2VITB

Influenza virus hemagglutinin, mutant with thr 155 replaced by ile, complexed with a neutralizing antibody
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
221
structure length
221
Chain Sequence
QVQLKESGPGLVAPSQSLSITCTVSGFLLISNGVHWVRQPPGKGLEWLGVIWAGGNTNYNSALMSRVSISKDNSKSQVFLKMKSLQTDDTAMYYCARDFYDYDVFYYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antigen distortion allows influenza virus to escape neutralization.
pubmed doi rcsb
source organism Influenza a virus (a/x-31(h3n2))
molecule tags Complex (hemagglutinin/immunoglobulin)
molecule keywords IMMUNOGLOBULIN (IGG1, LAMBDA)
total genus 37
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1997-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vitB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vitB01
3TT1H 3B2VH 4OFKA 4ZFZB 4XVJH 4PJ5D 4HK0A 3THML 4KKAC 4XNUH 1YEDA 3CFEA 1M05B 1BZQK 3PWPA 3CGTA 1WT5A 4OZGA 2ADGA 3F7VB 4TOYL 3SDCA 5JA8B 3JV6B 3ARBA 2W91A 1JTPA 1QLFA 5IMKA 1ZK9A 1J8HA 2AJYL 3SDYH 4BZ1L 1MPAL 4WNQA 1JF1B 1SYVB 1VB9A 2ATPB 4I5BA 3HS0A 5D72L 1Z3GL 4JFXA 3U0WH 4J1UB 4P2QB 4QHUA 3ARGD 2FJFA 5GS0C 3RI5K 2PXYD 2HT4C 2EDKA 4P4RB 3T3MF 3EYSL 4R7DA 2R0LH 4MB5A 1W0YT 3FQWB 1CK0L 1CE1L 1NC4B 1U8JB 5HD8D 4JY6B 1UCBH 1A5FH 3G5XB 3SKNB 3TESA 2ZUYA 2A2QT 3IXTA 3SDXA 4XNYL 2ZG2A 5I1JH 5DGQA 4OZGB 3EAKA 4NZTL 1A6ZB 4LCWA 1KF9B 5EC1A 4FQPA 4LL9A 5ITFB 3MRBB 1RUPL 3BPLB 2PCPA 2DQEL 4UNTA 3C6SA 4KTDL 5K9OB 1B0GB 3B9AA 4YHOL 3HPLA 4OF0A 1KG0A 2NXZC 4LHUD 2ZPKL 3W82A 4JVPA 4C4KO 1L7TL 2VAAA 4JZJC 1T22A 1ULVA 1RK1A 2MSPA 2F54B 2CUHA 1RUMH 1C5DA 1HHGA 3C6LD 2W0KA 5C9KA 2CLZA 2VLRE 1SVCP 4NQED 3RWHA 1PZ5A 4F7TB 1S9KC 1YYLH 2GW5A 4LVHC 5C0CE 1DFBL 5CEYA 1U8NB 1G0XA 3L3HA 1CLYH 3PWPE 1MCOH 3VFMA 3L9RA 2VLJD 5J4MA 3FFCB 4IEFB 2VDPH 2HJKB 1OB1A 4YDJB 2VLKD 1CXIA 4XCEA 3HN3A 5FXCH 4EQ3A 1CVRA 2DQJH 3QDJA 3U0PA 2AV1A 3O3AA 2VZ1A 3PWPD 3N06B 1J0KA 4KFZC 4LLVB 1ITBB 3NCYS 3UTSE 1J1PL 3TCXA 1DDHB 1S7TA 2DKMA 4NQCE 5EBLB 1MWAB 1U92B 1KJ2H 5JR1L 1BECA 3ILQC 4JDZA 4XPFH 3ULUC 4H26A 5IQ9A 3F12B 4NWUL 3WUZA 5C0BB 4BFBD 4OM0L 2VLKA 1G6VK 4XVSL 3FFCE 3RJQB 2FNBA 5ESVA 3QDHA 2IPKB 3DX6A 4OJFH 3TVMC 3TO4D 1EBAA 3FTGA 1YEFL 4B50A 4K7PL 3MRCA 4LSRL 1ZA3B 3OZ9L 5I1HH 5L2JA 1MIEL 5DUPL 3WKMH 3S5LG 4G9DB 3QXTA 2P8PB 3G08A 1CXFA 4YBHA 4M5ZH 5DJ0B 5I66B 2CKBA 5H37G 3UTPE 2FR4B 2Z4QB 4F2MB 1SJHB 2FJFB 1EZVX 3QUMB 5MHSD 2EYRB 4N5UA 4MCZB 3TH3T 5C0AA 2GUOB 4XPBL 2OZ4H 5BS0E 2W9DL 2VXVH 3BHBA 4UT9H 4OLWL 2YUZA 4DVRL 1U58A 5ENWA 4MWFA 3MOAL 2UZYB 3FB6B 1UZ6E 2DN7A 3BGFB 3L3GA 4G6KH 5F9WC 1CU4H 5KG9B 1YY9D 1Z9SA 3U6RA 3FO0L 3CDGB 4ZAKA 3FQRB 2H6PA 1OP5K 4X0KA 4NBYB 3CXDL 1TENA 1OY3B 1W2KT 43C9B 3G9VA 3TO2B 4HGMA 1CICD 5I8OH 2VISB 4POUB 3ROLB 2HMIC 2DM7A 4CNIA 1NH6A 1A1MB 1X5JA 4WGVB 2E6QA 3HPJA 2C5DC 5HHOA 3BH8A 5IT2L 3BD4A 4LSTH 4WFGD 3TIEB 3EJYD 3NIFF 3RL1A 1NUNB 4WW2C 5F6IB 3U7YL 2EXWD 1IT9H 1BJ8A 3S35H 1BQUA 4HS8L 3OGCB 4YXLL 4JPWL 3L6FB 3INUH 4HKXA 2NNAB 4YHLL 5T5NF 3HC0B 4I18B 3JWDL 4MJIB 4XPTH 4OCYH 3SE9H 4X6FA 1WBXB 2OI9B 2AJSH 3S34H 2FGWH 1LO0L 2XNAA 1G7QB 3S36H 4EI5C 5J6GA 4UQ2A 5D7IB 4G9FD 5LAXA 3VRJA 4I9WE 2AJ3A 3KLAB 3CH1B 5BOPA 5KN5A 3P77A 1ZGLA 1T83C 5EZIH 2IPTL 3AU1A 3MBEC 4JFQB 1F11A 4ZO9A 1FFOB 3CFKA 5I0ZA 3KYKH 4UUJB 3T08A 3BUYB 4ZUWB 2I9LA 5E5RB 4LQFL 1JZ4A 4HUVB 3CU1A 3GMLA 4L3CA 1GOGA 4UOW1 4HGWA 5JIKA 2I9TA 1T0MA 5A3ID 4LSUL 3RP1A 2EDRA 2W60B 1T5XB 4PGDA 5JZ7C 4GRLB 5CILL 4MNQB 2X70A 3M8OH 4QHMA 5CP3H 4I4WA 4O5LH 2C4XA 5I8CA 3DGGB 1KTRL 1HH6A 3DMMD 5ISZE 2GITA 2V2WA 5EOQL 3PWNA 1IAIM 4MCYB 2ID5A 3QIUD 5GZND 4JQIL 2X4QA 3CX2A 5BQ7B 2BERA 3CX5K 1YNTA 2Q8AH 3VWJC 4KHXH 2CKBH 3VWJD 3RVUD 5CGTA 4KJQC 4PRIA 3QRGL 1AP2B 1G7HA 5J12C 1G6RL 1GJIA 1ZHKA 1UEYA 3CZFB 1BFVL 3FONA 1KC5L 1F4XL 3ARDD 4HCRL 1V7NL 4KZEH 1RZIA 1BD2D 2BXYA 1WICA 1S5IL 4G7YL 4DN4L 5JIIA 1WWAX 2VUYA 3IFPA 3L3DB 1IQWL 4JFDE 1TCMA 3T0DA 5GIRB 2Z9TA 2QQNL 1B0RA 3H7BA 5IG7A 4M8QA 2JE8A 4Y4HA 3SE8H 1OTSD 2X4PB 4NHCL 3SDAB 2X4UA 1ZLSL 2ARJA 3SJVD 3RHWF 3BH8B 3SPVA 3BIAX 3P2TA 4JO3H 2CK2A 5C92A 1E4WL 1CDUA 4XB7A 1KPRB 3W2DL 4PS4H 4OUUA 1CZ8H 2V7NB 3SGJA 5JPNB 2YPLB 5JDSA 5E7BA 2EDEA 4TVPD 15C8L 2OTPA 1JHKH 1KFAH 3N1QC 5A2LH 4UIKL 3TJHC 3H6JA 4U6VL 4PB0L 3OAZK 2HH0L 4OGXH 4FFVD 4JY4A 3MODL 3FQXB 2N1KA 2DF3A 1JNHB 4K94C 1WT5C 3S96B 5SWSB 3GSRB 5I1AA 3O9WA 3PDDA 4RQQA 3B83A 3KS0H 4JPIB 4F80A 3LRHA 3IDMB 4PREB 1J05B 4GAGL 1AO7E 4NDMB 5E94B 1F4XH 3GMRB 5ABDE 2P5EA 1G6RH 4HFWA 1MI5E 5IFAL 4W70A 1HZHH 1PG7W 4OGAD 4PY8J 5EUOA 2KKQA 5FOBA 5F3HB 1P6FA 5DUML 2FJHB 3MNWA 4ETYA 4KHXL 2BNUA 4PLKC 2Z35B 2AXFB 2BNRE 3GIZL 4AMKL 3HR6A 4QOKA 1BQHG 5I8EB 2ED9A 4PJIF 2W65B 1HSAB 1QOKA 1FO0H 5D7LE 5CILH 1ZHNA 3SDDC 1LEKB 2FEDD 4E41B 1FDLH 3SE8L 1QBBA 3D85B 2QHRH 2NY6D 1G0DA 3DNKA 4LSUH 4ZO8A 5JXAH 4URTB 3HE6C 4LPCA 4FOMA 5JORB 4U0QB 1UFUA 1NCBL 3R4DA 4PJ9B 1H3VA 4G7YH 4PJGE 4DN4H 5MENE 5C8JA 3PV6A 1MJJB 2PO6B 4U1MA 3O3BA 1JGVH 3L5XH 3FN3A 4PJEA 1U8OA 5HYJA 1OAKL 3ALPA 4E42B 3R0NA 5EU6E 3QEHA 4OQTH 5MEOA 1WBZA 1F2QA 3BJ91 4Q9RL 5C9JB 2YD9A 2PUQT 1WWWX 2VDMH 