFBH 3I6LE 1A0QH 4Y4KA 1V7MH 4CVZB 3BESR 2Z8SA 2UYLB 1BBDH 1YQVL 1JPFA 4PJDB 5TFSL 1X5IA 4JFQA 2ATPA 3IT8D 3Q48A 4GRLC 1ERNA 1I8KB 2YEZA 3KPMA 5D96C 5AZ2H 5A2LH 5L7XL 4FZEL 1I1FA 2I5YL 3SGDI 5T3XH 1LEKA 2VXQL 5GRJH 5EOCL 4P5TB 1AGDA 5CJXC 4KZEL 5C09A 4WW2B 1INQB 3IDIA 1G6RL 1FO0L 3HE7C 4HPYL 1A6TA 4HUUA 4H0IA 4XI5D 4LHUG 3SPVB 2AJVH 1WBYA 1E27B 5KS9A 2YKLL 3DUUB 2K1MA 1YMHB 2VQTA 4PJDF 4FQ1H 1S3KL 4I18B 4JQVA 4J3SA 2ITCA 2MFNA 3CZFA 4LF3A 1CXFA 2QQQA 2BMKA 1IEBA 4HKJA 2P8MA 2E7LA 4PD4J 1F3RB 2VQUA 5EWIL 5TDPB 1XF2A 1WTGT 4P5MA 2Q3ZA 4TSAH 2Z91B 3MACH 1S5IH 3ZDXE 5DTFB 1U8KB 5ACMA 4CU6A 4NQCE 1VGKA 3HB3C 1CWVA 3GSNA 4LRIC 2GW5A 4LASL 2AJSH 1MQKL 5L2KA 1I1RA 3T8XB 3C5JA 3GI8H 2YD8A 5CP7B 3DVGA 4KJYA 4YQXH 3EOTH 3V79C 3NIFF 4LPXA 4CU7A 3T65B 3G6DH 3GJFK 4LLMB 3ULVH 5LG1A 1DBMH 1I1CA 2J3SA 5GIRB 1J10A 1A3RH 3VXNA 1ZK9A 3RZWA 2FX9H 4JQXC 1TJGL 4FQXC 4PRPE 2EC9T 3EW3B 3N1QC 1KPUA 1KCLA 3PHOA 3TIDA 4N8VB 3MGOA 1S8DA 4HXBH 5DD0H 4KVNL 3DECA 3D9AL 3BPCB 4M61B 4NKOA 4U1HA 2LTQC 4YPJA 3S35H 2DJUA 1N6UA 5IFAH 3TESA 1CLYH 3WIFB 3GKZA 4ZUTA 2W0KA 5DDHB 4W4OC 5EG6C 1FVCB 1QBMH 4MS8C 1GGUA 4OF6A 5ANME 2N7BA 4AEFA 2A6JB 4M00A 1A7BA 2GEEA 4J2XA 3QISA 1JNNL 1PD6A 3KG5A 4XNMB 3U9PH 3QHZH 5AZEL 4LIQH 3MOAL 3Q2CA 5I1EH 4KHTL 1U58B 4X6CA 1MJ8H 1RK1A 3PHQB 4KI5E 1CDIA 5L2JA 5DMIH 2OTUA 4PRIE 1DCLA 3QDMA 1JZ7A 3FHAA 4M6NH 4RRPG 5E9DA 2AXFA 4FP8H 4NQVB 4IJ3C 4WTZA 4OZGB 2X4QA 3EAKA 1M1SA 4KRNA 4HK0B 4XMPH 1RD6A 3QQ3A 3VGBA 5E08H 3WNPA 2MSPA 2ZG2A 3NMEA 4OFPA 4QYOB 1PFCA 4MLIA 1R24B 1FG2A 1FE8L 1KELH 1MFNA 3N06B 3EYUL 4IRZH 4PP1D 2PO6B 4EDXA 3KPTA 2Z31D 3NCYS 3OKKB 2VKXA 4NCDA 1WVZA 1CF8L 3BVNB 4APQD 2MMXA 1U8QA 3CMGA 1MLBB 1UZ8B 4IRSC 4YDVA 3C5ZD 5GJSH 2Q8AH 3RAJH 4TSCH 5IMOA 3I50L 3BKML 3LD8B 3QUXB 2QADC 4HJGB 3BKYH 1ZGLP 1RZGA 1GOHA 2AEQL 4ZQKA 3FQWA 1MVUA 2HYMA 4M1DH 3ZE0F 1UWEL 1KIPB 1CK0H 2D4FA 3TPUA 2LAAA 3O6LH 1SYVB 1QFOA 4DK6A 1RZFH 1YJDL 4RFNB 2BXZA 1YZZA 5E8DH 4JRYE 3TA3D 2B4CC 1LILA 3QUYC 4JO2H 3D3VE 4X80H 2AABL 1B0WA 2VH5H 5KN5B 1KIQA 3CNKA 5L6YL 3GK8H 1CXHA 4MAUL 1F4YL 1A5FL 4NIKB 4Y89A 3AB0B 3MV9E 1TMCB 3S35X 1W0WB 3LKRA 5F3HA 4P2QD 1UADC 4Y8AA 2EXYD 5ICYA 5DWUL 4NO3B 2X4RB 3QZWG 1NAKL 5CSGA 3S88L 4HFWA 4JFXB 5C09D 3CD4A 4Y5YC 1ZKAA 3WHE1 3ZT5A 5TGBB 3ULVC 4JHAL 4XCYB 5L8LB 3EO0B 2CUIA 3OKYA 4Z18A 1FGVH 3F5WB 2EZ0D 1WEJH 3I85A 1ADQL 1WZ1L 2DWEA 4KTDH 1IKNC 1RZIB 5JW5A 4GKSB 3NA9L 1YY9D 3FJTA 2ZUVA 2QSTA 1PG7L 1PX4A 3LMJH 1AC6A 2PW1B 1FFPB 1XZ0B 3AXLA 4LCIH 1I3GL 2VZSA 3R06A 3X14B 2XKSA 1T5WA 4D9QD 4TNVF 1KEML 3T3PF 3O9WB 1UCTA 5F89A 1HIMH 2OTWB 3EZ8A 3C6LB 1IGCL 5C0CA 4X6FB 4LLDA 4LLUB 2F9BT 3U1SL 3C9NB 4DKFL 3HNVH 3FZUD 2VR9A 1KCVH 1ZGLM 