3QUXC

Structure of the mouse cd1d-alpha-c-galcer-inkt tcr complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
203
structure length
203
Chain Sequence
TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quxC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quxC02
4LLDB 5GQBA 4MVBD 3AREC 3MR9B 4DKEH 4N9OB 4U6XB 3SDXF 1S7RA 4PJGA 4G8GB 3L3OA 3EYUL 4OGAD 4BSWA 2APBA 3KWWA 3H9HB 1Z9MA 5BQ7A 3WS3A 5T1LA 1HIML 2GT9B 4DCQB 5C0NC 1JMZA 3JV0A 2VTFA 5EC2B 3CXHJ 4ZFZA 5C0GB 1K8DB 1SY6A 3MJ8B 1ES0B 5E8OB 3OZ9L 1FIGH 5D7LB 4KZDL 1GOGA 3TBTB 3W9DA 4U1NA 3SDAD 2IWGA 2F5AL 1M7DB 2CXGA 2DJSA 2YPLA 2GITB 4D9RE 3RY6A 2EDNA 5T33L 2EE3A 1IQDB 4YXKL 3IDGB 2NY1C 3LHPH 4HFWB 1NAMB 1TJIH 4WUUB 1UB5A 4HUNB 4L4TE 4I3GA 3FQXA 1WBYB 3TEUA 4XPBL 5DC4B 4NPYB 4NC2B 1JZ4A 1LEIB 4GT7A 4MNQE 4HBQA 1RK0B 1U8JB 5T5NG 5KVGH 3QO1A 1SY6H 5AAWA 1AGEA 1IEBA 3TN0B 3GUTB 4H1LB 1AXTH 4G42B 2QHRH 5FO8B 3T1WA 1F4YL 2ESVA 4PY7A 5IQ7H 1MI5D 4MCZA 2A73A 1U8KA 4M6OL 3HFML 4HKXB 5AD0A 4JRXE 1QFWM 4WTXA 2DQCH 3F7RA 2G5RA 4YDLC 3UBXG 4M9OA 3G6DH 3BFOA 2FD6L 1J0KA 1FAKT 1KF9B 3LS5H 4MJ5A 4GQ9H 3WO3B 3ZKQD 5KSBB 1F42A 1DQQB 3MOBH 3NIGF 3CK0L 5D7KD 1W8NA 1D9KA 3MXVH 4WW2A 1A7PH 1PG7W 4I3RL 5BS0E 3OR7A 1NBVL 2Z92B 2F19H 1MJJB 1GZPB 4W4NA 3MRJB 3MOQA 3KXFD 1Z5LB 4JKKA 5I8CA 1A0QL 1WLHA 2R29H 5E2TH 5C07D 4XWGH 3NN8A 2RIKA 4LU5L 4ZPTB 1FZKB 1SHMA 4YHZL 5IFAH 2YPKB 4U1IA 2IALB 5DJ0B 2FHFA 1MUJA 4TUOB 5CCKL 3O8XC 1T20A 3EJYC 1JRHL 3L5XH 3SE8H 1YPZA 3QUZA 3PGDA 1QSEA 4X5WA 3OXRB 2WW8A 3GMQB 3OR6A 4XXCC 4JDTH 2VZ1A 2J88L 4NN6C 1FN4B 1AGCA 1DP0A 3VGEA 5D9SB 3N9GL 2Q7YB 1MRFH 2AV7A 3W2DH 3L3HA 5BVJA 3CFEA 5J6GA 3C6LA 1UKTA 2F74B 1TPXC 3NACL 1P1ZA 2H9GB 4TRPL 5BS0B 4LIQL 3BUTA 1JFQL 5I8OL 3QR2A 3ES6B 2R1WB 5DMYA 3I2CL 3JSSA 5IWLC 2O5ZL 4PJ8D 5HDQH 1WZMA 3ZTNL 5DK3A 5E8EB 3V4PH 5GGSB 1TZHA 2PO6B 4NQDD 5HVHC 5C0BA 1HCVA 1UVQB 3VGBA 3BGAA 2F53A 4N8VG 3P0VL 3O6LL 2C1PB 1N5AA 2BNQB 5B3NA 3TBSB 4M1DL 4GKZA 3PV6B 4JAMB 3QCVL 3BYYA 5E2WH 5ETUA 3IAQA 2YUZA 1CFNA 2UUDH 4PJ5A 2DTSA 1GZQA 1Z0NA 3CZJA 3I6LD 4PJCF 5IFJA 4I4WB 1OP3K 5EOTB 1MFBH 4X6BB 1FL3B 2HJFA 3MNVB 4R6UA 3U4BL 1IAIH 4OKDA 4YGAB 3HE6B 1YMME 5FYJD 1T21A 2BNRB 2ADJA 3KPLA 4JJHA 4NO0B 2R56H 1TTUA 4EXKA 3ME0A 5E08L 2VAJA 4OCYH 1H0DB 3IXAA 1FYTE 1R3HA 4Y16A 5I1LA 5HHOA 1T2JA 2GTWA 4X7SL 2R0WL 2ORBH 1Q9WB 1I85C 3CAFA 3O3AB 2Z93A 5I76A 1A2YA 1LP9E 5DR5H 2CLRB 5I17B 2R8SL 4F57H 2OTWB 3P9LB 1V05A 4YBQD 2BNUA 2WUBH 5E9DD 4GQPH 3V6BR 3VG9B 4CVXB 2R2CA 4NHCH 2ZUWA 2VWEC 3FT4A 5ECJE 3E6FA 4EI5C 5GZND 3U9UB 1JTOA 5DSCA 3ARGD 1F13A 4RAHA 4Z95H 5E4IA 4OKVB 2XIDA 5A16B 4F58L 5ESQB 4G6JH 1FQ9C 1KTLB 3GI9H 12E8L 1I3RA 2DS4A 4N90E 3SDDC 4EIZC 3GHBH 4MQXD 4TSAL 1YMMB 1MH5A 1P9MA 2MCPL 1GAFH 4E0RA 2FBJH 5KANI 1I9RL 5T3ZE 3VXNA 4M4PA 1KN4H 5EU6D 1NC2B 1FLRH 2PYFA 4OGAC 1X5IA 4WUKL 1JHKH 5ID0B 4U2YA 2C3XA 4X5XA 3DTXA 1N4XL 3S5LB 3M17B 2A6DA 3C5ZD 5DJZA 3CSGA 2NXZB 3CDGB 1HEZB 4P2QD 1CQYA 1JF6A 4YZFE 3FFDB 3Q5TA 4PGDA 5KTEH 5T3XH 2NPLX 2J6EA 1P4BL 3SY0A 2NXYC 1UM4H 3SDAC 4ORGB 4MNHA 1TITA 3CCHB 4PJ9D 4GRWE 2HJLA 3LPFA 5L9DL 1WBZA 3RHWK 4NRZA 4P2CG 2VC2H 3RTQD 2IG2H 3E2HC 3IAPA 3GRWH 5E2VH 3S4SA 3FB5A 1QLFA 2K3TA 3IDMB 3VFNA 1RURL 4XMLH 1BVLA 4BQCA 4EBQL 5F7LB 2DD8H 1I1RA 1FDLH 1TVDA 3DSFH 3EOBB 4TQEH 1I7UA 1JGUH 5IB4A 4P3CH 1FNEA 3MRDA 5GHWH 2HLAB 4QHUA 5DD5H 2BOBB 25C8H 1MSPA 6FABH 3EOAB 4OZGA 3BGMA 4OQTA 2J6EH 3CVHL 4I0PA 1UJ3C 3F5WA 4QY8A 4XNYL 3DX9B 4XTRD 5ERWB 5KW9H 3QEQA 3BVNA 4TULL 1JGVH 4TYUA 1A4JA 1VESA 4NWTH 4RMUA 4UDUA 4ZODA 3KAAA 3QIWB 4PJEA 1IGTB 3OWEA 1LE5B 1J10A 4HIEB 5L8LB 3WIFA 1QFWL 3L3DA 3T1FB 1W72L 2CKBL 1G1YA 2E27L 4Y2DD 1DLHA 2NZ9D 4HWBL 5IMOA 1DANU 4LCWA 4AL8L 4S10A 1DBKH 3CU1A 4JZJB 4C4KT 3PQYD 4XI5D 4NQTA 4OQTH 5EU7E 3NBNA 3RWIA 4MD0B 1U8LA 1L4IA 4YDJA 4XPTL 5EBWB 4JJ5A 5D70H 1YYML 2PYEB 1KENL 1RVFH 4I5BB 4XCFL 2DN7A 3K46A 5A2FA 2YXFA 3DXAE 3P4OB 1S3KH 4AG4L 2O61B 4XXDA 5H35A 5L2KA 3RJDA 3D3VB 4HUXB 5FM4A 4K7PX 4HFUL 3U46B 4LSUH 1BX2B 4YHPB 4JM2F 2ZJSH 4P4RB 2C9AA 4KKAD 5FDYA 3AREB 4FQXA 5HGBB 4LQ1A 3RPIB 4U0RC 4RBPK 4DVRH 1R3LA 4YHIB 2DBJA 4YFLI 1MF2L 5MERB 5DXWA 1RUQL 4CADA 3CX5K 4NHUB 5HYSB 4BYHA 3TT3L 4HWZA 2QQKH 1NDMB 1MFAH 3MRGA 4QRSB 3B9KD 4KQ4L 5EZJA 5F1IB 2UWEA 3MA9L 4PJ8C 4QXWA 5EO0B 3IU4H 4J8RB 1G7LB 4U05A 5J3HC 1NMAL 2VITA 4Z7QE 5LXGL 3AGVA 4UUJB 2GY5A 4PRIE 1KIRA 4JVUA 4HS6B 1HOCB 4Y19D 1T1ZA 1J8HA 5SWSB 3V6ZB 3ZLQC 4LPCA 3RZWA 2DWDB 3DXAB 1FNSL 2NY1B 2Q8BL 5DJCB 2NLJB 4WTZG 3EO9L 3LH2L 3CSYA 4GAJL 4ODUB 3QUML 5IEKA 4Y4FD 2Z8VC 3DGGB 3PHQA 4MCYB 2EDXA 4D3CL 2E9WA 4JHAH 3QH3A 3RUGB 3WFDL 4JY5L 5E94B 3WIHL 2HVJB 4RDQF 5HTSA 4S2SA 1J1OL 1EHNA 1HHJA 2Q76A 1OVZA 4XNMA 4U6YA 1EFXD 1OWRM 3CPLB 4KVNL 2WIMA 2J3SA 1OGAD 4WCYL 3FN9A 1IL1B 1GC1C 3QZWG 4PGBA 4YDLB 3T4YA 4IEFB 3BRDA 4PRIB 2D0HA 4LNRA 3LKSA 3GMPB 5TQ0H 1UG9A 2IBBA 1H3GA 2EDFA 4HLZG 2VH5H 2BDNL 5I1IH 2XKNB 4PJGF 4YBQC 4PRAA 3GO1L 1UXSB 5F93C 5TE7H 5DJ6A 1XH3B 3N0PB 4KROC 4X7CC 2GYSA 2PUQT 5ENWB 5HGHA 3NZHH 5GZNC 3MJ9L 4C59B 