3AACA

Small heat shock protein hsp14.0 with the mutations of i120f and i122f in the form ii crystal
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
123
structure length
123
Chain Sequence
MYYLGKELQKRSEELSRGFYELVYPPVDMYEEGGYLVVVADLAGFNKEKIKARVSGQNELIIEAEREITEPGVKYLTQRPKYVRKVIRLPYNVAKDAEISGKYENGVLTIRIPIAGTSVFKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dimer structure and conformational variability in the N-terminal region of an archaeal small heat shock protein, StHsp14.0
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Chaperone
molecule keywords Putative uncharacterized protein ST1653
total genus 23
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aacA00
5LUMA 4YE0A 2CG9X 4FEIA 4ELDA 3QORB 1WH0A 3GUFA 4M5SA 4YDZA 2KMWA 4YLBA 2XCMC 3N3EA 5DS1A 3EUDA 3GT6A 4JUTA 3VQMA 1RL1A 2CR0A 4MJHA 3Q9QA 4YLCA 2KLRA 4RZKA 1WFIA 3VQLA 2N3JA 4ZJ9A 1GMEA 1EJFA 2RH0A 4JUSA 3QORD 4YL9A 3W1ZA 2MNWA 3J07A 1WGVA 2BOLA 3IGFA 2Y1YA 3Q9PA 3AACA 5DS2A 3QORC 4I88A 2O30A 3QORA 4PBDA 4PCKA 3L1EA 2WJ5A 1X5MA 3AABA 3L1FA 4M5TA 2Y22A 2K8QA 3GLAA 2WJ7A 2Y1ZA 2N0KA 1SHSA 3L1GA 2JKIS
chains in the Genus database with same CATH superfamily
1HINH 5DD5L 3UJIL 3EDEA 4K9EL 2EVIA 1OSYA 4KAQH 4B3VA 4AYBA 1N6VA 5E8DH 3WS3B 2O6DA 3DGCR 2OMUA 5DO8A 4QIRA 2QLVB 3LNDA 3EYVB 3CXDH 3QE5A 2ZOUA 5T1LD 5EU5A 2DEYX 2NX5E 3S4SB 2OR8A 4DVBA 1A4KB 1OP5K 1UYWH 2ICCA 5CHNA 5DMGD 3KJ4C 4G6JH 4AH2B 2CKBL 3MNWB 3PWJA 3EZ8A 2D2CC 4MS8D 3OKEB 2EDMA 5BPPA 3X11A 1SHSA 4JM2B 1KIRA 2VCOA 1DVFC 2YEZB 3KLKA 4PW4A 2AXJA 3QDGD 2F54E 1U3HA 1JDDA 1G1KA 2I9TA 2M26A 3P9MA 5AAMA 4AQ1A 2DQCH 1WD9A 2X2YA 4I89A 3U1QA 5BS0D 1NBVL 4XMKL 1IGCL 4CDGC 2Y7MA 2X2HA 2K7QA 5AYTA 4K3GA 1E7UA 5C9KA 1OGPA 2N7SA 2MOGA 1J8HA 1IFHH 2J43A 3MLZH 3CSTA 3L7EB 3EFFB 5HPMA 1YNTB 2FWUA 2OMVB 5FDWB 3O3BB 3G5ZB 4R4ND 4OZFA 3UO1H 4IGBC 4YHOH 2EDJA 4FJZA 2H32H 4J12A 3RWGA 