3QUXC

Structure of the mouse cd1d-alpha-c-galcer-inkt tcr complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
203
structure length
203
Chain Sequence
TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
total genus 46
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quxC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quxC02
4JO2L 3DURA 4P2CG 1QLRA 2FGWL 4PRBA 1KF9B 1ACYL 4NO0B 5EIIA 1IKFL 5LAXA 2Y1VA 1F4WL 2CIIA 5GS0C 3FO2B 5JW3L 3OGCB 3BDBA 3ZDXF 5KSUA 3MZTA 2BDNH 4X5WA 3GDBA 1H3PH 4RMUA 3GSOB 2NZIA 1P4BH 2GK2A 4WI2A 4HX1B 3EFFA 5IP4A 3FB8B 3G6AB 3T2NH 3UTTE 3WE6A 5I1HH 5AZEL 5KOVC 5DHYB 3BKJH 3BZFA 3MLVL 5TGBA 5HXMA 4N9GA 4X4YA 4LSDA 5T1MB 4HG4J 4Y16A 4D8PA 1J1XL 5IB5B 5KSBA 4NPYA 1C7TA 5EIIB 5LAXB 3ULSA 2QJDA 4P0DA 4KRMB 1JFQH 5KSUB 1MFEL 4XI5D 5TDNA 2A0LC 3QRGH 1HQRA 3NA9H 4KVNH 3O6FD 1CZ8H 1MFAL 2Q1EA 2M26A 4NT6B 1XEDA 4HF5H 3WE6B 2CQVA 3BZFB 5IF0A 3IETA 2B0SH 4OLEA 3K8LA 5DEGB 4G6AC 3AM8C 4D8PB 4Q9CA 2YKLH 4TPRL 5KSBB 4NPYB 2AQ2A 5F71A 2UZIL 5JXED 2X44D 5FKPA 3CFCL 3UPCA 1CDYA 1HQRB 4HK0B 2R8SH 1B4JL 2DQUL 2R0ZL 3T0XA 2GHWB 2MWCA 1HILB 2FJFB 1T1YB 5IF0B 5IMMB 4G6ML 4GAJL 3N1FC 5EU6B 1PKQB 4I8DA 4NZRL 2PO6D 1FZKA 3CFKA 1EHLL 4UV4L 2V9QA 1H15A 1AGFB 4RGMC 1EV2E 4KV5E 4KI5D 1GC1C 1AXIB 5CJQL 1TETL 5F7UA 1P4IH 5L8LB 5FKPB 4S1RH 4QF1A 4YPGA 1F5WA 2Y6SD 2DM3A 4ZYKA 3P2TA 5IB2A 2OYPA 3O6ML 1F90L 3GSXA 4ORZC 3N9GH 4PRAA 2R4RL 2X09A 4KH2A 2ZNWA 3K4ZA 1EGJH 4X9IA 2WV3A 1P9MA 2HJKA 1F13A 1LO0H 1I1AD 1U3ZA 3CFKB 2XNAB 2KUTA 5IB4A 4LL9A 2YWZA 4MDIA 2EE6A 4LCWD 5KBNC 2D7PA 3SHSA 2F5BH 4HDIA 3O3EA 3LY6A 4YGVA 4QF1B 4BSJA 1TPXC 2ZUUA 1M7DA 5IB2B 1T5WA 5H94A 2JCCF 2V5SA 1EZVY 1HN1A 1KFAL 1OVZA 1I9IL 3HB3D 1CXFA 4PRAB 1DSFL 3NABL 4YC2B 3OV6A 4P3DA 3FB7A 3GMMB 2VLKD 2XZAH 1QYGL 4JPKH 4LFHD 3ZE2E 1R24B 3ZL4L 2V17L 5TJWK 3ZYZA 5IB4B 4M62L 4MDIB 2PYEB 5BV7B 3K3QA 3QJHA 3KVQA 3RNKB 3VXNB 4NDMB 4HDIB 3O3EB 5BO1H 4YGVB 4MX7B 1T5WB 5H8DA 3LQZB 4X7TA 4PY7A 4KI5E 4NWTH 2CLVA 4ZFZA 4OCRH 1G9MC 4OFDA 3MV7A 4KAQL 4L8SC 3D5OF 4P3DB 2F8XC 3GNML 4RFOH 1WFNA 2HKFH 4Q74A 3FO9A 3SKNB 3K8MA 2E7CA 1IGTB 3I6GA 3MRLA 1RIHH 1Z3GH 2NXYC 3SEPA 4X7TB 4PY7B 1ZLSL 2CLVB 4G8GD 4O2EA 3SO5A 2EEDA 1G9MH 1NGXA 3MV7B 1P7QA 4LCWE 1T7XA 3R0MA 2YMXL 4ZFGH 1OARL 3HPLA 2V2XB 5F9OL 3IYLW 4AMKH 1OTUC 3MNZA 1UKSA 1KPRA 4PJIE 4YUEH 4NQXB 2FO1A 2C1OB 3I6GB 6FABH 3GRWH 3MRLB 4S1DD 3WIIL 3V7AG 4Q9QH 2VLKE 4IRJA 3Q5TA 3QUYC 1I7TA 1IBGL 2ZCKL 2HVKA 4HK3J 5IROC 2X9YA 4W70A 4O2EB 5DRZA 3UDWA 1S9XA 1NGXB 3VDCA 2DQGH 4JREC 2NY3D 4P2RD 4G42B 5LWYH 1JZ6A 4OM0H 2V9TA 3TV3H 3MNZB 3MCG1 1OWRM 1KPRB 3ORJA 4WTZA 5D96B 5E2TL 1QSFA 3HR5A 2P42B 3V2AR 5E2UH 3S6CA 1QVOA 3G6JF 2VDML 5IG7B 5ICYA 3SE8L 1I7TB 1TZGH 4PGJA 3ALWA 3DRQA 3V6OA 4QRRA 4CJ1A 1GGYA 4OLWL 1L0XA 1YEJH 4LDOB 4PG9B 3DGGB 1JNNH 1C08A 2V2WA 3WNPA 4LIQL 3B9KA 1T2JA 5DD5H 2HG5B 4NCC2 2IAMC 3PNWA 3MNVA 7FABH 1IM3B 4X4ZA 3ARFD 1ROWA 4G8GE 1BQLL 2DLTA 1QSFB 2QQKL 3IJYA 1MCCA 5DI8A 1RZJL 3TN0D 3ZKND 1QVOB 1LO5B 1RUAL 1KB5A 2VXQL 3DGCR 4I5BA 4MQ7A 4QRRB 3GBML 4PFEA 1R3IH 3TA3C 3MOBH 2AW2A 4XXCC 1T1XA 5F9DC 5IJKC 1AJ7L 1C08B 2V2WB 3B9KB 3ULUD 4Y4HA 4YE4L 2XPGA 3B9EA 2NY2C 3PNWB 3MNVB 3GJEA 3IJYB 3OX8A 3DX9A 4P2RE 4PUBL 5DI8B 1AXTH 2BVOB 1BJ8A 1J1OL 3RTQD 2KBGA 1K4DA 3EOTH 1UENA 2Y72A 1BZ9A 1KB5B 1NGPH 4YO0A 5EH1A 4I5BB 4QXTA 1T1XB 5T1LA 3QWRA 4R96B 1LP9E 1JPTH 3L3JA 2XPGB 3PV7A 1SY6A 5D72L 3NPSB 1G6VK 3GJEB 4OF7A 5KSBF 4U7SA 5JIIA 4NRYA 5FHBL 1W8NA 1MCHA 3OX8B 2HFFA 1AO7A 4WU5B 3QQNA 3GMLA 3O3BA 4H8WH 1K4DB 2HJFB 1MUJB 2COQA 1U3HC 1BZ9B 2KDGA 4L9LA 2NY4D 4YO0B 3GSUA 1JF5A 2ZUWA 2IPUK 2ZUQB 4QXTB 1KPVA 2RCSL 3ZHLA 4R90L 4XHQA 2VIRA 4JVWA 5T1LB 3QHTC 4GFTB 5A2JH 4DN4L 3I2CH 1DTUA 3Q6FA 3L3JB 1W2KT 3QDJB 1BM3H 4NRYB 3D18B 1TZIA 4PV9A 2HFFB 1AO7B 3BQUD 1RZGA 5CGYD 1L7IH 2XTJD 4V2CB 2P8MA 3GMLB 3O3BB 3ULUE 4YXHL 1QQDA 4L9LB 4H88H 1FYTA 2D0FA 5EN2B 3GSUB 4FZEL 1FBIH 1UQSA 1NCBH 4F2MA 2X2YA 4OFVA 2VIRB 4FA8A 1EEZA 3KYNB 2RGSA 3MV9D 4WWKC 1I75A 5E5MA 3Q6FB 5C07D 3KPRD 3IDXH 1X5AA 2P45B 1KJVA 3PQYA 1CS6A 1RK0A 2VR5A 3LMJL 1JL8A 1TZIB 3RIAK 4PV9B 4G43A 1RZGB 4LDEB 1RUPH 4P57A 1RVFL 3F5WB 4AENA 4EUPA 3BRDA 2PTVA 1MF2H 2VLRB 4OF5A 2Z35A 1QQDB 1VDGA 3F6IA 2IBGA 1B2WL 1UQSB 2GJ6D 3RGVA 4F2MB 2C4FT 2FNBA 5HGDA 1X5LA 3MFFA 2RR3A 4U1NA 3PQYB 1SYVA 1FZOA 4FQJL 5CZVH 3WNOA 5L2JB 3TO4D 1ZTXL 2F53A 2NY5H 3MNWA 1V7ML 2I60L 2VXVH 3EDJA 3VXQA 2FLRT 1OAYH 2JK5A 2DJ4A 3C5ZD 5E6ID 2ADJA 5GGTH 4XAWL 4PJ8B 4DN3H 4MNQD 2XTJE 5F7MC 2VN4A 3QJFB 2ZJSL 4GRWB 1FZJA 3OXSA 1KLGB 3QIUC 3CH1A 5HGDB 3MFFB 4J6RL 1SYVB 1KV3A 4JG0H 5JA8B 1BGXL 1QFOA 3C9NA 5I8KL 3ROOA 3EYUH 4JRXD 1CQYA 1ORSB 3QPQD 2CDGA 3BGFB 3MV9E 1D7FA 5L0QB 4FQHB 4UIKL 1B88A 5C07E 3HAEG 3KPRE 3PHOB 5KJRH 4XPHL 1JZ8A 2JK5B 2X4OA 1CU4H 4IDJL 5DMIH 2ADJB 3MJ9L 4XPFL 5I74B 3T3MF 4FP8L 2XG5A 3WXWL 4C83B 1FZJB 1MI5B 3ARDB 3OXSB 3CH1B 1NGZA 2Z0BA 2GJ6E 5JPMB 3C9NB 4I0PC 3KJ4B 2EC9T 3EOYG 5I1IH 2I9TA 4RNRB 4OZIA 4HKBA 1LK2A 1CFBA 1RJZA 4ZTPH 4GBXA 3VFNA 2VDOH 4F7MB 4LSQH 5C0JB 