4CMMB 3ARGC 1I1CA 3EYOA 4KGJA 3V2AR 3UBXI 4LCCA 5SX4H 4NP4H 3TF7C 4X7DC 4MA3A 4KMTH 4P23A 4RISL 4LSTL 3UZEA 3WFHA 1CICC 3O8XB 4LMQE 5F7MC 3NPZB 1LHZA 2IH1B 4U1KA 3DSNA 2N7AA 5DUBB 3O6FD 3C2AL 1B0GA 1GPOH 1A6WH 1IM9D 2DDQL 5GRZA 4AM0B 4QRQB 4U0QB 3WHE1 1DBAH 1T80A 2R0KL 4NN6B 4QT5A 4RGMC 1KCLA 1MCLA 2JJSC 4ZAKD 3DO7A 3X13B 5JDSB 3WXWL 4PTUA 4LLYA 3C5ZC 4JPVL 3G5ZB 4WENB 4U2ZA 5FYJL 3U7AA 4CL7A 1RZ7L 2I07A 1TPXB 3K1KC 2BCKA 4MNGE 3TPUA 5EPMA 4XC1H 1FJ1A 2A77H 1GC1L 1HH6A 1ORQA 3WE6A 1RK1B 1T2QL 3NFNB 1IARB 5J13C 1NGXA 4MWFB 4ODVL 2YPLD 5F71A 3P4MB 3RTQC 2VLKB 1JNNL 5GGUB 5DJ2B 5ID1B 1WSST 4X8JA 3FB6A 4N0UB 5IW6B 5HVHB 3IFNH 5CEZL 2F58L 2A6IA 5FAAA 4AMKH 1QLRA 2QR0A 5C08E 1VB9A 2X70A 4NCDA 3BKCL 4ODWB 2BRRL 4WW2F 3RDTA 3PDGA 2EC9T 4ZUVB 2YRZA 3W39A 3HC0A 2Q8AH 1JV5A 2VWEE 3OGOE 4NQEA 5I0ZA 1VCAA 4X7TB 2HT4D 2ESVD 4L4VA 1CGUA 2AK4D 3LEXB 3MV9A 4MNGB 5D1ZD 5E03A 3EAKA 2FATH 4KQ3L 4X4ME 3BRFA 2C5DC 1JPSL 1T1XA 2YKLH 3N85H 1BMGA 4MJIA 4KJPD 3DYOA 5ITBL 3DO3A 1AI1L 2MQ3A 5C8JB 4JB9L 4ZYKA 3R1GL 4Y2DC 3TFKD 1YEIH 2W91A 1MRCH 3GJEA 4XHJD 3WDJA 3KPNA 4Z77B 1CGTA 4FP8H 4HUVA 4EUPG 2CDFB 2GJ6D 4WY7H 4TOYH 5C08B 5F7UA 3D1MC 3QDGA 4KHTL 4GG6E 5BO1L 3O3EB 1LO2H 4QLRA 5ALCH 3U6RA 4EI5B 1MHHB 5FYKU 3UTTA 1OAKH 5FHBH 1JWUA 1YN6A 4RBPH 3GSWB 4YQXL 4XC3H 4JG1L 2QSCH 4QRRE 4LSVL 3SDXE 2IGFL 2RQ8A 3QFJD 2OS7A 3SDDB 1BP3B 1REIA 3BIBX 3CVHB 1CT8A 2ADGB 2DI7A 4KVCH 3UROR 4NUGH 3WN5A 3U36A 1JPFA 3DYPA 1LO3H 1ORSA 1QYGH 2RCSL 1NKRA 1QQDA 3D39A 3C6LD 1FNFA 4ALAH 1MAMH 3ZYJA 5KS9F 1SEBA 2O5XL 2ENSA 2CO7B 4UDTA 2HJKB 4HBCH 1PEWA 1OGTB 1MQKL 2BY3A 4R8WL 3ZL4H 4N9GA 4YXLH 4P5KA 4GG6B 3GSOA 1TQCC 1XF5B 3QXDA 4JY6A 3I02A 2PXYD 1E4WH 2DQFB 2J7LA 2NXYB 4LSQH 4NBXB 3SDAB 4H0IA 3RX5A 2YSSA 1EJOL 1RIHL 3G04B 3K8MA 4R7NB 4IRSD 2VQTA 4JM2C 5GRVL 5FIEA 4LDEB 5LWYH 3SDXB 3FO1A 4PRPD 3E2HB 3UBXA 1JNLH 1BWWA 3OB8A 3LKNB 5D5MF 2HFGH 2Z8RA 3X17A 4O51B 2MFNA 5D4QA 3WS6A 5I30H 3QIUD 2OSLB 2BMKB 1U8NB 4PJ5D 1EO7A 2NTSP 1FVDB 1YDPA 1T83C 3NCCB 3ZYZA 3ZE0E 3KPQB 5E95B 3WD5H 3BKYH 4JFFA 3B6SA 2YMXH 1S7QA 3BHBA 3SKNB 3EJZD 1UJ3B 4R2GD 2JIXD 1O0VA 1FZJB 3MRNB 1HXYA 4OIAA 3NIGE 2E7LC 1KCVH 2OZ4A 5EIIB 4XP4H 4LCUA 5EBMB 4AT6B 4KC3B 4K3DL 1LDPL 1NDGA 4Q6YA 3TBWB 1IAIM 3T4AA 3CLEH 2R1YB 4HHAA 3TYGH 4JRYA 3EW3B 1V7NH 4K7FA 5KG9A 2R15A 2B7DT 4NO5B 4O00A 4Q9BA 1DL7H 4OZIE 1NKOA 4JR9H 3H9SA 1RFDL 4ENEC 1SJHB 4F9PC 4YNYA 4B53A 4RQQB 3DETD 3JTSA 3QUMB 5T3XD 2WINB 5I15L 3C8KB 4KJYA 3IS0X 4M1GL 1P69B 2CQVA 2OZ4H 4EDXA 5IIEB 3VJ6B 4NQDE 3BIKA 1A3RL 2H8PB 1UZ8B 4X7FC 4EDWL 1EERB 3HZVA 3O6FC 3Q6GH 5CUSL 4PFEA 5ACLA 1GGTA 2YK1L 3QO0A 3UEZA 5TDOB 5C0FB 4RZCB 5EULV 2V7HA 4LBEA 1U2HA 4RIRB 4ZAKC 4RFEA 3I6LE 1OQXA 3EHBD 4N8VA 1YYLH 4U0RB 3HPLA 2AXGA 2ZSVB 4P48A 1NBYB 3BP4B 3NABH 2HRPL 2X1QA 4FXGA 1OM3H 1JUFB 1N3NB 1MCDA 4MXVF 3MPCA 2XWTA 2PW2A 4HT1H 2VSDA 4PJ8B 5GSVB 3RZCA 3GMRA 3GM8A 3M8OL 1SYSA 2BVEA 3KYAA 2VAAB 4DKEL 1R5VB 5C9JA 3D9AH 1J18A 4QHMA 3HLAA 1G7QA 4PGZA 1U0QA 3FCTB 5E7BA 1QO3A 3MRCA 2F8OA 3HZYA 4OLZH 3MX0A 4NQDB 4HUKB 4OM1L 3BPLC 4XCYB 1C12A 2VZOA 1A9EB 4K3JH 3G5YB 1EUTA 4PJEF 1CLZH 1JE6A 4HWUA 4PJCE 3QP3A 3QQ4A 3MJ6A 5SWZA 7CGTA 3KLHD 1S78D 2H1PH 3KPRE 3HC3H 3TA3B 5CEZE 4O5LH 1CIDA 2AI0L 3O41B 1RZGB 3BISA 1P4LB 5K33A 2EDLA 2EIZB 4NT6B 4PGJA 3BH9A 1NGPH 4QEGA 4DJMA 1JYVA 1UB6A 1AY1L 2HT4C 4I0PD 2VQ1A 1A1MB 1XEDA 5D1ZC 2RHEA 4HW6A 4LLMB 1WCQA 1HHKA 4GW5B 3LHPL 5D96C 4ZS6C 1TJIL 3FAXA 5BV7H 3UPRB 3BE1L 2X4TB 4FZ8H 3T2NH 4KJPC 5EU6E 5F9WC 2WM0A 4NIKB 1BBJA 3F7PC 3HG1E 1AIFA 5CHNB 1NGWB 1IM3B 4UILH 4CJ1A 1UWXK 4ZOCA 4WW2C 3TFKC 1I9JH 3GMMB 3PDOA 3KR3H 1QLEL 1V7ML 3WUWG 3LV3B 4Y4KD 4ZO6A 1AXTL 5E99H 4XHJC 4AQOA 2EDDA 5IQ7L 4LCWD 2B2XL 2EZ0C 4PJCB 4P2QE 5H94B 2YOCA 4GKSB 3MV7E 5E9DB 4JLRA 4PR5A 3KPRB 3G5VA 1CFSB 1BZ7A 3LN4B 3NPSC 4KROB 4JPKH 3UTQA 4IJ3C 2MKLC 3DMMD 1EH9A 1ZA6B 1K3ZA 3RVXD 3KPOA 3ARGB 5FDWB 2AP2A 3LS5L 4QXUH 4GQ9L 3MOBL 1OW0C 4LLAA 5JNYA 3MXVL 2ZKHH 1I3GL 2Z35A 4NBZB 3QUZC 3PP4H 3LN9A 3L9RA 1CICB 4OQ1A 2X09A 5DHXB 2XNAB 3VGHA 1IT9L 2E7BA 3SGKA 4M6ML 1VACA 5FCUH 4O2CB 3F7VA 5EU6B 3VGGA 5L88H 2W38A 3X3FH 3HG1B 3TBYB 1GRWA 1FYHB 3C6LC 1BWMA 1KGCD 4X0KA 4RGMB 5IFAL 5DURD 3OJDA 3ZKXC 3C5ZB 2G75A 4P2QB 4LPXA 3TZVD 5TE4H 4PGCA 4UTBL 1KULA 4PBVC 2PXYC 2XPGA 1JK8A 2FR4B 3D2UD 3OAZK 4NQCA 4LHJB 2VZ3A 3O3UN 4MJ4A 1R3JB 2IQAB 4X9BA 3G5XB 4JDTL 4HGMA 5J13B 2B1HH 4IRSC 1NFIA 2KUTA 2NY6D 4ZTOH 3VDCA 4XBEH 2ICWI 4G80B 1MOEA 1MJUH 3RTQB 1MRFL 3V0AC 3W2DL 3MLZH 4GSDH 5DWUL 3VWJA 4Z7OF 4OZ4B 3CZFA 4MDJB 3OKMB 1HXMA 2EC8A 1P7KA 2ATPA 4HQQH 3DYMA 3BDYH 5DDHA 4RA3A 3DX8A 1PY4A 3PWVB 4YAQA 1VA9A 4EN3A 2JTDA 2YZ1A 4PBXA 4JFPB 1VKXB 1Q72H 4UOJA 2HA1A 4FMFA 2ZCHH 1QRKA 3ZT5A 1YEKH 4PRBB 4UU9A 1IFHH 3A6CH 5D71L 3RKPA 3V4PL 3VMPA 3FONB 1DQDL 2Q87A 3RBGA 5EDXA 2DOCA 1G6VK 5JTWA 4XB7A 1IAKA 4ZFFA 2V2WA 3RGVD 2ZOKB 4CJ0A 1A6UH 3ARFD 4TVPE 4OUUB 2AABH 4XCCL 4NKMA 3F7YA 4J3TA 5I1CH 4Y2DB 4HULB 4AEHL 2AQ2A 3QIBA 2DRUA 4JO3H 4B7LA 4HGWA 5CEYA 4Z7VA 5T1KB 1XGPB 3BZ4A 4QKXB 4DUXA 