1LO0H 3OJ2C 3MRLA 4XCFH 2QADC 5L2KE 3BWAB 1YEIL 5DTFB 2DTML 1GRWA 3BSZL 1ZA6A 3P73B 3GSNB 4LLUB 1SYSA 2R2BB 2MPAL 1G84A 2UZXB 4MQTB 4S1SL 1FZMB 3T0AA 4JHBA 5ICYA 4HIEA 1JMXA 4X6DF 2JTDA 5I1IL 3CCHB 4PJIA 1KCRH 5MHSE 3RGVD 2G60L 1XF4A 4Y5YB 2VN4A 4Y1AE 4WEUD 1NEZB 5ILTL 1NANI 2JLLA 5MERB 3IAQA 4RMVA 4MCZA 3MV8A 2QHLA 4YHZL 5IB5A 3W39A 3ULUE 4L9LA 5TDPA 3DLQR 1KN4H 4X8JB 1XIWD 4KJWD 1NGYB 1T04A 3IJYA 4KMLB 1C08B 1K5NB 4GRWH 1NKRA 2QKIA 1CFTB 2PR4H 4PP2A 1WITA 1QLFB 4R3SA 5MEPA 3FO0H 1VADB 4M6OL 2WQRA 5HHVH 3EFFA 4GOSA 2PN5A 3HC3H 5IM7B 4A6YH 4RIRA 5DLML 4ZFOL 5I1AB 2AJSL 4G3YH 3UTZA 1YC8A 4GLRH 3GHBH 3FO1A 2W38A 3W5NA 1E6OL 2W9DH 4ONFH 1JGDB 3LHPL 3QIUB 5DQ9B 4OFVA 1U6AH 1TVBA 3EJYC 4ELKA 5E2VH 4ONGL 4NUGH 4XMKH 5DRXB 5E99L 2DLHA 3K80A 3WIHA 3G5ZB 5EU6A 4YDVB 3CC5B 1F4WH 4KGJA 2HVKA 2QKIB 4J7RA 1CF8L 5DUPH 1CFTA 5J9PA 5I8EA 3HI1A 1A1OB 4KXZI 3D1MC 3OZ9H 4OAWA 1J8HB 4IHOA 3BIKA 4DGVL 4MDJA 5DRNB 5F7LB 4XNMB 4Z9KB 1TZGH 3UROR 2VLJE 2JELL 4JJ5A 3VH8B 2VZVA 2VE6A 4LDEB 5I9QC 4LHQB 4JN2B 4X5WB 1IGYA 2WWMC 1WAAA 4YHML 1U95A 3QDME 3MLTA 2IADA 4G80A 3TA3C 3CFJB 1MUJB 1MFDH 2Q86B 4M5YH 5E6IB 4O00A 4MXWH 5HVFB 4JFQA 5HPMA 3RWHB 1P1ZA 4X7DC 5SWQA 5IBLD 2HRPL 5L7XL 2JJWA 4DGYH 3IKKA 1TPXC 3K2UH 3V9FA 4E41E 5AD0A 4F58L 4OZ4A 4PJ8D 4I18C 1EH9A 3VG0H 2YUXA 3GSXB 1BOGB 1KTDA 3WO3B 3MV9D 1X7QB 5C6TL 2FX8H 2YPVH 1K4CB 1F4YL 1MCPL 1S7SB 4EDWH 1FO0B 1MHPL 4M7KL 1JPGB 1DQTA 5D1XC 5EA0L 3RDTC 5JHLL 4NQSB 3TJEH 3RDTD 3RRQA 2ENSA 4LVNB 2CKNA 1B88A 1KB9K 4N8PA 1F3DH 3NA4A 4C83A 3GMMB 4K7PH 5ETUA 2ZOKA 1PQZA 5F7NC 3FB8B 2V17L 3NMEA 1CLYL 2EIEA 2C3WA 5JIHA 4AT6B 1LE5B 4MHHI 4P2OC 4OJFL 4X7FC 4F7CA 5GS2H 4KKCC 4I3RH 1T2JA 1G9EA 2DMCA 3FOLA 1UH3A 5E2TL 1H5BA 1VGKA 2E6PA 5ERWA 4P4RA 1F4YH 4EDWL 4H8WC 2NY3B 2FGZA 4LLWB 4X4XB 4YBLB 2IFGA 1YEEH 5T1DL 1ZVSB 1C1EH 1A7OH 2YRZA 1TZIA 2PETA 2QR0B 1X5IA 32C2B 4WWKB 5EZJB 4YXKL 3IXTB 3O8XA 5FYLL 1CD8A 4XNZB 4IDLA 2Y6SD 2AV7A 1T20B 1QEWA 4MSWA 5EU7C 5L7XH 1YN6B 3BDBA 2NY5H 3MLXL 4MQ7B 4BZ2L 1AJ7L 4HZAA 2R4SL 4WU5A 3EO1A 1J1PH 3S35X 3KWWA 2EDYA 5C0AE 2F9BT 1QPPA 4K9EL 1T03H 4YIQB 4K71C 2Z8SA 1IKNA 3MROA 4UINL 3QI9C 1ORQA 1HI6A 5EU6D 4KRMB 5AAMA 4MLSA 4JG0L 3PQYE 5KZCB 3BEVA 5E8NA 5FO7B 1TETH 3DVIA 1RZJL 5TFSL 1QBLH 3TV3H 1S9VB 5CWSB 3JWOC 2FX7L 4HDIB 4NP4H 3RDTB 1I3RB 4IIQA 5ACMA 1QEWB 4N8VA 1MPAH 1NFKA 3RU8L 3CVIH 5F7EL 5CFHA 3MMEB 3MA7A 5D2LA 4DW2H 1BZ7B 4KZDL 4NUGL 3RTQA 1AO7B 5EBWB 3D9AH 5HI4C 3KPTA 1IQDA 1U8QB 5A2JH 3F65A 4ONFL 4YHOH 2Z0BA 1XEDA 3PWJB 3HZVB 2ZUVA 3ULVD 4Q9QL 3B9KB 5MP6H 3BKCH 4LARH 4IDJL 1HYRC 2HFFA 4DCQA 2XN9A 3CDYA 1IAKA 4N0FA 2ZUXA 4UV7H 3O2VL 2EXYC 2AJZA 1OQXA 3TF7C 1LO3L 4FFYL 3ZE0F 2CMRH 3PDOA 1KTLA 3MX0A 1NDMB 4P2YA 2VLRA 3L1OL 2BHUA 1RK0A 2DBLH 2GEEA 3MLUL 3B6SA 1MEXH 5FV2A 1GPOL 3SJVB 2VKWA 5FKAA 5BS0B 3FRUB 5HDBF 1BOGA 3FRPG 2ZUSA 5DT1L 4H20L 3MBEB 2PYFA 2CH8A 4JDVB 3KXFA 1AO7A 4YHZH 3TO2A 5DJDB 1A4JB 3C8DA 3AMKA 3TO4B 3GMQB 3T2QA 3HPJB 1F58H 3P4NA 3HMWL 1ZHNB 4F9PA 2PTTB 1QBMH 2FSEB 1LE9A 4JPKL 4HULB 4TVPE 3D85A 1MFEL 5E1AA 2X4OB 5EO9A 2WUBH 3QPQD 1W72B 3LKSB 3Q1SL 1F90H 4Y4HD 1ZT4B 4I0PB 3IFLL 4H0HB 5DJCB 4U1NA 4A2LA 4D9LH 1WBYA 5AZEL 1IM9B 3V5KA 3AREA 4ZFGH 5KSAC 4FFZL 2ITCA 1IKFL 3T1FB 1P4IL 3SJVE 4HGWB 1DBKH 3DX9B 4PJ7E 1L7IL 3GMOB 4ELMF 1WBXA 3GBNH 1NLBH 4RGNB 1B0WA 2Q8BL 2Q6WB 1S7UA 5C0FA 3HE7D 3U9UA 43CAA 1AXTL 4XPHH 3DGGA 5C07D 4LIQE 3BGAA 4TRPL 5FUOL 4YXHH 5EO9B 4XHJC 1QFUH 3RQ3A 5BCAA 1ED3A 3BPNB 4MD0A 3D6GA 4R4FL 2YOCA 4UAOB 4MXQD 1UACL 4PJHF 3VI3F 4X6DE 3VW3L 4QYOB 1OOAA 4B5EA 4I0KA 3QPXL 5F9OL 4G5ZL 1EAJA 1DANT 4TVPH 1MOEA 2QBWA 1V7MH 4GRLA 4LRNH 5EO1A 5EUOE 4Y1AA 1MHHB 4KXZH 4PJAA 3DVNA 1HNGA 4M1DL 4PB9H 4OZHF 1FYTE 4I3SH 3CFIC 4OLZL 3HNTH 1D5BA 1LK3H 2QSCL 4PJ8C 4ZPTB 4NNXA 4Y5VB 1UVQA 1UXWB 3EKCA 4UMGA 4LKCA 5EPMA 3TYFA 4IJ3C 1CL7L 2HWZH 3QQ3B 4JRWA 5E6IC 4AY0A 4YZFF 3MRQB 1MVFA 1KIPB 3ZTJG 2XZQH 4ODBD 4QYOA 2P44B 3E6HA 4LHJB 4ONOA 1P7KB 3PNWB 3SDXF 1ZEAH 2DIBA 2FATH 3LB6C 1OAQH 4Y16D 4KJPC 4Z0BL 4GKOA 2H32H 1JMZA 1E6JL 3EO9H 1MCHA 5ALCH 1KB5L 3G6JA 3NH7L 5DRWB 3LQAC 4RMWA 4S1RH 3X14A 4IBLT 4L9LC 4NRXA 5JHDB 4G5ZH 3EJZC 3GEWB 4BUHA 4Z7WB 2GAZA 3W2DH 3M1BA 4P46D 3CDFA 3KS0J 4KGLA 2PTUA 1PEWA 1R3LA 2J8UA 3SOBL 4L8SA 4Y4FA 4QOKE 1J05A 3MACL 5E1AB 3QIUC 5GZNC 1BQLH 5FA4A 4TNWF 1R5VB 4Y2DB 4YXHL 1VFOA 4OI9A 2CIKA 5ALBL 2P5EE 1LP9B 5KSVB 3MGOA 1IQWH 3RA7L 3HB3C 3P40A 3K3QA 3QXAA 5C2BL 4AQ1B 2PYED 3KJ4B 4YHPA 1S7WB 1ZV5A 4HK3N 1RUQH 1DBKL 3EOTH 1MFBL 3JUYA 3LH2H 5IJVB 4YEEA 3KLHC 4LPVA 4WHYH 3U1SH 3AS2A 5DO2D 3GM8A 5INDA 4ZD3H 1RZFL 2CKBL 4FTVD 3ZYJA 5D6DA 3RVTC 2XG4A 3E6FA 5C0EA 1ADQL 3RVTD 3VXMB 2H2SD 1QBML 3C87A 3QUXB 4X80L 3VFRA 3QR2A 1HYSC 1T4KB 3E8UH 4GJTB 2MTPA 3CSGA 5HGBB 4FZ8L 2UYLB 5C2UB 1AXIB 3C9NB 3WFDL 4NCC2 3DUSA 5C0GA 2G75B 3EYVB 3MZTA 3R1GH 1BF2A 3MLUH 1AE6L 5IB2A 4ZQKA 2EXYD 5AUMA 3RUGA 1MCBA 2C7UB 1UWGL 4P48A 3BRFA 4LQFH 2NW2B 4OD3L 4O2EA 3D39E 3GRWA 3VRIA 5SX5H 4PJAB 3BXNA 4X6DB 5CP3A 2FBOJ 3WLBA 3ZL4H 2ZWLT 1LILA 1U8JA 1O0VA 3STZB 5BRZE 4KI5F 4R7NA 1FZMA 2HN7A 2VL4A 4GXUM 5D7LB 4FQCH 