5FO8A 1IARB 3HMXH 1MCDA 2JJSC 3TIEA 2NX5D 4IMKA 3QI9B 1QFHA 4G6AD 1HDMA 3ARVA 4YDJA 3DMMA 4JPWH 4UNVA 3CXDL 5L2KD 5DZOA 1WT5A 1NCCL 4P57B 1BZ7B 4ISVA 5ADOL 1VKXB 4KTEL 4DOHE 5GZOC 2OM5A 5SWSA 5JOEA 1FYHB 3CLEH 1DLFH 2ZCKH 1T2QH 2AK4E 1FH5H 3VFRA 1EZVY 5L9DH 4EOWH 3QWOB 2A77H 3QO0A 5LAXA 3LKPA 3WCYA 3FT3A 1UENA 4LHUA 4DQOH 4FTVE 4GSDH 4KKAD 2YPVH 4XP1H 1IQWH 3ES6B 4KKLD 1B90A 1DUYB 2XFXB 5IV2A 2Q76B 3RIFF 3TBVA 1CIDA 4D9QE 2EYSB 3L3JB 4OKDA 4PP2B 5JA9A 1T6VN 2AP2A 3VG9C 4JREC 5FA4B 1JNJA 4LDEB 3X17A 1KLFA 4KK6C 4YHLL 3RY5A 4XRCA 1T7ZA 2A9NH 3LS5H 1WIUA 3H7BA 3SDAB 1CDCA 4KK8C 2QR0A 4G9DB 3QDMD 4WUKL 5KSVB 5EU7E 5E9DD 4QHLA 4OGXL 4PJ9A 3S97C 3H8NA 4AL8L 1RHHB 2R39A 5CAYB 2PTTB 3GBNH 3IJYB 4W6YB 1GAFL 4DFIA 3H3KA 5J12B 3VWJA 5GHWL 5IR1B 4NUJA 4D9RD 1A7QH 3ARGB 4O2FB 4YNYA 5EBMA 3LKOA 2DM4A 4QHNB 1D3CA 2YBRA 2CLVA 2J4WL 3U48A 2P47B 5FYLH 3DV4B 3T0EE 1OPGH 2R1YB 1MAMH 3GB7B 2BOBB 4JY5L 2XY1A 4Z5RB 1NGYB 43CAA 2CR3A 5FECA 5IWLA 1JZ5A 1KULA 4RAUA 1C08A 5GRXG 4JGJA 3VJ6A 2A6DB 2YD7A 1N0XH 4U1MB 4U7SA 2LABA 1AFVL 3MOBH 4W70A 5KSAC 3IDYC 1MHPH 4UTAH 5DJAB 4WJ5A 5I76B 4GRWF 4LHJB 1MIEH 1D9KB 4I0PC 2D7TL 5E6YA 1ORQB 3NH7L 4NKIL 3QNXA 4JDZA 4F9LA 1Z9OA 1IJ9A 1Q9KA 4BSVA 3NZHH 3QDJE 5J9PB 5JHDA 4FMKA 5TH2A 1DBKL 2BZDA 3PL6B 4RRPA 2XWBA 1AR1D 1QSFB 4R7NB 4Y5VA 5GS1A 2Y7QB 2B1AL 1FGNH 4N0FB 1YEHH 5DEZA 1KNOB 3MLVL 5D7SH 3TBSA 1NLBL 1REIA 2NPLX 5HHVH 2AJXL 3BFOA 3LQMA 1FNAA 2HRLA 4QNPF 1I1AC 4KQ3H 2OLDA 1LO3H 3LEYH 3RWJA 3Q0HA 3QCUH 2I9LA 3O8XA 1ZTXL 1X4YA 1UB5A 4YE4H 2DAVA 1JNLH 3RU8L 4Q97A 5E56A 3VH8G 2ESVE 4N90D 5GGUB 3BWUC 4MSWB 4F7PA 5CUSH 3S96B 3UJIL 1AE6H 1N64L 1DBJH 1RMFH 3OHXA 1H3XA 1TVBA 4EN3A 2NXYB 4Y4HB 1N5YL 4L3CB 4G8GE 1UJTA 5FA3A 5F7EH 1GHFH 4PTUB 3X12B 5IB5A 1KTLA 4YWGL 3TGXA 3VWKB 4OV5B 2FLBT 1HHJA 5IB1B 4F15C 4JZOA 5IB4B 2OQJB 1Q0YL 4KVCH 3IS1X 1TTFA 1ND0A 1S9VA 2VZ1A 5C0CD 4LEOB 4UQ2B 1CD9B 3JV4A 1WQVT 2ICEA 4LSUL 5FYJL 5ERWA 4PV8B 1AXSB 2DQHH 1RZKL 2HJFB 2J7LA 3DMMD 4HIXH 2JELL 1WWAX 4DKEH 1A6AA 1YMMA 3P4NB 2RFXA 3KYMA 1AHWA 3EFDL 3LN4B 5CD5C 5SWSD 3QZWA 4HMCA 5HHXH 4WI9A 4WNQB 3VXMA 4MQXC 4HCRH 1DN0A 3D69A 2FB4L 3C8KB 2J2ZA 3RWDB 1QEWA 3X13B 5MHSD 1HYSD 4LHUD 2FWOB 1N8ZB 4DGVL 2IH1B 1RQ5A 5D2LE 3TVMB 4L8BA 5HYSG 2W07A 3P11L 1G9NH 4MNHB 1RIHH 5IHUL 2G75A 4EBQH 1VACB 4XNYL 1FZOA 3UBXI 1I85A 4XVJH 4WHTB 2ZUQC 4GG6B 1OD7A 3C60D 3WFEH 1JTOA 2VLJE 1EHXA 1XIWC 1CN4A 3HHRB 4TVPL 4LHQB 4TNWK 1KGCD 2BRRH 2XZCH 4XHQA 4CMHC 2H6PA 4XP6L 1FIGH 3P0VH 5GGSB 3M1BA 2OR9L 4PJ9D 4KUCF 5KJRH 1Z3GH 4UDUB 4ZD3L 1ES0B 3ZKND 5JLZB 5CSZA 5ESVB 1T1XA 2DBJA 3GRWH 2ZOLB 2D0GA 5D6DC 2KL6A 4AIZB 2AQ1A 5I1DB 4KFZC 4G7YL 2V9TA 3VWJD 4XBPA 4UMGA 1DE4A 