5FUCC 3FTGA 4CN1A 3KYKH 4R9HA 3W0WA 4OCYL 4KZEH 4PREB 1KPRA 3P3YA 4LASH 5D1QB 3LSOA 4JN1H 4QOKD 3VMOA 1XIWA 1IC5H 4HJ0D 1P9MC 4CW1B 5D7SH 5C0DA 5KVDH 4F57L 5GRJH 4M7ZC 3M45A 1CXLA 1GGCH 3DRQA 1N64H 1F90H 2WUBL 2X2YA 1MCWW 4JM4H 3IFPB 1BAFH 1C5CL 4NHCL 2X4QB 1BD2E 2APFA 4HUUA 4M7JH 4YHML 3EHBC 4Z7UE 1VHPA 4GLRI 1CF8H 5IW1B 3U7WL 1S5IL 3GMLA 4M6AA 2LV4A 4NO3A 3EYSH 1KCSH 4G6JL 3FMGL 2AVGA 3QXWA 3GI9L 1Z6JT 4WW1B 4LLUA 4MA1C 32C2B 3PIQB 1KG0B 2FDBP 1GAFL 1WWBX 2R2BB 4B41A 2VB5A 5F3HB 1TQCB 4E5XA 3MUGA 2EKSB 1KN4L 4X4YA 1FLRL 1A1NB 1S7WB 3N50A 5BZWA 4JFXB 1H3PH 4Y19B 5JO5A 1T3FB 2NY7H 3TIDB 3RNQB 2D9CA 4JM2B 4PJDA 4JVWA 2V5TA 2VDNH 4LCIH 4PJXF 3QDJA 3LKOB 3QZWA 3SGJA 1PAMA 1S78C 1DUYB 5A1AA 3WXVL 2NY5L 1T0NB 2VISB 5T3XL 3ZZ1A 1RZ8B 3HUJA 1EEZA 5HD8D 1L7IL 1U42A 4IOIA 5IF0A 2X4OA 4NQED 5HHMD 4JFDE 4I0PC 2LAGB 4UQ2B 4KKCD 3E8UL 1F11B 3A67L 4L3CB 3MV9D 1R3KA 4PV8B 2IG2L 4L3AA 2EEAA 1EFXB 5E2VL 5TGBA 3GRWL 3QEGH 1ZLSH 5A43C 1XF4A 2UVEA 4D0BB 1ROWA 1OGAB 4WFHD 3PNWB 5F88B 2DD8L 1FDLL 3DSFL 4MJID 4TQEL 1N7MH 3QNYB 1OWWA 3LCYA 3SO5A 3OXSB 5DLML 4X6DA 3OKKA 1CGSH 4JKPH 4PJGE 5I6XC 5DD5L 25C8L 2EH7H 5IMMB 2DJ4A 5DK2B 1U93A 2APTA 3KYNA 4I48A 4Y4KC 4CNIA 1KBGH 2Y06H 5C0EA 2XZCL 3DROB 1M7XA 3BSZH 4OCXH 3QUXD 4HLZH 4G9FA 4BSVA 4HH9B 5ADPH 1JGVL 3DIFB 2HT2D 3MXWL 3P2TA 3O81A 4FXLA 3DMMC 3RVXC 3IDNB 3KYMB 2CRZA 3T3PF 1YEJL 2W59A 2YPLE 5SX5K 3DURA 4G6KH 4WTWA 5CZXD 5E0QA 1JI1A 4C56D 4EZMA 3RWHA 5JA8B 2Y7QA 1K8IB 2XKSA 3HRZB 1S8DA 3M07A 1I7TB 1PDKA 2V7NA 2IPKA 3SE4A 2BVYA 3MROB 4BZ2L 5TFSH 1K85A 3O6FB 1U8OB 3GB7A 4OQTL 2JCCA 1S7RB 4PJGB 2GI7A 2OI9C 3L3OB 4FQXC 4BSWB 1G7IA 5T1LB 4ZAKB 5EIVA 2FJFB 2CR3A 4OZFG 1CK0H 2ESVE 5LGKA 3NIFE 4YC2C 4ZFZB 2N1KA 3TZVC 3RI5F 4DN3H 1MLBB 1NUGA 3PXHA 2VSCA 3W9DB 5E6ID 1YN7A 2MSPA 2NY6C 2ZJSL 3D0LA 2YPLB 5HGGS 4UTAH 3CIQA 1U3YA 1OD9A 3F6LA 4I77L 4DVRL 3SKMA 1OP9A 1HQRA 4OLYH 1UB5B 1INDH 3BPLB 3FO9A 3FQXB 4P9HC 2BFVH 1GL4B 3V6OA 2R9HD 2QQKL 3C6SA 3L3GB 4KMLB 1I8LC 5IB2A 4LPUA 3D0VA 2VXTH 3FL7A 4JFQA 5E5MA 3QO1B 4HK0B 1IEBB 1TJGL 3VRIB 3QHZL 1IZJA 3VCLB 4JFFD 4JKLA 2ESVB 4PY7B 4EUPA 3MCLH 2ZUSA 1HCFX 3RNKB 1U8KB 5D1ZB 3UTOA 2R69H 3RL2A 4S1DD 5AD0B 1DLFL 3V0VA 1YPZE 4LSPL 5D96B 1QSEE 3V79C 4NM4H 2FECL 4IMLB 2F9BT 5F9WB 4BFEA 1AQKH 3BPNC 1EAPA 3WNKA 1KYOJ 4HF5H 4UT7H 4JHAL 5T1DH 4WW2B 3ZSTA 2VN4A 4OF6A 5F9JA 5JIHA 1DFBH 3UYPA 3SBWC 4YE4L 1LO5B 4HV8B 1WT5C 3ULUF 5EFIA 2GJ6B 1TXKA 4EUPH 5I8CB 1EEQA 4TNWK 4UI2A 4IJ3B 3WEXB 3Q1SH 4U1IB 2PF6A 3GIZH 5GJSH 5GRUL 3EYQD 1MWAA 1QRNA 2IPUG 1MUJB 1X5KA 4HJ0C 3L3IA 5CJQH 2UY6A 5C0BE 1N0XH 5TQ0L 1T20B 1VFBB 3QFJB 4P9HL 1UZ6E 3O9WD 5I1IL 2F53E 3HZKA 3QUZB 1Q9OA 3PGDB 3DX7B 5I66A 3SKJH 4NKOA 4X5WB 3U1SH 5JOFB 1WQVT 1PVHA 1A22B 4Z8FH 4YIQA 3ULUD 4PJ5E 1PSKH 3KVQA 1AGCB 1C8PA 4OLWL 4G3YH 5A2KH 2AV7B 5J6GB 3C6LB 3MCG1 4DFIA 4OFIA 1RZIB 4KMTL 3ZKXB 4OSUL 3QHTC 5FK9A 1PD6A 3MLVH 2ARJQ 4O2EA 4F7TA 3GMOA 3IU3A 4FQJH 2AXHA 3I3BA 1C7TA 3ALWA 3H8NA 3BD5A 1A6WL 4FRWA 1JGDA 2X7LB 1QSFA 5HHOE 1WITA 3TWCL 2QADD 4IRSB 2X41A 1DBAL 3DHJA 3SE3C 1TZHB 2RFXA 2OJEA 5C0BB 4KV5E 3EO0A 4OI7A 2F53B 5I8EA 2G5BA 1N5AB 1CIUA 1GOHA 1ZXQA 4NNXB 2X4PA 5CINH 5DUMH 5KS9B 2A77L 5HHVH 5HD8C 5ETUB 1JHTB 1K9TA 3K2MC 1CFNB 1P6AB 4PJ5B 5C0CD 2XY2A 2IQ9L 5FUCE 3HPJB 5IFJB 1ZT1B 1YEFH 5DJXA 4KKCC 1HI6A 3ZKNC 1QFOA 5B21A 2VABB 5C86A 5I2IA 1Z0MA 2FJHA 4XP5H 1Z2KA 1IGFL 1T21B 3IFNL 1ZS8A 5DMIL 2ADJB 1XFPA 2OTUB 3KPLB 4DGIH 1JYWA 4QHNA 1E4KA 5K9OA 1G7HA 4WFGD 5D5MB 4P2YA 1AE6H 1QP1A 1V3MA 1ZAGA 2MCG1 4PJFA 2RR3A 1MVUA 4RFOH 4WFFD 2Z93B 2ADFH 5I76B 4IIQC 1A2YB 4HMEA 5LGJA 3QUXC 3AC0A 4QHKJ 4IDJH 5CD3B 2FATL 4LHUG 4YH6A 2BNUB 5MHSE 2L0DA 2HT2C 5HYIA 3FQNA 3VXSD 5I1JL 1PZUB 4M7KH 3FT4B 2YKLL 3NMEA 5BOPA 3SQBA 1YNKH 4P2OD 4NRXA 4OB5H 1X44A 2OXHA 1I3RB 1ZTXH 1GCFA 1MH5B 1CLCA 4E0RB 1RD6A 3MRRA 4PRDB 1OLZA 3VXNB 4TOYL 2CUIA 3MGOA 1MCQA 2GTZA 4M7ZB 1JF1A 1DBML 4ISVA 4WV1A 5DTFA 1JIBA 2HMID 4LKCA 5ALCL 3K4AA 4OZGE 4X5XB 3DUUA 4MXVE 2BSTB 2FEDD 2CLVA 5HI5D 1OAKL 3NCYS 2A6DB 4WEBH 2V2TA 4PJ7A 4KHXH 3QEQE 1TZIA 3D25B 3CMGA 4OUOA 1R0AH 4MA1B 3SY0B 4ODSL 4PG9A 4DVBB 5ICZA 5E6IC 4KVCL 3L95A 1F00I 3SDCD 4PJEE 2CSPA 1LO3L 2HJLB 4HKZA 1WBZB 3C9NB 5KBNC 1R6VA 1NCCH 3MJ7B 3MBED 4ALAL 1MAML 5F7FA 4LCWE 3WS6C 4HZLB 1BVLB 1Z9OA 3RIAK 4HBCL 1I7UB 5IB4B 1FNEB 1RUML 3P0YH 1MCOH 4YXLL 4P0DA 3MRDB 4HPOH 1T1YA 4QHUB 4PRHD 4EN3D 1KFAL 5F89A 1OP5K 1A1OA 5IEHB 5FYKH 3WUWA 3QB7C 4OF3A 1ZE3C 4K7PL 3BH8A 2UYLA 5IESH 1N0LA 1FRGL 3F5WB 4I0PB 4OGZA 4U6HB 3SEPA 3MMEB 4QY8B 1NCUA 5FHAL 5LWYL 1RU9H 4B5EA 2V2XA 5CJXC 3BVNB 2PCPA 3RJQB 2P5WA 4R4FH 3S37X 1NMCC 1KC5H 5L2KE 2IANA 3DVGB 1JNLL 4OD1H 1SBSL 2HFGL 4IRJD 2J2ZA 5EIQA 4UDUB 3MGTA 1WF5A 4A2MA 3U0PA 2CRMA 1MREL 1SJXA 3S3PA 5I30L 1OL0A 4PJEB 5JW4M 3MRLB 1NFDA 3WIFB 1H3XA 3L3DB 4YWGL 5I6XB 2XQBH 1KGCE 1MAJA 5JPMA 2EEDA 1DLHB 2GK2A 4Y4KB 3WD5L 3NA9H 2YMXL 3IJHA 5IMOB 1BPVA 4LCWB 3QIBD 3B9DA 4XVTH 1NGYA 3QEHB 2NY4D 4PB0H 2GJZA 3LOWA 4CVZA 1KCVL 2UWEE 2PTTA 3ORJA 4W68A 1A8JH 5IBUG 