3FFCD 2AKRA 1PW3A 5D9SB 4R0LC 3DX8A 3EYOB 4JPVH 3GRWH 2VSDA 3SQOL 1KJ3L 1VADA 1YEHL 2DQUH 1KV3A 2H32A 2HJLA 4DW2L 1M1SA 3UAJC 5CD5D 1VFUA 2DI9A 2YEZB 4PRIE 1SJVA 2AGJL 2VDOL 4NN7B 1ZTXL 3BMWA 2N56A 5ICXA 3T0VA 4YFEA 5C0RL 1JPFA 1XR9B 2E7LC 4GRLC 1K8DA 1C5CH 3GJFA 5T33L 1MY5A 4AEFA 1FBIL 1NC2A 2EH8H 3UYPA 5D5MF 5H8DA 4R97C 3P9MB 1VSCA 3FN9A 1ZGLM 3FOMA 3TA3B 3VG9B 1SBSL 3MCKA 5BS0D 5JW4Q 4M6MH 4YDVA 3PL6D 5A2FA 2K7QA 1GC1L 3HS0B 5FM8A 3DI3B 4UINH 2HTLD 5LJYH 4Z6AT 4E41A 4L5FL 4HUUB 3MXVL 4QEGA 3MRPA 4QRPA 3KR3L 4WO4B 1VFAB 2NY3D 4GQPH 3T0EC 5DJ6A 4NN5B 2F53A 1RJCA 3TBSA 2R4SH 2YEZA 1G9NH 5EUKA 1R3JA 1Q9LB 1S9WA 1EEUA 1I8LA 5F89B 4LLVA 5TQ0H 1WAAE 4H1LB 1FNHA 2CDEB 4LVHB 1FQ9C 3PABB 5CLWA 1YEEL 5T1DH 4DK3A 4OCSH 5BS0A 2YUVA 2WQ8A 1ZLUK 3CFBA 5JW4R 4L3AA 2V9RA 5C71A 2ORBH 3PIQA 4ORGB 4U3HA 4LAQL 4YR6B 5EU3A 3VFNB 3RUGE 1CN4A 1KPUA 3TO4C 1BJMA 4QXGL 4JKMA 4Q9BA 3TVMD 4TQEH 4MA7H 3P4NB 4LRIA 4JFOA 4JFYB 1ITCA 4YDJA 1MCSA 5IBUB 4HC1A 1X7QA 1UM4H 3PJSB 4TTDC 2D0GA 3O3AB 4NZUH 4HIEB 4I5BB 5EA0H 1N26A 3SDCD 5M95B 2JJSA 4GKSA 3FZUC 1MCPH 1AC6A 4H5SA 2Y36L 1T80A 2LAGB 4H1LA 3UYRH 4QXGH 5I74C 1XCTB 1U3JA 3FFCA 1NGXA 3I2CH 4BH7B 1K8IB 2YRLA 3GSXA 2VLKE 5KS9B 1C5BL 1NCWH 2VWEE 1S78C 2X89D 4KK5C 1RAMA 4A2MA 2SEBA 1RFDL 5DD1L 1DUZA 5KSBF 4OFPA 3OKOA 4JVWA 1M7XA 1RFDH 5DD1H 4Y4HC 4OCLC 1J8HE 1SY6H 1N59A 2FH8A 3DV6B 3MRGB 4BH8B 3VFUB 3IDJA 4DEPB 1YYML 4G9DA 3DXAA 5SWZB 5ANME 4KI5D 3MREA 1CG9B 4XTRC 2ZSVA 3ZDYF 1ZA3A 3W9EA 2O26U 4LSDA 3V6ZA 2IF7A 2DQJL 4MZ2A 2NY0C 5HYQA 4BM7A 3O3UN 4TUOB 2P1YA 5I1KH 1U3ZA 3LKNB 4LHUB 5FA3A 5FGCB 2W92A 3QUZB 4K3EL 3OR6B 3BWUC 4XCNA 4WWKA 5KSAA 1SJHA 3QCVL 4XBGB 3B9EA 3TVMB 4U31A 3LY6A 2J88H 3VXNA 4MA7L 4NKDB 1CICB 5D70H 2HJFB 4JM2D 3OKLB 3MJ9A 2O93L 5ELIA 1A1OA 3KR3H 1I1FA 5IVZA 2VDOH 1A1NB 3ULUH 3HE6B 1J86A 4J4PC 3CXHK 4R0LA 4BSWB 4HS3A 4WI7A 3BJLA 4JN1H 4GRWE 5HHVL 1DSFL 3WN5B 5DEGA 4GG6E 4MNHB 4HPYL 4N0UA 1XIWC 3L95A 4ZDHA 2PXYA 3QNYB 3DURA 4O9HH 1BLNA 1M7DB 1U91A 4YBQC 4MMZC 1D9KC 2DLFH 3NCJL 2E7MA 3SCMD 3BN9C 1F45A 1YUHB 3QQ9C 2R4RH 5GS3A 3U4EA 1W8OA 4K71B 3X14B 3ARFD 2YXMA 3GRWL 1CE1H 3BP6A 4UU9B 3MRMB 1ZE3C 4X7EC 3QH3A 3LS4L 1JGLL 4HWBA 1FZOB 4OV5A 1KCRL 5FYJU 4FQCL 4P5TC 3O11B 5BZWB 3M45A 3ZSTA 2NNAA 2RGSA 1NFDF 3OPZL 5FDWB 2YZ1A 2MCG1 2QV2A 4MHHG 4NO0A 2D0FA 3U9PH 1CVSC 2H2SC 3E8UL 3O4LE 4PTUA 4U1JB 2Z92B 5I71B 1I3VA 2B4CH 2VSCA 3ARQA 1IZKA 3PDOB 4HIHA 1JPSH 3QDMD 1LEIA 1IGIL 2QQKL 3BP4A 4NC1E 2DM2A 2VDML 4QHLA 4XCFL 1RZFH 2K3TA 4O4YL 2QSTA 2BNQD 4PLOB 4HKXB 3AM8A 4N0CC 4Z7NF 4NO2B 1FNGB 3VFSB 3X3GH 5D7LD 1X4XA 4NRZA 4P2RB 2G2RA 4U6XB 3WFDH 1BJ1H 3TT1L 2EDHA 2EH7L 3MUZ1 2XWJB 1ZWIA 4EUPH 4QRRA 1PX3A 4AIOA 5C2BH 3FB7A 3P4OA 5I8CB 2OJZH 4XC3H 4G8GA 4N9GB 1XR8A 1DLHB 3CH1A 3KG5A 2YD8A 1PEZA 2DJSA 3KWWB 3M17A 3VCLA 3VFUA 5DMYA 5TDNA 4HS6A 5KS9E 1FDLL 3OTTA 2Q6WA 1CQKA 5F7FA 3R06B 2NX5D 1BQLL 3WFCL 4M00A 3S3JA 3W11D 5AZ2H 1HI6B 4PD4J 4LPTA 2K9UA 4AL8H 1D9KA 1TVHB 3LRSB 3I75B 4X80H 5CZXC 1RZIB 1N2RB 1ZWIB 5C0FB 5GRUL 5T3XE 1HHKA 1H3PH 4PJFE 5ALCL 2NY2D 1VHPA 2LE9A 2OLDA 4P2OA 4LFHG 3QUXC 2YK1L 3QUMH 5KVMC 3ZTNL 1ZAGA 1MLCA 5HGDB 1MRDL 1FFPB 3UPAA 3DMMB 4JB9H 1G7QA 3GJEB 3RKPA 4N8VG 1WCQA 3TZVB 1CLZH 1CL7H 2HWZL 3O45B 4JY4B 5DQDH 4QGYA 2VRAA 5L0QB 4Q74A 4PB0H 3HI6H 4QTIH 2KPNA 3D85D 3EO9L 4U7MA 4OZHB 1U8MB 5JIPA 4JO1H 1X4ZA 2IQAB 1OF2A 3B6SB 3OKKA 3QQ4A 1MQKL 4OCWH 2KQMA 4X6CF 3LQZB 3PE9A 1SHMA 3VFWA 3DVNB 3VXMD 5CD3A 5FGBA 2FHBA 1FZOA 4NPYB 3CSPA 2R8SH 3ME0A 4K3HA 3EO0B 4HUMB 1P5VA 4NQVA 2BY0A 3HNTL 3ES6B 5D7JD 4F9LC 2CRMA 5TE7L 1SVZA 2WLYA 1CDHA 3O45A 2R2CA 5DUBA 1JYVA 2DYPA 5C70A 2YMXH 1KSRA 2PYEA 1ETZA 2DM3A 2VABB 3QDGE 4XP6L 4OV6F 5E5MB 4J8RB 3MLYL 5FO8A 4WFGE 3MNWB 2F15A 1HINH 1H3XA 1S9WB 1MAMH 2R9HC 3GSVA 2A6IA 3TFKC 3I02A 4Y5XA 1KC5H 1L4IA 5D93B 2Z31C 5DA0B 3REVA 1LP9A 4L3EE 5F6IC 4U1GB 3NFNA 2AK1H 5J56B 1YPZA 5L9DL 3M1BB 3HZMA 1KEGL 5F44A 3BRGC 2PKDA 5DR5H 4JDTL 3FB7B 5B38B 3OKNA 1IGJA 2C4FT 5FHAL 1VEPA 3VDBA 4LRNL 3UDWC 4UIMB 4JFZL 5SWZD 1ZSDB 2YD2A 5FKPA 2RJMA 3QUYB 1BIHA 1HDMB 3HG1B 3G6JB 1L7IH 2BNUB 5DRWA 3TCLA 1KLGA 4ZFOB 4R4FH 4IRJD 3KPPB 2H1PH 4BELD 3NAAH 4FS0A 3VD4A 1BFSA 2QADD 4CDGC 1SM3H 2GK0B 5KSUA 1SYVA 5DT1H 3WXWL 2DWDB 1G7LB 1I3GH 5DK0A 4HIIB 4WY7L 5ESAB 4XPHL 2SEBB 2HFEB 4FQQB 1FFRA 4JR9L 2ADGB 1MAKA 3F7VA 3BPNC 3SDCB 4PJHE 2EIZB 5IB5B 2RHEA 1OGAB 3NGBB 5I16A 3V95A 3O2VH 3N9GH 3MQIA 3PQYD 1B3JA 2CRZA 3MV01 4PJ9A 4PRPA 3ARUA 4QT5B 4RNRA 1IM9D 3RVXD 3RWCB 3C09B 1G9MH 4NSKA 3F7QA 5D1ZC 4ZPVA 4LIQH 1BF8A 3A6CH 5DHVB 4CMMB 2R23B 5SX4H 2ZUQB 1JHLH 3INUL 3BN3B 4LF3B 1GOHA 3D3VD 1RVFL 3HRPA 3EYFA 3VD7A 3MUHL 4Z77B 4DUXA 1TZHA 4KZDH 1PY9A 1KCVH 3CVIL 1IT9L 2WBJC 4PJCE 3GBLA 4UV7L 4PJXA 3J8F7 3MJ8A 4YUEL 4JCLA 2J12B 4P59H 3MCLH 4LARL 4DAGH 4D94A 1R24B 3TM6A 1DQJA 2W59A 4PRDA 5ADOH 3KPMB 1I75A 4R4NC 5IT2H 4GRWB 4NM8L 3MRBA 3ESVF 2YWYA 7FABH 1AFVL 1L0XA 1R5WB 4P9HL 3BQUD 1Q9KA 2BY3A 3LKPA 3UYOD 5ACZA 4U1GC 2NY0B 4CU6A 3JV4A 3X17A 1LO3H 1KB5B 5CSBA 4JM2B 5AWNL 3CFCH 5LGHL 3QDJE 1FYHB 4GRMB 3JTSA 1ZHLB 2VN7A 1PLGL 1SEQL 4G6JL 