3CVHB 5TE6L 5DQ9B 5CEZE 1J88A 4L4VB 5TQ0H 4OSUL 4LCCA 4KXZH 1FNEB 8FABB 1YNTA 5BJTA 4O4YH 3MLZL 1EGJH 4H8WC 1CIUA 4WGVB 3AY4C 2P5EE 1UWXH 1G7QB 4OCXH 4MDIA 1A14L 3GSOA 3JWOL 3PWVB 2I25N 2F54E 2NY3D 3FO0H 5F93C 2I9TA 4M48L 2FHBA 1G6RA 2DDQL 1FO0A 4BZ1L 4M1GL 4YPGB 1KN4L 1FNHA 3RWGB 5F1NA 1LE5B 2IPUK 3CFEA 3MGAA 3MRPA 3MO1B 3V5KB 5F9OH 1ITCA 4K71B 4Q58C 1T1YB 3I3BA 4XHJD 1AY1H 4AENA 5FV1L 5DRZB 2GAZA 5BRZB 3CDFA 1ZA6B 5IB2A 5JHDD 1J8HA 2HFTA 4HIEA 4S2SA 3W0WB 4Z7WA 3CU7A 3AFLA 2WIMA 2P8LA 4YJZL 1Q0XL 4V1DD 3HE6A 3RX5A 3G9AB 1MFDL 2CRYA 5C8JB 3EYQC 1RZJL 4MA3A 1FJ1B 4JM2B 3UCRA 4HJ0C 1PLGH 3ZMRA 3MXVH 2C7UA 3OKDB 3TFKD 5EN2B 2X1OA 3FKUS 3QIWB 2ZUUA 5I1AB 5C0ND 5I74B 3O8XD 3HI6H 2O5XH 1A2YA 1UCBL 1VEPA 2W0PA 5F3BB 2F74B 3UAJD 4DFHA 2KKQA 4LGRB 1AD9A 3VRIB 3C2AL 4HFUH 4XXDA 5C6WH 4OT1H 4N5EC 3QXDB 2V9RA 3D0LB 3FCTB 3QHFH 5I71C 3EDEA 4EN3D 3T0DA 1KIRA 4F7TA 1XMWA 4U7KA 2D9CA 4LVHB 2R0WH 4GAYA 4J3OC 3ORJA 5ID1A 3QA3A 5JXAL 3FB8A 1PKQA 1U91A 5IROC 3WDJA 1QP1A 2R0ZH 2DWDA 3GIZL 3QQNA 1BQSA 3QFDA 5BVPL 5ACZB 4PGJA 3KPSE 5IK3B 1BQHG 4POZC 3EOYG 4BFIA 3BUYA 2VZTA 2YR3A 4YX2L 5HYJA 4KI5C 4DCQB 2P5WA 3O2VL 2Y36H 3D39E 1LNUA 3RUGA 3OV6A 4OD3H 3DJ9A 2IF7A 4J1UA 4MCZB 4MQ7B 3FQRA 2BRQA 1TJIH 2PNDA 4ZUVA 3O3DA 2NY6D 3PGCB 1S7VB 5I8KL 4K07A 2E6PA 5JA8B 3GHEL 4QKXB 4UDTB 3VCLA 1JYNA 4J3XA 5DYOB 3V0VB 4TULL 2FZ3B 5IEHA 5C0AE 3QCTL 1YMMD 4PJCA 5HGDA 4F3FB 4IDLA 1DQQA 2HRPL 4L1HA 4LQFL 3L3IA 2EH7H 3BPNB 4JRXA 4ZUUB 3F7QA 3VXMD 5KSUB 1VGEL 2BVPA 3KPRB 4HG4K 2G60L 4OCMC 3VH8A 2A6KB 5FGCE 4R0LA 4PJ7E 1H8SA 4Z95H 3RQ3A 3GMOA 1C5BL 3VW3L 3J7HA 2XZZA 4KKCC 1UJ3C 1S5HB 2ZSVA 4YGVA 4X6EA 1T03H 1JGLH 4I4WA 5AYQA 4Z78B 5IKCA 1RJYB 3HZMB 3UC0L 3HZKB 4LAQH 4OV6F 2ARWA 4TN9A 5EC2B 4DAGL 4OIBA 4E41A 3S34L 1LP9A 2N56A 3JVGA 3RA7L 1A6UL 3UYPA 4H25B 3V4VL 3W5NA 4GLRH 4UNUA 5EBLB 4X98A 4C55A 2VAAA 4I3SH 3PQYA 1R3JB 4PP1C 2R69H 3TO2A 2DL9A 4JN2B 3T0BA 5JW4N 1ZS8A 1PDKA 2LU3A 4RMRA 4ODTH 1XGYH 3TO4B 4MNQA 1MFBH 1KT2A 1AGEA 5JOFA 2MTPA 3BHBB 4NJAH 2NY5L 1MFEL 4Q9RL 3MLYL 4WI2A 3IRZA 3VXPA 4Z76B 5GRYA 3EO1A 5DC0A 2OJZH 3MLUH 1G0DA 4MB5A 1U92B 5HYSA 1ZSDB 1WSST 2H1PH 1XF4A 5FO9B 5D7IA 5DS8B 4P5KA 3DTXA 3LDBC 2EIZB 3PIQB 1JMXA 3HPLB 3SJVB 1OARH 5FV2A 1T21B 3OR7A 2IBGA 2QSQA 3REWB 3R8QA 2FYYA 4PRHA 5DFTA 3CMOH 1XEDA 5IQ7H 2HVKB 4ZYKA 4OZIA 1B3JA 2WWMD 4KV5F 1YDPB 4MZ3A 4TTDD 4Y4KC 3RWEB 2A0LD 1CBVL 1J8HD 1YUHB 5BS0B 1IAIH 2VDNH 3HRZA 1AGCA 1U8HB 4OTXH 3HE6D 5EB9A 1KG0B 1ORSA 3BEWB 3SKNA 2D4DA 5C0GA 4QF1B 4GRLB 5CBEB 3BD4A 5ISZB 4DKDC 1OCWH 4LARH 2W0FB 2M1KA 5CINL 4JY4B 2XWJA 5DD5H 1ZLUK 2KH2B 4NQSB 1K4DA 3C2SA 3HE7B 3MUHL 4ODSL 4JO4H 1YY9C 4JQVC 1N6QH 3KPPB 4J6RH 5C9JB 3KWWB 