4HPYH 1B6UA 3OPZH 2BOCA 3DMMB 3W0WD 3MA7A 1QBAA 2QQNH 4HZAA 4JJ5B 5I9QC 3EYQC 1CE6A 1J8HE 5DFWH 2BHZA 1S7UA 4KKNA 4ZO7A 4I3SH 1H9VA 4MAYA 1BEYH 2OR7A 2WLYA 5ANMB 2DQTL 4LLWB 4XXDB 3MRFB 5KSVA 4MLSA 4XX1E 4BUHA 3BPCA 3JUYA 4JFHD 4JR9L 4LEXH 1ZVYA 3QA3A 4PV9A 4PJDF 3ULUC 3VGFA 4A2LA 2X05A 3TIEA 1C7SA 1I3VA 2ZOLB 4FQQA 3R4DA 2FB4L 1U3HA 2OI9B 4FQXB 1OAUL 3FOMA 5E2JA 1HQ4A 1R3LB 2AJXH 4JFOA 5DURB 4CADB 2V6HA 2YD9A 4YC2B 3RP1A 4PPTA 5DQ9B 3TZVB 3MRGB 1F4XL 5EZJB 2P8LA 3HNSH 4JEGB 1IGML 3D2UB 4Z7OE 1Q9KA 2VITB 5BV7C 2F8XC 2QADC 4Y0GA 1KIRB 4EI6A 1ONQA 1U8MA 5JQ6H 4S11A 2XG4A 2NY6B 4NQXA 1MCJA 4BH8B 1IEHA 2AV1B 1H3UA 5MP6H 5KVFH 1NCDL 4F7PA 2X4NA 2VN7A 3AS2A 4XNQA 1WBXB 1YYLL 2GEEA 1A14H 3RAJH 3U0WL 3CSYB 2GFBB 4LLVB 5IEKB 4N0CD 1OM3L 4NCC2 3PHQB 5IW3A 4YHOH 3QULA 3V4VH 4HT1L 5BMFL 3FZUC 3RWGA 1MCPL 3D9AL 4KPHH 5F6HI 3DPBA 5D7IA 3ULSB 4YJZL 3GZKA 1HHJB 2Q76B 4XNMB 4U6YB 2YA1A 3ARYA 4OLZL 3QXVA 4K3JL 2ICEA 3T77B 3UAJD 5ICXB 4D0DA 1OAYH 3ULUL 4PGBB 2ZG3A 2OQJB 3T4YB 4WHTA 5K9QG 5GGQH 5F7HA 1XR9A 3P11H 1Q0XL 5D1XD 1ULVA 2GSIB 3I9GH 2HWZH 3LKSB 5GZOC 3BPNB 1NGPL 1T7ZA 1HKFA 3LQZB 3IFOA 2JCCF 2M8XA 5AZ2L 3WJJC 4LAJH 2E3VA 5AWNL 3BIAX 3HI5H 3TO4A 5DJ6B 2WBKA 3QG7H 2AGJH 2DYPA 5HGHB 1KEGH 4FZ8L 3QJFA 4N0YH 4UIKH 4P2OC 3T2NL 1Q94A 2W9DH 4U31A 5E00A 4A6YL 4FTVD 3O4LD 2EDBA 1IGCL 1RUAL 3UJJH 1I1AA 5BRZD 1FNGA 4QOKB 4UILL 3A6BL 5KSUA 2VQUA 3QXAA 1I9JL 3EOTH 3I3DA 3R0NA 2FHCA 3WFHB 4HUWA 1PZ5A 3SGKC 1OTUC 1FFNB 2OL3L 4JFED 1B0GB 5E7FA 3MODH 3ZE2F 1CGWA 2AEQL 2XWBB 4LKXA 1A7RL 4P2RD 4ZQKB 2HMIC 2A6KB 1L7TH 4QT5B 4NQEE 1I8IA 2FEDC 3Q3GA 2UZIH 4IS6A 3VI4F 4F8QA 4LLYB 4QXUL 4L4VE 4U1LA 3MV9E 5FM5M 2I07B 2XTLA 2BCKB 3TPUB 4PD4K 1D3CA 3VXMA 2ZKHL 5EPMB 3MZTA 1AHWC 4OD3H 3S36X 4Q9QL 1DTUA 1HH6B 1ORQB 4ZFGL 1AR1C 5JIIA 1IBGL 3MCKA 3UO1H 3MSPA 3SDCC 4MJIE 3MYJA 4MHHI 5FCUL 3P40A 1RJLB 3X3FL 1ED3B 2NY2D 3IDUA 3VRLF 2FHBA 3MBEC 3VWJC 3R06A 2YN5A 3THML 2C4FU 3FB6B 4H20H 1JPST 1QUNA 1BGXH 2A38A 2A6IB 2ZP0T 4JO2L 3BKMH 1QLRB 2QR0B 3A6OA 1EHLH 3CGTA 1F6AA 3AB0C 4F9LA 1TCRA 3QDGE 1ZHKA 4EN3C 3W39B 1B0WA 2I5YH 3HC0B 2FJGA 3HKFA 4NQEB 1YUHA 5HHMB 2WWKO 1K5NA 2B1HL 2A0LD 4JO1H 2VR4A 1NCAH 3UTTE 4K7PY 4XBEL 4L4VB 2BVOA 3MV9B 3L3JB 3AVEA 3MLZL 4GSDL 5DRNA 3TJHC 2FO4B 2ID5A 2WBJA 1T1XB 4OTXH 4MJIB 4HQQL 3BDYL 2XXMB 3H9YA 4PJXB 3TCXA 5ELIA 1WEJH 5C6TH 4L3EA 1JL8A 2AJYL 1YEHH 4M03A 4OFYA 1G0XA 4DOHB 3MNZA 3D39E 4K23H 4ZYKB 4Q58C 3P77A 2UZYB 3K4ZA 4WNQA 1JI2A 2ZCHL 1T6VN 4JN2A 2VDOL 1P7QA 3QIBC 4IIQB 3MBXH 3KPNB 3A6CL 4UQ3A 4J2XA 9CGTA 5C0RL 2V9TA 2NY4C 4Z0XA 1AFVH 2NX5D 3QDGB 1AR2A 2N7BA 3D85A 1LVEA 2FSEB 4OZFA 1CLOL 2D7TH 3PWPD 1EZVX 1H15B 1JWUB 1NJ9A 1YN6B 5EC1A 1C16B 1QRND 1PEZA 4I0CC 4NC1C 3LN5B 5EBLB 5I1CL 4NDMA 4D9QD 4HKBB 4OCWL 4ERSH 2PN5A 4N1CA 4ONOA 5JLZA 1X4XA 5CP7A 1PX3A 4JO3L 4L29B 3WBDA 2CUHA 3KLAA 1JPFB 2HG5A 3FT2A 3SKUD 1ORSB 2ZUTA 1W0WB 5IFHH 1BBDH 3IB4A 3QDMA 3GHEL 4BA8A 4K8RH 2VNCA 2YD2A 4U3XA 4JFFE 4LASL 3HHRB 4NUJA 1FC1A 5J11C 2VOTA 3WKNA 3DI3B 3GMNB 4GS7C 4MXQD 4NNYB 1CL7L 1UXWA 5FGCB 4OZFH 4O02H 2AJUH 3WJLA 5GS2H 1AKJA 2XQYG 4N9GB 4X83A 1NUNB 5DMGD 4P5KB 5CZVH 3GSOB 3IGAB 5KVDL 3I02B 1RQ5A 5GRJL 3JWDC 1O5DT 1EDQA 1F90L 5E6IB 3S7GA 4JM4L 1QSFD 2GHWB 2R4RH 2YSSB 5CEXB 2DLGA 4GBXD 1TVHA 5BOZG 4IOFD 1ZEAL 4M7JL 1X6LA 2A6JA 4JRYE 1M05B 3HNVL 5ESAA 3P0GB 4N1HB 3FO1B 3AM8A 1CF8L 5MEOA 3SGJC 3ULVD 1DN0A 3UBXB 5DJAA 3HCVA 5EUOF 3EYSL 1ZLWK 3N1MC 2JJTA 3H9SE 2GCYB 3U7YL 3EFFA 3ZDZF 1YDPB 3OV6A 3FOLA 4DAGH 1YQVH 4F37K 3ECBB 2VLJA 4JFFB 3B6SB 1H3PL 4NN5C 1S7QB 3BHBB 5DS8B 1HINL 4NJ9L 4ONGH 3RX8A 3MRPA 4YR6B 3GSNL 4JHBA 4PP2B 1HXYB 2L7JA 2VDNL 1E4XH 3OGCB 4LCIL 1NMCB 1NC4D 2WNGA 4K3EH 4LSDA 1S7XA 1ZVSA 4LCUB 4GRWH 1QKZL 4ZUUA 1FPTH 4FQHB 5D1XC 1F3JA 4L8SC 2DQGH 1NDGB 1KEMH 2EDWA 2VXUH 4U1JB 2Y4SA 4EOWL 3T4AB 2PR4H 4HHAB 4ZFOA 4JRYB 2DLHA 5E8PA 2JELH 1RIVH 1QA9B 1EHAA 5KG9B 2AJ3B 4NNPH 3I6KA 2J4WH 2WUCH 1TETH 3WFCH 4TTDD 3JWDL 4Q97A 2CH8A 1JGEA 4JHWH 1VGKB 1N7ML 1VFMA 4CAGA 3OJ2C 2R4SH 4KJYB 1LWRA 1CGSL 4JKPL 2VJXA 5DI8A 1ITBB 1U8PB 5I9QB 3WSQL 5JW3H 4EDXB 1NGZB 3GNMH 4HIHA 5DQDL 5HHNA 3BIKB 5IP4A 1FH5L 1A6VH 2Y06L 4MA8L 5D7JA 3SE4C 1OSPL 2YR3A 5SWZE 5JXEA 4OCXL 3ARDA 4ZD3H 3CH1A 4J7RA 3NCJL 1C5BH 3QO0B 2APXA 4TNWF 1D5IH 3RWDB 2V7HB 4R96B 3ZHLA 4RFEB 4U1MB 4QRTA 3QRGH 4N8VB 2HLFD 3HPLB 4NQSA 3QI9A 5K93A 1MFNA 3NFSH 4H25A 1D5ZB 1KJMB 5HPMB 2XWTB 3ARZA 2PW2B 5JHDA 1I1FB 4OV5B 3RZCB 5TFSL 4OT1L 3GMRB 1ACYH 1SYSB 2NY2C 5C9JB 5BV7B 2QADB 3T0EA 3VD7A 4QHMB 3HLAB 1G7QB 1KJ2A 43C9B 2DQIL 4WDIA 3O3BA 3HZYB 1C12B 1MHCA 3T3MF 1A02N 4Q74A 2VXVL 1XGRB 3V6OC 5GSRA 1NFDF 3QQ4B 5SWZB 3MV8D 1WICA 1ZGLA 3EGSA 4K9EC 1E6OL 1DQLH 1NQBA 3BH9B 2GUOA 2A0LC 4JPIB 1OHQA 1R5WA 1CD1A 4WHCA 2VQ1B 4POZD 4LHUA 4H1LG 4QXTA 5HVFB 4G8FA 5C0IA 2IF7A 4XNUH 4OLYL 6CGTA 1INDL 2WIIA 4LP4A 1A5FL 2APWA 1KJ2H 1BBJB 4YGVA 4ODTH 1VERA 3HI6H 1C5DB 1CFBA 1V5JA 4KXZI 4UNUA 3HZMA 1BOYA 3VXPB 4G8GD 3PDOB 4NQVA 3TO2A 4L9LC 1PKQE 1FP5A 3G6JA 5E1AA 2ZPKL 5KAQG 1I9IH 2XACC 