2B4CC 4I0PC 1T6WA 4DVRH 2O5XH 3UO1L 1A6AA 2DQTH 1VPOL 4X9GA 4JRYB 4PJFA 1NKOA 5GRZA 4HFUH 1AKJD 4J4PD 2FWOB 5H37H 4HQQH 4KWUA 3TH2T 2LABA 4AEHL 3IKCA 3D25B 4O2FB 5EZOL 5BV7B 2X1XR 2FIKA 1MIEH 5MI0C 5DA4A 5J13C 3BRDA 4G8FB 2BFVH 4FQIH 3S37L 5FYLH 2J7LA 1CGXA 4QKXB 2AV1B 2CQVA 1AXSA 3AREC 4S1QL 5D2NA 4ZFFA 1KJ2A 2W0FB 4DJMA 1E28B 1DL7H 3IDIA 3LPGA 3ULVE 4EXKA 1FLTX 2DS4A 2PXYC 4P99A 5GSVA 4B7IA 3RWIA 4P2RA 1UXSA 1N5AA 4ISVA 5JZ7D 3WFHA 3BDYL 1AGEA 2ZNWA 3ARRA 1VDGA 3VG0L 3PG2A 2NW2A 1IEAA 2CLVA 3LPWA 2VYRE 4N1CA 4TSBH 2B5IB 2DKUA 1KACB 3BQUA 2Z8WC 4NWTH 3ULSA 4YXKH 1QR4A 4M5YL 2YKLH 3UDWA 3WHXA 2NY4B 1FHGA 3GGWA 5T1LD 1JFQH 5GGRB 1DUZB 3BX7C 3L7FA 3V8CA 5HDLA 2E7LA 4HJ0D 4JFEA 3QDMB 1JFQL 2EDQA 2R1YA 2VERN 2IFFH 3RGVA 2JIXD 2PTVA 3GSWA 3PWUA 2YWZA 3MV7A 4ODUB 1NL0L 4M3JA 3MRHA 4Z78B 4ZAKB 1A9EA 1TZGL 4D0DB 2BOCB 3ETBF 1D5XA 2F58L 1UXSB 3S37H 4ELKB 4LF3A 3C6LC 1Q9WA 1N8ZB 2FB4H 3RVVC 1J18A 1R3HB 4MWFB 4F2MA 1YYLL 5CP7B 4HXAL 4NQXB 5LGHH 1CF8H 3QQNA 2WSKA 5ID1A 1UZ6F 3BZEB 1RUML 4JLRB 3MNVA 2IH3B 1J88A 3H9SA 1DQLH 3ULVH 3HI1B 3QULB 2Y1VA 2AJUH 1F4AA 5BZDB 1DL7L 4WCYH 5H35B 2EDFA 4AENB 2EICA 4J2XA 1VEOA 35C8L 4PV9B 3QIBD 3C5JA 4JEGB 1AFVH 1K4DA 4KDVA 2NTFB 5DMKA 1RIHH 3ULVC 3UO1H 4CNIB 4QHKJ 4LU5H 1NPUA 1I9RL 4OBSA 2EYRA 3MCLL 4U1LB 1L6ZA 4A6YL 3E2HC 4R9HA 1I8KB 1F4WL 3BHBB 1U42A 3FB5A 2ESVE 4P2QD 1PFCA 3EDEA 3QUZA 4MNGB 4UOW0 4XNYH 4GKZB 3QFDB 2JCCB 3LKOB 4ALAH 4GAYB 2Q1EA 3ARBB 3UMTA 4UILL 1I85C 1XF2A 2A6JB 1SEBA 4Z7UA 3P77B 1INQB 1UYWH 3DXAB 5SWZA 5ADOL 1QFWI 4AIZB 2EYTB 3HC3L 5AWNH 1EHNA 2L7UA 1EJOL 5E8OB 2DICA 2UV3A 3H8NA 4P2RE 4N90E 4WTZA 5E7FA 5DD3L 1F97A 3WV0A 1G7PA 1RVFH 1QR1B 4G43B 4JGUA 2P5ED 1OSZB 6CGTA 2VXTH 4RAVB 5FDWA 2BVQB 1VKXB 4X9FA 3THMH 3GHBL 4IRJC 1G9ML 1FNLA 5J8OA 4XP5L 2EKSA 2IBBA 5JNYA 2ICWA 1K8IA 2X4SB 2V5RA 3HE6A 1IQDB 1U8QA 1L9MA 1NGQH 3MV7E 3C5ZD 5F7WC 3B9KA 1K85A 2P5WB 3QUYD 2UZIL 5A16A 2BSRA 4NZRL 1JGVL 3L5XL 5IMLB 2DTMH 2WBJD 1FP5A 1KN4L 3WDJA 4OD2A 4U6TA 3MLRH 4GW1B 4G8IB 3B8SA 3DHMA 1U91B 3W0WB 3IU4H 4NFCA 5ILTH 3N9GL 4QXWA 1KULA 5GGVL 5E4EB 1U8NA 3U83A 5KSBE 3SJVA 3O41A 2WZPD 1IBGL 4UTAH 4JR9H 1MRCH 1EUTA 1ZVYA 3BEVB 5E8NB 2LU4A 1I85A 1QRNA 4PRHD 2W9LA 1U3HD 2DQHH 1HOCB 1NCBH 3VXNB 2KDGA 1UJ3C 3KHQA 1S7VB 4NOFA 2P24B 4BQBA 1MFNA 3DX9A 3FONB 3AS3A 3AB0B 5DR5L 4M93B 3RZCB 4WW2A 3H7BB 5E6ZA 4ODXB 5H2BB 4P46C 4LHUG 4N0YH 4Q9RH 3B9DA 3GMNA 1A3RL 3KJ6L 1U8HA 5D7JB 4LOUC 2CUMA 3AFLA 4PRAB 1LP9F 3DIFB 5FECA 2R2HB 4N68A 2I5YH 3MV8D 3MRDA 1ZS8B 3QNXA 4AMKH 3CZFA 5F72S 2B1AL 4MNHA 3D39D 1D5MB 1CD9B 2ICEB 4NQDB 4JDTH 2YA1A 5C0IA 1YN7B 3BZFA 2IPKA 2LU3A 5CIPA 3T8XA 2F53E 2QHRL 3QG6B 1MRFL 3D3VA 1V5JA 1KIPA 4NNPH 3QI9B 2OI9C 3HI6L 3KPSE 3IU3B 4UIKH 2A6JA 2X1WL 3HUJB 4RFOL 3H3KA 1DLHA 4M62L 5CJBA 1MFCH 2YHGA 2P8MA 1AY1H 4ZOBA 3HC4H 3R06A 5JHDD 3WFEH 5TE4H 3WMSA 1PVHA 4X9IA 5IB3B 1JRHI 1FL5B 3MODH 2BP3A 5KBNC 2AS5M 1X6NA 5IBTL 4RQQB 3HRZA 5KVGL 5DUMH 5EDXA 4U6VH 1QR1A 1HZHL 3VD3A 4NPYA 4ZOCA 5IIEB 2XICA 5LG1A 5HYJD 3DVGA 1QHPA 3BP4B 4QHLB 5DQDL 5IFJA 1Y6NR 5FM5O 1HQRB 1CLZL 4PS4L 2PO6D 2HT4D 3TPUB 4OFDA 4P2OB 4K8RH 4PJDE 4OCWL 1KXVC 3N1FC 4AL8L 2FHCA 4YGVA 3BKMH 1NAMA 1EDQA 4XBPB 5I1GH 3VXME 2RCSL 4LCYA 3VWKB 3QT2A 1WTLA 1FNFA 4NNPL 1WV7T 3WLWD 3D0LA 5EIVA 1A7RH 2L4OA 2RB8A 4D0CB 4HWUA 1NEUA 4OGYL 1R0AL 4QOKD 1NDGB 2ADIB 4GUPB 4M03A 2JKXA 3EW3B 2D7NA 4KJQD 1I7TA 2XQYG 2XKNB 4YX2H 3ZKSD 5LWYL 5GSRA 5GRJH 5CEZD 3IFOA 1A8JH 3W11C 5INDB 1E4WH 3QUML 3U7AA 2YSSB 3F6IA 5E4IA 4RGND 1QYGL 3ARVA 4JQXC 1I7RA 1TTGA 4YHPB 1ZLWH 5I30H 2F19H 4QNPF 3QUXA 5SWSE 1BQHA 1Z9LA 4N1EA 1HDMA 3NFNB 5C8JB 1H3PL 1RMFH 5D5MB 4XAWH 3HZMB 3VRLE 4RGMB 1HK6A 4EOWL 2IG2L 3I85A 1LDPH 3CCHA 4PJIB 4UT7L 1YNKH 3F7YA 4NYLB 1JZ5A 4X98A 5LAXB 1DBBL 4PD4K 1OHQA 3UJTL 1I1AC 1I7TB 2Q7YB 2OSLA 4XT1C 5JOFB 2C1PB 3GMNB 2A6DB 4J3XA 4X8JA 2DLEA 2NLJB 3GM0A 1IBGH 2P47B 3AM8C 4UUJA 5E0QA 3F58H 4TSAL 1Q94A 2X4NB 1JGLH 1T04B 3IJYB 5J6HA 1C08A 4HPOL 2A6IB 2KL6A 3KAAA 5F21B 2BRQA 2QL1A 6FABH 3PHOB 4RWYH 3RNKB 3TEUA 2OK0H 4UTBL 3DYMA 1IGIH 2QQKH 4Z18A 1YEGL 1JF1A 1KOAA 3B9KC 3L5WB 1AHWB 4XPTL 2ENYA 4M1GH 1HKFA 1OSPH 4YHLH 5EZIL 2C7UA 5C0BD 4X98B 3NFSL 1IC5H 4ZPVB 3FO1B 1NGZA 3OGOE 4RFNC 1JPTL 5SX5K 3SGEI 1RPQA 2Y7QB 4WW1A 2D31B 1BAFL 5C0ND 1NFDA 3QULA 1ZHBA 3MRJA 1A2YA 3QHFH 4XPGH 5F7HA 1JPSL 3T2PA 1N64L 3QIBB 5HDQL 3SCMB 1A4KA 1J0IA 3G6JE 2OL3A 4JHAL 2VXTL 2DLFL 3NCJH 2G75A 4V2CB 1ADQA 4OF8A 2R2EA 4YK4B 1MIMH 1NJ9A 4LLMB 5IK3A 4HPYH 1MLBA 1RZ8B 1Z9OA 3LS4H 3G5ZA 5C1MB 4GH7B 1QFWL 2HFEA 5F8RC 1T1YA 3Q0HA 2ZP0T 2JCCA 3LKOA 3MJ8B 2NY7L 3RX8A 3T4AB 5C6PB 3AAZB 3QDAA 1BP3B 4WFEE 4ODSH 2VXUH 3PGCA 1FL6A 5JXED 3G6DL 2HFTA 5D2NE 3SDXE 5F89A 2HVKB 4PBWD 3BZ4B 3IAGC 3HFMH 3CXDH 4HD9A 5D70L 2VE6B 4OZIF 5EOCL 5J11B 2NYYC 4Z76A 2UWEF 3LEYL 5GS1C 4BSJA 3CK0H 5DD0L 4LAJH 3JV4B 2G5RA 2BMKA 3U7YH 5DRNA 1HWGB 5FKPB 5GJSL 2GT9A 1A7PH 4G6KL 5DRXA 2NXYC 3A0OA 4RX4A 2APWA 4GRMA 1Q9LA 4S0SD 4TUJA 1MCEA 1P53A 2VXVL 4FXKB 1I7RB 3U82B 3ELAT 4KQ4H 4YFDB 4L4VB 4F37F 1A02N 4MGXA 4ZG1A 1DVFD 3T4AA 3RBGA 3FB8A 4GBXD 