5JUEH 3S8WA 1LO3H 5I17B 2GKIA 2X4OB 3WFDL 4JRYA 2A83A 4AG4L 3GEWB 2DL9A 4LNVA 3R0NA 3C5JB 1V5JA 4WO4C 4XP4L 5HDQL 1KJ2A 3A67H 3F7YB 1ADQL 3JTTA 4PBXA 4BK4A 1RK1A 1NGZB 1UXSB 4EN3C 3RL2B 2Z4QB 2AGJH 7CGTA 1XF4A 2F5AL 4MNQE 2I9TB 4OZIB 3BFOA 4U05A 3WJJC 1RJZB 1A7PH 4Q6IC 4BZYA 3WIHA 4EXPX 5IW6B 4GBXB 3GIVA 1KLUA 5K59E 3TYGH 1NAKL 4LCCB 3REVB 4JRYB 3HUJA 1FSKC 2IQ9L 2FZ3A 5BMFH 5EO9B 4JRXE 4O9HH 3R4DA 1F00I 3MRQB 2IPTH 4GAYA 3EIFA 2VSDA 1A9EA 1K6QH 5D7IE 2GITB 2VWEE 5D1QC 1MWAL 3NACL 3B4NA 4HAGA 1XF4B 4Y2DD 1UG9A 4U1IB 2XWBA 3IFLH 5HDOA 4YHIA 5FYKD 4Y1AA 2QTEA 1X5YA 5DJXA 3GIVB 4UIMB 1KLUB 1UM4H 3TZVD 1FFPA 1FZMB 5F6IC 5K9KB 4NFCA 4WHDA 2E9JA 3HUJB 5E1AA 4F9LA 2FZ3B 1S7SB 3NFPA 5DYOB 4M6OH 4V1DB 3CFJB 3DX8A 3HG1D 1NUFA 4UV7L 1BVZA 1I3GH 2P5EA 2UV3A 3FRPG 2VXTH 4JO1L 1MCIA 4OTXL 3E2HB 1A9EB 4R3SA 1U6AH 2Z91B 1IQWH 4HLZH 1A3LL 4Y8AA 2XWBB 1W0VA 3VJ6A 1J9CT 1J1PH 4JFQA 4YHIB 5SWSA 5CEXB 5DJXB 4OF0A 4P49A 1FFPB 2PTTA 5AG9A 5HHQA 4K7PY 5E1AB 3NFPB 2CLRA 3DUSA 1C5CL 3ARSA 1IKNC 3MLZH 2GTZA 2F8OA 1L0QA 3HNTH 3VWKA 5CD3A 2X89A 3GSWA 3V6FA 2LTQB 2O61A 3MO1A 3PDOA 4R3SB 3VXRD 2BNQB 2CXGA 4D0CA 3V0AC 2BDNL 5GGSA 3NIFE 2WW8A 4WJ5A 1W0VB 3VJ6B 4TULH 4JFQB 5SWSB 1P4BL 2GYSA 2WBJB 4C59B 5M94B 4W81A 4M6MH 1R3JA 3CDYA 2M1KA 4K3HA 1HHIB 3NGBC 3VMNA 3HTLX 4FQ1L 2EC8A 3T2NL 1S9VA 5I1HL 3UPRB 1VADA 5HHQB 3BKJL 4Y5XC 2CLRB 3DUSB 5JZ7D 3L95A 3BPLB 5K9QG 3VWKB 1HH9A 1QHPA 2EC9U 5FYKE 4F37K 3SDAD 3GSWB 1QSZA 2KQNA 3V6FB 3KWWB 3RU8H 3MO1B 4MNGB 5T5FL 1FG9C 3QHFH 4XNXH 4XBGB 5ACLA 1J5OL 4L4TA 2DBLH 2CMRH 3HG1E 3ES6B 1OAXH 4XPBH 2X4TA 4KVNL 1CZ8L 5CP7A 1IGMH 3DO7A 3NN8A 3G5YB 3ZE1F 4HWNA 1R3JB 4HF5L 4FNLH 1S9VB 3BOVA 5D1XC 3X12A 4JVPA 4P5TA 5FK9A 3GSVA 2B0SL 1KTRL 4DEPC 3L95B 2E5EA 1RJCA 1HH9B 3RX8A 5LGKA 3U4EB 3MOQA 2VZ3A 1XMWA 4LSTH 2DLHA 2CR3A 4L4TB 4D94A 3MJ7A 3U6RA 1KPUA 2R2BB 4OZHE 5IW1B 2X4TB 4Z95H 1S8DB 3DO7B 5ANME 1FLRL 1WZLA 3GSRA 3VXRE 1CXEA 2RBLA 4LHUG 1X5IA 2BHZA 5JHDD 5I1CH 4CJ0A 2Z31A 2IH3A 4NQDB 4P4KC 4ONGH 3BZ4B 5FA4B 2H26A 3CFBB 3UTSD 4CU6A 4YAQA 5EUKA 2PXYA 4P46A 5JMRA 1LNUA 3PWLB 4X5LA 4P9ML 3TIEA 1P4IL 3RY6C 3MJ7B 1KPUB 4S1RL 1G6RH 5C0ND 3NVQA 4WNQA 4HS8H 5B38G 1KB9J 1A7OL 4CN6A 1BD2D 4O2FA 2H9GB 1D5ZA 4QT5B 2ED7A 4JN2A 5JDSA 5D2NB 2DI8A 3QNZA 5LGHL 4BH8A 1NJ9A 1YPZA 4K55A 2FEEL 2Z31B 3S3PA 4F15B 2VDPH 1NEZA 2VZUA 1FNGA 3QIBC 4U7MA 4GRWF 2IH3B 1B0GB 1N64L 2PW2B 2ZCHH 2H26B 1YEGH 2W9DH 3O45A 4YAQB 4JPVH 1NCDH 1LNUB 1NQBA 3PGDA 5FV1L 4XMLH 2F5BL 5DD3H 4GW5B 3P30H 4WW1B 4E42B 5F96L 2H2SC 4OUOA 4YHYB 4O2FB 4LFHG 2BVUA 1FO0B 5ITFA 3QNZB 5C71A 4BH8B 1NJ9B 1YPZB 2XZAL 4JPKL 1NEZB 1FNGB 3HLAB 2E9WA 3IDIA 4PLKD 3TNNA 1MCKA 4XVUD 5JHDE 1NAML 1NCAH 5BO1L 3RDTA 5D7JD 4U2ZA 5EC1A 1FVDA 4P23C 4HUKB 4TVPH 2EEAA 4DKAA 3EJZD 4OCSH 3UTSE 2ILLA 4OCRL 4RMRA 3U9UA 3SPVA 4PYHA 5ITFB 1CICA 3B2UC 1DBJH 1YJDH 3U7YH 1E4WH 3GBLA 5CGMA 4RFOL 3GSNB 1U8KB 2HFEB 1TTUA 5T1DH 1BD2E 4JFEB 5ILTH 3IDIB 1WITA 4DUXA 3TNNB 5J8OA 1RIHL 1O5DT 5IMKA 4P5MA 3RDTB 3QAZB 3RIFK 1Z3GL 4OZIF 5EC1B 4DKDC 2HP4A 2YHGA 1FVDB 4G6FD 4LPCA 1ZGLA 1G9ML 2FD6H 4FQCH 4ZUVA 4ZFGL 1CICB 1T89A 2FGZA 5IGXH 4PY8I 3VXUD 2DQCH 2F19H 2LVCA 5ID0A 1PFCA 4WW2C 2IAND 2EDXA 5FO7A 1P53A 2BNUB 3SDCA 3ARGD 4XHJC 4YUEL 4EKXA 4XC3H 2UWEE 4X6DE 5HI5C 3FFCD 1LEIA 4LLVA 4OZFG 5IMKB 1OHQA 5CZXC 4Q9QL 4Z7QF 1Q9WB 2A2QT 5C0AA 1VENA 2DYPA 1RUQL 3MA9L 4ZUVB 2E7HA 3HUJF 3IDNA 5LWYL 4OM0L 1AD9A 2YOCA 5IHLB 3X17A 5CZKA 3SDCB 5FO7B 1KOAA 4QOKA 3ECBB 1JZ3A 1LEIB 1MFDL 3RZCC 2FX7L 1FGVL 4DZ8A 4EQ3A 3QXUA 3U0WL 5EBLA 1FVCA 2RFXA 4GMTL 5C0AB 3TYFA 3E8UH 3ZHDA 3MCKA 4PJXE 1JV5A 2C1PA 4KK6D 3MLYH 4MLIA 1VEOA 4YDVA 4X6FA 5I1KH 4X9GA 3IDNB 3NFSH 3GKWH 1JNNL 2IBZX 5DD5L 1OTTC 5DJZA 7FABL 4QOKB 1JK8A 2B1AL 1HH6A 2C3GA 3O6LH 5DURD 5CFHA 1UH2A 4DZ8B 3VXUE 1DR9A 1N3NA 1A8JH 3I85A 3QULB 3T4AA 5EBLB 2RFXB 2IANE 3OAYK 3TYFB 3MCKB 1T80A 1JV5B 2EIBA 2C1PB 2DAVA 2P7TB 3L5WA 3FFCE 4X6FB 1R3IL 4YDVB 3GMPA 3RWDA 4KGJA 5HGBB 5HHMB 4W4OC 3QXAA 3V5KA 5DJZB 5J13B 4HFUH 1JK8B 2IEPA 3QUZB 5DD6B 1HH6B 1WJ3A 3RY5A 1U8OA 4HQQL 5JQHC 2YPLB 1AXTL 3BH9B 1EO8L 2EDFA 4I18B 1N3NB 2ITDA 4PJGA 3EOTL 1TJHL 1JPFA 1CGSH 4ZAKA 1NGPL 2DLFL 2EYSB 3H3PH 2VABA 4N0YH 4B41A 3TO2B 3V5KB 1EK3A 1JPTL 3QI9B 4S2SA 3W11D 5HJ3A 2FECI 5J3HD 2XWTB 1LE5A 2JE8A 5HI3D 2ITDB 4IRSA 4KXZI 4PJGB 5C6PB 2XZQL 2AJSH 3DV4A 4R4BB 4ZAKB 2VABB 4OLVH 1A14L 5F72S 4L8BA 4MYWB 2UY7A 4M1GH 2N7BA 4S2SB 1ZT4A 2VO5A 4WHTA 3LZFL 3RKPA 1S78D 4PJDE 1BM3L 5A3ID 5DJ6B 4J3WA 4HBCH 3V0VA 1SBBA 4C4KT 2NTSP 1ZWIA 1LHZA 1L7IL 4Q2ZA 1LE5B 5JW4M 4IRSB 4WI4A 3DV4B 1PG7X 2GCYA 4H88L 3D87B 2O93L 2X1PA 1FBIL 2ARJA 5C70A 4HIEA 4JZJC 5DGRA 3FFDA 4H25A 4L8BB 1FCGA 1UFUA 5DJDA 3IDXL 1ZT4B 4WHTB 3WFBH 1GJIA 3QCUH 1CD1A 3V0VB 4YLQT 3ARZA 4CVZB 5E56A 1MF2L 4UU9A 1HSAA 4ONFL 4POZC 1KBGH 1P4LA 3MQIA 5GZOD 1CIUA 4JQXC 5DEZA 4AM0B 3B9VA 5FXCH 4R4FH 2ARJB 1ZE3C 2B5IC 1YPZF 4XPTL 4N5EC 4N0RA 4OFYA 3VFPB 3JVGC 5DJDB 3UYPA 2BY3A 1TJGH 4NSKB 5CZVL 1CD1B 1UM6L 3SGKA 3TPKA 3LN9A 4LGSB 4C56D 1DQTA 1GIGL 1ZT1B 