1WCBA 2R69L 1IGJA 4X98B 1UYWL 3MRIB 2V17H 4PR5B 4QXGH 3G5VB 1ZLVK 1BZ7B 1NLDH 3VXSB 2H6PA 1ZA3A 4GXVH 4NQCE 5IR1A 2HVKA 2FYYA 4UNTA 5T5FL 2Z8SA 4FQ2L 4P2OB 1IC4L 3P4NB 1KPVA 3I75A 5K9QI 1PG7H 4HF5L 3UDWC 4MAYD 1BFVH 3MUJA 1BFSA 4ETYA 1UT9A 4JQXA 3L9RB 4XAWH 2EYSB 3MRBA 2DTML 1A7OH 3VFOA 5C7XH 4K9EL 1VACB 4GAYA 4GMTH 3B3IB 1EVUA 5FXCH 5JOEA 3FO0L 4Y4HA 1QBML 3IXTA 4JRWA 1HHGA 1SEQH 4N1EA 4BKLA 1GSMA 4X0KB 2OX5A 3DUHA 3OJDB 3H3BC 4J1UA 4UAOC 5IKCA 2R2HA 4APQA 5ABDE 5CJQL 2E9IA 5LGHL 5DMGC 3EDEA 1T4KA 4PGCB 1AHWB 4ZOAA 1JK8B 3T09A 5D7IF 3SKJL 3U1SL 4FFZH 4J3UA 5E2UL 3SDCB 1VFUA 4IRZH 4Z8FL 1GOFA 3K8LA 4IOFC 2F54A 1Y18A 1KTRL 1TVBA 3LS4H 1PSKL 3AXLA 1FSKC 4G3YL 2Y5TB 4KUCF 3MBEB 4D9RD 1UH4A 3ULVC 3VWJB 2HTLC 3CZFB 2HH0L 4QTIH 1UACH 1XR8B 3RVVD 5EO1B 1T1WB 3CLFH 4N8CH 2ATPB 3RA7H 4MZ3A 4L4TD 3MLVL 4Z7VE 3MO1A 5DDHB 4I2XA 3DX8B 5J57B 3AB0B 3PABA 1YEGH 4PRHB 1T0MA 4EN3B 4MNQD 3P9WB 4Z5RA 4OCRH 3W0WE 5K9KB 2C7UA 4RA0C 5FA3A 3NCFB 3KNBB 4UU9B 3REWA 2VLLA 4OLVL 3S6CA 1M4KA 1K2DA 1SJVA 1D5MB 3QCTL 3H7BA 3KJ6L 1E4KC 5ACMA 5HGDA 4G7VL 4ZFFB 1IAKB 4JRXD 1M71A 5DEFA 5CINL 5DUML 3F12A 5HHVL 2CDEA 4Q9RH 5FCSH 2V5SA 4X9FA 4G6AD 1SMAA 3CFDA 4D9LL 2W9EL 4NKMB 5FECB 3F7YB 1KXTB 3BQUA 1YNTA 3VXRA 5MEQA 1RUKH 3QIBB 1U95A 2LVEA 4TTDC 4MAUH 4YFDB 5EU5B 3TO4D 4HJJH 4JFZL 5BS0D 4XP5L 2NY4B 4JVPA 2DYPD 5HDBF 2R39A 1KELH 3TYFB 3FTGB 3W0WB 1A7QL 5ACZA 2CIIA 1KPRB 1KCRH 5BJTA 3ULVL 4DKDC 1AE6L 2XWJA 2CD0A 1I4FA 1BECA 4PJDE 4RFOL 3W11C 2ADFL 5ESVB 5GS1C 2QKIA 3BI9X 2FLBT 3GKWH 3QRFM 5ADOH 3QDJE 4YDKH 1CE1H 1L9MA 1VFOA 3GSNB 5C0AA 1EEYA 2HFTA 2HKFH 4DQOH 3HUJE 4WV1C 3ZMRA 4KK5D 3RU8L 3LZFH 4HUUB 3GSVA 3S34L 3V6FA 2HLFC 1YNKL 4MMZC 3C60D 1F5WA 3GMLB 1N59B 4OB5L 3B2VH 2B20A 2YEZA 4NO3B 4ETQA 2C3VA 1MVFA 4G5ZH 2XRAL 5J11B 4GS7B 4LLUB 3KDMA 5CIPB 4I9WE 1OF2A 1T7WA 3CXHK 3NOIA 5J6HB 3HE6D 3AU1B 1E28A 3BP5A 2NW2A 3B83A 2VLRA 4E5XB 1FORH 3V52H 4X6DE 2GW5A 1YJDH 4QGTA 4RAUB 5BZWB 5C6PB 4TSCL 5LAXA 2YRPA 5IGXL 4XBGA 5JO5B 1HKLL 1FO0L 3B5HA 3VXOB 5HXMA 4PJDB 5EU4A 1JTPA 4WWKA 1ZHBA 2MNUA 4WEBL 3VFWA 3QZWB 4KHXL 3L6FB 5CILH 4G9FE 1J87A 4GRLA 1ERNA 1R0AL 1EEZB 1WTLA 5JUEH 5TE6H 4P59H 1SM3H 5IF0B 4XPAL 3KPTA 4KXZH 1LP9F 4POZC 4OLUL 4XGZA 1R3KB 4YHLH 4NN5B 5I19L 1NCCL 5EUKA 2P5EA 5TGBB 4Z76A 2WBJD 5EWIL 3IF1A 2P8PB 1ZLVH 1A3LH 5EU3A 4YDVA 5SV4A 5IV2A 4F2MA 2A83B 3OKKB 2JCCE 3P0YL 4HMDA 4HPOL 5D1XB 1PYWA 4L8SB 4OGYH 1FYTD 1FVEA 1U93B 5DD1H 3KYNB 1NL0L 4I48B 5SV3A 4NO2B 3NTCH 5DJYB 3S8WA 4CNIB 2A9MH 5HY9A 4XP6L 5JW5A 2FEEI 5C0EB 1HYSC 1P7QD 1RHHA 3PWNB 3EBAA 2X5PA 1YEEH 4BSVB 1Y6KR 1J8KA 3EDDA 1KC5L 3I50H 4K94H 5D2LA 3QQ3A 2Z4QB 1CDGA 1LE9A 4K71C 1TJHH 1YC8A 4FTVB 3O4LB 4NKIH 3V5KB 1FNLA 2HFFA 4KJWD 4MAYC 3RWHB 3ZE2E 1R24A 2GAZA 2Y7QB 1EBPA 1MAKA 4M62L 4XH2A 5F9OL 3NA9L 4M8QA 2V7NB 1DVFA 3CFCL 4L8DA 1A6ZB 2IPKB 2WZPD 1BOGB 4XVTL 1AO7A 3V6OE 4JFEB 7FABH 3GB7B 4GRWF 5T3ZD 1HYRC 4R3SA 4O4YL 2JCCB 4UT9H 1U3HC 1FFPB 1S9VA 3QDMD 3NFPB 2FX8H 4HPYL 1ZLUH 1CS6A 1JHLH 3OPZL 3Q2CA 2QQNL 8FABA 3VXTA 2FL5B 5ISZA 4JPWL 4FQIL 5CSBA 1NEZB 4R26H 1BEYL 1VSCA 2GSGA 5ILTH 5FM5O 5I1AA 1CFVH 5E8DL 4LHQB 5H37G 2R0LH 2OR9L 3VFGH 1A21A 5HYJA 1YN7B 4LEXL 3VW3H 1G7JA 3T65A 5AYUH 3QIWD 1Z9SA 2NY2B 1NBZA 3RVWD 3LKQA 4PS4H 3RWCA 3WIIH 1S5HA 1KB5L 2Q1EA 3SKMB 1HQRB 4HIXH 4OAWB 3FO9B 3VXUA 2VDMH 4FQ1H 2DLTA 3C6SB 4YO0A 3U48A 5LKNA 1QBLL 3D0VB 1DUZA 3FQUA 1Q0YH 4PG2A 3HNSL 3LQMA 5E5MB 5JW4N 4XNXH 2P8MB 5HI3D 1DJSA 1QRNE 4HDIA 5T1MA 5KVFL 4XBPA 5MP6L 3ARWA 3L1OH 1N2RA 4FQCH 2DF3A 2E7CA 4M3KB 4D9QE 2AJZA 3B9EA 2X89D 3GJFK 1FZMA 1A14L 2VDPH 3SOBH 3F58H 4CRPA 4CN4A 2E8ZA 1FVCB 1CDUA 3SCMA 4G6AC 1X5FA 1ZHNA 4XP9H 3OKLA 1T5WA 3GSXA 3ARED 1JPTH 4QRPA 5JIPA 3SJVA 2VIRA 4KPHL 4Q2ZA 4ZUWA 4MA7H 1Q1JL 4L9LB 3GSUB 3TO4C 4GW4B 3G6AA 5EFIB 1JBJA 4FFYH 4JQVC 5D6CA 5DQJA 3PL6A 2W0FA 1OAYL 1IEAA 1ZT4A 5INDA 4X8XA 3U83A 3SGEH 5GGQL 1QSFE 2FIKB 3P11L 4ELKB 5DD3H 1XF3A 2HWZL 1ND0B 1QRNB 2IAMA 1DE4A 3HMXA 5KVMC 2GJJA 3L7EA 3LIZH 3PP3H 3X12B 3RGHA 5M95B 1INEH 3FB7A 1EMTH 4O9HL 2D31A 4UNVA 3DXAD 4TUKH 3EYVA 2NY1D 1VGEH 2RGSA 5I1GH 3CMOH 1B88A 1I8KA 3QG7L 4U3HA 4YIQB 2JB5H 1MJ7H 2AXFB 4G8IB 4UIKL 5IROA 3R8QA 3C60C 2W9DL 3DWTA 2EDRA 2ICCA 4HJGA 4E41A 4RAVA 3QUYA 3PHOB 3UJJL 2XTJC 5FA4B 3DJ9A 4Y5YA 4R4ND 1UM6H 5I74C 2DQEH 4WHYG 4G6MH 3GMOB 3MUHL 2HP4A 3RWFA 4Y5XA 5ICYA 3JV4B 4L8BB 2DKSA 3ZYIA 2EXYD 2WWKT 3MODL 3HMXH 5EOQH 1QSFB 3T0ED 4NM8H 3MACH 4PRID 2BVUA 1L7TL 4PJFE 2WSKA 4MS8D 2KDGA 2UZIL 3VFPA 1FSKB 1FGNL 2RFXB 3EUUA 4PJAA 4CMHC 5I8EB 4HWEL 2G5BB 1NSNH 2X4PB 3QBTB 1JPGA 2R0ZH 4YX2H 3WNLA 5F7EH 4MD4A 3GBNL 5DRWB 3HR6A 2JF1A 4Z7NF 3BAEH 3U9PL 1F6LL 1HI6B 4IHOA 1AGFA 4Y8AA 2WBJC 1XGUA 5I2IB 3JV6A 2FJHB 4P4KD 1B90A 1E0OB 1BGXL 4QWWD 3VFSA 4H5SB 4QHNB 4S1RH 1EHLL 1TNMA 5K9OB 4OZHA 1YMHA 1G7HB 4MQTB 5EUOB 4KTDL 2Y36H 2ZCLH 3LB6D 3FQRA 3VFMA 2WMPA 2I5YL 2JLLA 4ZO9A 1I1YB 1ITCA 1JZ5A 4AEEA 3K0WA 4JO1L 1IGYA 4PJ7E 4RWHA 5LGJB 5FGSA 4FNLL 5FYKE 1KLUB 4Y8DC 3CSPA 4OD2A 4RX4D 3BUYA 4U6XA 2QSVA 3HMWL 3FT3A 