2HFFA 3JUZA 4F33B 3PG2A 1ZAGA 4N8VG 2EECA 3J8F7 5I8CA 3IVKA 4Z0XA 1KJ2L 4D94A 4CKVX 4OFKA 5I19H 1HN1A 2CIIB 1NSNL 5E2UH 1JZ4A 4U1KB 4DN4L 5C6PB 4JFDA 2B2XL 4I8DA 4U1IA 3ECBB 1JHLH 1QG3A 1F58L 2NCMA 1MHHA 4HUXA 4XAKE 5C3TA 3PWPB 4JDVB 5JXEA 1HK6A 4NYLA 1RUKH 1RPQA 5HYJD 2P5WD 4G6AC 1NCNA 5EU7C 3A67L 1GGCH 4JAMA 5IGXL 2IFFL 3G5YA 1JF5A 5FKAA 1RUML 3VXTB 3X3GL 4XP4H 5CILH 1TETL 2XN9E 1EMTH 1A9BA 1HSAB 4X6DB 1JRHI 2BFVL 4QOKD 1TDQA 2EEAA 4GXUM 2OS7A 4OI9A 3SGKC 3UTTE 1FYTE 5GQBA 1K4CB 2IG2H 3MJ9H 1FDLH 4FQXB 1IGJA 4JRXD 4KKAC 5IFJB 1QBLL 3T0EC 5JPMA 4OLEA 1UH2A 1RULH 2VDKH 2NY1D 4YXLL 5EUOA 4Z8FH 2NNAB 4P9HC 5CFHA 3FN3A 3L9RA 1X5XA 3G6JB 2B20A 3K4ZA 1T83A 1I3RA 4GW4B 3G04B 1ZT1B 4PJEA 3V9FA 2VIRA 5FB8B 3M45A 1OP3H 1J1OL 1EFXB 2X4TA 5E2VL 3MLPA 2NLJA 4WUUB 5K9OB 2DQFA 2YRPA 3IDNB 2R29H 3CDYA 1X7QB 3QDGE 2BVOA 4RMTA 3WJJC 2W0LA 4FQCH 1BQHA 4M7KH 5HJ3B 4QRRA 5AAMA 4E41D 4EDWH 2YZ1A 3DIFA 3L6FB 3G6JF 1TVDA 2VXTH 3L5JA 4IJ3B 4TUKL 3QUML 5K9JL 4ORZC 1T3FB 5DMKB 5TE4H 1E4KA 1OAYL 3JTSB 3PQYD 1RI8A 4PJCE 2QKIA 4XNXL 2AJYL 4RBPK 3L3GB 4WHDA 5EUKB 2VXVH 4NZRH 1QYGL 2FJFB 1L7TL 3A6OA 2QQLH 5BV7H 5CEZH 1SEQH 4XCCH 1OGAE 3GJFA 3O41A 5IM7B 3RPIB 4GBXB 4HS3B 3OMZA 4M7JH 4YHNA 3M8OL 1IGFL 1B0GB 1GXEA 4MNGB 1XF3B 1CG9B 4DJMA 4MNQD 2B0SH 1XCQB 1BQLL 5TDOB 5F71A 4IRSB 1RHFA 3C87A 4JVUA 4TUJB 5E8OA 1SQ2N 3HS0A 4XMLH 4F57L 2PXYA 5KTEL 2QADB 1DQLL 3ZDYF 3PP4H 3JV6A 4D3CH 4QRSA 1EDQA 2XG4A 1S7QB 2VN4A 3ROLB 1JPGB 4NRYB 5E5UB 5A1AA 1BD2E 1S7TA 2RB8A 4AYFA 3WXVL 1CDBA 5I1KH 1UZ6F 4JANA 1KJVB 1K8DA 4NNYA 4OZFH 1BBJA 3QXVA 3MUGB 4YFLI 5D8JL 1DQDL 1FVEA 4MJ6B 2X6MA 3ZTNH 4N9OB 3SO3C 3MA9H 4YAQB 3IU3B 1FAIH 3RVUD 1RJZA 2YC1A 5DJ2B 2OSLB 4BQ6A 1UM5H 3GI9H 5D1QC 2OBGA 3STZB 4EQ3A 1CFQB 2OXHA 2CKNA 4WEUD 1FVDB 3GMMB 1ZGLA 1GC1L 4LKCA 2DI8A 5HGAB 3DXAB 4IEFB 1HE7A 4Y5YB 4KGJA 4J8RB 4YDKL 1RFDH 2WBJD 3RWIB 4JDTH 4P2CG 1I8KA 1YY8B 3V5DA 1DANT 1IILE 2X42A 4GAJH 4C57C 5I1IH 1SM3H 2VLRE 4HAGA 4LSSH 4X5XB 4NQDE 1INQA 3GIVA 1SJVA 1EHLL 2EH8L 2F5BL 2EDKA 4WEBH 2YMXH 4PRHE 1JTTA 4L3EB 2X40A 1D6VL 1U3HA 4OZIE 3BD3A 3S8WA 1E27A 3F8UB 1OY3B 3DUUA 4HZLB 5GS2D 1YMHA 3ULVF 4Q0XL 1E28A 2FL5A 4HC1H 5HI4D 3A6BH 2QV2A 2EYRB 2AKRA 4N0YL 5JXED 4ZUSB 3BN9D 4KUZL 3AS2A 3BDYH 1NCWH 3DMMC 3KLHC 1WT5C 3T04D 1FFRA 3IKKA 5EO9A 4K8RC 1QQDB 5IG7B 2OZ4A 1U8KA 1A7RH 1YNKL 3QXAB 3HAEH 3VD4A 5JO5B 2ZPKL 2DTML 4UT6L 5CJBA 4Y1AA 3ZSSA 4A6YH 4XC3L 3L1OL 3LEVL 1WIOA 3SDYL 1FZMB 3T8XA 1MJUH 3GMNA 5CJ8A 5BV7C 4GW5B 2DLFL 3V6OA 3T65A 4DGYL 2D0FA 2HH0L 4M43L 1JIBA 5GIRA 1DQMH 3H3PL 5D7LA 3VXRB 2VQ1B 3TCXA 4OGAD 2VE6A 4JFDE 5E1HB 4N8VA 2XKNB 5LCVL 4JREB 3WS3A 4W6XB 3O2WL 4F58H 2BVTA 3DX9B 4L8SB 5C0BE 2DM3A 