2UY6A 4UU9B 3VCLA 5I71C 4RCAA 1OAYL 3Q2CA 3UX9B 4J3UA 1P5VA 4QHMA 4I3GA 3DO3A 1I85A 5DMGC 4MD0A 3PE9A 1K4CA 2Y23A 2VRAA 2IPUG 3OAYH 4NM8L 5D9SA 3MJ9A 4CRPA 5BS0A 3U48A 5CKAA 3EYUL 4CAGA 3TEUA 4YDJA 3S34H 4O2CA 1XF2A 3VXSD 3P4MA 3FQRA 1QA9A 4WIQA 3VCLB 5IKCA 1KTKE 3NIGF 5K9QI 3TC9A 3JWOC 5KJRL 5FDWB 3GJFA 5B39G 4DVBA 1CU4L 5LGJA 4NP4H 4PRIA 1TLKA 1JGLL 4EQ2A 4ZPTA 2NY1B 4RAUB 1MFCH 3AS1A 5HPMA 4FN0A 4MD0B 3AVEA 1K4CB 1XGQA 2DDQH 3QR2A 4G8FA 1AI1L 1FE8H 4LHQB 1OAQH 4MA8H 5D9SB 4NBYB 5TE7H 3JUZA 1EIBA 1TNMA 3S4SG 5I1IL 1DVFA 1WBXA 4LU5L 1P7HL 1FP5A 2JIXD 4Y5YA 3T0EC 2FEEI 3P11H 1BMGA 1ADQA 4Y4KD 4JO3H 4ZTPL 5IKCB 3VD4A 3GJFB 5JUEL 4DVBB 1LO3L 3C60A 2AVGA 4PRIB 4KKAC 3K0WA 3QUKB 3OAUH 4C56E 4XAKD 1Q8MA 1Z0MA 2DL2A 1XGQB 4G8FB 2B20A 2AGJL 2NYYD 1DVFB 4AT6B 1XIWD 4Y5YB 3U30C 1A7PL 5JXAH 3DJ9A 1P1ZB 1YN6B 1EHXA 1XF3A 1MWAA 2Y7QB 2YD6A 1JF6A 3IAGC 2ZG2A 3C60B 3MYZA 4P2QB 4IIQB 2DKSA 2D7MA 3VXSE 2D7QA 2V5RA 2IPTL 2BSED 4MJID 5ALCH 1K6QL 4K8RD 1NFDF 5FYJD 4DK6A 2QADB 4LLDA 1X7QA 5IHUH 1DLHA 4XI5C 5JOFB 2UZYB 3IFLL 4DGIH 4LPTA 3O6FC 2DLGA 2AERT 4U1GB 1W72H 1UM4L 1XF3B 4NRZB 2JB5H 1VERA 3O9WC 5EPMB 2XFXA 5C0IA 1S7RA 3DVFA 3FOMA 4M6OL 1BWWA 2VC2H 3VGGA 1D3CA 3BYTA 1I3GL 4MDJA 4JFDD 5HVHC 2VXTL 4JFYA 3SGJC 3ULVD 2YUXA 1FG2A 4PPTA 1X5FA 4I9WD 4XNUH 4GG6E 4LLDB 2P5WA 4OD1H 1U6AL 3TVMC 1IQWL 5JXEC 3H6JA 4P59H 4J3XA 3W82A 3BUYB 1DLHB 2EDLA 3QH3A 2FX9H 3D85D 1V05A 3D6GA 4HIJB 3SCMA 4LRIC 5L6YH 3TJEL 5GGVY 2DWEB 4XAKE 2P44B 3F58H 1FDLL 5HYJD 2CK0H 1WTLA 1S7UA 3S98A 4KC3B 3GHEH 3TPUB 3MLZL 5D70L 3S35H 3HNTL 1X4ZA 3T08A 4MDJB 1A7QL 1QR4A 4YHML 3AS2A 4X99B 4JFYB 4KI5C 4QHNA 3ARTA 1FG2B 4RRPA 4Y4FD 3J7HA 2P5WB 5F7KC 3FMGH 4FXGB 1ETZA 2AXFA 1A3RH 2OXGA 2Y6SC 4PJHF 3SCMB 3UTTB 1QBLH 4M6ML 4YXKH 4MJIE 5FYJE 2A9MH 5MEQA 1EPFA 2EDWA 3EJYD 1IARB 2MHAB 3HE7D 4NYLA 4WFHD 5ACMA 1T7WA 1A2YB 4J4PC 5GGSY 1IAIH 1HKFA 1FNEA 4OF3A 2R2EA 4F7EB 1NGQL 4QHNB 3RU8L 1R3KA 3BO8A 3QHFL 4XNXL 5DR5L 1BBJA 2DBLL 2CMRL 2AXFB 5ERWB 4ALAH 1ZLVK 1OAXL 3V8CA 4UINL 3VXTA 4Y89A 4JFDE 3T0AA 5DQ9B 3ULVE 4F7TB 1A47A 3HB3C 5DFVD 1CTOA 1HNFA 4I9WE 1RSFA 5MEQB 1V3LA 4QRTB 3RWJB 3W5NA 5JHLH 1SBSL 1DDHB 3WNKA 4NIKB 4ETYA 3D0LA 5CHNB 2DKMA 4H1LG 4PV8B 1F11A 5BZDA 5HYJE 3RWCB 3P4NB 4LSTL 1J86A 4LOUD 1R0AL 1BBJB 2YD7A 3WNNA 3AM8A 4ZDHA 1QKZL 3VXTB 3BEVA 4XNZC 4IBLT 1CGWA 1FAIH 3MRKA 1NEUA 1KJ3H 3U83A 3RNQA 1ZEAL 4ZG1A 4TOYH 1MCRA 5ABDE 1KXVC 3O4LD 3V6ZB 1MEXH 1I8IB 5I1CL 3LKSA 1E6JH 1PSKL 3ARBD 3VWJD 2VDQH 3VFSA 3RI5K 3RVUD 4ONGL 4DOHE 3ZDXE 1WV7T 25C8H 1F11B 5BZDB 1Y18A 4OD3H 1CD8A 4WFHE 1GZPA 4P3WA 3X11A 1K3IA 1NSNH 3VXMA 1G6RL 4NNPH 3BEVB 2EZ0D 2VISA 4HS8L 3RAJL 3QWOA 1H0DA 3SO3B 1CWVA 3NCJL 2W65A 3L5XH 3MRKB 4D0BA 1INEL 3RNQB 1BZQK 5JDJA 4KK5D 4HPYH 3MODH 4YWGH 4NKOA 3LKSB 1F2QA 3QQ9D 2VDPL 5DEFA 1I7ZA 3MRDA 3VFSB 2APXA 4FQXD 3S88H 1YEGL 2Q3AA 4HG4K 4JPVL 1NCDL 3KYMA 1GZPB 4XMLL 5HSFA 2YR3A 1K8IA 3P30L 5L7XL 3QWOB 1W0YT 1BJ1H 2R0LH 4D0BB 4BUGA 4O58H 5JIHA 1FYHB 1NAMA 2NY3C 3WJLC 2AJUH 1A4JA 4Y19B 3DMMA 3WHE0 2BOBA 2H2PD 3ARED 4WWID 2XICA 4C54A 4NFDA 5DEFB 4YPJA 2ZSVA 5BRZD 2CO7B 3WLWD 1ZHBA 2HLFD 1DL7L 4PJ5A 3ZT7A 4GSDH 3SKJH 2PO6B 1EHNA 1R5VA 3O4LE 4LSSH 1DP0A 3L3IA 4LKXA 4LHUB 1NCAL 2EYTA 4HXBH 1K8IB 2H1PH 3IJHA 5C0CA 1AKJD 2X10A 1J7VR 2X4UB 3DOSA 4TVPL 4ZSOE 2V7NB 1OP5K 5JO5A 1DBJL 3U7YL 3DMMB 2BOBB 5T3ZD 5J12C 3FQXB 4HUWB 1J8HD 1MRFH 4RQQA 4PJ5B 5ILTL 3UYRL 3S7GA 5IJVA 2F15A 1I1AB 3GO1H 1PZ5A 2FHBA 2XKSA 2ICWA 3L3IB 4LKXB 2X70A 3A6CH 3TN0C 4WUUA 3ZKNC 4GKNA 5DSCA 4NKIL 4I77H 3WFCL 2FD6L 1D9KB 4FQCL 2FWOA 3JXAA 5JO5B 3L3GA 5C0FA 3RWFA 2DQCL 4PJIB 4POYA 4UOJA 3ULUC 2ED9A 1BQHA 3FZUD 4Z7WA 4DUWA 4RQQB 4X98B 5I8CA 1KTLA 4JFOB 4YQXH 2ZG1A 2P1YA 3LEYH 3ZKXC 5IJVB 1FV1A 2VDKH 1PZ5B 1AR1D 2ICWB 2QR0A 2X70B 2JCCE 4WUUB 3RTQC 2Q8AH 1PD6A 1RZFL 2AS5M 5BRZE 1IGCH 1CVRA 2CKNA 2YRZA 2AEWA 1TCMA 1K5NB 1FFOA 4GRMA 4NCC1 2FWOB 3L3GB 5C0FB 3QUYA 4ZS7H 2J8OA 4H0GA 5IROA 3Q3GB 4NWUH 5CINH 1I8LC 3DXAA 1KTLB 5I8CB 4APQC 2G75A 4OLUL 1FV1B 4AQ1B 4XPAH 5T3ZE 3MFGB 2M2DA 1RZ8A 3V5HA 3E8UL 1J8HE 4LLMB 2NY4C 4KQ3L 4N0FA 4DK3A 5CSGA 4OBSA 5I1KL 2WINA 3CXHJ 3NFSL 3GKWL 1Q0XH 4JGJA 3BT2H 4NJ9H 4OT1L 4I13B 5IQ7H 4G8GB 4BKLA 3MBEC 4JJHA 4GRLC 2KQMA 4MMZC 4YXLL 2CRMA 2VLMD 2H32H 1WBZA 5HYSG 3O6LL 1I3VA 1E27A 4TUOB 5CGYC 2DD8H 2NZ9D 3C08L 4RFNC 3TGXA 4NO0D 1RZ8B 3V5HB 2EE3A 4H5SB 2FCBA 1OTSC 3R8BB 4N0FB 2HTKD 5AG8A 2OTWA 5CWSA 2ICWJ 4Z7UA 4BKLB 4RMTA 4JFPB 4HFUL 1CXKA 4P2RB 3TA3A 1WBZB 2IMMA 1WZKA 4PJCE 4QNPF 4XWOD 1T0NB 3STBA 4RAHA 2R23A 3VMOA 1IJ9A 1INDH 4BH7A 5F7YC 3P4LA 3BMWA 4JFXA 4N0YL 3W9DB 4HFWA 1YYMH 2OTWB 4MNHA 5EOTA 1GHFH 1CE6A 2LAGB 4Z7UB 5C3TA 4G7YH 4KDTC 1DANT 2XIDA 1ND0B 5MERA 2F8VA 2BNRA 3QZWG 1OP5H 4OCXH 3KPSA 1U92A 3G6JE 4HS6A 1TENA 4DAGH 1YDPB 1NBQA 2R23B 2AJSL 1T03H 4BH7B 3AAZA 3FQUA 2VLME 4JFXB 4TNVK 2IBZY 5E6IC 3C5ZC 5KAQF 5GXBB 1QZ1A 4M61A 3L3KA 1ZVYA 1FVEA 3ARRA 4OLVL 4FFVD 1RY7B 5EOTB 1CE6B 2BMKA 2E8ZA 3BKYH 4KV5F 1U3HA 2IJ0C 5ICZA 1DLFH 3H42H 5MERB 1C5BL 2BNRB 3WHXB 