1YYMH 2Y36H 4KK9D 1DQLL 3ULVL 1BVLB 1I8IB 2MMXA 5IVNA 4NZUL 4U1IA 3BZ4A 4UI2A 3FQUB 2O61B 1J0JA 4HXAH 4QLRA 4NQSA 4HUUA 1NGXB 4XC1H 1CTNA 1GZPA 3G5VA 3NCFB 3SDCC 4LCUB 4U05A 3STZA 4OD2B 2ZOKB 3QXUA 2OR7A 2ITDB 2BVUA 5B4MD 2CDFB 4DGIH 3F8UB 4QWWC 2OYPA 3RWCA 1YMMA 2IFFL 4LEOA 3T77A 5DI8A 1WCBB 2NY1C 5BOZG 4TVSa 4GAJH 3WHXB 3WNPA 4JREB 5J1AB 3NVQA 2E3VA 4NWUH 3HE7C 2ZUTA 4JFEB 4XPFL 5H94B 5JPMB 5FYLD 1C5BH 4BUGA 1OL0A 3MNZB 3WD5H 1T89A 2GSGB 1KNOB 3WS6C 1DBAH 1DFBH 3HCVA 3TBYA 3ULSB 4PG9A 2CK0L 5I17A 1Y18A 4MVBD 1NFDB 4NQCB 1I1YA 2EC9U 1J1XH 1U93A 2P48B 5FEBA 1KYOK 1M05A 1KJVB 3IS0X 1GC1H 1T6VN 1I4FB 4EN3A 4M7JH 4WHTB 1SBSH 3OWEA 3T77B 4S1QH 3QZWA 1P7QB 2QQLL 2C3GA 3S4SA 5E6ID 1XCTA 1VFAA 2AERT 1MCOL 5DWUH 3RTQB 4XWOD 5EBWA 4W81A 4KTDH 1BZ9B 1G9NL 3VH8G 2X4TA 1K4DB 2Y4SA 1H5BC 3VU2A 4YGAB 4N0CD 3LQAL 1GGUA 2XRAH 1XH3A 3MXVH 3DVFA 4ODSL 1ZLWK 4ONHB 3PL6B 1L7TH 4OCSL 1RZGB 4S2SA 7CGTA 4RRPA 3R8QA 4H0GA 4TTGA 4PGBB 1IC7L 1QSED 1VPOH 1IEHA 4C58B 3O6LH 3WLWC 2EC9T 4GW5B 1RUPH 4OCNC 2D7TL 5EC1B 4L3CB 4Z7UB 3WE6A 3U0WL 2NCMA 5C0RH 1DN0A 1OTSC 1FG2A 3S97C 4L29A 1HE7A 4JHAH 2Y07L 3RAJL 2W60A 2AJYH 4KUCD 4I2XA 3SE3A 3G5XA 2YN3A 1UWGH 3T09A 3Q2CA 1LGVA 2CO6B 5TDOA 3E1F1 5E8OA 4MAYA 4WI5A 1YMME 3ZDZF 4NC2B 5ID1B 1K5NA 3IETB 1JV5A 4MAUH 3ARGC 3VRJB 1LO5B 4M7ZB 3GFUA 1ZLVH 3GSOB 5AYQA 2EH8L 3H42L 3SGKA 3V6OC 1INQA 1T89C 4KKBC 4FN0A 5DD6B 3QO1B 4Y4KA 3RY4A 2JJSC 1ODAA 1CGWA 2XTJC 4K94H 5C3LD 3QDJD 4ZUWA 2D7QA 5DZLA 3QDGA 3TP4A 4JANA 4UQ2B 5IR1B 4P3WA 3CXHJ 2CRYA 1OAYH 2W0PA 3T3PE 5CSZB 1QSFA 4HPOH 2RIKA 5CJOL 1MI5D 4JAMB 2XKNA 4TSAH 5TPWH 5DGRA 1EGJH 3QI9D 4PBXA 4JKPH 4RGNE 3H3PL 3LH2L 2BHYA 5I2IA 4G8GB 4XNXL 1LD9A 3EOTL 4ORZC 5D72H 4F3FB 2EDNA 2P7TA 5IG7B 1T1WA 4Q2ZA 3C8KA 1O7VA 4OD3H 4JDZB 1RZ7L 2X4UB 4MD0B 4PJBA 3RA7H 3SEPA 3ZTJH 4EI5B 5HSFA 3LSOB 3SPVB 4BKLB 4NRZB 2YZ8A 2ZCLL 3RVWC 1A9BB 5HJ3B 1DVFA 2HKFL 4M7LT 1KB9J 4L1DA 3CZJA 2DM4A 3T0EE 1TXKA 4JAMA 5J06A 1PG7X 1Z9MA 2C1PA 3BGFC 5IHZA 4NRYB 5GGQL 3KYNA 4HUNB 5KOVC 1DBJH 4RMSA 3IFPB 5ISZA 4XXDA 3W9DB 5GISL 2BX5A 5H2BA 2J6EA 3ZYZA 3ROOA 2X4SA 3QCUL 3GI8H 4GXVL 3ARGA 5DF0A 3KPRE 3GMOA 1FSKC 2OQJB 2X2YA 4IJ3B 5JUEL 3U9UB 43CAB 3WO4B 1D9KB 2BSED 3SOBH 3LKQB 4RCAA 3IS1X 3KPRA 3BPLC 5A2IH 5AG9A 2DLIA 3BESR 1GC1C 5FOBB 4FQHA 3VXSB 3I6GB 2V9TA 4F7CB 2CPCA 2XIDA 5F9WB 1CE6B 5D7JC 3HE7A 4NN6B 5KSBA 4MJ6A 3G6JF 1JYNA 5KVGH 3OAUH 4K7FB 1KPRA 2NY3C 2WIIA 1U58B 3OKDA 4LKCB 3GSRA 1D6EA 1MCFA 5IK3B 3TN0C 3WFEL 4JFPA 5F9DC 1YY8A 1QA9B 5INCA 3LKQA 4HLZG 4MJ2A 1T1YB 1A7QL 1AR2A 3S8WA 4X4YB 1UZ8A 1KB5H 1F6AB 3TGXA 3O6KL 1LK3L 4OF3A 4JCMA 5GQBA 5T1KA 5FYJH 3T0EA 1D5BB 3KYOA 1DZBA 4JZOA 1RZKC 3DUUB 4W6WB 1H0DA 4KROC 4QF1A 5D6CA 3ALXA 1TNMA 3O8XC 5IR1A 2DL2A 5JHDA 5JUEH 5HGHB 5DVKA 2KZ1B 1JGEB 5CINH 4OZIE 1QUNA 4M93C 3IGAB 3RZCC 1B4JL 2BCKB 3P4MA 5FYKD 4AQOA 1Q0YL 4Z5RA 5DS8A 4DTGL 1BBJA 3F6LA 3LRGA 4UDUA 4YC2C 4I3SL 5FCSH 4M1DH 4PB9L 3V8OA 1MRDH 3C60D 3S98A 4FTVB 3D39A 1SYSB 1KEMH 2V5TA 3U0TA 4HZLA 3LS5H 4YDLB 4OZFA 1OP9A 4LPXA 1IGCL 4FMKA 4R90L 5DJ2B 4XWOC 1HHKB 4EDXB 4OBRA 3O9WC 4Q9CA 1G1CA 3MZGB 3O6MH 4M48H 3QPXH 5F9OH 5CHNB 1AXTH 1RUAH 2VJXA 1RZ7H 1MVUB 2GSIA 1DUYA 1EO8H 2DD8L 3OV6A 3NZHH 1HQ4A 3RGVC 1KTKE 4NNYB 4BZYA 5IEKA 2BNQE 2VIRA 4XNXH 2OTUB 4EI6A 4NKIH 2R2HA 4FFZH 2WWMD 5DXWA 3W5MA 4GBXC 3WFCH 5HYJE 2ZCHL 1FPTL 4MZ3A 2A6DA 2B1HL 1U36A 4GXVH 4YGVB 4KK5D 3QWRD 4WNQB 4F8QA 3ESUF 5D5MA 2EDJA 5FM4A 3RVUC 3V5DA 2PW2B 3GMQA 3VI4F 5CIPB 3L1OH 3ZKND 4F9PC 1JWMA 1NLBL 4Y16A 2CMRL 1KJMA 1VFMA 4HW6A 1XGYH 1N0XH 1EJ6A 1QLEH 1ZLVK 2Z93A 1KIRB 5HY9B 3MR9B 3BWAA 4PJBF 1CWVA 4NJAL 3U7WH 1H15A 1FVEB 1QFOA 2HKFH 3OHXA 3VXOA 4Z77A 3G9AB 3CC5A 1ZT7B 2VLME 3HG1A 1F4HA 3I6LD 4WWKC 1MFEH 1I9JL 1QNZL 1NEZA 4OI8A 4POZC 4R97B 1T7VA 2EDOA 1P84J 4L9LB 5IFJB 1NMBL 2FX7H 4NP4L 3UTZB 2X44D 3IDXL 1FJ1B 4PPTA 1EGJL 3TPUA 2KZWA 1PX4A 1SMOA 5MP6L 4JG0H 4NN7C 4E9LA 3K74B 4I0PD 3FKUS 1YQVH 2VL5A 4KKBD 5F7DA 4ODWA 2YPLA 4RDQG 4UILH 5T1KB 5D5ME 5KANI 1MUJA 3D9AL 3KNBA 2AW2A 1WVZA 5LBSL 1NMCB 4C56A 1K3ZA 3UTTA 5IMMB 4EI5D 5SWQB 5CEYB 1Q9KB 5DFTA 5IJKA 3RU8H 4X6EA 1F6FB 1JGEA 4Y8AA 3NPSB 4OZ4B 4O02H 2J1KA 5DHVA 1CIUA 1AJ7H 1QBLL 3MJ6A 1DBMH 4LU5L 3EZJB 2ERJC 3D2UB 4MA8H 5DWUL 3SHSA 1QVOB 2X40A 3IKCB 4JN1L 5I15L 1T2QL 35C8H 3EDJA 3TN0A 2DTSA 5TE6H 4MA1C 1EUUA 4D3CL 1RJYA 3D0VA 4U1SB 2Y06L 4ODHH 4CADA 5J1SC 5F7EH 1BIIB 1RULH 2YA2A 3P9MA 3SKJL 4KKAD 2AP2A 4HGKC 3GMPA 2H9GA 1J1XL 3RX7A 1RUKH 2NX5E 5DD6A 2APFA 2D7TH 1NMCC 4RGOH 3LAFA 1ZANH 4BZ2H 2NY5L 3MLXH 1A6ZA 4CBPA 4QRUA 4X5WA 1MCNA 1I1AD 5I1LA 5DHXB 5F1IA 1MCJA 3NFPA 1NCCH 3IDGB 1JK8A 5JHLH 3FJTA 1V3MA 2FX8L 5T3ZH 5J6HB 3OKOB 3V0AC 2PF6A 2FIKB 1UKTA 1IJ9A 2HT3C 3MGTA 2R29L 4W68A 4RA3A 3BEWA 4G6FB 2V17H 2J6EH 3AS0A 5FO9B 1ONQA 1II4E 1MCWW 5DRZA 4GS7C 4U1KA 1LO4L 5F1IB 5E2TH 1A21A 2BMKB 4MS8C 2OXHA 1UM5H 4HK0B 3U36A 2CK0H 3GGWB 3IDJB 4XBEL 5JOEA 4KK6C 1G9MC 3SDDD 2IANB 3GDBA 3D5OF 4F58H 5DTFA 2ICES 3SDDA 1NCAH 4DGYL 2I07B 5BVJA 2IAMC 2FX9H 4HX1B 3LCYA 2DIAA 5CZXD 1KGCE 3LD8C 5EO0A 4L8CB 4LLQA 4OF6A 5ESQB 2EDBA 3TJEL 