3MLWH 1D6VL 3VH8G 2VLMD 4KJWC 4NRXB 3PGCA 1CN4A 3WNOA 1YEHL 2D4DA 2DICA 4XVJH 1MPAH 3MJ8A 4FG6D 3CXDH 3H3PL 3LEYH 4DKFL 3O6KH 2WP3O 5GS1B 3MBXL 4LP5A 2E9JA 4DZBB 4AEIH 1QFHA 2P7TB 5JA9A 5D7LA 3TBTA 3MLYH 3MGOB 2GTZB 5LQBL 1AFVL 1F4HA 1DEEB 1M7DA 1RZFH 2MMXA 3K8KA 5CMAB 1J5OL 3CH8A 3NH7H 4ISVB 4WV1B 4Y4HD 1B3JA 5DTFB 2GITA 5GISL 1J1PL 3BPOC 4LPYA 5IB3A 3S9DB 1KCUH 1IQDA 5FYJU 3DUUB 3TCLB 1LO4L 4PLNC 4OI9A 2D7TL 2CLVB 1KNOB 4XPHH 1OY3B 1LMKA 2V2TB 4WUUA 2DWEA 1OQOA 1WBYA 5AEAA 3WJLC 5MENA 4MDIB 1TZIB 2P5WE 4NPYA 1T7XA 2IANE 4ERSL 5F1KC 4U7SA 4PG9B 3IFLL 4QCIB 5IHUL 1RK0A 4OF7A 5JHLH 3QPQD 3TN0A 1NFDE 1CU4H 4G42A 3RVWC 1HWHB 2KQMA 3MZGB 4R4BB 3B5TA 2FZ3A 3T0WA 1GVIA 1JVKA 4HKXA 2LU7A 2F5BH 2YPVL 5DUPH 4HAGA 1H5BA 2BVQA 3MV8B 4O02L 4B0MM 3N1FC 5CZVL 3F7QA 5F89B 1Y6NR 5KSBA 1A1OB 1DQQA 2XA3A 5L6YH 2HKHH 5HI3C 3QQNA 1F97A 2HT3C 3BH8B 5TPWL 3BMVA 1WZ1H 3IKKA 2V2XB 3UC0L 1NCWH 4IMKA 4JO4H 3VFRA 2PCPB 2P5WB 1UGNA 3IRPX 3TT1L 2X10A 5T3ZL 1YQ2A 2IANB 4P46D 1YECH 3SDDD 3MRJA 3WNPA 4G9DA 4O58H 1ZSDB 2QTEA 1NFDB 3PWJA 4N0RA 3QHFL 5DJ0A 4DAGL 2ITCA 2WBWB 2K7QA 4PJIA 5JPMB 4HK3N 1FV1A 2DQUL 3OKDA 1URLA 4ONGL 3BP6A 1NGYB 1KB5B 3OXRA 1VENA 3GMQA 3VG0H 1E4XL 4M48L 2ARWA 1XGYH 5EU7C 2PTTB 4H8WH 4JDVA 5D9SA 2BOCB 1I8MB 3PDDA 1D5XB 4FZEH 2OM5A 3MA7B 2RB8A 2NXYD 4K71B 3V4UH 4KJQC 2DQGL 3AS0A 4R7DA 1S7UB 1KEML 2VXUL 2PR4L 4YFEA 1EGJL 4MAYB 1JZ6A 1ZKAA 4LVNC 5D7JC 3PJSB 4XZUB 4QRRD 3W5NA 4JZOB 1U41A 4F7MA 5KSVB 2R1WA 3ARDC 1JWMB 4NNPL 3BPCB 2J4WL 5DZOA 2YD8A 1U36A 3JVGA 2ZG1A 4BQBA 3QA3B 4Y1AE 4LSSH 1U3JA 3TIEB 2YD3A 4HS3B 3SGDH 1S7TB 4JHWL 4FQQB 3S98A 1U3HB 1L0XA 5AYQA 3FOMB 3QQ9C 5F7NC 5GGSA 4MMXC 3S88L 1F2QA 2PO6A 4JFOB 5D7IE 1SYVA 3IJYA 4M5YL 4QO1A 5JW3L 3QXTA 1G9MH 1HDMB 4R4NC 4U33A 3VFVA 3TH3T 1ZT7A 4LEOB 3TBSA 5L0QC 1OCWH 2B5IC 1U91A 5CSZB 2P47B 5IT2H 2CLZB 2EXYC 5TH2A 1T66D 3ZE0F 3T0EC 1VPOL 4EI6B 1EXUB 1C5BL 1TENA 1UCBH 2A9NH 1D5IL 4X6BA 2IMMA 3P30H 4MS8C 2P42B 4RNRB 4F7PB 4XRCA 3QRGL 5L8KB 2BNRA 2VDLL 2D7QA 4NO0A 3DLQR 4L4TB 2AEPL 2AK1L 3AY4A 2EE9A 1OARL 3HC4L 2F8VA 4V1DA 5JZ7D 1EK3A 4MNQB 2G9HB 1ACYL 4XNZC 2FO1A 3RWGB 1Q9WA 2VZVA 3O3AA 5D7IB 4ZNCD 4PTTA 1T03H 4OZIF 4RGOL 5I17A 3QEUB 5D2LF 5GGSY 1IQWH 2OTWA 3BP7B 2P5ED 3P9LA 4P4KC 1MJ8H 3QCUL 4JGMA 4L1HA 4QWWC 4X6CA 1NAKL 1G7MB 4D0DB 3OKNB 1GIGH 2NTFB 2H2PC 2X9WA 4JRXB 3LEVH 2V5YA 3L7FA 3U9UA 4XMKH 1XR9B 3LB6C 5DVLA 3WNMA 4N0FB 1X5LA 5FOBA 5A16A 2QSQA 4TSBL 3S36L 1DQLL 1S9WA 4LAQH 5INCA 1JRHI 5HDBE 1AGBB 2CIKB 4P5TA 3IFOB 4DGYH 3VXME 1YEDA 2XTJE 1AXSA 4PRNA 2DMCA 1LK2A 4NZRH 2P48B 3TO4B 5M7QA 3D69B 3ARUA 2QQLL 2DYPB 1MNUH 3VGAC 4CGTA 1Q94B 1CVRA 1A6TA 4CUCA 2B0SH 4EJ1C 3MLRH 4HGKC 4ODTL 1FNGB 4JKMA 4U7MA 3HI6L 5J3HD 5KSUB 3A0OA 2WLZA 3CDGA 4M7LH 4FG6C 5DRZB 1HEZA 5C3TA 1TZGL 4HUWB 4JQXC 1PZ5B 4C58B 1FE8H 1I9IL 1XGQA 1MCRA 4ORGA 1BF2A 2V17L 1S9XA 4QXGL 5FYLH 4LVOC 4Y4HC 1BHGA 4POUB 4GXVL 3TA3D 1OTTD 1ZOXA 4ZO8A 1I8IB 1FLTX 3O6MH 3Q3GB 5JR1L 3KPSA 3C60B 3TVMD 2YRLA 1DQTA 3IDMA 1PG7L 3ARBA 4X5LA 2XTJB 3EOBA 1BFVL 1P7HL 3AS3A 3K74B 1BQHB 5I74B 4XAWL 2UVFA 5IJKA 1UCTA 2BOBA 5C7XL 1A7OL 2LU3A 3MYJB 3QPQC 1HE7A 1AD0A 3EOAA 4Z9KB 4NJAH 5CJOH 4L3EE 2QLVB 3L3KB 1CZ8L 2X4UB 2XZAH 5J0BA 5E5RB 3R06B 1W0YT 5ERWA 1SEQL 1J88A 3WFBH 5LG1A 1TFHA 4CMHB 3S35L 3V5HA 5I0DA 1F6AB 1TCRB 1ZHKB 2R1XA 3C5SB 3F62A 3KPRD 4ZXBD 5CEZD 1QFUH 1HNGA 3T1FA 3T2PA 1K5NB 4KROD 2ZCKH 4IRZL 4KKLC 2JK5A 4G7YL 5M94B 3LS4L 3RFZC 3DECA 2BVOB 1MIML 4UMGA 1HK6A 5DRNB 1WIPA 4JZJA 5IJVA 2WBJB 4P46C 1DSFH 3X11A 2UY7A 3CLFL 4HIJB 3EYUH 4AY0A 3BT2L 1CICD 3RA7L 2YD1A 1IGIL 2ZUYA 5IB5A 3C5JA 4LMQI 1HIMH 3SCMD 4L3EB 1YEGL 2BXYA 5CS7A 3QDME 2PYEA 2ZSWA 3ABZA 1FYTB 1M7IA 3HG1D 3QWOB 3MNZB 3BQUC 5CFHA 3P77B 4F7EB 4R90H 3OZ9H 3P4OA 4JN2B 1P7QB 4TVSa 5I73C 3HAEG 3D3VA 1LP9B 1NCNA 5BXFA 1BF8A 3U46A 4Q7DA 3RY5A 4BM7A 3TBVB 1BX2A 3V8CA 5DO2D 3PL6D 1NCBH 4P4RA 4OIBA 3MV7D 3DX6A 4W6WB 3LDBC 1QEWB 3SKOB 4OZFB 4YXKH 3CSBA 5HGBA 4XPFL 3RPIA 5JW4Q 2ADIA 4YHIA 1NJ9B 4YHKH 5EC1B 4Q9RL 3BZDA 1KIQB 3KPPA 1YJDC 2WQ8A 4F8TA 4NHUA 4XPBH 3OJMB 2NNAB 4OIIH 4JGJA 1NDMA 1A4KA 1RUKL 5F1IA 3E3QE 3KLAB 5GGRB 2HG5B 3FT2B 3JXAA 4UUJA 1G9EA 4X9HA 4PJAF 2Z0BA 5BW7C 3QDMB 5SWSA 2Q7NA 4X4XB 3V6ZA 3BPOB 5CAYB 2Z9TA 3HFMH 2VLJE 4XMPH 4MB5A 5DJCA 1A6AA 2VYRE 4GG8A 1UXWB 4NFBA 4BK5A 1AKJB 4MX7B 1P53A 2ILLA 3GKWL 5ADOL 4YDKL 3OMZA 1T66C 3O0RL 3CK0H 4DQOL 3RUGA 3LZFL 3AMLA 1TVHB 2HVJA 2BX5A 4I3RH 2A6JB 4GRWB 3DRTA 5ESAB 4WWKC 4NYLB 1NBVH 2CR6A 4W81A 5MEOB 1ZWIB 3C09C 2CUMA 1DN0B 1R3IL 1CLYL 4G5ZL 5F97E 1A0QH 4GRLC 4JGUA 1GGBH 3U4EA 4QYOA 1J05B 4ZG1A 4PLKD 5JZ7C 4QRUA 4KDVA 1QFWI 1UM5L 5TDNB 3EFFB 5J06A 3GMPA 3FOLB 5T1KD 3OAYH 1YJDL 4AIXA 2NR6D 5CCKH 5CLTA 4Z78A 5KN5A 1I7ZB 2XKNA 2P24A 5D1QD 1U8IA 4UB0L 1XH3A 1LD9A 5ENWA 2C4XA 2ERJC 3QYCA 1X7QA 4CMMA 2CJUL 4ZUUB 4BFIA 4DGVL 1F3JB 4MZ2A 3WLWD 3BJLA 4GMSL 5JUEL 5TE6L 2B1AH 4P59L 1SM3L 4TRPH 4TVPD 2VUOA 4NBYB 5I8OH 4FXKB 4RGNE 5D8JL 3WDIA 2BXZA 4FFVC 1RZKH 4HCRL 3EYFB 3I2CH 1RJZB 1Y0LB 1JGEB 3LD8C 