1KEGH 4L9DA 4HWZB 3KPSB 1U92B 4HS6B 3BN9D 1CGTA 3QPQC 4GS7B 2E9IA 3GMNA 3VFWA 2OCFD 3FQUB 3HKFA 1CCZA 2ADGA 3N1PC 1MJ8L 1TQCB 2VWEC 5CILL 4D9RD 4M61B 3L3KB 4KKCC 1FVEB 5ACZA 3OB8A 2HN7A 1VKXA 3HFMH 4CADA 4NO3B 1N5YL 4M02A 4B7IA 4XVSH 5INCA 3MOAH 2GFBA 5FYLH 4NKQB 4RMWA 4WWKA 4XNYL 3GMNB 3VFWB 1GPOL 1OSPL 3NCEB 2ADGB 1KBGL 2DQIH 5DTFB 5EUOA 1MHPH 1KIPA 5H2BA 3TCLA 2BVTA 1A4KA 4R4FL 5IVOA 5EORH 1IE5A 3UTZA 1MAJA 3N85H 2HN7B 4P5KA 1P84K 1ERNA 5KSBE 5J6GB 1VKXB 2A73A 3ILPA 3L3OA 5INCB 1J0ZA 5ELIA 2ERJC 4WWKB 2DQEH 2IMNA 1D6EA 5SWZA 3EW3B 1X5HA 2NX5A 3BQUB 2CPCA 3QA3A 3TCLB 1KIPB 2XTJB 3IDGB 3RPKA 3IJSB 3UTZB 5EZJB 2A38A 2FIKA 5F7DA 1JNLL 4JEGB 2HWZH 5DMJB 3L3OB 1I4FB 3OG4B 2WQRA 3UTPD 1A6UH 5IMOB 1OM3L 4D9RE 1TVBB 4PREA 3S34L 2AQ1A 3QIUA 5SWZB 3MBXH 1IAKA 1BLNA 4K2UH 1NLBL 4EOWH 3D3VA 3FCTA 4NP4L 2BJMH 2H3NA 1DANU 4Q7DA 2DQDL 3FB5A 2VZ1A 3BEWA 4P2YA 1FCCA 2YSSA 4MVBD 4PJIF 1JYXA 2GJ6B 3WS6C 2DDQL 2ATPA 5F7DB 1FE8L 2DM7A 4H0IA 4BSWB 1OAQL 3MV7D 4MA8L 5A2FA 2Y36H 4WTWA 5IT2H 3QG6B 3VFTA 1T1WB 4U3CA 1BECA 2A6IA 2Y4SA 3FQTB 2J5LB 5DUBB 4OGYH 1OAZL 1MFNA 4JFFB 1A7NH 1GL4B 2AJVH 4JO3L 3WO4B 2OL3H 3P0YH 1RI8A 4PRHB 4I0PA 3D3VB 2H3NB 1A9BB 5EU3A 2GSIB 2DICA 3K81A 5DJ8B 3PGFL 1LMKA 3BEWB 1ES0B 4KTDH 2YSSB 3OAUL 4FFYH 3ARQA 3O2WH 5JW4R 4KZEL 2VDRL 1EFXA 5F6HI 1A6VH 2ATPB 3KJ6H 1P7QD 2MFNA 2OJEA 3VFVA 4AL8H 3VFTB 3MJ6A 3NCCB 5B8CB 1KYOJ 3JWDH 3I3EA 3QDMB 5EOCH 5JXAL 2QSQA 3ZO0A 4UILH 1JN6B 2X7LB 3UTPE 4FQPA 5EU3B 3TJHD 4EDWH 3C09B 5JZ7C 4IRJD 4Q6IA 2X40A 2N7AA 3DRTB 4UOW1 2Q87A 1U8HA 3HRZA 2IQAB 3H9YA 1GXEA 1X4YA 3VFVB 5C09B 2MPAH 4JG1H 1YNTB 2WLYA 5L88H 4YHPA 1IC7H 3PWVB 5DJYA 1W72L 4AH2B 1QSFD 5C0GB 3MV7E 3EOBA 3T3ME 3V52H 4X80H 2ZOLA 3MUY1 5C9JA 4OIIH 3AROA 3HRZB 4DQOL 4QRRD 4F7CA 2F9BT 1R3LB 3LVEA 2HRPL 5F89B 4CW1B 3EO1B 5J7CC 5GIRA 3S3SA 3QFJA 5GSVA 1GAFL 2ZKHH 3T65A 2ID5A 3B9KD 5HHNA 2FX9L 1N2RB 5L6YL 3T77B 4YFDB 1PEZA 5JMOC 2FJGA 4U4BA 4ZUTA 3F58L 3HZMB 3TBSA 1NFKA 2VR4A 4XVJH 2CK0L 3I9GH 1LP9F 1IAMA 3QHZH 3GHEL 4XPGL 2AI0H 5KSVB 4W6WB 3LRGA 4JN1H 4JDVA 1LDPL 2ZOLB 3WSQL 1BOYA 4Z7UF 2HT4C 4ZPVA 1OY3B 1BBDH 2EXWC 3F7QA 4F7CB 4G6KH 1JWMA 1IKNA 3KHOA 1BVKA 3RWEA 3QFJB 4MA3A 1YMMA 1A3RL 1KELH 3BP6A 4X8JA 5HHNB 5C0NC 3EYVA 4OAWA 4F58H 4L3AA 1N7MH 5E9DA 1QBLL 2F58H 4YXKL 4P9HH 2HT2C 3T04D 3TBSB 5E6ZA 4MA7L 1T0PB 4ELKA 1X9QA 3P4OA 3UTOA 4DGYH 4JDVB 5DQJB 1IAIL 5CSZA 1A1MA 5A2KH 1BVLA 3ZTJH 1ONQA 1OT1A 1QSFE 3WLBB 3OSKA 2R0WH 5T1LD 1JWMB 3RWEB 3QWRD 4MA3B 3TBVA 1ED3A 4K3GA 1YC8A 3G04A 4ALAL 4X8JB 3EYVB 4OAWB 3QDJD 4QRRE 3LKRB 5CJ5A 5E7FA 5F9AC 1AO7D 1ZVSA 4PJAA 1JGEA 3VH8A 3LKQA 5JHLL 2X5PA 3DYPA 4HWEH 3P4OB 2GY5A 1CLYL 4HK3N 4PGEB 1BVLB 1LEGA 3I50H 5D1XA 5DHXB 4AZ8A 1WWBX 4FQ2L 4PG2C 4OGZA 5IR1B 1A6TB 3DVGA 3TBVB 5C0DB 3OKMA 1OPGH 3X14B 4AQOA 5D7JC 5ANMB 3VXRB 2RB8A 1FAIL 1T0MA 3EJZC 1KJ3L 2OSLB 1ZVSB 4PJAB 4TOYL 1LQSR 3VH8B 4OB5H 1G6RA 4G8IA 1MEXL 1E6JL 1CQKA 2VDQL 1LEGB 4LEOA 2VE6A 4YK4B 4GXUN 5DGQA 1I3RB 4LPUA 5CCKH 4OD3L 4IOFD 4DEPB 3SDAB 4OM1L 3HCVA 3OKMB 4UZGA 5GISH 3C6LB 3SJVA 4NNPL 4P4KA 2NPLX 4WV1C 3VE0A 4CMHC 3H7LA 4C58B 3PQYD 4M93B 5JPNA 1JHTB 3UBXG 3ILQD 1H9VA 4TSCH 3RY6A 4HPYL 1U93B 5IVZA 1MNUH 3MODL 4YWGL 1G6RB 1B3JA 4G8IB 2X4SA 4ELMB 3K74B 3RL1A 2XQBL 3QDJE 5IVXB 4LEOB 3OKYA 1T83A 2VE6B 3ARGC 5GS2H 5ECJE 4XP9H 1AO7E 3RGVD 5J11C 5FUZH 1G7IB 2CUHA 3F7VA 3HCVB 3SJVB 5FM5O 5ID1A 3VE0B 4QLRA 1XR8A 2R0LL 4E5XA 4NN6B 5JPNB 4O58L 1YUHB 5C7XL 2F53D 3B5TA 1U8JA 3W9EA 2X4SB 1M6OB 3R1GH 3QEQA 4LGPB 5KS9A 4ZOCA 2ORBH 2GI7A 1QUNA 4M6NH 3BPCA 3H8NA 4Q9BA 3F7VB 3MRMB 4LSSL 5TDPA 2X4QA 3UTSB 2GK0B 3E0GA 5ID1B 1XR8B 4OZGA 4KK6C 4EUPH 1OQOA 5CP3A 4IMLA 1RMFH 1U8JB 1BD2B 3CXDH 3DETD 5FKAB 3PQYE 4L3EB 1CGUA 4KMQA 4MMXC 4JHWH 3X3GL 2ZSWA 1OAUH 1OGTA 1RHHB 1U95A 1B4RA 1XGRB 3GO1L 3S5LG 2BRRH 2AK1L 4I0CC 2AEQH 3A6CL 5E99H 2X4QB 5K59F 2QSTA 3MMEA 4TYUA 4RGOH 3BP4B 2EECA 4OZGB 1YEFH 2APWA 4GG8B 1S7XA 1WLHA 4ODSH 4I77L 1I7RB 1KB9K 4IMLB 1QLEH 3ABZA 1NFIB 2OR9H 3SE3C 4GRWE 3DECA 5IK3A 2OQJB 4GBXD 3EGSB 5BW7A 2OR7A 4JRYD 4YQXL 1CFNA 2F53E 3VGFA 3MUZ1 2VDKL 5ESVA 1OGTB 1U95B 1DBML 1YY9D 1IGCL 4ZO9A 4P2OC 2R1XA 1S7XB 4YZFE 4ZODA 1PJ9A 3PWPA 1J10A 1HDMA 5T3XD 4JCMA 4ZS7L 3ULUL 3FT4A 1U8NA 5J57B 3DPBA 3W11C 2XYCA 5CINL 4F9PC 1CFNB 3RIAF 2D7OA 4PGCB 2NY0B 4XPAL 2AAVA 5DS8A 5HI3C 5F9WB 1JZ2A 1C12A 2WWMD 3RZCA 3QSKB 2V6HA 3PWPB 4NKDA 4F57L 4YEFA 3O0RH 4G6FB 3BT2L 4NJ9L 4Y1AD 5IQ7L 3PP3K 4J1UA 4R7DA 3THMH 1WBYA 3FT4B 4U1HA 1HXYA 3CX5J 4NO2B 2C3VB 1EEYA 5A3IC 4NC1E 2G5RA 4LP4A 4NM4H 3NIFF 3PHQA 1VEMA 4OZIE 1KJ2H 3W81A 1DUYA 2MKWA 2DD8L 5DS8B 1AY1L 2P5ED 1C12B 5B4MC 4NQVA 5IEKA 5JOEA 5LXGH 2ENYA 4OQ1A 1FC2D 3JTSA 2BNQD 3L9RA 3M17B 4JRYE 3RX7A 3S36L 4YDIH 1N59A 1G9NC 2XKNA 5T3XH 5CJ8A 4BZ2L 4NKDB 3WIHH 3LEVH 2Q8BH 1J18A 1WAAA 4G3YH 5SWSD 2B4CH 4J1UB 3MXVL 4R7DB 2OXHA 4U1HB 1HXYB 4JPIA 1YYLH 4JKMA 2O5XL 1EEYB 1BIHA 5TE6L 2X6MA 1P7KA 2CDFA 3PHQB 1ZOXA 4UQ2B 2ENSA 3QQ3A 4W4OA 3VWKD 5T3XE 3QIWA 2X89D 3VRJA 1LD9A 4NQVB 1PG7W 5JR1L 1TQBC 5FM8A 