2Y1VA 2ADJB 1H8NA 4TUOA 1CDHA 3UJTH 3WIFA 5DQJB 3OF6A 1A4KB 4ZSOA 1EEYB 3U4EB 2XA8H 4X6BB 3RGVD 3BE1H 4QRRD 5H2BB 5ACLA 2V2TB 1BHGA 2A6JA 2CRMA 4XNMA 1RK0B 5E5MB 1JHTB 5EOQL 3UTPE 1HHKA 4NP4H 1YEDA 3VWJC 3T77A 3UPRB 3PHQA 3WE6B 1GYAA 4YDIL 4O02L 5C08B 3QBTB 3GMRB 1AO7B 3EO9L 1NGZA 4NQVA 4YHML 2PR4H 3RX7A 7FABH 2CIKA 1EVTC 3S3PA 1J9CT 3C8DA 3DRQB 3WFCH 4MA8H 5FYKL 3NIGE 4Y5XA 4OLWL 2LV4A 1KTRL 1PAMA 2YOCA 5IWLC 4ZODA 3JWDH 4K7PH 4PRDB 5FUOH 4M6OH 1CD0A 5DJCB 1OLZA 1QFWI 1KN2H 4M3KB 5J6GB 1JV5B 2VAJA 1QRNE 3OKKA 2PXYD 3QG6A 5F7DA 3TZVC 1QSEA 5I66B 2BOCA 5KSAB 3IDYB 1VFAA 1E4XL 4UBDD 5DZNA 5DJZA 4AT6A 1FPTL 3N9GL 4DUVA 2Z0BA 2IPUG 3O6ML 4I0PB 3MLTB 3VFNB 4BK4A 1HOCB 1RZ7H 5SX4I 3MCLL 3RKDD 3SHSA 3QXTA 2FEEL 1UM4L 5FCUH 1HQ4B 4XGZB 4QRUA 3NFNA 1W2KT 3GSUA 4TRPH 5IMMB 3OJMB 5C9KA 2ZUYA 1SYVA 1IC4H 4OD2A 2CJUH 4MA7H 1JWUB 5HHMD 1IGIL 4UT7H 12E8L 3L3DB 2EDRA 4ODUB 1D6EB 3O8XC 1FV1A 4QGTA 4LSVL 1GRWA 5GSRA 1LO5B 1MH5B 2GK0B 5KN5A 1I1AB 4W6WB 3MV8E 4MD0A 3MJ8B 4X9IA 1HYRC 2MNUA 4OM0H 4YR6B 5FYJD 4NRXB 3GSWB 1VFBA 2DQEL 3RNKB 1C1EH 2AV1B 2X4UA 3H6JA 1AGBB 2V5YA 1W0WA 2W9DL 5EORH 3HC4H 5FOJA 2VZ3A 2EO9A 5KSBA 3O11A 5CSBA 5HI3C 2I60L 2VSDA 1TZGH 1FCCA 3QNZA 4NO3A 3OJDA 5IVXE 1A6VL 3MLXH 4P5TD 3BP5B 4O5LH 3Q3GA 2VR4A 2YPLE 3ARTA 5TGBA 5FOBB 3EO0A 3IDJA 1AH1A 4J4PC 2J6EL 4F15B 3QFJE 1ETZB 1NBZA 4M62H 1RZIA 4ELMF 4PJHB 1CE6B 1CLOL 3IU4H 1MF2L 3L7FA 4MYWB 4GKSA 4RISH 3MV7E 4XPTH 1YEKH 2PW1A 1FFPA 3QPXL 5DHXB 2SEBB 3UX9B 2WZPD 1WC7B 2AJZB 4NQTA 1LE9B 4Z0BL 1F90H 4HWBH 3QG7L 4UOW1 2DS4A 3C6LA 3AS0A 4EVNA 3TBTA 1T1WB 4UV4H 4LLUA 1MPAL 3U0TA 4TVPD 4Y1AD 4DVRL 1SHMA 3VRJB 1S9YB 1Q9OB 4CADA 3QI9A 3CVIH 5EBWB 3TN0A 5INCB 2ADFH 5EU5B 5D7JC 3OAZH 1PGRB 1QFPA 2ICWA 3DHMA 2C1OB 4P57A 1BZ7A 2XQYG 3BSZH 4JN1L 4PLNC 2CMRH 4MXVF 3BW9A 3CPLB 5D7LD 3JWDC 2HLAB 2JIXB 4PJXB 1Q1JH 2IPKB 4GQ9L 4K3EH 4YXHH 4WFFD 3N1MC 5BMFL 4QLRA 3QWOA 2LAGB 3PWNB 2MCG1 1SJEB 5GRWA 1QVOB 1DUYA 3ZKMD 4JKPH 1KB5H 4HPOL 4G5ZH 3B83A 4NDMB 2ZUQB 4MVBD 5C2BL 4QCIA 4WU7A 2EYSA 3OF6D 4ZXBA 3ZLQC 5CP3H 1A1MB 1XIWB 2DQIH 3EYVA 2HKFL 3U46B 3JTTA 3VFTB 2R1XA 4PJXF 4CMHB 4JQIH 3IGAA 4R96B 3U7YH 4Y1AE 4LEXL 5GGRY 4MZ2A 1T1ZB 3SDDC 4K3HA 5IJVB 1GH7A 3O45A 3MCKB 4XPHL 5KSVA 3S37H 3HPJA 3KNBA 3RI5K 1LDPL 4YXKH 2IALB 2OJEA 1BWMA 1KCRL 3QQ4A 3GKWH 4E5XB 4GH7B 1ZHKB 3L7EB 3P73B 1G84A 1A8JH 5JIHA 5I15H 3LKNB 1VERA 4E0RA 1AQDB 2FBJH 4O2FA 3O2DH 3C8HA 3VFMB 4QHNA 1RSFA 3QEHB 3BP4B 1Y6NR 1CLZL 1MEXH 1HINL 4YHPA 3UROR 3FB6B 2VLME 1QSED 4L4TE 3K8MA 4D0DA 2BOBA 4Z5RA 3P9LB 3E0GA 4ZSOE 5F1SA 3VXSB 1NGYA 5CZXC 1MREH 1RZ8B 4LSRH 25C8L 3VXOB 4GQPH 3SE3A 2E9JA 5E0QA 2BX5A 2HG5A 4PY8J 4S1SL 2FGWH 3QUXD 4U1MA 