4XXCA 4QRQA 4HX1A 4RDQG 3T0BA 5JHDE 2AKRA 4Z7UF 3ZTNH 2ZNXA 4EIGB 3DV4A 3T0EE 5DI8B 5JDSA 3WLBA 3G5ZA 3P0VH 3QJHA 4FQPA 1NBQA 2A9ML 4XB8A 1DVFC 1EO8L 4LVNB 5D7JB 4JM2D 1X4YA 5L2JB 1RK1A 3G9VA 1ZGLP 3ARDB 3CH1B 2H26A 5IWLA 3FB8A 4MWFA 1NCTA 3TA3C 1OTTC 3T8XA 1K3IA 1K6QL 3CFJA 2VLKA 2VXQH 5GGUA 5TJWK 1TJHL 5DJ2A 3TVMC 1BD2D 5GGVL 1I3UA 1NMBL 1Z3GL 4N0UA 1FGVL 4OCMC 1BLNB 4NQSB 1FFOA 1LILA 2ARJB 5MEND 2X4SA 4H25B 2CXKA 5E08H 2OJZL 1RI8A 1MLCB 5L0QB 2XZZA 3M1BB 2MOVA 2B5IB 1DBBH 1MHPH 5JHDB 4DN4H 5FF6B 7FABL 5TF1L 4WHYH 1BJMA 2E6PA 3T0EB 4X7TA 3HE7D 4R0LC 2CRYA 1DANT 2R8SH 1KJ2B 3LEXA 1JHLL 1FIEA 2NYYD 4L9DA 3O3BB 2NCMA 1KPUA 1P2CA 4NFCA 1MHCB 3AUVA 2OP4H 3G6JE 1OAXH 2SEBB 2DKMA 4Z7NE 1OAQH 5GSRB 4R26L 3FFCA 1EZVY 1V8HA 4PG2C 5ILTL 4ZXBC 4PJIF 1CFVL 3EGSB 3TJEL 3BN9D 4ONHA 3VFGL 2GUOB 2VLME 4ENED 3QSKB 4F58H 5IVZA 1U58A 3MNWA 3VW3L 1CD1B 4XNZB 5AYUL 4JFDD 3OKYA 4R97C 4I8DA 1I9RH 4UV4L 4PS4L 3WIIL 2CDFA 4QXTB 5IVXA 5C0IB 4P4KB 2OLDA 4HIXL 4AJ0A 2XV6B 2WIIB 3VH8A 1B4JL 4WUKH 2EIBA 3TLRA 3K1DA 3RI5K 1KXVC 4FQ1L 3O3EA 3SCMC 2D03L 4EI5A 4MGXA 4YGVB 1Q0YL 3N1QC 4LOUD 3RL1A 2G60H 5KOVC 4J6RL 4NQVB 3H7LA 4G43B 5F96H 3C8DA 5E1AB 5T1LD 5AG8A 3CVHA 4Y5VC 1P4BH 5CBEB 2W07A 2ADGA 4FQCL 1ZHLA 3STBA 3BRGC 1J0ZA 1WCBB 2FWOA 4OGXH 1WZKA 5DO2C 1IGJB 3PL6C 3FO2A 1U6AL 4ESKA 3GI8L 1ZA3B 3WKMH 2VDPL 4M1CD 5IR1B 5HDLA 2HVKB 4X4ZA 2FYYB 3DARA 5TDPA 3VGAB 3V5DB 5JMRA 3NIFF 2F54E 1KPVB 3I75B 1MCEA 3MLSL 1W72A 3GM0A 4EBQH 2CKBA 1JPTL 4MA7L 2VR9A 4X6EB 4HWBA 2HYMA 4JQIH 1XF5A 5D2NA 4I2XE 1WISA 1EX0A 4F3FA 3VFTA 5DVNA 5IROC 1T04B 4K55A 4LVOB 4Y4HB 3CVHH 3G04A 3OG6B 4S0SD 4XNYH 3CC5A 1HHGB 4KDTA 1MFEH 1Q8MA 5BVPH 5F7DA 1CR9L 4TULH 5DD3L 3MLXH 1M6OB 4J1UB 5IKCB 4Y5YC 1CTOA 3LKNA 4F80A 4C57C 2LAAA 2IFGA 1ZANL 3LIZL 4KRNA 4G8EA 4Y5XC 1K4DA 1INEL 3CVIL 2OTPA 1EMTL 4TUKL 1BJ8A 1U8NA 1QFWH 1VGEL 5B38B 1W72H 4ZS6D 2CKBH 2E27H 3HI1A 43CAA 1Y18B 1MJ7L 4X6CF 3AXLB 4HWBH 4KI5F 4EQ2A 3SKNA 1MI5A 3IDXL 3D18A 1YPZF 1D9KD 3VXRE 5HYQB 4LQFH 3IYLW 3IKCA 4GXUN 3BXNB 4UIMA 4PLKC 1UM6L 2VXSH 3MO1B 4XPTH 1KLGA 2DQEL 2EZ0D 4V1DD 4K3HA 1YYMH 1T0MB 1KENH 3MOAL 2NR6C 4XCFH 1RMFH 3HMXL 5EOQL 5FKAA 3V0WH 5FA3B 1OB1A 4AG4H 2NQCA 4NM8L 5D1QC 1KN2H 3REWB 2I9LA 1H8SA 3LQAC 5D72L 4YUEL 3B9AA 4KRLB 2ED7A 5CSGA 5B4MD 5IBUB 1SJHA 5I1HH 4M5ZL 3L5WA 5HGDB 1NSNL 4P46B 1N8ZA 2A74B 4NRYB 5C0AE 1M71B 1S7SA 3KXFA 5DEFB 3QUZD 3DBXA 3QUMA 5C07A 1QSED 3WLWC 3F12B 2WINA 5TQ2L 2P45B 2X1OA 4YX2L 4GAGL 1MF2H 3INUH 1CBVL 1KT2A 1MEXH 1U3ZA 4XP1H 3CFDB 3TT3H 5IIEA 3VJ6A 1UZ6F 2WANA 4P5TD 3BQUB 3UTPE 3O11A 4AIZB 3VXRB 5MEQB 2WP3T 2H8PA 4KQ4H 1UZ8A 5I73B 1KTKE 3MA9H 4W4OC 3KG5A 4JZNA 5F3BB 4XVUD 1CG9B 3AAZA 3DVNA 3R8BB 4S1RL 3OBAA 3R0MA 2VLRE 4RZCA 4D8PA 5JXAH 2O26U 4RIRA 4F7CA 1MFCH 2CIIB 3LDBB 5ACZB 3QNZA 5BJTB 2Y36L 2EE2A 1FNSH 4LPWA 2XWJB 1I4FB 2ZSVA 1NBYA 3EO9H 3LH2H 1QNZH 3BWAA 3QUMH 1IAOA 2QKIB 4QRRB 1YY8A 1KJVA 5C0BD 4PP1C 1NANI 3DVIA 4DUWA 4I18A 1CDIA 1EEYB 2F53D 5B39G 3BESR 4D3CH 4M93C 4PJ8A 1V3LA 5GSVA 3WFDH 4JY5H 2MQCA 1R5VA 3B5GA 3GSVB 3MJ9A 2JB6B 5JMOC 4KV5F 1T5XB 5DEGA 3GBLA 3KPSD 4KVNH 5GGVY 1AC0A 5HHPA 1E6JH 2YEZB 3G5YA 3LQAL 4GUPB 4WCYH 2D4FA 2P5EE 1JWSA 4XCNA 4HIIA 4YEEA 3CXDL 2VDKL 1X5ZA 1PGRB 2YD4A 3LEYL 3PGFH 1JN6B 1RZGA 4WEUD 2VLRB 4TVPL 4NT6A 2HFEA 5E6ZA 3O3DB 3HE7C 4MD5B 5LAXB 1FG9C 3NH7L 5IHZA 4Y16D 2NYYC 2XN9A 4RWYL 5HHOD 1RY7B 2J8OA 4XAKE 5EU4B 1H8NA 4HWNA 1CFTB 4WWKB 1ZHBB 3VFUA 2XZQL 4NZUL 1H5BC 3C09B 1WWCA 2X4TA 3MJ9H 1UWEH 5DK0A 4GRLB 2EDYA 2QV2A 5D2LE 5DHYA 1J0HA 3K2UH 3BN9C 1NGWA 1IM3A 1PKOA 3IDJB 4RISH 4LSTH 5C1MB 2E9BA 1CU4L 2EEBA 4H8WC 5J9PA 4XGZB 4IMKC 5EUKB 2P5EB 4Z76B 3C2AH 5H94A 2DDQH 3IF1B 2FH6A 1XT5A 4GKSA 1JJUA 5E9DA 4AZ8A 2GK0B 3HNTL 1CFSA 5DUPL 3QISA 1AO7E 1FG2A 4OF8A 2R0KH 2ERJB 3ZT6A 4F2MB 1EEUA 4MXWL 4NOBA 1PYWB 4LOUC 4JPVH 1BREA 5FYJH 5L8JB 1FVEB 1INQB 1RZ7H 1OAZL 2HKHL 2OMNA 5HY9B 4X6FB 5CGYD 5CWSA 1WIOA 2W65A 5ISZE 1XF2B 1KUMA 3WFZA 1KYOK 1WZ1L 1T2QH 3OAUH 3CFBB 4JCLA 1G9MC 4ODVH 1F4WL 5DJ8B 4OZIB 1C08B 1UA6H 5D2LB 4M1CC 5MHSD 1TMCB 4S1SH 1YECL 3LD8B 4OZGF 1LE9B 5HYJE 4O58L 1QZ1A 5CJ5A 1EA9C 4CDHA 5GIRA 2HFFB 2JJSA 2F58H 3C5ZA 4QNPF 3RY6C 4KAQH 2YA2A 4MSWB 3MRQA 4D2NA 1DVFB 4KRMB 3BKCH 3VXUE 1G9NH 4L8DB 4JE4B 3JVGC 4LL9A 1B0RB 2JKXA 3JZ7A 1KJ3H 4GW1A 1R3JA 4R3SB 3VG0L 3BJ91 1A7BA 2IC2A 4PJ9A 2X40A 1FL6A 5I1EH 1FIGL 4G80A 1HN1A 1LNUB 1QR4A 4H8WL 4P3DB 5IUSA 3RTQA 1KIUA 4JANB 4FZEL 4MJ6A 3TVMB 4ZMAT 8FABB 4KQ3H 3VXTB 5I75C 1H3VA 1N6QH 5ISZB 3ARQA 5IOPA 3OKMA 5DGRA 1JPSH 4JFYA 2PW1A 2A1WH 3O4OC 1NUDA 3HR5B 3QEQD 3WFEH 4LK4A 3UTSA 1AI1H 1OSZA 1QD0A 1WWWX 1A9BB 4JB9H 3U2SA 1G7JB 4LSSL 4CU7A 3I6GA 3T65B 2LFGA 4PJBA 1B2WH 1HNFA 4R0LB 3LKQB 4ZOBA 4PRBA 4QRPE 4WU5A 3REVB 1D9KC 4OLEA 1FAIH 1NLBH 3SJVE 5KVGL 3FONA 1SY6L 1HHIA 3VXUB 1QVOB 5BO1H 5MEPB 1G9ML 2X6MA 4DZ8A 2BSRA 3OHXB 2QHRL 3AY4C 1BQLH 3EO1A 5H2BB 1ZV5A 1OCWL 2ZOKA 4N68A 1DUZB 1S7VB 4ZXBB 2D3VA 2DQCL 5DMKA 2EO9A 4NGHH 2Z31A 4LSVH 4OF5A 4C54A 2IGFH 3HAEA 1UCBL 2A9NL 5GS3A 