3NPZB 2JLLA 1D5MB 5GZOC 3JTSB 5TE4L 3QUMH 3RQ3A 3HUJE 1FL3B 1E4XL 1N59B 2XKNB 2HKHH 5IHZB 1YYML 5E4EB 1GHFL 2GTWA 1GVIA 1HXMA 4G7YL 1FAKT 3G5ZA 4ZXBC 1WWAX 2PW1A 5IUSA 5FA3A 2X4RA 4OCXL 1S7QA 3ESVF 3O3UN 2K9UA 3KLSA 4G9DA 4Y1AE 4PB0H 4DAGL 5I0DA 3QIWB 5D6CB 1LD9B 4DCQA 5K9JH 5IBUB 4M48L 3HZVB 3KPMB 3KLAB 2R1WA 3DTXB 5HYSB 1QHOA 4L4TD 4PJAF 1ACYH 1QSEA 5FGBC 2GTWB 1MCNA 1YEIH 3E3QE 3BKYL 2P5EE 1HXMB 1OAKH 1K8DA 1DLFL 3G5ZB 4NQSA 2PW1B 3H42L 5E8OB 5L2KA 2BNQE 4KJWD 2OBGA 2X4RB 4P5TD 4NCDA 3LKPA 4ZUUA 2XXCB 5D8JH 5SWSE 3CMOH 5KVGH 5AZEH 1DQLL 2IGFH 3WO3B 2ZUSA 4BA8A 4ZNEA 1MIMH 5F7FA 2AXGA 2R1WB 1IL1A 4HGMA 1C1EH 3FL7A 3Q1SH 2XKUA 4ELMF 4PJ9B 3HFML 1K8DB 3MV01 4NQSB 4LSUL 5IVXF 5L2KB 5E24E 4XVSL 3MOAL 4HMCA 5FYLL 3MRJB 3LKPB 1IAII 2Z31D 4HD9A 2JJSC 1GGTA 4HH9A 4Y4KC 3HZKB 1IRAY 1DJSA 2DQIL 2PXYD 1MHPL 4P46D 2AXGB 3T0DA 1IL1B 3QZWB 2EE9A 4H20L 5EORL 5I76A 4JDZB 4MCYA 4S1QL 2BSSA 5IB3A 4CVWA 4WY7H 5I0ZA 5ETUA 4LK4A 3LD8B 5IHBA 4DWHA 4N1EA 4L4TE 5DJ2A 5IESH 1AC6A 3NTCH 2PF6A 2DQEL 3JVGA 1EXUB 5KSAA 2VXSH 4HH9B 3PP3H 3WN5C 4PJ7A 2X05A 1HHJA 4X9FA 3VGBA 1R5IA 3ZYJA 3U0PA 5FGCB 2X1OA 2Z92A 4QHKJ 3SDYL 2CIKA 4LEXL 2C4XA 1G7PA 4MCYB 3RVVD 5IB3B 1XCQA 5ETUB 4CDGC 2HWZL 4K8RC 4RDQG 1A6UL 2GIYA 5DJ2B 5AD0B 1F90H 5KSAB 3RJQB 3L3HB 4MJ4A 4JM2C 4IRZL 4MA1C 4E41A 4PJ7B 4EEEA 4OZGF 4K2UL 2XY2A 4EOWL 1H5BC 2NW3B 1R5IB 2BJML 3QB7C 1KCSL 4OV5B 3QDHA 3RDTD 4MAYA 1Y0LA 4HEPG 5TH2A 2CIKB 3L5HA 1CLCA 1DEEA 4F37F 3BSZL 5D1ZB 3ARXA 3QBTB 3ULVC 4UDUA 5TQ0H 1CICD 2EDTA 2VLLA 3NAAH 5IT2L 4RFEA 3HPJB 1KFAH 2QEJA 2CKBH 4KFZC 4QGTA 4JY4A 3BVNA 3NABH 3VFMA 3QNXB 5MEOA 2OL3L 4E41B 1J88A 4U6HA 5EZOH 2H41A 3P0YL 5I73B 4KRPB 2HTLD 3T0EA 1GH7A 4QRSB 3MRIA 1YPZE 1NCCH 4MAYB 4K9EH 4KTDL 2BP3A 5DO2C 1DEEB 35C8H 3S35X 4KHXH 2UVFA 1PYWA 1A6VL 2I24N 4UDUB 1ZLUH 2W60A 3KJ6L 1A6ZA 1HHHA 3GBNH 5CJXA 1BEYL 4RFEB 1WCBA 2VZTA 4HV8B 5SX5H 1IFHL 2J2ZA 3EYSH 3NZHH 4HJJL 5F21B 3T09A 3KR3L 1WZMA 4JY4B 5EOCL 3W0WB 3SDCD 4KAQH 1MCWM 4PLJD 4WI5A 3VFMB 3TM6A 5MEOB 5AYUH 3MR9A 2AXJA 4LVNC 3VXSB 3EJYC 1OSZA 4EDWL 2BHUA 1MREL 1CBVL 5C0AD 3AY4C 2KL6A 2XN9B 4UT9H 1W72A 5KVDL 3RHWK 2DYPD 3OHXA 1AD0B 1KIQA 4PJEA 2W60B 3VMPA 1A6ZB 1QSVA 1J0HA 2EKSA 5HTSA 2NY6B 2MPAL 4WTZG 3UBXI 5L88L 1IC7L 2WP3O 3NIGE 4YGAB 4WFEE 4QOKD 3MRBB 1U8MB 1OARH 2DIBA 5DFVC 2WWKO 2CGRH 4ZS6D 1OSZB 4X80L 4Z7VA 2XTLA 1A6WL 2DQTL 3WFEL 5L8KB 1NL0L 3O6FA 3ZTJG 4X0KB 3IS0X 4Y8DC 1W72B 1QLFB 2HRLA 4QRPA 4R26L 3OHXB 3O9WA 5IEHA 4PJEB 1HI6A 2HJLA 2ZCKH 3NFNA 5HHMD 5ITBL 2OI9C 2ZKHL 4JQVA 4NBXB 1UCBH 5FGSA 4YX2H 3QUZD 1XIWB 2C3XA 3U2SA 3TVMA 1EJ6A 2D31A 3BGAA 3I9GL 1GGBL 1OD7A 3JWNC 2YPLD 3QHZL 1SMAA 1YEHH 2AI0L 4JN1L 3ARBC 5E2TH 3VWJC 3MRRB 4KKBD 1IM9A 3CH8A 4QRPB 3RVUC 1UA6L 5IEHB 4G6KL 3GMRA 2VDMH 1KXTB 1HI6B 2HJLB 4N9OB 3NFNB 3S96B 2L4OA 4MCZB 3WBDA 1KELL 3HE6A 5C0AE 4NQEB 5FM4A 3RFZC 5D7LA 1N7ML 2F58L 3IRZA 4LIQH 1VFOA 4KK5C 3BH8A 1RZKH 4HWBL 3JV4A 3QRFM 1SQ2N 5ADPL 4XRCB 4FS0A 4A2MA 3QQ9C 5F8QC 4QOKE 4ZAKD 3PHSA 1RZJH 4FQXC 3GMRB 2WANA 1QG3A 3CPLA 4KK9D 2R69L 2R0WL 1F4YL 4J4PA 4LIQE 2VXQH 4JFDB 2EH8H 2KZWA 3HE6B 3RIFF 1FL6B 5D7LB 2KPNA 3BH8B 3EOAA 4MB5A 5HHME 2I25N 3JV4B 2NW2A 3AXLA 1G7LA 4OCYH 4X4MA 2H2PC 4IRSD 4U1SA 5IMLA 3AREC 4UT7H 1FGNH 2WIMA 4P48A 4FABH 4OKVB 5TPWH 3WLWC 2HLFC 2VL5A 4D0DA 4U1MA 2YPLE 2MOVA 4I1NB 1OPGL 3MRNA 4XP6H 5E8PA 2OJZH 2GQHA 4W6XB 4Y4FB 4LP5A 4NN7C 4XP5H 3OWEA 3FONA 3HI1A 5C0BA 4NKMA 5D72H 5JQ6H 3EOAB 2NW2B 4DOHB 4MD4B 4J23A 3QFDA 4QRUA 2FH6A 3HE7B 3FRUA 2VL5B 1I8KB 2LU7A 3CDGB 5CCKL 4LLWB 3RVTC 3HNSH 1QFWH 5BVJB 4MGXA 1PLGH 5HVWA 2Z93A 3MRNB 4PJGE 5E8PB 3SDXA 1I1CA 3LS4L 5ESQA 4JO4H 4EUPG 2R4SH 4R90H 5DZLA 2B8OT 3FONB 1HYSD 5C0BB 4B0MM 4NKMB 3QXTA 4TSCL 4M4RA 5KTEH 1MNUL 1GSMA 3DROA 1QACA 2ED8A 5E00A 1IILE 4LPVA 4QRUB 4OBRA 1C7SA 3FZUC 2BRQA 4K7FA 2VDNH 3FRUB 2FDBP 3UYOD 3I6KA 4R0LC 3BN3B 4XP9L 1KT2B 3WV0A 4YXHH 3INUH 5C0RH 3SDXB 4OFYD 3VD9A 1OGAA 3LDBB 3UJJL 4PJ7F 2QQLH 4U0RC 4TRPH 2FR4B 3PABA 5I1EL 5EZIH 2XQYG 3N1GC 2CSPA 2W9LA 4GQ9L 4JVUA 3DROB 1JF1A 5E00B 3LMJH 4DZBB 5AEAA 4WI8A 1OLLA 3GZKA 2ORBL 4K7FB 3OPZL 3I6KB 3MX0A 3CSBA 3OXRB 1CG9A 5DF0A 1S7VA 2NY1D 4M6NL 3WJLA 4GKOA 1T66D 1UB6A 5KN5B 1ZA3A 4XCYB 3O11B 1OGAB 3VG9C 1DZBA 4OJFH 4RGNC 5DJ0A 1AHWC 4QYOA 3BD3A 5BS0D 3C5SA 3PABB 5FAAA 1VFAA 2QQNH 2J1KA 1RMFL 1NPUA 5IOPA 1EMTH 5T1KB 4ODWB 3PL6A 3CXDL 1JF1B 1JHLH 5GGRA 1UZ8A 2XZCH 4RZCB 1ZTXH 3EDFA 2DMKA 4B50A 4R6UA 4UTAL 4PRID 2I60H 1YA5A 4JHWL 4LLQB 2OM5A 3UBXB 5FO8A 2V5TA 1F2XK 1UB6B 4OCWL 2BRRL 5GS3A 4X4XA 2AEQL 5E99L 1CGYA 1JHKH 1ZA3B 2NZ9C 5H37H 1XZ0A 5FDYA 1T7YA 1YEFL 2NLJA 4QYOB 4ODSL 2YD2A 2GJZB 1DVFD 2HTKC 1A21A 4YBQD 1QLEL 3LHPL 5IOPB 2Q86B 1J0KA 3PL6B 1NUGA 1W0WB 3RY4A 4X7DC 1UZ8B 5FUCE 4GO6B 4M3JA 1YY8A 3C60D 4P2QD 5DVMA 1N0XL 5FO8B 4XPHH 2DIAA 3BGMA 3DNKA 4X4XB 5EBMA 4XWOC 2VQUA 1QFUH 1XT5A 1XZ0B 4I4WA 1BJ1J 3UTQB 3C8DA 4LCYB 2QADD 3WXWH 4N8CL 1YEKH 2WMPA 2QQQA 5HGHA 4PRPA 5MI0B 5C8JB 5CUSL 2O26U 1K85A 1F4HA 1H3GA 3REWA 4GG6F 1JI1A 4WHCA 5KG9A 