3WNLA 3ZT7A 4XNZB 4HK3J 5DRNA 2UWEE 3Q5OA 5DRWA 5HDQL 2RCSH 5DJAA 5FFLA 1LO0H 4JFEE 3HE6C 3OZ9L 3RZCA 2YA0A 4N1CA 1K2DB 4XBGB 4J3VA 1KJ2A 4NQCB 4DW2H 1WFNA 2ZUSA 4ZFOA 4HQQL 3MNVA 1JGUL 4Z6AT 4D0CB 1YPZE 2GY5A 4H88L 1J12A 3WFBL 4ZNCD 3PL6A 1X5LA 5CZVH 3Q5YA 4KKNA 1V7ML 3VD5A 2Y7QA 3RVXC 1BBDL 4LLYA 5DD3H 4N0UB 2KPNA 2ZKHH 4P46A 4K3GA 1M7IB 1FBIH 3FFCE 3MNZA 3ZDXF 4YFEA 5AZ2L 2E3VA 4PRPB 3KJ6H 2DLIA 4M3JA 2GTZA 3LRHA 3F62A 3Q6GH 1NUNB 3WFHB 4IMLB 5I71B 4OM1H 1GJIA 1IM9B 4KU1A 4HWZB 4NPYB 5JOPE 1JNHA 4A2MA 2AJVL 1X3DA 5MEPA 2ARJB 4OCYL 4MSWA 3S96A 2Y6SD 4FQ1L 5ANMB 3VE0A 3V0WH 3UZVB 4JO3H 1MFAH 1T20B 1F2QA 3TNMB 4NOBA 4UIMA 5DEFB 3S37X 3MODH 1SVCP 2B4CL 4YHIB 4U3XA 3NVQA 5DO2C 1CGSH 3LVEA 1N59A 4OV5A 4PRIB 1QPXA 4W4NA 4FOMA 3PV6B 5C0DB 4TVSa 5IB1A 1GOFA 4GAFB 3BGMA 4GG8A 1V5JA 4KKBD 2F53E 3MACL 4M8QB 4RGMC 2OQJA 3G5XB 5FXCH 5IFHH 3C6LD 1PQZB 2GITB 1BVKA 1MCHA 1HSBA 4LEOA 5B8CA 3T08A 3MRLB 3QUMA 2NY0D 2JJTC 3GI8L 3OX8A 5KSBE 4XVSH 2FNBA 2NY1C 2NY4C 1AD0A 1E4WH 1NMAH 4YQXL 1TENA 3EOTL 4KI5F 5IBUB 2A74B 3QI9D 3TN0D 1T0MB 1T7YA 1W72H 3ULVL 1DBML 1BECA 2HJFA 3HI1A 1JJUA 2XT1B 1UXWB 2WWKO 1A3RL 1NLDL 2EDFA 2FX9L 4ZTOH 4AEHL 4GKZB 4AK1A 1BLNB 3VGGA 2HTKD 1WUNT 1X44A 1HCVA 5DD0L 3V6BR 1WWWX 3LQZA 5CLTA 1QFUL 3V7AE 3SDCC 3C8KA 4H26A 1Q9WA 1RURL 3S35L 3X13A 5I1JL 3TBWA 3JVGC 1CLYL 4URTB 2IH1A 2ZSWA 1QBML 4FFVD 4KC3B 3TVMA 3QPQC 1XH3B 3UMTA 2GHWB 2J12B 4NUGH 3U9PL 1Y0LA 4LIQL 1T7XA 4ZXBD 5I1EL 4HUVA 5MENA 1MJ8L 5JZ7D 3LN5B 5EZJA 3BKCH 3CJJA 2E9IA 5DMIL 1CGYA 2NTFA 3RDTC 4M6NL 2A1WH 1SEBA 4WHTA 1OTSD 4MHHG 2BSRA 2EYTB 5HPMB 3L95B 5JIIA 4U1JA 3B2UD 4Q9CA 5DJ0A 3MA7B 2Y72A 4XMPL 4APQB 5KVGH 3S3JA 1MI5E 2EC8A 5E08L 1FL5B 4FA8A 2VR5A 1UXSB 3DVNB 3MREB 4MXWH 3C5ZB 4CL7A 4UDUA 1L6XA 1UVQB 4X99A 1KELL 1MUJA 1QR1A 5BQ7A 1ZMYA 4YHKL 4AIZA 3MRHB 5DK0B 1IQDB 3OXRA 3ARGD 1HZHL 3MR9B 4HF5H 4WV1C 5B39B 1JPST 2IFGA 4L4VA 5DXWA 3RAJL 4YHZH 5E2TL 2OR8A 5E24E 5D2NA 1H15B 1FC2D 2BSTB 3PDGA 1F4AA 3BJLA 8FABA 3MRQB 3HFML 3BKYL 4TYUA 3UTOA 4ODBD 3MRMA 3MRBB 1FL3B 2AEPH 4XMKH 4M1DL 2B39A 1QSZA 1NFDE 5I16A 3OKEB 5FGSA 1CK0L 4NN5C 3NCFB 3O6LL 3I84A 4Y4KB 1RZFL 4YPGA 1OVZA 3ZL4H 3RWGA 3RZCD 1XF5A 1LE5A 4ALAL 3WLWC 1TJHH 1JPFB 1LDSA 3CU1A 4Q7DA 1TFHA 4JO2L 3U79A 1JGDA 1T1YA 2X41A 5DRZA 1J0ZA 1G1CA 2YEZB 3KPMB 1I1FB 4X5WB 1LEKB 1ITBB 3GK8L 1BJMA 3KYOA 3KYNA 3PL6D 5C09B 1ZV5A 2X7LB 3L5XL 4HKXB 2CLRA 3IDIB 3N85L 1BOGA 3HC3H 4AEIL 1A6TB 4HUUB 4K3DH 2Z92B 4OLVH 4P46D 3BKJH 4Y2DC 5KS9B 5F1IB 1FJ1A 2Y5EA 3S7GA 4O58L 5FK9A 4PG2A 5EN2A 3T0AA 2DOCA 2ITCB 4OI7A 3CZFB 3R4DA 4FTVB 1KJMA 1OAUH 4PJBE 4NQXB 1IEBB 4HKJB 2UZYB 4WCYH 1WAAE 4FQ2L 2V7HA 5C0RH 4LMQI 1FGVL 1WEJL 4ZO6A 1OHQA 