5EZOH 1QKZH 3KJ4C 4M7KH 3CK0L 3DPBA 5FUCE 3RGVB 5E24E 1Z5LB 4OLXH 4M1CC 4YHMH 1N3NB 2APXA 5E2VL 5MERA 3KVQA 5T3ZE 2GSGA 2BOCA 4DGIL 3BP5B 3P73A 2EO1A 1MHEB 3K2UL 1HWHB 2VXUL 2O5XL 4XGZA 1U93B 4G6JH 2HRPH 1OGAE 3MLSH 4G3YL 5JLZA 4QHKI 3HTLX 3TIDA 4F9LA 4ZNEA 5TQ0L 3SO3B 3C9NA 3HMXH 5C0BE 3EFDL 1URLA 1AKJA 3NGBC 1LK2A 1XGUB 5BO1L 1WZKA 4GG6F 2Q87A 3BPOC 4OZIA 5DC9B 4LFHD 5FYKL 3UTSD 1P7HL 1XZ0B 1RSFA 1P4BH 1T2XA 5B8CA 3GSQA 4XVUD 1C16B 4Y19D 3HZKA 4YFLF 4MNGA 3CDCA 2XTLA 3CFDA 4MD4B 1EFXB 4PRBB 2IQ9L 2NZ9C 3OKMA 1B90A 2X1QA 1P9MA 2Q3AA 5E99H 5T3ZD 1FNAA 5HHMB 3TBVB 4JRYE 5BMFH 2FLRT 5I1LB 1UB6B 2JJTA 1BZ9A 3PP3K 1HCVA 2DL9A 3CSYB 4ZNEE 5DLMH 4HIHB 1LEIB 3IFNH 4MQSB 2J8OA 2GJZA 1YPZE 2IGFH 3GNML 1EBPA 3OJMB 1I1CA 5B8CB 1DP0A 5GZOD 4S2SB 5J13B 4OQTL 1OAXH 4N8CL 3RTQC 2CIIA 3ZKNC 4ODTH 3DSFL 1LVEA 2UWEA 5IESH 3HI5L 3P0GB 3W0WA 4OV5B 1I3GL 3LEXB 1FN4B 3L6FA 3WXWH 1KBGL 1DBBH 3MUY1 4JN2A 1YEIH 2DOCA 2P49B 4JE4B 5T1LB 2MQ3A 4EDXA 4JY5L 2F74A 3DHJA 1MCIA 3VFVB 4CW1A 1S7TB 2DWEA 4AEEA 3KPQB 4PV8B 3VCLB 4DZ8B 4KI5C 2OXGA 5CEXB 5E00A 4WENB 1PKQB 5EWIH 5I1IH 9CGTA 3C5JB 1FO0L 1JPTH 1T0NA 5D96C 2BVQA 2N7AA 1I1RA 4FZEL 4WI3A 2VQUA 1DVFB 4LDLB 1U3HB 3G6AB 1U92A 1S5HB 3FAXA 4ODVH 2C26A 5E9DD 4LLYA 4ORGA 2XXCB 1I7UB 2P42B 1UKQA 3HB3D 3GJEA 2GYSA 1IGTA 3VI4E 3ET9F 3VXTB 2AK1L 5IB4A 2RCSH 3NCCB 4GG6B 3BD3A 3I75A 2B7DT 3WCYA 5CSZA 4BFEA 5L0QC 3NPSC 2NR6C 5CEXA 4PJBE 4PYHA 1Q8MA 1OWRM 1RUQL 4G8EA 5K9QI 4APQC 4AIZA 4CMHB 3UJTH 2O5ZH 5KTEL 3MV11 2X42A 4XP6H 2OMNA 5D1XA 3EO1B 3U6RB 2IG2H 3VMNA 3D3VE 5JXAL 1JNLL 2EYSB 2XPGA 3ROOB 4WJ5B 3F62A 4FRWA 4YHKH 1A6UH 1QSFE 3QQ9D 1NCDL 2EXWC 2F19L 3L7EA 1PAMA 2IEPA 2GFBA 2B0SL 1QYGH 3H0TB 2FEEL 4IOIB 1UJ3B 1YN6A 2R0KL 2YR3A 2GUOA 4W6YB 4OFYA 1FIEA 2NXYB 4DOHE 4GG8B 4M43H 5DUBB 2B2XL 3D18A 4IM8A 1RD6A 4WO4D 4NM4L 5GGUB 2R39A 1FZJB 4UB0L 1YN7A 3BZFB 1MQKH 1S9VA 3E0GA 1JTTA 3MJGX 1WC7A 3QB7C 5KG9A 3I6GA 3HMXA 4NC1C 4GLRI 2GJ6D 3I6KB 2FH6A 1E6JH 2P5WA 2FECL 4NRXB 3VA2C 5T1MB 3ARGB 4QRQB 1CDJA 1CZ8L 4JB9L 1H3UA 4FQJL 3UTTE 3V0WL 1RZKL 1CGVA 1HQRA 2AEPH 3ARPA 1N6UA 1GGCL 5HHMD 5HVHC 5IKCB 3IGAA 2FBJH 1GGIL 2V7NA 4K7PY 1OCWH 4YBLC 4X6CB 1NDMA 1A6UL 1QRNB 5F1NA 3BUTA 4J8RA 3HZVA 4PRHE 5GRUH 4QF1B 2OL3H 5D6CB 3VFTB 1EHLL 3LSOA 2QQNH 4XP1L 4Z95H 3TCLB 2UYLA 4ZO6A 1CE6A 5HVWA 3QEHB 3KXFB 5DEGB 2DWEB 5DFVC 2VWEC 5D1QD 1MWAH 4BA8A 4G42A 3OKEA 3G04B 2AVGA 2CXGA 5IIEA 4P2OD 4KK6D 1MFCL 2JJTC 2VITA 3O81A 5DVLA 4HCRH 3SKOB 4XAKD 4Y4FC 1WAAF 1FNEB 4UTAL 1QZ1A 1X9QA 4KKCD 1XT5A 3REWB 3L3IA 3SE4A 1KN2H 1J1OH 2GCYA 3QFJE 5F8QC 3V5HB 3BPCA 5IW6A 5IF0B 1QFUL 2Q8AL 3RY6C 4Q6IA 2VB5A 1T4KA 1M4KA 2NY2C 4AZ8A 1A7NL 2GJJA 3EDFA 4P5MA 3G5YB 4ZOAA 5I8KL 4MQXD 1IAOA 4IOFD 1HH6B 1LO2H 1T0MB 3STLB 4QOKB 3PHOA 2Q8BH 4HAGA 4ESKA 1YJDL 3EHBC 4LSQL 1PDKA 2PW2A 1HSAA 4WWID 1HXYB 5CBAB 2Q7NA 1CD0A 2FGWL 2VTFA 4X7TB 2FD6H 4Y88A 4MX7B 1KBGH 4WU7A 3WJLA 3WNKA 3JBG7 2G2RB 1KELH 5FYKE 3QFJB 4MJID 3MXWL 1ERNA 2NXYD 2WUBL 3UZQA 3OG6B 4O5LL 3C09C 5EZLA 3H9SE 1EX0A 3FT3B 1L6XA 2OZ4A 3H0TA 1CT8B 4NQTA 4G9FB 3HMWH 4WIQA 3GNMH 5JQ6L 1IAOB 3BVNB 4OKVA 3MA9H 2HJLB 1NGWB 4WDIA 4X6DA 3V2AR 1UB5A 4JHWH 4E0RA 4KMQA 2VLLA 3O3EA 2Q7YA 1DE4A 3MJ9L 4R7NB 1AGBA 2VR5A 4G6MH 2L7JA 1JUFB 2FZ3B 4RA0C 4XRCA 5C08A 3N1PC 4O9HL 4KROB 3T0ED 2DMKA 3EDKA 4KTEL 5T3XD 4GQ9H 3DTXA 3VFOB 3UZEA 4C54A 2VZUA 3ZSSA 5JPNA 1CICC 4YR6A 5FHBL 5IMMA 5ITBL 1VFBA 1I9RH 3SCMA 1NUFA 3ULUL 2YSSA 4Q6IC 2VZOA 4KMTL 5HI3C 1IEBB 1U95B 2AK4E 1EPFA 4K7PX 4XH2B 2MQCA 2VLLB 3O3EB 1KLUA 1X44A 1FVEA 1ZHBB 4MD5A 5F1NB 3IDYC 2X5PA 4LBEA 5DD3H 5DJ2A 4P57A 5AEAA 1CR9H 3PWPB 4MAYD 3EFDH 5L6YH 1KCUL 3ZMRA 4HKBA 3WKML 4HWBL 4OTXL 5I1KL 2F5AH 1AR1D 4CVZB 1UA6L 4PRNB 5T5FL 3DJ9A 3PXHA 2IALA 3C6SB 1E4XL 4K2UH 1KIQA 1YEFH 1TJHL 4P4KA 4PJDF 4UT9L 4D8PB 1MSPA 2VLJA 3WEXB 4BSVB 2LAAA 5GGSY 5KSAD 5DEFA 3UTSB 2BOBB 3VFWB 5KVFH 2D03H 5GSVB 4DKDC 5F3HA 5FCUH 2CLZB 1GGBH 5LXGH 1N5AB 1NFDE 3CX5J 5C09E 4X83A 4QRRD 4OT1H 1S9XB 5HI5C 4DK6A 2O61A 4Y4FB 1VA9A 1EV2E 4KUZL 1FH5L 1D5XB 1C1EL 3G5VB 1WK0A 4F33A 3RGHA 1H15B 1UQSA 1O7SA 3O6FA 2DKSA 4Z7UF 3RBSA 3KLHD 2AJUL 3D2UA 4Q58C 1E0OB 3OJDB 3CUPA 3MGOB 3K4ZA 1BJ1J 3VXRE 2ZKHL 4YPGB 4NKOA 4APQB 5IMOA 4Q6YA 2A73B 2A83B 5DYOA 5JTWA 1I9IL 3BISA 1KJ2L 2V2TB 3OF6D 4PV9A 1NCNA 1I7UA 3MREB 3WKNA 1DQDL 3MRLB 3CFEB 3CLEL 4IRZL 4JRXB 4AEHH 3VXTA 3BZEA 4K8RD 3GHEH 5I17B 4ZXBC 3WDIA 4P3CL 4LKXA 1NCCL 3HNSH 4JQXA 5FK9B 1FO0A 4NWTL 5CWSA 1KJVA 3L3KA 2DQTL 2EIBA 4CMHC 5DHYA 4LLDB 2L0DA 1SEQH 1K9TA 1Y18B 3C2AL 4MXWL 1NMAL 4FFVC 1MHCB 4X99B 3I6LE 3BW9A 3MFFA 2AKRB 4KRLB 4P49A 4JZJA 5D9SA 4Y16C 1RULL 3SKJH 5E4EC 3HPLB 1HILB 1FNSL 3P30L 3ZZ1A 4KRNA 1ZVHA 3KPOB 5ANMA 1YNLH 4POYA 3EYSH 4JRXE 4XH2A 1G7PB 4ZUSB 1P7QD 1FBIH 2BFVL 1X5XA 2OTWA 4BQCA 5GGUA 3ZE2F 4DAGL 5K9OA 5C09D 5I1DB 3GKWL 1NAKL 3PP4L 2IANA 2EYTA 1FAIL 1Q38A 1RK0B 4GXUN 1KPVB 5F88B 5MEND 1RQ5A 5I1JL 1KT2B 3HAEH 2XTJE 1L9NA 1MHCA 5LBSH 4YIQA 2FDBP 3QO1A 1JHLL 4EKXA 4L29B 2ZPKH 4XNMA 5JDJA 4D8PA 3BH9B 5D2LE 3LHPH 5FGCE 1YQVL 2R0LL 4RDQF 4XZUB 4HJ0C 1GAFH 3WUWA 4IRSD 5EIIB 