5BS0E 4KRLB 4GW4A 3KPOA 4PJEF 3V0WH 4UUJA 4UDTB 4BQCA 3VXOB 1J8HB 1NC2A 3ROLA 4AG4H 4EBQH 1I8LA 3P9LA 5J1AA 2H32A 2W92A 1XGYH 4APQA 4PRIE 1T6WA 4XP4H 5HDQH 2P8LB 3BAEL 4M7ZB 5HGHB 1VSCA 5HGAA 3O0RL 4FFVC 4XBPB 4JZNB 2BK8A 4FQQA 4XBEH 2F5AH 3NH7H 4GW4B 3KPOB 4NM4L 3FB6A 5H35A 4KJYA 1NC2B 3MBEA 5DLMH 3MUGA 1KCRL 3ROLB 4GRLA 3T1FA 4BZ1L 5JW5B 5J1AB 4KQ4L 2P5WD 4P2QE 1RPQA 3MLSH 1JBJA 4ZO6A 2WNGA 2G60H 1X44A 2JB6A 1CDHA 3LS5L 2Q8BL 3LEVL 5HGAB 3SCMD 2B4CL 5EFIB 1MWAH 3QO0B 3BW9A 2IG2H 3NACH 1OD9A 2DI7A 1YYLL 4FFZL 2KZ1B 4PJCB 4ODVH 3STLA 3FB6B 1ZXQA 3MV9A 4MXWL 4KJYB 4N1HB 5C07A 4X8XA 1DQJA 2BERA 4TTDC 5J1TC 4KZDL 3TBWB 1SHMA 4UV7H 3FHAA 3QUML 2P8PB 1G9NL 2JB6B 2Q7NA 3JV6A 4JO1H 1MVUA 4OTXH 1OF2A 3BW9B 2O5YH 5D7KD 3STLB 4YC2C 4RX4A 3T0VA 2YUWA 3F7PC 1P9MC 1UJ3B 4PB0L 4Z0XA 4KDTA 1DQJB 3OR6A 1S9YB 1MY7A 1VFMA 3ALPA 5HHOA 4KGLA 5BV7C 2VKXA 3BDYL 1YEIL 4WHYG 1A1NA 3FAXA 5DQDH 1OAKL 1VGKA 3CXHK 1YEDA 3CCHA 1A6PA 5I1GL 4LCIH 1K3ZA 2P5WE 2A0LD 4X7SH 1HQ4A 1AFVL 4NC0B 5D8JL 5KVGL 1NC4A 3I02A 3CMOL 3FQWB 4FQ1H 4Z0XB 4TTGA 4R7NB 1YNKL 2IGFL 2Y5EA 5I9QB 4X6CB 3BIKB 1MIML 5BV7H 2ZUVA 4U7KA 4FQLL 3DURB 1QLRB 1FJ1A 4G6AD 3KS0H 4PRBB 1C1EL 2VJXA 3Q1SL 5T5FH 2CIIB 5GS0H 3MYJA 4MVBC 1MQKH 4YBLB 1J5OH 2Z8VC 4HC1H 3U9PH 1YEDB 4ODUA 4X5WB 3CCHB 1YECH 2GY7B 4QNPE 3EFFB 4Y2OA 3U7WH 4HMDA 4YHLH 1FN4A 4ISVA 4JM4H 1NC4B 5TGBB 4N9GB 5E2JA 5D7KE 4X4YB 1FFRA 4Y16B 1EA9C 4LVOB 3VXMD 3ULSB 5LCVH 4XWGL 3MYJB 5D5MA 4WY7L 5TDNB 3UP1A 5BCAA 1NEZG 3DUUA 3ZDYF 4Y19D 1MCWW 5IESL 3NTCL 4ISVB 2R9HD 1FLRH 3RUGA 2VXSL 3IETB 5JNYA 5D96C 1MVFA 3F12A 1V8HA 3TJHC 4LHUD 4GKZA 4NOFA 5JTWA 4KRNA 5C6TH 3I84A 4OFPA 2L7JA 3C8HA 1NDMA 4P9MH 3DUUB 2L7UA 1A7OH 3DMMD 4KK8D 4GLRH 2XA8H 3RUGB 2MQ0A 1IQDA 2B1HH 5LGHH 4PJ5D 4LVHB 1G0DA 2R39A 3F12B 2XY1A 1FZKB 4F7PA 1H15B 1N64H 2J12B 4S11A 1GC1H 1JPST 4KDWA 2OL3A 1YZZA 4ZOBA 3MCLH 1NDMB 1U42A 1D9KD 4YPGB 5FM5M 5TQ0L 1WWCA 4LSPH 5F96H 1KJMA 3NAAL 4QHLA 4ZYKB 1P5UA 4K94C 1DQML 5MENA 3VXME 3B9KC 3GSXB 4TSAH 5TF0A 2CKBL 4IHOA 1IQDB 1IZKA 4U6XA 4LNRA 1ZLWH 1UXWA 5EZOL 2E7LA 2HJKB 1P2CA 2A74A 3CVIH 4HBQA 3V6BR 1ZVHA 4F7PB 4Y19E 5EBGA 4HKXA 1NCCL 4BJLA 1LO4L 1EH9A 4B7LA 1VFUA 4MS8D 1RJYA 4WUUD 4K9EL 5F9JA 1BWMA 2OL3B 1XAUA 35C8L 5HHVL 1LDSA 4KHXL 4NZJA 4TN9A 1NAMH 3GBNL 1M7DB 5AZ2H 5L8JB 5H94B 1CK0L 4K94H 3CUPA 3IDJA 5MENB 4OZHA 1GOGA 3NZHL 3EYSL 3JSSA 4IHOB 4O51A 4R97B 3NPSC 4LNRB 1UXWB 2LABA 3KDMA 3FB7B 2EDJA 5AYUL 1RUKL 1UT9A 5D93C 5I1LA 1JYNA 4HKXB 5F9JB 4N5UA 1OTUD 3D25A 4UT9L 4KJPD 3KPQA 5A40E 3BISA 3QJHB 3RI5F 4PJ5E 2ZUQC 1HHKA 1DBAL 1FL5A 3ZDZF 1A64A 3BIBX 5CSBA 4EXKA 3C6SA 3GKZA 4ZFZB 2OP4H 5E08H 1OP9A 1BFVH 2QSCH 3TBTA 3DXAD 2JF1A 2CGRL 3FO9B 5I1LB 5I19L 1HWGB 4WI3A 4HKZA 3QUXA 4MJ5A 3B5HA 3CSYA 3EHBD 2RJMA 4L9LC 1UYWH 3MV11 4PJCF 3JZ7A 1FL5B 1L7TH 4PGDA 1IAIM 2PKDA 4WUUE 1TXKA 5IQ9A 1RUQH 3MA9H 1P7QB 1VACA 3EUUA 1UCBL 5F3BA 3V5DA 1B9ZA 4YX2L 4V2BA 3HPLB 2CXKA 1AGEA 2VNCA 2P48B 3SGDH 4AEHH 4P3CL 1YEHL 1MLCA 2BZDA 3QUXB 4MJ5B 3NCYP 3WDHA 1FRGL 1MFDH 4DTGL 1JZ4A 2FX7H 1FGVH 1UH3A 4IRJB 3U0WH 4HWBA 3BDXA 4GMTH 2LE9A 4IOFC 4PGDB 4WEMB 1G0XA 2HVKB 5FHAL 1NCTA 5EOCJ 5DRZB 5IQ9B 1S9XB 3M8OL 1CL7I 4HKJA 1GYAA 3PWUA 1WWWX 3PG2A 1KYOK 5F1SA 1AGEB 4OCNC 1RZKL 2AJZA 1PW3A 1AGCA 4PLOB 1LO2H 2B1AH 5KVFH 1DBBL 3HR5B 4M7LT 4QXGH 1HOCA 3DXAE 5EZLA 5ICYB 1ZHKA 1JGDA 4PJ8C 1GZQA 3DRQB 2ICES 2EH8L 1SYSA 1AE6H 3MPCA 2E3VA 3PWUB 4Z8FL 2BNRD 5HDBF 3LN4A 4X6CF 1INQA 3KPSD 3SDDA 3D0VA 4LBEA 1ORQA 1AGCB 3U0TA 3BGFC 4OCYL 3TNMA 4CGTA 4UT7L 1FGNL 3U36A 4HQQH 4FABL 3N0PB 2FX8L 1EO8H 5TPWL 1IEAA 3E6FA 5EZLB 1ZHKB 1TJHH 5I74C 3BP7A 2E27H 5DC0A 2DLFH 2R2HA 5LQBH 4QWWD 4MQ7B 1N6VA 4XP6L 3WFHA 2CLZA 3ARDC 2OJZL 3TBYA 1P84J 2HYMA 4XP5L 1IGIH 5HHXL 5F7WC 2EYRA 4Y4HB 3KJ4C 4D3CH 4PJFA 5JQ6L 3SDDB 4ZQKA 1LVEA 4LBEB 5C0EA 1ORQB 3QG7H 4Z7UE 3U0TB 1Z2KA 3DETC 5I75B 3FTGA 5HVGB 3DX9B 3U36B 4JANA 5CBEA 3HNSL 2XZQH 1QFWL 3D69A 3BP7B 5ESAA 3QWQB 2R2HB 3PV6A 1PLGL 4WEUD 5DDHA 5DRXA 3EDKA 2CLZB 4JO4L 3TBYB 2R4SL 1I1FA 2XG4A 1A14H 1JPGA 3TWCL 2MCPL 5EG6C 4PJFB 4WWKD 4ZQKB 5CJBA 5KTEL 3LZFH 1CDIA 4OQTH 1X4XA 4NC2B 5T3ZL 5A1AA 3TT1L 4GBXC 3F7RA 2VDNL 4ODHH 2BNRE 4LCCC 5E0QA 2R29H 2ESVA 3GK8H 4M00A 3KPSE 4ZUSA 2DTML 3D69B 5ESAB 5H37G 3INUL 5C0RL 4Z7NF 5DDHB 5DRXB 1KPVB 1BFOA 3RUGF 2X42A 3ARGA 2HMID 1YY9C 3MA7A 4X7FC 5IFJA 2QQLL 1JPGB 4TRPL 4I48A 5EZIL 2YD8A 1WISA 3CU7A 5SWZD 2NX5D 2XV6B 3G9VA 4JR9L 2P8MB 4WI7A 4TSBL 1LK3H 5JORA 4ZUSB 3W2DH 4ONFH 3BE1H 3IKCA 1MHEA 4J2XA 1FYTB 5F1OB 3MXWH 1BFOB 2WBWB 5F1IA 2HFGH 3MA7B 4OJFL 1EEZB 1FFNA 3E2HC 5IFJB 5SX4H 3ESUF 4XPTH 5E5MB 4HGKC 4I48B 2QQNL 3CK0H 1EMTL 3QIUD 4JFFD 1KJVB 1JHLL 1RK0B 4I2XA 4YR6A 1ZGLP 2XZCL 1UM6H 4G43B 4P57B 4EUPB 4PRHD 4AENB 5F88A 3D3VD 1IC5L 1GIGH 4GUPA 4QTHA 4M6AA 4F9LC 3WFZA 5JORB 4PIRF 2Z35B 3IKCB 1MHEB 2D03H 1JHKL 5DVOA 3E3QC 5GGRY 3TIDA 4MHHG 1UC6A 3RGVB 2LTQC 1ITBB 5F1IB 1CF8L 1Q72H 4FTVA 1FFNB 3WD5L 4TNVF 1W8OA 4RDQF 1NCUA 4U1NB 1E0OB 1FZOB 3QDMD 4NM8H 4I2XB 2WBJC 1MH5A 2F53B 4I0PD 4ONOA 