3TURA 3ZE2F 2H6PB 1E0OB 3SDAA 4OF0A 1W0VA 3JQOB 3QPKA 4WIQA 4EN3B 4BZ1L 4GB9A 1CI3M 4UQ3B 3UC0H 2NXZC 3BAWA 1NC2D 4LSDA 3BDYH 1UQSA 1AJ7L 1JPGB 2WAHA 3LAFA 3UZVB 1MJJB 2WLNA 3BVUA 4M1CC 1P7QA 3L3DB 3HUJB 4R3SB 1UADC 4Y4KC 4E5XB 4X7EC 3IXAA 3B83A 5FGCE 3AT9A 4BK8A 3FH5A 3IDMA 3FO0L 3H9SB 2FJHB 4FTDA 2XKNB 4LLDA 1PBYA 2ZX8A 1BIIB 1T1XA 2VDOL 3LZPA 2A3TA 3ME0A 4WWID 1VCAA 3K81A 4Y5VA 1Q90A 1FSKC 1OLLA 1J0HA 2DQDL 1WF5A 3MREB 5DLMH 1E40A 5TF0A 4A04A 4C4KT 2ZSWB 2IANE 5IVXF 1BLNB 3VYNA 5AB0A 4DKFH 2EH8L 4OF3A 3H9SE 1KGYE 4CMHC 4JZNB 4Y7OC 4IKNA 3BP5A 3R7RA 1NCWH 3F6LA 1RKRA 3RIFK 1CD1B 1L3NA 3FSWA 2YLHA 3CDGB 2W94A 3FSOA 3RI5K 3TZVD 3UTQB 1YJDH 5CO1A 5DRZB 1E3FA 3FFCA 1M53A 4JHUA 3GSWA 5CXPA 3VGGA 5JLZA 4FXGC 4K4KA 4M61B 4LLWB 3UYPB 5C70A 4G6JL 2AJXL 1I4FA 5IMLB 3HAEB 1JD7A 4WWKA 3GYRA 4UOW0 1ET7A 2IEPA 3AC0A 2Z0BA 1TTFA 1JTPA 4RDQF 1S7TB 3IFPB 3V0IA 4NAJA 5FV1L 2ZKMX 3QR2A 1T0MB 3S5LA 4DHLA 4KI5E 5DUMH 3VFVA 1WRFA 4HF5L 2BC4A 3GJFH 3VRIA 1KCWA 3ZL1A 3TA4D 2GJZB 2DDQH 3EFOA 1F2XK 3HLKA 4Y4KD 2G3XA 3U30B 4GIAA 2AGJH 3HZMA 5EDSA 4I0PD 3IMWA 5JZ7C 2BOBB 1DVXA 1NPNA 2K9UA 3DUSA 5JDJA 1T5WB 2H1PH 4JO8A 3VWJA 4NQTA 4A7VA 1AMXA 4TL5A 4R26H 3WJJA 3ETBJ 4NQDA 4XBPA 3QJTB 1BBJB 3ZE1B 3MLYL 1DBMH 5I26A 4FQXA 5ADOL 2IH8A 1TVDA 3LQZB 4P59H 4LCIH 5E5RB 3KLDA 4OJFH 1KLGA 4ZYKB 5CCJA 2BM3A 2VXTL 2C34A 1L7IH 8CGTA 2G3ZA 1Q1PA 4U2YA 4ZS7L 5TPWH 1S7TA 3N40P 4G70B 1KBPA 1T6WA 4N2LA 4A7GA 5CF3A 1KSRA 2BY0A 4FXKC 1TQCB 2UY6A 1RK0B 4LU5H 5C0AB 1L6PA 4WENB 1PX3A 4OCSL 2P42B 5JLZB 1KCUL 1NFDA 7PAZA 3SZKC 2VAJA 1JZHA 5ERWA 5FYLE 4M5ZH 4PJBF 2PYED 1JPST 2Y72A 2OW7A 4HJUA 4NP9A 3VFGH 4APQB 5KZCD 3O3DB 4NZTH 4FF9A 3T2NH 2JIXD 2B5IB 1G9MH 3O2VH 1RIVH 1RZIB 3EXJA 3IPBA 3WEXB 1E4XH 4B0MM 1ZIBA 3QUZD 5IVOA 3MREA 2VB5A 2PWEA 1QFWH 2WVVB 4ZMZA 1SDDB 4Y5VB 4EUPG 3VQLA 1P4LB 2O5NA 3PWUA 2JB5L 5TE7L 1ACCA 5BS0E 4HX1B 1MCOH 3TN0B 1BIIA 