2A9MH 1X5KA 4JZNB 3CVHH 5B38G 1NC2B 2BSTB 4QY8A 4P4KD 4M4PA 3ARDC 2AXGB 5FFLA 1C16A 5CEZE 1AI1L 4NFDA 4MDJB 4MD4A 5TDOB 3ZKQD 5DJCA 2P8LA 5DMJB 1H8SA 1A5FL 1RHHB 5J3HD 1KPVA 5F88A 3R1GL 3IF1A 4YHNB 5SWSD 3O41B 5E6YA 1NMAH 1AKJB 3KGRA 5A16B 4OZGF 1B6DA 5KVDH 2QQQA 4M6AA 3NAAL 1MWAA 3EOAB 4FZ8H 1FGVL 4H88L 4P3CH 2FEEI 1OT2A 2PYEE 4R8WH 2F8XC 1JF5A 2E27L 4W4OA 5D7IA 1N0XL 2BSRB 3EYUL 2BVOB 4LCCB 1UM6H 3VXSD 4KKLD 2R1XB 5EO0B 4S1SH 3CLEH 3K81A 2HT3D 3K1KC 2GJ6E 5IW6B 3U2SA 3P9LB 4P2CG 2XZZA 3OGCA 3MYJA 1FYTA 5HGGS 5FHAH 4S0TD 4LVOC 5HBBA 1KTDB 4U3XA 1F3JB 1YDPB 1FRGH 5C0JA 5IV2B 5J11C 3TC9A 1RU9L 5EH1A 1BVZA 4I1NB 4TUKL 2IAMB 4PFEA 1TJGH 1BX2A 1HHIA 2GJZB 1E28A 2WAHA 5DMIL 3VXUB 5I75C 4BH8A 4Y5VC 1XF5B 4MJIE 5GS0L 4RBPK 2F53D 4PJ8B 1WEJL 3LMJH 4AT6A 2X4QB 3C5SB 1LE5A 4D9QE 5LQBL 5GXBB 5I18L 2IMMA 3KYMB 1GGBL 1P9MC 5LXGL 2X9YA 4PRAA 2IH1B 4C56D 2YC1B 4XMPH 1I3UA 5D2NC 1WZLA 3PWLB 2J8HA 3KPLA 4IIQC 2YPLD 3P0VH 5HXMA 3QXDA 2J4WL 25C8L 2V5MA 1MCCA 3LKNA 4WW2B 2R8SL 2H6PB 4LSSH 2B5IC 1IRAY 4HXBL 5HI4D 3CPLA 3O8XB 1D6EB 8FABA 2AEIT 2X70B 4N8VB 2ATKA 1OAZL 4WHCA 1MY7A 1ZEAL 1X4YA 2GITB 2V2WB 2WMPA 1J8HD 3MLWL 4MB3A 5F7UA 1IAIH 1CCZA 2BRRH 1CGUA 4TUOA 4KU1A 1F8TH 3REVB 4ZNCD 1RIVH 3MC0A 5IFAH 1ACYL 2WBJB 5CJ8A 1G7MA 3WS6A 4OB5L 4XCNB 2GFBB 1WFUA 3LZFH 3QG6A 4M61A 3VXRD 1CI5A 2AAVA 2HVJA 5B38A 2P5WE 4WRLA 1FV1A 2J8UB 5E08H 3T04D 3BKYL 5BJTB 5CJXA 3QXDB 3MOBH 4GG6A 2H2PD 3RIAK 4HJGB 5FA4B 5FUCC 1IVLA 3TNMB 2YMXL 2YK1H 4PJXE 2OBGA 3CPLB 4R2GD 4PJBB 4RFEA 3QA3A 3IFOB 1J11A 1WZ1L 5DMKB 3OB0H 1PKOA 4HKZA 2D7OA 1JHKL 4KC3B 3T0BA 5B3NA 2J2ZA 4MNQE 3S4SG 1Z0NA 3HAEB 1YPZF 2R69L 1FE8H 1IAKB 4N0FB 3O6FC 4KRPB 5IW3A 2W9EH 4CVZA 4HUXA 3MRNA 4ZPTA 2BCKA 3I84A 1ETZB 3OG4B 1G7LA 5F1OB 1S7XB 4YO0B 3O4LA 2GI7A 2AJZB 1AH1A 2ZUQC 1JE6A 3HG1E 4GMTL 1KENL 4FTVA 1BFOA 1HXMB 1U3HC 4NJ9L 2DQIH 5JDSB 4X6BB 2E7HA 1NAMB 4YQXL 2XZAL 2OJZL 4ZSOA 1G7HB 3VFSA 3FRUA 1JZ2A 5DHVH 3RWEB 5K9QG 3BZDA 1GGYA 1DQQB 2D0HA 2VDLH 5IHLB 1D7FA 5LVEA 2YD3A 2AJVH 2C3VA 5E2UL 1T5WB 4I77L 4P23A 4WTXA 1AHWA 4HJJH 5K9JH 4R26H 5EC2B 4KJYB 1YJDH 4LSQH 3V4PL 5FV1L 1Q94B 3OAZH 5D93C 5BQ7A 3KPPA 2C9AA 2AQ1A 4KJPD 5JW3L 2HFGL 1HXYA 4JQIH 3VXOB 2JB5L 5HI5D 2DLGA 5CLTA 1MJJA 3PV6B 4Z7QE 2VIRB 3ARED 5IFHL 3U9PL 3VFTA 2NY5C 3F7YB 4NYLA 5CUSH 4GG8A 4ELME 4NO5B 1KN2L 1PGRB 4JRXA 3U79A 1N6QH 1MCDA 3BD5A 3QHTC 1E4XI 4S1DD 3V5DB 1MEXL 4G8IA 8FABB 1CGSH 3MFGB 1HQ4B 2NLJA 1H9VA 4XC3L 1OAYL 5E8DH 3MUJA 2R4RL 4GSDH 1OTTC 2BY2A 3TNNB 5FF6A 4AM0B 3N85H 4JRYA 3V0VA 2WUCH 3VE0B 3EIFA 3MCKB 3QIWC 4Q9QH 4XCYB 1NUDA 3BN9D 3O9WB 3AY4A 5A2KH 4JG1L 1VERA 3SKUD 2NX5B 1NCTA 3S36L 2FBJL 1TMCB 3SDAD 3FQTB 4NQDD 1CXLA 1T1XB 2RFXA 4D9QD 2FL5B 1R24A 4XCCL 4OZFB 4JY6A 2OTWB 2FYYB 3R0MA 1HSBB 1J5OL 5EU7E 4KVNH 4HKJA 3TH4T 3TLRA 4UT6L 2XA8L 4HEME 4F7MA 3A6BH 1IC7H 4Y19B 4NNXB 1UVQB 1UXWA 3IB4A 3GJFK 1NJ9B 4DKAA 5DJAB 4E5XB 2IQAA 2P43B 4KDTA 4UB0H 1H3GA 2YA0A 3QIWD 5EU5A 2XRAL 5DVOA 4PRNA 3FT4A 3BAEL 2PCPB 1H8OA 2B0SH 2XG5A 5C07A 4J3WA 5IHBA 2FYYA 5IVXB 4MNQD 1VCAA 3LN9A 3QDMA 1D6VH 2QQLH 1CU4L 1KJMB 4IOFC 3FQUA 4L4VA 3WS3A 1HHHB 2XWTB 4IHOB 3RI5F 1PZUB 5C0NC 4Y19A 3ALWA 2X6MA 4MDIA 3QAZB 2D9QB 1IAMA 5D71L 2ITDA 5IHUH 1SJEA 3PUCA 5DRZB 1EERB 4OCXL 1A14L 1K2DA 1KJ2B 2J88L 3RL2A 1EFXD 1C12A 5BW7C 3GBMH 4KKLC 1DTUA 3BEWB 5M94B 3CUPB 3VGFA 1UKSA 3BE1H 4DKFL 4N1HB 3U30B 5FO9A 3E3QC 4RMUA 2X05A 4Z78A 1CYGA 2X10A 1LEGB 4PGCA 4U1LA 3CLFH 3LN5A 3D87B 4DN3H 5IJVA 1ZSDA 2Z31D 4A6YB 5GGTL 4X5XB 1CFNB 5F9JB 1CLOL 5JMRA 3FB5B 3F5WB 1EO7A 1P2CB 4LP4A 5ICYB 3MRFB 1XH3B 4AG4L 1FGNH 4DVBA 3O2DA 1ZA6B 4PJ5B 2I07A 5BVJB 1CXHA 4HUWA 3RY6A 2R2BA 1RY7B 2MKWA 1XF5A 2XN9D 5BRZA 3N1GC 5EBMA 3VXRB 5IM7A 1CDCA 1B9ZA 3ILQD 2R0ZH 4LCIL 2JELH 4CRPA 3DX8B 3MRCB 1Z5LA 3QZWB 3JSSA 4FQLH 1TQCB 5A1AA 3QHZL 1N5YH 4X99A 3RTQD 1DQMH 4JZJB 3EOYG 4DQOH 1UWEL 4OUOA 1I1YB 1C5DB 1A7PL 1IE5A 1YEKL 3QJHB 4PJCF 4WUUD 4RNRB 4KDTC 4P57B 4HG4K 2IAND 3DSNA 5DSCB 5I1CL 2NZ9D 1A6VL 4LLDA 3QBTB 1TJIL 4HWZA 3KHOA 1U6AL 4JO2L 4NQCD 5AYUH 5C07E 3BYYA 2R23A 1B0GA 2ED7A 4EBQL 5DJAA 4EN3D 1Q1JH 5DJ0A 5DJZB 5I66A 1MNUL 2A0LC 4QRSB 5L8KB 3PWVA 4DQOL 1F3DJ 4KK8C 1NBYB 3IXAA 3ZDZE 1BHGA 1MHEA 2WANA 3RWJA 3S3PA 1XGTA 2ESVA 3ILPA 3RIAF 5F7KC 1A1MA 2H41A 2DQCL 4KPHL 4OLEA 3GJFB 2DQCH 4KPHH 5EIIA 4RFEB 3VH8A 3C08L 3L3HB 2E5EA 5HDQH 1BBDH 4HC1H 2NYYD 4HKZB 2UY6A 3TA3A 4Y2OA 5IVZB 4LRIC 4DWHA 3CFDB 1CK0H 5F70A 3DV4B 2CDGB 5HHXL 1Q1JL 3TWCL 3PWJA 1NGPL 3B2UC 3CSYA 1WIUA 3V4UL 3IF1B 1CLOH 5HI3D 3RL2B 1OD7A 3QJFB 5F3BB 3QCTH 2XYCA 4JO2H 1ZKAA 3V6FA 2AGJH 2V2XA 3L95B 4ZDHB 5HHNA 2OMBA 3T0WA 3T1WA 2DRUA 3RDTA 3B5GA 4UTBH 1KJ3H 4FABL 5BVPH 5CJXC 2AQ2A 3T0XA 4R96B 5EIQA 1YEKH 4JFED 4OD1H 4BJLA 5ISZB 3DIFA 1T21A 2X09A 4EI5A 4BFIB 1H5BB 1VGKB 5ERWB 1DJSA 2NW3A 3VA6A 2FECI 4XNUL 2BJML 3MBXL 4DEPC 3F58L 2R0WH 4A6YA 1Q0XH 1DR9A 3KDMA 4NN6C 5HYEA 3MUGA 4XGZB 1OAKH 5IHUL 1CDIA 1JVKA 2VDRH 1BWMA 3P0YH 4KJYA 3NBNA 4QNPE 2RAMA 2XTJB 1LO4H 1MFAL 2PTTA 1A9BA 3P11H 1G7JA 1LDPL 4EOWH 4LNRB 2AJXH 1VGEL 1RMFL 1W72A 3VRLF 1Q9OB 3GJFH 4HF5L 1D6VL 