1JMXA 5F88B 3MNWB 1RQ5A 4UAOB 4QTHB 4GAGH 1J12A 1HYRC 3VXQB 3BPLC 1IC4H 4G7VH 5SWZE 3TIDB 1QFUL 1EFXD 1PQZA 2NX5E 1JGLH 2LV4A 5FUOL 5E8DH 1FLTX 3WYRA 5C09D 1YEKL 1AI1H 3MREA 1UKQA 3MRFA 3ROOB 1MCDA 1MH5B 4LU5H 3MJ8A 4P2OA 4CBPA 2MJWA 2P47B 4WDIA 3RRQA 5CJOH 2CDGB 1UJTA 5IV2A 4WVRA 5DRWA 3QISA 3V0WL 3IU3A 2NXZB 2BVQA 1AQDA 1CYGA 3KXFA 4JFFE 4JE4B 1PQZB 4EBQL 4BQBA 5J1SC 4PRHE 1XGYL 4F9PA 3T1WA 3D3VE 4YIQA 1Z9SA 4LDLB 4JAMA 4D2NA 5DZOA 2KH2B 3E6HA 4IMKA 4W4NA 2XOTA 3MREB 3AB0B 4NHCH 1R3HA 1S7WA 5HHPA 4XBEL 2PCPA 3MJ8B 2D7TL 4CN4A 4HKBB 3NH7L 1LK2B 5IV2B 2GUOA 2WUBH 5DRWB 1MLBA 4YJZL 3VFNB 1CDJA 3DLQR 3Q48A 4KUZH 1AQDB 1PX3A 3BPOB 3KXFB 3QDME 2A6JA 2BY2A 5DLML 3P40A 2I5YH 2A83B 4RISH 4YIQB 1UACH 3MLSL 4JAMB 5I1JL 3QFJD 1KJ2B 5EO0A 3JTTB 2G60L 1NCWH 1RK1B 2MTPA 3OJ2C 5CLWA 2ZCLL 1A6AA 1R3HB 4M03A 5HHPB 2IG2L 3KAAA 1G1CA 2PCPB 2E6PA 3QUMA 4W6YB 3T8XA 4KTEL 1ZS8A 4ODVL 2GUOB 4JKWA 5D2NC 2C7UA 5C09E 1MLBB 2C4FU 4ZO8A 4RRPG 1H3UA 3K7UA 4F15C 1BX2A 1TTGA 3B8SA 1CVSC 4NZTH 1M1SA 1CT8A 1L4IA 5EO0B 1CXLA 3D2UA 4GAYB 2NY7H 1TMCB 2R15A 1T4KA 4G9FA 4YHYC 1XR9A 3IF1A 1N4XL 2IF7A 2O5YL 2OMNA 2V7HA 3LOWA 3QUMB 5T5NF 1ZS8B 2C7UB 4Y1AB 3TJEH 4N68A 2EDQA 1FDLH 3BWAA 1BX2B 3MZGB 2FBJH 4ZXBA 4M43H 4FRWA 1MCBA 1VA9A 2DQFA 3DX8B 5D70H 4MJ6A 2YPKA 1WFUA 1X3DA 1CT8B 1A7QH 4YHMH 3D2UB 1EUTA 2P5EB 4HW6A 2FLBT 5KAQG 3HA0A 5DWUH 3H9SA 3KNBA 5DQDL 1T4KB 2IADA 4KPHH 3RVVC 4G9FB 1JGVH 1BQSA 2X1WL 2V7HB 3AGVA 5IBLC 3RVXC 4LCIL 3MLWL 1D6VH 1L6XA 3QFJE 4X7SL 5DRNA 5MHSD 4OI8A 3CX5K 1X5JA 1MJJA 1X5ZA 3VXPA 4D9LH 2PTTB 1MPAH 4RIRA 3MRCA 5D1XD 1HSBA 2DQFB 2GTZB 3RZWA 1Q94A 5CD3B 3RWHA 5BV7L 5BZWA 3QCVH 1JRHH 3T2OA 4U49A 3MRPA 4PJFF 3VU2A 3RDTC 1NGQH 2O61B 2Y07H 3C6LD 3QAZC 2YA2A 3PDOB 3MC0A 5GS0L 5DR5H 1MQKL 4AIOA 1WEJH 4D0CB 4XTRC 4HC1L 3U9PL 2N4IA 4K3JL 1MCPH 5GGSB 5DD1L 4WJ5B 2J8UA 1YECL 4UINH 3RKDD 3FO1A 1CICC 4LQ1A 5DRNB 5FF6A 3A6OA 3U7WL 3GSNH 1LWRA 4YHLL 4JM4L 4G6JH 1E6OH 1VADB 1JPSH 3MRCB 1HSBB 1SBSH 3HS0A 1Q94B 1TDQA 1ZT7A 2JIXA 5BZWB 3MRPB 4JY5H 4ODXA 1VFBA 1V3MA 2JJSA 3SJVD 4F8QA 5LCVL 4P4KD 1S3KH 4EVNA 4RA3A 3O41A 3BPNB 1R0AH 2WSKA 2J8UB 1QKZH 1RULL 3FO1B 1MCSA 4XNMA 5CP7B 5HPOA 4H0HB 2BY0A 3NN8B 2UUDK 3T3PF 3K2MC 3AU1A 1ZEAH 3X12B 3SDCC 3EFDL 4PLJC 4P5TB 5FK9B 3GSVB 1PSKH 4JFHD 3HS0B 4PJAE 1Q9LA 5MHSE 4K3DL 1NKOA 3C8KA 4ODXB 5JOPD 1HKLH 2VLJA 3WN5A 5C6TL 5F8RC 3O41B 5IW3A 2MCG1 2K1MA 3U6RB 4Z77A 1J05A 1JI2A 1YN7A 1RD6A 3RAJH 4XNMB 3NCJH 3WS3A 2BVPA 2H2SD 1INEH 4HCRH 4HT1H 2XA8L 4TVPD 3GSRB 2B1HL 4L3ED 1QFWI 4MQXD 4QHUA 4ZS6C 4XH2A 4ELME 4GXUM 2CKBA 2VZSA 1GC1L 4JM2A 2VLJB 5EUKB 2PXYB 1TVHA 4P46B 5IVXE 3VGAB 1WICA 1T1ZA 3MCLL 1MOEA 3TIEB 1D5XA 1H5BA 2EEBA 4Z77B 1ZMYA 5DXWA 4WNQB 4LSPL 1YN7B 3KGRA 5L7XH 2JKXA 3WS3B 3SJVE 2BVPB 4TSAL 1D5ZB 4Z76A 3LEXA 1U3YA 4JN2B 5JDSB 3T4YA 5J13C 1KN4H 3QUZC 4YZFF 5D4QA 1S5HA 1F3DJ 3UAJD 4XH2B 3A6BL 3CVIL 4Z5RA 4I18C 2CKBB 1DL7H 2A6DA 5B22A 3RVWC 3O45B 2UYLA 2CUMA 5ALBH 1JWSA 1TVHB 3P9MA 1F4AA 3ZTNH 4KKBC 1FH5H 3PGDB 1D5XB 4G8EA 4N0CD 4JFHE 4NNXA 1BQHG 2WLZA 5T33L 5AZ2L 4K94L 3MRHA 1Q0YH 5IM7A 3G08A 5JOPE 3LEXB 3QI9C 2E6JA 3T4YB 2FO4A 1XF5A 1NMCC 2Q7YA 1S5HB 3WKMH 4LQFL 1D5BA 2VQ1A 4LF3A 3D48R 4Z5RB 2NY0D 4XP1H 3UYRH 2UYLB 4TVPE 3P9MB 4ZAKC 4L3EE 1JYWA 3NZ8A 3CFDA 5CP3H 4G8EB 5GS1A 4KK9C 2OTUA 5CZXD 3PWPD 3EYQC 2ZPKH 4NKIH 3PGCA 5IM7B 3GMOA 3G08B 2OP4L 3U9UB 3WFCH 5E08L 3P73A 3BKMH 3SPVB 2V5MA 4OZGE 1BFVL 1I9RH 1XF5B 2QSCL 5DHVH 4MSWA 4OZ4A 3SE9L 3VW3H 1FPTL 4HPOL 2DMCA 4LF3B 2A6KA 3IXTA 4JHAL 1EVTC 3BRFA 3ELAT 4IRSC 4N90D 1GGIL 4OFIA 1D5IH 1UYWL 3CFDB 3UJIH 1UM5L 5I30L 1C16A 4P5MB 5GS1B 5DMYA 1RZFH 1L7TL 1SM3L 4ORGA 1B90A 3PGCB 3GMOB 2ATKA 1ZGLB 5CEZH 3P73B 3IFNH 4TNWK 3CZFA 2L0DA 4OZ4B 1XH3A 5K33A 1FORH 5KW9L 5ID0B 2A6KB 4F8TA 3IXTB 3HRPA 5C86A 4AEHL 1OTTD 2BXZA 1QTYT 5D6DC 2UUDH 4CMMA 3DV6A 4OLUH 4CKVX 1MHHA 4LLVB 3VD3A 4JHZA 4A6YH 1PZUB 1KG0A 2BVYA 2XRAL 4FG6D 4I0KA 5EU7E 3WUWA 4HIIA 4CNIA 2BCKA 3VWJA 1T5XA 2DYPB 4KQ3H 2ATKB 3CU1A 5E95B 1M7XA 4OGXL 4ZSOA 3BP5A 5DK0A 5HI4D 1AD9B 1HYSC 1L6ZA 2FL5A 4OT1H 4WEBH 1C8PA 3PWPE 3ZKMC 4MZ2A 3DX7A 1I9JL 4YXLH 1LO2L 3QIWD 1G7QA 4R2GB 5KVFL 4CMMB 4QXGL 1MHHB 4LPXA 4MHHI 4GKSA 3C08H 1KC5L 1FVCB 1T2XA 3P0GB 4HGWA 3QEUA 1OP3K 5D7SL 3WUWB 4HIIB 2PUQT 1AH1A 3TH2T 1T5XB 3KPPA 5BJTA 4N90E 1A1OA 5FUCC 1AE6L 3BP5B 2D9QB 4R9HA 4XGZA 4MD5A 5DA0B 3SKUD 5DJAA 3O8XA 4LRNH 4U6TA 3QDGA 2B7DT 2ARWA 2Q76A 4RBPK 1RV6X 1I1YA 5KVEL 2Z8WC 2YZ1A 3OF6A 4GKSB 3T4AB 4HGWB 2NY1C 3M07A 1I85C 1DQQA 2DTSA 1T66C 2E27L 2JCCA 5LQBL 3CLEL 4PJ9D 5BJTB 3L5WB 3I3DA 3GMPB 3RWDB 4PYGA 1IGIL 4MD5B 5L2KD 2IFFH 2V2TA 3QXAB 3O8XB 4D3CL 3QDGB 4NN5B 1WAAE 3QG7L 1AKJA 2Q76B 5DMKA 1U8OB 4OIBA 4PBWD 2W0LA 1A0QH 4DVRH 4BYHA 2J8UF 1JPFB 4KDVA 3HZYA 2NMSA 4XX1E 3MLTA 4LLUA 4LHJB 2IBBA 1B6DA 2V2TB 1DVFC 3HMXH 3NMEA 4Y5YC 5HJ3B 4Y7MA 4EI5C 1C5BH 3SE4C 2BOCA 4NN7B 2ITCA 4OQTL 4F3FA 2IH1A 3UMTA 1AIFA 3S5LA 3V9FA 4N8VA 4ODHL 2R2CA 2VR9A 4URTB 3C60C 2R29L 3GK8L 4IIQC 2CK2A 5L9DL 4Z78A 1CI5A 2W1NA 32C2A 1MJ8H 