2H32H 4KTDL 1IC5H 1FNGA 1H3PH 1XF2B 2XICA 4P5MB 1DFBH 4CN4A 5KG9A 3P0GB 3D0LA 2FGZA 3FCTA 2H3NB 1OP5K 3BN9C 3LMJL 3FOMB 4Y4HD 4LCIL 4ENED 5BO1L 3RX8A 4BFGA 2DYPB 2H41A 1NMCC 4ZUWA 4ZFZB 1UWXK 5T5FH 5L2KB 2DRUA 5LVEA 3HN3A 4IOSD 3DVGB 4KJYB 4YHYC 5ACZA 2GTWA 2RQ8A 4NBZB 4C59B 2ED8A 4X4YB 1RIVH 1DTUA 4JEGB 2DLHA 3HNVL 2CGRL 3VXNB 1KPRA 1KCVL 5T1LA 3MQIA 3NCYP 1MCPH 4OBRA 4JPWL 3MGOB 1S8DB 4M7ZC 2W38A 2VXSH 1LD9A 2HJKB 3KPNB 1AIFB 2VN7A 4H1LG 1J11A 1INEL 3CLEL 4U4BA 2ZCKL 1T2QL 2NXZD 4N8PA 3RIAK 4QHUB 5L9DL 4EOWL 4ZUUA 4EKXA 1NKRA 3EFFB 3QWQB 2NY7H 3FO9A 1KBGH 4DQOL 4PLJD 4GSDL 5T5NF 4NHUB 2YPVL 4XP1L 1IQWL 2A6KA 4X8JA 1RK1B 3E3QC 2DBLH 4UT9H 4LBEA 4WU5A 3BD5A 2OTUB 1F6AA 3QDMB 4OGYH 4JVPA 2AXFB 5HDBE 3TVMD 1MRFH 3OPZH 2APFA 5F9WC 2X4QB 4KUCD 3QQ3B 4X7CC 1B4RA 5MEND 3H3BC 5AG9A 3HZMA 3HZKA 1HKLL 1FG2B 4ZNEE 1DQTA 3GSNH 2A2QT 1OAZH 1IEAA 1S78C 35C8H 2R4SH 4X9FA 5GGRA 1YEJH 3PABA 1P4BH 3RVVD 2EDLA 4K3JL 1TCMA 2J88H 5GGTA 1JFQH 5F9AC 3BZDA 3QEQE 5IW6A 1A1NA 4G7VH 3QRGL 2EEBA 1U8QB 5EPMB 1R5VA 4GS7B 1B6UA 4YDVB 4E9LA 5IMOB 5HGHB 3UDWC 2PXYC 2IJ0C 2BY1A 3O6FA 3EJYD 1NAMH 3LV3A 2MJWA 1RZGB 5FYLL 5C07E 2P7TA 3OR6B 4KHXH 4HXAH 3FT2A 4UBDC 1MAML 2FO4B 1BVLA 1MVUB 4NKDB 1NCBH 1A7PH 1CXIA 3TO4A 1UKQA 2BSSB 5EFIA 3B9EA 4L4VD 5ID0A 4XZUB 1A7NL 4G8GB 1X9QA 4NQEA 4QHKI 1N0XL 2L0DA 4G6JH 2G9HA 3MOBL 4Z76A 1AQKL 1KCSL 4P59L 1MHPL 4UTAL 1KIQB 3QH3A 1IAOA 4RGOH 1A6ZB 1UM6L 2VLKA 1MIEL 4U0QB 5DS8A 3VA2C 4M4PA 3OKLA 4EXKA 2EIZA 3PIQA 3NZHL 4ZO9A 2AEWA 2J6EA 3SO3B 2FD6L 3UTZA 4HKZA 3PE9A 5ICYB 5D1QB 5ICXA 2GJ6A 4HFWB 1YEHL 5I17A 1J0KA 1BF8A 1AXTL 5HHVL 3DX6A 1U8HA 3NA4A 2QJDA 1LO3L 4KY1H 3RBGA 2DWEB 3QCUL 4IOFD 1UC6A 4QF1A 2OMNA 3LPGA 4GRLA 2X5PA 2EKSA 5ISZA 4PD4K 4YE4L 3SE4A 3HC0B 1VA9A 1JNLL 2W0FA 4BQ8A 4AQ1B 3QIWD 1T80A 4JY4A 3AXLB 4PBXA 1U3HC 4NHCL 5CJXA 5CUSL 3P0YL 4NQSA 5DGRA 4G6FD 4JPKH 2QBWA 1DBJL 1RMFL 3HE7A 1J1XL 2CKBB 1T5WB 1ZEAL 3SBWC 1YC7A 4JPVL 1T4KA 1IGYB 5F89B 5HHQB 1F3DJ 4N1EA 3QYCA 1HH9A 4LSPL 1GHFL 4LLDB 4L4JA 3AM8C 4R3SA 1F4WL 5FO8B 3PF2A 2EE6A 1HDMB 4KVCL 4HEME 3DMMB 2CIIA 4YDJB 4G9FE 5D2LF 4HSQA 4U1KA 3D0VA 1JN6A 1DBAL 3TV3H 3PWPA 5SWSB 1NGQH 3WD5H 3LAFA 2HT2D 3VFRB 2ZCHL 3ISWA 4LRIA 2HTLD 2A73A 2DQHL 4Z7VE 4H5SA 4LK4A 1PEZA 3D6GA 4UV7H 4HIXL 3FT3B 4LHUB 5DD1H 5BV7B 3OB8A 2CDFA 3SGJA 4U6VH 2GK2A 3C08L 3BMWA 5IV2B 4ZDHA 5HHXL 4U1LA 3OWEA 3RY4A 2RGSA 4HCRL 5FYKD 1IT9L 1P5VA 1OT1A 2P5EB 4RCAA 4JQXA 4FQXA 3W81A 1T04A 2EEDA 4NC0B 2F54B 1QFWH 3BT2H 3ZKMC 2OYPA 2C26A 3DETC 1RIHL 3H7BB 3G6JA 2QR0B 3EJJX 1TPXC 1LEGA 4J12A 2AERT 4QHLB 4FZ8L 3K1DA 1ZT1A 4JM4L 5GZND 3DUSA 5A3IC 3PUCA 5B4MD 5SX4H 1AXIB 2HVJB 2QQNH 4WUUA 5K9OA 3TP4A 5JIPA 