3H9ZA 3G6DL 3P30L 4HDIB 3ESVF 1A7NH 1YY9D 4XBPB 5T1MB 4R97B 2YHGA 5B4MC 4KI5C 2BY1A 1P5UA 2UWEF 3PQYA 1FZMB 5DYOB 1PX4A 5L2KD 1OTSD 1A7PL 2RCSH 3HTLX 1F3DH 4YBLC 2GQHA 3SCMB 2F19L 2EDEA 4RMQA 4KUZH 1T5WB 3GSXB 5DEZA 2O5XH 5IG7B 4P5TC 4QRPB 3SJVB 5GRWA 2R29L 5E2TL 4E41E 2VIRB 4FQXD 4Q2ZB 4XWGL 4R8WH 4ZUWB 3RWEA 5IK3A 3G6AB 4Y5VB 1NANH 1PKQA 1T89A 4XVUC 3OX8B 5D6CB 5A2JH 3LMJH 5DQJB 5CLWA 1EJOH 3HAEH 3PL6B 1RIHH 2W0FB 2X4QA 1IEAB 3MV7B 1GIGL 3RVTC 1ZT4B 5J7CC 1WFNA 3L5XL 3SE8L 5INDB 3LEVL 4XMKL 1L9NA 5I1DB 1XF3B 5FV2A 3BEWB 1XGTA 1J8HD 4QTHB 3DOSA 1DDHA 1U92A 4PJAE 4DGYL 3PIQA 1KG0A 3FB7B 3B9KA 1GGUA 2D31B 2R23B 3EYVB 4L8CA 1KLFA 2Q3ZA 5F3HA 3FQTA 1OLLA 4NZRL 3N1GC 3WHXA 1I8KB 1S7WA 4N8PA 3IDIA 3X14B 3VDAA 3ROLB 1T3FA 3TIDA 3MLUH 1MCNA 1ETZB 3EZJB 3ARBC 5HDQL 4J3SA 4FA8A 4GH7B 4Y5YB 4M7LL 5HPOA 4FMKA 5LCVH 5IJKC 2VISA 1UENA 4Y4FA 1LDPH 4MB3A 4AH2A 3BEVB 4Y5XB 5ICYB 3DV6A 4OZHE 2VDQH 5IVXF 4Y16C 4EKXA 4UQ2A 2X9YA 1F11A 5E2WL 1WGOA 3O6ML 3Q0HA 4AENA 1CGYA 1EFXA 4HXAH 4PJAB 4WFEE 1RFDH 3I85A 2E8YA 1MHEA 4D0BA 1OGAA 1MFBL 3PNWA 3F65A 2MQ0A 3FFCD 1W2KT 1JPGB 2EYTA 5FM8A 5I15H 1YC7A 4TUJA 5CKAA 4MD4B 1IAIL 1L6ZA 4NJAL 4IHOB 3TGXA 2R56L 3KJ4C 5AUMA 1A3RH 1AGFB 2HAZA 3BW9B 2XZAL 3DROA 3FN0H 1IAII 3MLTB 1XGUB 2ORBL 3JV6B 4P23D 3WFBL 3TNNB 3SE9H 3FQWA 3PWUA 5EO9B 5D7LE 2YBRB 5DR5L 3C87A 5FUOH 3DHMA 1YMHB 3MV11 3FQRB 3VFMB 1QFUL 2YD6A 5CGYC 3IETB 2AJVH 4LFHD 2HRPH 5C2UB 4DW2H 4M61A 4WUUE 2W60A 4Z95L 3ZKMC 4WTZA 5GXBB 5MENE 1JYNA 3MROA 1ZMYA 3O6FA 4OD2B 1IM9A 3BUYB 3M8OH 1DSFL 3GHBL 1BQUA 3FT3B 3L5IA 3O45A 4BQ9A 2FBJL 3UPAA 4PGEB 3BZFB 4ZAKA 1U8QB 2FJFA 3PGCB 4OM1H 4TNVF 1XZ0B 3ILQD 1JHKL 4R90L 1RIUH 1MLBA 4YFLF 3MREB 1BM3H 5IVNA 2AI0H 1X5AA 2I26N 1LEKA 1AP2A 3FN3A 1AY1H 1WWAX 1HH9A 4M93B 3CJJA 1NCBL 5J1AA 5KTEL 4BELD 3GJFB 5KSBE 5IB3B 3RDTD 5IVOA 1UM4L 1BD2B 3QWRA 4M9PA 3VXQB 4YHKL 1FZOB 4Z7UB 4H0HB 3BE1H 2DWEB 4BQ6A 4L4VD 3ZKND 5MENB 1FL5B 3T08A 4OIIL 2VC2L 2XT1B 3L3GA 1AQDA 4EVNB 4ZTPH 2MJWA 4URTB 3ZDXF 4WI7A 3HB3D 4XMLL 1KOAA 4HK0A 2DIJA 4D0CB 2FH8A 1DR9A 3VRJB 1QLEH 1V7MH 3UYRH 3VRIA 3VCLA 3HE7B 1JGUL 4P3CL 3O2VH 2B2XH 3OKEA 2AK4A 5GHWL 3RNKA 2FZ3B 2IMNA 4PJIE 5D1ZA 4ZSOA 6FABL 3UTZA 4XMPL 5HBBA 4ZDHA 3MGAA 4LGPB 5HJ3A 1QR1A 4BK4A 1H5BB 2BVQB 2J6EL 2HN7B 2ICWA 5KW9L 1RZKC 1F3DJ 5DJDA 2C3HA 4IMLA 5IB1A 3QDGD 4LRIA 3STZB 3AFLA 4NWTL 1V3KA 3RBSA 5C0JA 1I3GH 3LKPA 1YY9C 5DGQA 3OKOA 4JFDB 2J12B 3V9FA 3UTTD 1S9YA 3VFRB 1LO5A 1IT9H 4HV8A 2GJ6A 4M6MH 5T5NF 2XYCA 1CCZA 5E24E 4HAFA 1OTSC 1X5JA 2LU4A 3B4NA 4G9DB 5DT1H 1GGBL 1DQMH 1DBKL 3RKDC 3WEXA 2ED8A 3PWJB 5FOJA 4KTEH 1BJ1H 2ITCB 4PJIB 1OW0A 3KWWB 1FV1B 2NW3A 1VFBA 3OKDB 3D39D 3QFJA 5BQ7B 3WS3B 1EJ6A 4UTBH 3P9MA 5D70L 3BP6B 3DX7A 2BNQE 1IRAY 1CXFA 1RVFL 5JOFA 3P4LA 2K1MA 2HRLA 3WCYA 3QWQB 1S3KL 4JDVB 2DIBA 4UOW1 4U1NB 5DWUH 4RMVA 4LSUL 4R7DB 3ESUF 2B1AL 1RZIA 3UJIH 3SO3C 2BNRE 5J89A 4WI2A 4F7MB 1RZKL 2PXYA 2X7LA 4V1DE 4TPRH 3MRHA 1MFAL 3OB0H 3IVKA 4IRSA 5D71H 3IU4L 1DQDH 4PRPA 4PLJC 1AGEB 1SYVB 3IJYB 3EIFA 1HZHH 5I75B 1XCQA 3VFVB 1ZT7B 2W1NA 4NNXA 4X6CE 1X5YA 4MCZB 2A73B 3QIUA 1WIUA 4KI5E 5KS9A 1U91B 3EJJX 3O4OB 1JHTA 5TH2B 3E6HA 4C83A 4XCCH 4B7IA 4AK1A 3HPJA 1ZT1A 4ODXA 2XN9D 4AEHH 2VXQL 4MJ5B 2EE6A 4XRCB 5FYLE 2JIXA 1D6EA 2VABA 4J3VA 5JQHC 1D9KB 4JRYD 3B43A 2GY7B 1C1EH 1MFDH 2OTUA 3UJTH 5C92A 3GDBA 2E6QA 2FECI 3OR7B 3T0AA 4V1DB 3H9SD 5D5MA 5DMJB 1DBBL 1MHPL 2QEJA 4DN4L 4ACPA 4CKVX 2ITDA 1CFQA 4LCCC 3NN8B 4PTTB 4EEEA 4P23C 4GLRH 5CD3A 4X6CB 2OP4L 1OAXL 1C5CH 2ED9A 1H3TA 1OAQL 5DVOA 2XOTA 2VH5L 3G9AB 5GRXG 4MHHG 4YHMH 1YPZB 3L7FB 1QSEB 1T7VA 4J4PA 1E27A 3OR6B 5TE7L 5FOBB 3U7WH 1S5IH 3HA0A 2NY0D 4YBLB 5C09A 1S9WB 3FMGH 3NZHL 5INCB 2VUYA 3KPSE 3N1PC 4P5TB 5BVJB 3L3HB 3CFEB 2X42A 5B39A 1YEDB 1AXSB 4PRNB 4PRDA 4NP4L 4X99A 1LK2B 1P1ZB 4KTYA 3NCMA 3GRWA 4MVBC 3SDYH 1A6TB 5SX4I 1MWAH 3RZCD 2BSTA 1GPOL 2C3WA 3MRKA 3ILQC 1CXEA 2G60L 1BIIA 5F96L 2WQRA 3WXVH 2NY5H 3D25A 4ODHH 2YUVA 4DVBA 1L7IH 5D2NC 4PJBF 1XGQB 4OGXL 2KZWA 4HEME 1S9XB 2QBWA 2YC1A 5SWZD 4XC1L 3RDTC 3WKML 4GKZB 4KDTC 3C9NA 3A67H 1I9EA 3E8UH 4NOFA 1AC6A 3MJ7A 1GZQB 3KPSB 4HEPG 3FZUD 4YDIH 3ARBB 4HZLA 2EDJA 2ENYA 2HJFB 4L4JA 4DTGH 5DLMH 5L7XH 3CFKA 4IDLA 4FABH 2C3GA 3HB3C 3UTSD 1LK3H 4KK6D 3N06B 4JQIL 1AD0B 3ROOA 4U6TA 4LF3A 5IEHA 3O2DA 4AMKL 4E9LA 2PYEE 3IXAB 1R3HB 2XZCH 4U6HA 4Y16B 5HHOB 5I1LB 3MMEA 3QNXA 2GTWB 1MFEL 5BVPL 1T22A 2H45A 1A3QA 2Q8AL 5GZOD 3MLXL 1N6VA 3D3VE 3DVGA 3MXWH 3BD3A 1WUNT 3P73A 3V5HB 4HXBH 1YEJH 4M3JA 2R1XB 3MRLA 4P5MA 2R2EA 2Z31D 3CNKA 3DGCR 1BJ1J 3KHOA 3N85L 3E6FB 2JK5B 2ICWJ 3BYTA 4U3CA 4Y4KA 5DSCB 3PWLA 5FB8A 3KJ4B 3K80A 3QPXH 4BZ2H 5IJVB 3O2DH 3QEHA 3X11B 1XMWA 2RAMA 4LQFL 1YEIL 1J0YA 4KWUA 5A2LH 1CD9B 2DM2A 2Y07H 1MRCL 5HVWA 2VXSL 3DMMA 4FP8L 3ZDYE 3WN5C 4WY7L 3C5JB 5IB5B 1OTUD 1MCKA 1BVKA 3J7HA 1DBJH 2PYFB 2ZSWB 5SWSE 1KB9J 5GRYA 1M7IB 2IBZX 1RMFL 3V0WL 2FGWH 1LO2L 5ANMA 3C08H 4ZUTA 3DTXB 4LLWA 1P6FA 5IHLB 1IILE 3MRFA 1KN2L 5BXFB 5FHBL 5DJZB 3B8YA 4XC3L 2QSCL 2EDTA 4ORZC 4IM8A