2HAZA 1HYSD 2J6EL 2WM0A 3M07A 1OGTB 5I30L 1TFHA 1DEEA 4ZTOH 1BREA 5MEQA 2B8OT 5HHQA 1FORH 4PV8A 4KUCF 5C0IB 1S3KL 2I24N 3FB6A 3L7FB 3VI3E 1YMMB 2BZDA 1QFHA 3ZHLA 1YZZA 1U8IB 4J6RL 1WCBA 1TQBC 4J4PA 5IQ7H 3U1SL 3MA7B 3G6AA 1A0QL 1A9EB 1I7ZB 2R15A 4Z0BH 4X4YA 2H8PA 4V2BA 2ADFL 4WJ5A 5E5UB 1YECH 3HAEG 1MFBH 3P9LA 3SN6N 4U6HA 4IRJB 3WSQH 4Y8DC 4Z8FH 2WIIB 2FEDC 4MA3B 2HYMA 4HS3B 1UJ3A 2ITCB 2NY6C 3HE7B 4KDWA 4JFFD 3S6CA 1JYXA 4V1DE 3FFDA 4OGXL 1OP3K 2D2OA 4RGNC 1C7TA 4UNVA 4K7FA 2ZJSH 1EO5A 4YLQT 4PP1C 4ZMAT 1OTTD 4YZFE 3MACH 5F71A 3BUYA 5D2LF 2OR9L 4KHTH 2VNCA 1A1NA 2LU7A 2Z91A 1F6LL 4TNVF 3DV4A 5HHME 3UBXA 3HC4L 3KPSA 1ED3B 4M3KB 1JNHA 3WXVH 2GJ6A 2ARJQ 4WUUB 1IGFL 2HLFC 1ORSB 4TSCH 1ZLSH 4RFOH 4EEEA 4GAYA 1PG7L 2HTKD 4DUVA 1N6QL 5CHNA 4HH8A 3WFZA 1CFQB 1OAQL 2FATL 1BVKA 3CVHA 1NFIB 3TNMA 4ZXBB 3SKOA 5D6DC 2DQDH 3WFBL 5HDOA 1S5IH 4M1CD 1QRKA 3O4LD 4L3ED 2EKSB 1FNGA 3VWKA 4P46B 2WW8A 3QUXD 3BP6B 4UU9A 1J10A 2CUIA 4Y4FD 1A3RH 4G42B 5CEZH 4N0YL 3EHBD 4LQ1A 5DS8B 1CDGA 3V7AG 3MRQA 4WEBH 3U7WL 1Y0LA 4BFGA 5I19L 1J0ZA 3QWOB 4D9LL 2C3VB 2B39A 1OM3H 3G04A 3RFZC 3BKJL 5EOQH 4XHJD 1FCCA 4GSDL 2OR8A 4WTWA 4EUPG 2OJEB 3OHXB 4RMTA 4WHDA 4QT5A 5DD5H 1BFTA 4MQXC 2B20A 2VDQL 5EFIA 2GTWA 2B1HH 3PWLA 4PRID 3T2NH 3V5HA 4YFLI 1OPGL 3PDGA 4HIJA 4E42A 5GGVH 5D1QA 5T3XL 1LEGA 2PO6A 4U1MB 5T3XH 2VITB 1CT8A 2JB6B 3FRPA 5I75B 4TRPH 3MLZH 3KYKL 5FUOH 3UTQA 2JB5H 4FHBD 3D48R 5DJ8A 3NIDE 4Y1AB 4N9GA 1LDSA 3MRFA 4JM2F 4LSPH 5EULV 3CMOH 3S37X 1N7ML 4K3JH 5KW9H 1NGQL 2IANE 5DFWH 3S9DB 5T1MA 3GBNL 2BVPA 2IPUG 4ERSH 4XVTL 4OQ1A 1LP9E 4L3EA 1H8NA 1N2RA 4ZFGL 5D4QA 4WU7B 2DDQL 4OM1L 5IUSA 3W0WD 5IMKB 3SE9L 4PRPE 5CSGA 1L0YA 3IFLH 5HY9A 1MI5B 3K8MA 4HJGA 5EZLB 3UJJH 5JXEC 4KROD 4R2GC 5L2KA 4XNQB 1Q0YH 3UC0L 1F3RB 1JZ3A 4G9FA 4J3SA 4ELMB 2XZCH 2G9HA 4Y5VA 1XF4B 2DQIL 4NJ9H 4X7TA 1JWSB 1QO3A 3C5ZB 2FCBA 4BQ6A 4YWGL 3ARFC 3TV3L 1UJTA 4LMQE 1RZJH 2ZUWA 5TFSH 4PJFB 4H20H 3S96A 4JFFE 4LOUD 5CZVL 5I8OL 5E8EB 2FIRT 3VWKC 5T5NG 4PR5B 2DBLL 2DI7A 3VWJB 4X7SH 3EYVA 3CH8A 4PJHB 4Z0XA 1JI2A 3DYOA 2CIKB 4MA1B 4P4KB 5IB2B 3CJJA 1WZ1H 2Y25A 4KJWC 4IDJH 3UTSA 4IRSB 3ES6A 4NGHL 4ZUTB 2VAAB 5LCVL 1NAML 3MOBL 4Y4KD 4XPBH 1WBZB 2ICWI 5E08L 1A7OL 3KPMA 4FQ1L 3QRFM 4LBEB 4U0RC 4WCYL 4WV1B 5DK2A 1VFBB 5I76A 5E5MA 4E5XA 1KG0B 5D1ZD 5BV7H 1FRGL 1M6OA 5E9DA 1GZPB 1LMKA 2XY1A 3SY0B 1JK8B 4RZCB 3QUYA 1TETL 1PJ9A 1KLUB 1UADC 3U36B 3MOQA 1A0QH 3CMGA 3W81A 1BVLA 1I8IA 3D69A 5HGBA 5FGRA 1TDQA 4IRSA 1D5ZA 5EN2B 3OKNB 4B7LA 2CDEA 1OP3H 3FL7A 3IDNB 3CFJA 4OAWB 5C6TH 1DBJL 1D5IL 1INDH 4XMPL 4DFIA 1AQKL 1UH2A 4R8WL 2X4TB 3RKDC 5C7XL 2YKLL 4WGWB 1MH5A 4Z7WF 2NR6D 1HCFX 2MKLC 1KPUB 2DQGH 5CP7A 5JR1H 5C08B 3ECBB 2I27N 1IGYB 4QRPB 3JV6A 3DXAD 3PF2A 3IT8D 1C12B 4F33B 3MGTB 4LGSB 4PY7B 4Y89A 1NBQA 2VDKL 1TJGL 1AGDA 1INEL 4TN9A 2UUDH 1U8KA 5CIPH 4JJHA 3TT3L 4PJEE 1WISA 2P4AB 2JIXB 2NQCA 4MXVF 3STBA 1XIWB 2HG5A 3MNZA 1PQZB 5C0AB 4JQVC 1XGQA 2FO4A 2Z31A 2X4RB 5A40E 4ZYKA 4NO0D 1WJ3A 2BJMH 1HILA 3MBXH 1A6TB 2CKBB 2ZSWB 4FNLH 5CMAB 4KV5E 1I4FA 2BDNL 2LVEA 5BVPL 4OLYL 5C08E 4NSKB 1ND0B 1DQJB 2YPVL 4PRDB 3EFFB 2AXHA 4HQQL 1I7ZA 2E27H 1I1AA 1FAIH 2R56H 5GGRA 1EFXA 4PRBA 2UY7A 3L3KB 1CGYA 1NAKH 3MV8E 4YDKL 3Q6GL 3UBXG 5ADPH 5ICXB 4CDHA 1N3NA 5DZNA 5ACZB 2Y7QA 1YNLL 4WW1B 4MAUL 3H9SD 4JO4H 1T66C 4LKXB 4DOHB 4EXPX 4YC2B 4LCWE 4RAVA 4X9HA 2Y6SC 4GO6B 5HPOA 4NQEE 1VKXA 1AI1H 4ACPA 4CU7A 4HWZB 4WUUE 3NZ8B 4F3FA 5F1KC 1A3QA 3CDGA 5D7IE 2X1OA 1RZJC 3BIKB 1X6LA 1I1AB 4HH9B 4L4TB 4DGVH 1GAFL 4O51B 3RIFK 3DO7A 1RURH 5BXFA 1HN1A 1X5AA 4E41D 3MTRA 3FQNA 4WUUA 3WL9B 2UWEE 5T1LA 4EIZC 4MAYB 3WYRA 1OLLA 4I18A 3FN0L 5IMOB 3TBSB 3PABA 3KYAA 4CW1B 4YDIL 3GSOA 3RVVD 5B21A 4TOYH 3CVHB 1KXTB 1FL6B 3WIIL 3GKWH 3PP4H 4GKZA 1BLNB 1JWUB 2V7HA 4HDIA 3WUWB 1JCKA 1E6OH 4LIQL 3WO4C 3QFDA 3BSZH 1RHHA 3HHRB 4O2FA 2I9LB 3B2VL 5DVNA 1U9KA 1XAUA 3IDNA 4FP8L 5EU4A 4LMQI 3L3OB 5HYSG 2FWOA 2ZKHH 3AU1B 1OVZA 4NO3A 3QXWA 3EZ8A 2XOTA 3FO9A 3QHZH 1N5YL 3GO1L 3D25A 4Z7NE 3TT3H 1RV6X 1WWCA 2CD0A 3FCTA 2HT2C 3MV9B 2I9TB 3NACL 2Q3ZA 4N0UE 5KN5B 1BD2B 1IFHL 4JRYD 3GMPB 1KCKA 4ZS6D 1NUGA 4LLYB 5HHOE 5B4MC 3BGMB 1FC2D 4UAOC 3GKZA 2VLRB 5D8JH 3WIHH 1F02I 3ZO0A 2GQHA 4U1IB 2NY2B 5FCUL 1AQKH 2G60H 3W9EB 1CXEA 3RWFA 4L8DA 2GTWB 5TQ2H 3OR7B 1AC0A 3S5LB 5JW5A 3GMLB 2F5BL 1BGXL 3LKSA 2IBGA 5EOTA 5GGTH 4ZUSA 3QH3B 5H94A 1JPST 1Q9WB 3JWOL 3KPQA 4DZ8A 3QJHA 5JPMA 3CLFL 4KK9C 2OQJA 4XBGA 3IJSA 4U1HB 1FIGL 1TJHH 1F13A 2WNGA 4NQEA 1I9IH 4LEXH 3X11A 3PWUB 5T5FH 1N59B 3DV6A 2VZ3A 4IMLB 1F00I 2M26A 2D9CA 1QLRA 3MMEA 1JGUL 3CSBA 4XXDB 4RBPH 4HWBH 2FJGA 2VDNL 1TLKA 4EJ1C 5HYFA 1BOYA 1TQCC 3BFOA 4DKEH 2A6KA 2DQFA 3U2SB 1KGCD 1NBVH 4JZOB 3DBXA 2XI9A 3KYMA 2GY7B 3QWQB 3MV7B 4OCXH 1C8PA 4GAGH 3QUZC 1DEEB 4X4ZA 4BSWA 4NCDA 2MHAA 1FH5H 4FQ2H 3O0RL 2WLZA 1JRHL 2EE6A 2H2PC 3HR5A 2G5BB 3KLSA 4NGHH 5LCVH 3C60C 5ICZB 3IJSB 4U1HA 4FA8A 2IAMA 1A47A 3LKRA 4RISH 4GFTB 4OIIL 4YBQD 2VH5H 1E4KA 4Y4KC 5DD0H 3X11B 5KVFL 4YHNA 3QEUA 5IKCA 4B41A 5EOCH 15C8H 3OMZA 2HLAA 4UZGA 4X7SL 3PGFH 2N4IA 4Y4HB 1AR1C 1I8KA 3DRTA 4G7VL 4EUPB