5E8EA 3WFEL 3VWJB 3FFDA 4NUJB 3WJLC 1GGIH 1JUFB 4YNYB 5HJ3A 2Q8BH 2BRRL 2XZCL 3LKOB 4Y5XC 1U3JA 2YBRB 1FIGL 2CLVB 3L6FA 3P0VL 4XH2B 2ZJSH 5KJRL 1Z3GL 5AWNL 5DMKA 4CNIA 2YA2A 5GRZA 1MNUH 4PJAE 4KJPD 3JTSA 1BEYL 3UTSA 4PB0H 3FRPG 2E7HA 3HZVA 3V8CA 5EUKA 1C08B 3VJ6B 2FJFA 3LS4H 4X9HA 3VGHA 5HYQA 3DYMA 4H1LA 5KW9H 3SKUD 3O6FD 4HGWB 5TQ0L 4FFYH 1G7JA 4WJ5B 3B9KC 1E6JH 1U8PB 4O4YL 3TO4D 1EGJL 1KIUA 1XCQA 5TDOA 3QNXB 4WW1A 4JDZB 4OCXL 4IRSA 5IT2L 4NQED 4N0CD 4BSVB 5T3ZE 3FO0L 3MXWH 5JHDB 5FHAH 2UY6A 5B38G 3PGDB 5TH2B 4JKKA 2HT4C 1D5ZA 3ARPA 5E94A 3T4AB 2XWBB 4Y5VB 2DN7A 5F9OL 5A2KH 1JBJA 3TBSB 2ID5A 5E00A 1H9VA 3K2UH 3WLBB 4C56A 1TTUA 3QEGL 3RWJB 2NY2C 1NGPH 1QOKA 2D03L 2I9LB 3O8XB 3QUYA 3U2SB 1UA6H 5J13B 1Z5LB 2GJ6D 1DEDA 3RP1A 4WFHD 3DLQR 1HEZA 5DVLA 2MPAH 5TF1H 4YAQA 3IU3A 4F7PB 5I9QC 1PLGL 4JLRA 1X4XA 3MXVL 4MCYA 2OSLA 3O3AA 2HT3C 3W9EB 1CDGA 1FRGH 1TVBB 3KPQB 3KPLA 2Q3AA 4GRLD 4JZJC 4Y4FA 4P2YA 2RIKA 4NQEE 5FA3B 5K59E 5ISZD 3IXTA 5IB5B 1KTLB 5HGAA 1BJ8A 4QY8B 3F7RA 4HFUL 5IMKB 1HHJB 4OT1L 4PLKC 3GBMH 5F97E 3O0RH 2ARJQ 4JFHE 3QHFL 2Y07H 2Q87A 2YK1H 1C16A 3HE7D 2VLKE 1GGBL 4GW1B 1MRCL 1J05A 3R1GL 4OUOA 1ND0B 1WIPA 5JIKA 3OKNA 4ELKB 3JV4B 3VD3A 3GFUA 4KTYA 4NOFA 1KENH 2R0ZL 2ICEB 3LSOA 4ZAKC 5ERWB 4P23A 4PJ7F 2NY6B 4PREA 2IAMA 2VUOA 4PIRF 3S36H 3DBXA 4HZLA 4BA8A 3V6ZA 5SX5H 3ET9F 4MQTB 1A6AB 2VJXA 1YMMB 1V05A 2RFXB 4NCC2 4OD3L 2EYRA 3PWPD 3E6HB 1RJCA 1O0VA 1GZPA 3QZWB 4AMKH 1TJIL 3TN0C 1WITA 3VXMB 3HR5A 3HB3D 5AYUL 5EZIH 1DN0B 2E9BA 5SWZE 3WKMH 2JJSA 1QEWB 1FLRH 1QQDA 1S7WA 5IG7A 1U8LA 4ODVL 3WSQL 1BPVA 2HTKC 2VITB 1II4E 3AREA 1IFHH 3QXAA 1KFAH 5JO5A 1I8IB 3LZFH 1F6LL 4HWNA 3D2UA 2UVEA 3BZFA 1QBBA 5I73C 5HVHB 3U4BH 2BP3A 1WFUA 2NY5C 1C12A 4P9MH 4CN6A 3LIZL 2E27H 1YN7B 4FQXD 4Z95L 2BERA 4LNVA 4RFEA 3PWJA 4I3RH 5F88A 4WO4C 4ZXBC 4OUUB 2XIDA 3P2TA 4HHAA 2VQ1A 1JYVA 1T03L 4KZDH 2DJ4A 1BGXH 4KK9C 3RNQB 2H6PB 5LWYH 1C5DA 2HKHH 3M1BB 4LAQL 1KOAA 4M5ZH 4MLSA 4JR9H 3ARXA 4WUUD 3UYRL 1DVFC 2VDOH 3DX9A 5E6IA 1NEUA 3SCMC 5LQBH 1PY9A 5H2BA 2V2TA 4I3SL 5DK3A 1RK0A 3SE8L 4QT5A 3VFSA 2R69L 4JFOA 1YNTB 3RL1B 5BJTB 2AGJH 1NGXA 5F72S 3UTSD 4RIRB 5LBSL 4R26H 4WHCA 3WE6A 5C08A 4MDIB 1AO7A 3GSOB 3W82A 2VUYA 4ODTL 1XGYL 4P9HL 3RWFB 3DRQA 2WBWB 5A2IH 2X4SA 1UWGL 1LEIA 3WEXB 1WF5A 3KXFA 1JP5A 1LWRA 4NJAL 4OCNC 4Y2OA 5E03A 5MEOA 5F7HA 5F1NB 3S36X 4IRJA 3CFEB 1WFOA 3MRPB 3QRFM 4JG0H 2NR6C 1RUAH 2OJZL 3MLUL 4IRSD 4XPAH 5ADPL 1HNGA 5DJCA 4F7EB 2H1PL 5IB2B 1JV5A 4I2XA 4KQ4H 4HIEB 3VGFA 4CDHA 4Z7WB 3T09A 1AP2A 2P8LB 1OARL 3HE6B 5L88H 5DJYB 4PJ5A 2XRAH 4I0PA 5F7FA 3CMOL 4ONHB 2J5LC 3TCLA 4ODHH 1BVZA 1N26A 5IQ7L 1FFNA 2FLRT 4KJWC 1JWSB 4C56D 1TVHA 1IAIL 3UTSE 2VDNL