3HZYB 5CILH 2X4NA 3FHQA 3MLTB 2Y5TA 4POZD 2QADC 3KYOA 5C2UB 4N5ED 5KSAD 2BOCB 1N5YH 2MNUA 3PIQA 4U1GC 1ZWIB 5L2KE 4Q2ZB 3IS1X 4XNYH 2YXFA 1LK3L 1GPOH 1OSPH 3W2DL 2GCYB 3BE1L 4QTIL 2DQHL 5EB9A 2MMXA 5D1ZD 4BUHA 3MXWL 2G5BA 2X4NB 2Y5TB 3HAEH 4HIEB 2HFGL 2QHRH 1NBYA 3FFDB 4H25B 4NQUA 4ZNEE 3VD7A 5CEYA 3ZZ1A 3OKKA 5DMGD 2J88H 3CK0L 4L4JA 4O5LH 5I2IA 3PIQB 3PJSA 4OGAD 4E41D 1AHWA 4KJQD 3U82B 4KRPD 4LSRH 4HUXA 3S9DB 1HSAB 3O3AA 4MAYD 5CD5D 3QQ4A 1P4LB 3MRGA 4UNTA 1JIBA 2D03L 3ME0A 4CU7A 1QP1A 1NBYB 1Q72L 3AS0A 4L1DA 5FIEA 1HE7A 2D9CA 4YBHA 2C9AA 5FGCE 4U6YA 4HAFA 1OP3H 5A2IH 2EH7H 4KXZH 1JNLH 3VFOA 3W0WD 1H3WM 3SCMC 3IDYB 3BZEA 3PJSB 1OM3H 1WF5A 3T0ED 1LE9A 4HUXB 4GAGL 3N06B 2EDOA 3B6SA 1IC4L 3UEZA 1NLBH 2XN9D 4G7VL 1I8MA 4RSVA 2AEPL 2DQDH 3G6AA 4PJ7E 4QHMB 4RBPH 3KHQA 1J0YA 5E8DL 4ODTH 4AEIL 5GRVL 1IGYA 2NY6D 2I27N 4U6YB 5T1MA 1UWEL 4GLRI 1MJ7L 3VFOB 5IB5A 3BZEB 5BS0B 1IVLA 5CJOL 4YDJB 1NGYA 1OAZH 4O2CB 1XF2B 3P4MB 1LE9B 5CIPH 3FQRB 1QA9B 4ZFFA 3B6SB 3JWOH 1XGUA 1VEPA 1I8MB 5LGJB 4CL7A 2FEDC 4NT6A 5GHWH 1CR9L 1T3FA 4E41E 4ZPTB 5C6WH 3U79A 3PGFH 1UEMA 3BESR 4J7RA 1IGYB 3SKMA 5HPMB 1TIUA 4KZEH 2VDRH 5DEGA 4YHOL 4HLZG 3C2AL 4NHCL 2H45A 1WBXB 2RHEA 3KYKH 1NGYB 5FO9A 2VQTA 2WUBL 4ZFFB 1JMZA 1Y6MR 4KUZL 4HK0A 3HR6A 1XGUB 3W0WE 2WUCL 2VDLH 1SVZA 2I5YL 4QRPD 1T3FB 3O9WD 1N6UA 1HILA 2FJFA 1T1YA 4RISL 5IMMA 3SKMB 1UACL 3SGEH 3T0EE 5EU6A 1PKQA 1NCWL 2BVEA 2XN9E 4NQED 1AGFA 5EO1A 5SV4A 3SO3C 3AMKA 1JP5A 5ISZA 2FRGP 2K3TA 3TVMD 5FO9B 3HMWH 1SVCP 4K71B 1MWAB 1IM9D 3CZJA 4MB3A 3H0TA 4NZTL 4WTXA 3RWIA 1G7HA 4YDLB 4DQOH 4L4VA 2I07A 2NY7L 2DOCA 3HE6D 3PXHA 2XNAA 2HRPH 5EO1B 3KLHD 4LGRB 5D7LD 1X7QB 5ISZB 1EBAA 1GAFH 4PJEE 1DN2A 2ICWI 1FFQA 2W59A 1KGCD 4M7JH 3O4OB 4B53A 2R9HC 2FBJL 2XFXB 5C0IB 1S7RB 4M43L 4XPGH 2YUVA 3FOMB 4PP1D 3H0TB 1LDPH 3WSQH 4J4PD 3GMMA 2PO6C 4Z7VE 4ZUWA 3RWIB 1G7HB 3VDBA 1R24A 2I07B 4L4VB 4IJ3B 3OKOA 3SOBL 5DWUL 4QXUL 3VH8G 1F8TH 4KPHL 4QRPE 1JGVL 2OX5A 3QH3B 4BFGA 2PYEA 5BOZG 1FO0L 3RNKA 1D6VL 2E7BA 4NDMA 3VXNA 3SGDI 4PJGF 4JDTH 3DMMC 4KK8C 4KROB 4MX7A 4NQEE 3LQZA 4HC1A 1N8ZA 4MA7H 4HS3A 5DK3A 4D9LL 5GGQL 1MPAL 1S7UB 4NUGH 2A9NH 3VA2C 1I1AC 3QCVL 4ZUWB 1JRHL 1XGPA 4LLYA 3SKNA 2Y07L 3OKOB 1NMBH 5B3JF 1WEJL 4M8QA 5C0BD 3RHWF 1MCPL 1ETZB 1IGTA 4S1SH 1URLA 1D9KC 1OB1A 1CFSA 1JE6A 3GSNL 1Q38A 1N8ZB 4G6JL 4HS3B 1E6OL 5D7LE 4HXAL 4NYLB 1JPSL 2M8XA 3IRPX 2CR6A 1FNEB 3GM0A 3H3BC 5J89A 1CLYH 2V2XA 1KGCE 1XGPB 2R2EB 4LLYB 4JY5L 4MS8C 1R3KB 3BO8B 4FQ2H 1S3KL 4NQXA 4M8QB 3PP4L 5CKGA 1J0JA 2C1OA 1TTFA 1OB1B 3RBGA 3L6FA 1CFSB 2VYRE 4WRLA 1RHFA 1MRCH 2BC4A 1H3TA 2Z8RA 5CAYB 4G42A 3D0LB 2H8PA 4X4ME 1F6FB 1OGAD 1HKLL 1VGEH 4KJPC 3WIFA 1O7VA 4OM1H 3X3FH 4ZDHB 4JPWH 1DN0A 2QSVA 5IG7A 3L6FB 5FYKU 5T1KD 4HCRL 4HT1L 5FV2A 2YPVH 1CLOH 5C0BE 2BC4B 4X6BA 1NKRA 4HIHA 4PG9A 3ARWA 3DGGA 4YHNA 2XQBH 3KS0J 4WCYL 2H8PB 2X9XA 5D71H 2HG5A 1Y18B 1IM3A 3EHBC 1DQDH 3WIFB 3QXVA 4S1DC 1A22B 3X11B 1UZ6E 3VXMB 3B8YA 4RGMB 3V8OA 2VISB 1DN0B 3NCBB 1H0DB 1LO5A 3PL6D 3SDXE 2W65B 4HULB 1ZA6A 5C7XH 1KN4L 4NKOB 2V9RA 4X6BB 4M4PA 4HIHB 4JGUA 1I7ZB 3MRDB 1HWHB 4YHNB 2HT3D 4OI7A 3MLXL 5MP6H 4E0RA 5ALBL 3I6LD 1DCLA 3KYMB 2EIZA 3ZTNL 3N1MC 1FH5L 3CSGA 3ZDYE 3BKCH 2BVOA 1SMOA 1Q0YL 4OZFH 1ZGLM 3ZLQC 1OGAE 4M5YH 3V4VL 3TF7C 1ZA6B 2YWYA 1NAMB 4PD4J 1A4JB 1P6FA 1TPXB 3WKML 4R96A 1DBKH 2ZSVB 2YC1A 1ZHBB 2AJ3A 3ARFC 4XP1L 1CE1H 4E0RB 4L8SA 4LAQH 3X3GH 2EIZB 4F80A 2IWGA 1R5VB 5SX4I 2AK1H 4WU5A 2EYTB 3IJHB 3QEHA 4PRPD 4U6VH 5C0CB 4IOSD 4H8WC 2HJFA 2ZPKL 1WQVT 1MUJA 4X5XA 1HHGA 3BKML 5C08A 1I9RL 2MQCA 4M7LL 1EJOH 1T7VA 3VW3L 1N6QH 1IAOA 2YC1B 4GS7C 1G7MA 1NC2D 2AJ3B 2LAAA 2EDRA 4L8SB 3QDJA 1UADC 1D5IL 3D18A 3UJIL 4APQD 1DBMH 1MCOL 2VTFA 1TQCC 5D93B 3MSPA 4GKNB 3QEHB 5DSCB 2WM0A 4X5XB 5C2BL 1F42A 1HHGB 3DSFH 4QWWC 1V3KA 5CEZL 3I6LE 3V7MA 5EN2A 5C08B 3IFNL 1RJLA 2NXYB 3RWFB 1FORL 3KYNA 3ULUH 1BQHB 4JRWA 4Z7WB 3Q5YA 1IAOB 4Q6YA 1G7MB 3MBED 2PN5A 4GRLD 3DHMA 3NCYS 4JQIH 3ALXA 3DYMA 2ZWLT 4NFBA 4A6YL 2QR0B 3FT3A 1PBYA 5A43C 3F5WA 4LLAA 2VLRA 4C57C 4Z6AT 4O00A 3TH4T 1FFOB 4GRMB 2VN7A 1OTSD 3KYAA 1QRNA 4F57H 1RJLB 3QUYB 1P6AB 4XX1G 3U1SL 4WEBL 1P69B 4PRPE 5IBUG 5D2LA 1CFVH 3DXAB 4JREB 2G75B 3BQUC 4OLYH 3GB7A 5L2JA 4DFIA 2XTJC 3ZDZE 3FT3B 1AY1H 2IAMA 1YEEH 2NY5C 4N0UA 3NIDF 2HH0H 3B9DA 3EO0A 4POUB 3S36H 4U3HA 2WINB 2HMIC 3O2DL 1QRNB 4BZ2H 4GW1A 1QFWM 3VD5A 1EEUA 4PJ8A 1TITA 4RX4D 3MXVH 3QT2A 3GI8H 4LRNL 1MJUH 3QJFA 1KEMH 1DFBL 2O5XH 5D2LB 1KLGA 3LSOA 4NZDA 1JTTA 5TE6H 4DFHA 2R1YA 4XXCA 5AAWA 3OBAA 5IJKA 1E27B 3MV8A 3GB7B 5HHOD 1YQ2A 3BYYA 4LKCA 1ORSA 2IAMB 3V4PH 4N0UB 2EDBA 1GOFA 2DJSA 2AV7A 4FQHA 4XCFH 3MACH 5JR1H 3PHOA 3EO0B 5TE4H 4MXQD 4ETQA 1E4XH 1RIVH 5E2WH 1IMHC 4GW1B 5CWSB 2IFFL 4C83A 1R6VA 3TLRA 2J5LC 3WXVH 1EEQA 1MI5A 1NC4D 3ARDA 3LSOB 3TA3B 2R1YB 3HI5H 3TO4C 3WO4C 4NZUH 3ZE0E 3MV8B 2UVEA 1IGFH 1Z5LA 2VUYA 1A0QL 1L0YA 3EAKA 5JPMA 1M71A 1KUMA 4Y16D 5FYLD 4LKCB 2NY2B 4DVRL 4RNRA 3L7FA 4B5EA 1PG7L 4IDLA 4OQTA 2AV7B 4M1DL 1AXSA 4M48H 2B2XH 4ETQB 4F7MA 2AK4A 3QXDA