2J73A 3BWZA 4ONOA 4U05A 4LVEA 2W91A 2WVSA 1KB5L 2K3TA 1TJGH 3AFLA 3LPFA 3IM1A 4G6ML 1A4JB 2K8QA 2AK4B 3IBOA 1WTGT 4Z7VF 1WK0A 4KUZL 3RTLA 4PJ5D 3L3DA 3QI9C 1EJOH 1N7ML 1GGIL 3RLSA 3DDFA 2KQMA 3NFPA 2F53B 5EH1A 4Y5YB 3AB0B 1S9XB 4UQEA 1QFWM 2ESVD 5LCVH 2FL5B 3EFDH 1G7IB 1MPAL 4XNQB 2ETWA 4PRNA 4UQ2B 3LIZH 2HT2D 3SE4A 5HSFA 4MD4A 4ZJ9A 2H0JA 2I85A 4ZK8A 2YRPA 1V3KA 1OE3A 2FTAA 1QYGH 4EKJA 2G4GA 4JHZA 3PRZA 5I8EB 3WTWA 3ARGB 1ZV5A 3V5HB 3WO4B 4NO0B 1H3WM 4IHBA 3CXDL 1YNTA 2DLTA 3DKHA 3UZEC 3EFFA 2M2DA 3IAPA 1CQYA 1J8HB 2APFA 1NCJA 1BZDA 3GUTB 2CUHA 1AC6A 4L18A 3B5HA 2VOTA 4O51B 1DJIA 5BW7C 3SIKA 2VSCA 3P9MB 5F1IA 2MJWA 4AQ1B 3PHQA 3Q2VA 1RH8A 2GJ6B 1U3HB 3PAUA 2P43B 1S78C 1J5IA 1IRAY 1KIQB 4HIJB 1LE9A 1S4IA 5F96H 3VXTB 1HYSD 2ENPA 3P40A 1RFDH 3OKEA 4ZZKA 3D4GA 3QUYA 4FQIL 4LHUD 1RERA 5AVQB 1FC2D 1JGVH 4HKBA 4AH2A 1NGPL 2FO8A 2ZWSA 4XXCC 3QQ9C 4BV1A 4H5SA 1H3XA 4N90D 4Y8DC 3BN9C 1A4KA 4KKNA 3LRKA 1VPOL 4JPKH 2ZXGA 3V79C 4N3UA 2FX7H 5TTRA 1DZ0A 1TLMA 2GTWB 3FCSA 2NX5B 3IJYB 3LKNA 3NEEA 4PWIA 3WUWG 5HVFB 1UOKA 2CRZA 5MEQA 1DQMH 2F7OA 4YBQC 2BSSA 3MHZA 3WS3A 5I23A 2BIOA 1CD0A 4FYTA 3U9PH 3ARDD 5D96B 2NR6C 2A74A 4HJJL 2E9IA 1X5HA 4EUPB 4P4KB 5K9KA 4IJ3C 3T1FA 1DE4A 3MRIA 4I77H 2X70B 2E47A 3SDCB 3B3BA 2IQAA 1UTDA 5E1HB 4J4PD 4TNGA 4L0PB 5E00A 1TVHA 2ZX5A 3RBGA 1MUJA 5IEHB 2A77H 4ZW6A 4JFOA 5JQ6H 3NOIA 1ZGLM 2VLME 1UT1A 1YEGL 4GQQA 1MH5A 4XMKH 4Q97A 1KB5A 2FJUB 1KCLA 1NM4A 1GVIA 5J12B 1CD8A 3BH9B 2WINA 1MF2H 3CTTA 4HUUB 2O6CA 5CN3A 3GSRB 5DLML 3HG2A 2HUEA 4TQ8A 4IYKA 4PMEA 3V10A 5BRZD 4XP5L 1BXUA 2K70A 2FSEB 1WH0A 4EKXA 1FZKA 1BIHA 7CGTA 2V5SA 3CVHA 3HMXH 3NJKA 5JMOC 1AKJD 5E6IA 1FVDB 4J3UA 4RAUB 3PQYD 1XH3A 3VXUE 4JQVA 4NNXA 2HTLD 1I9IH 1NCWL 5G4NA 5C0RL 1ZY9A 1MAJA 2YAPA 3QXDA 4JFZH 1DSYA 2SEBB 3CK0H 4PJXE 4NLHA 3QCVL 5F6IB 3I75B 3LMJH 4HU8A 1A6UL 1XX9C 4QHNB 3F12A 4W9GC 3DBXA 4M48L 3W2DL 2WXQA 1MFBL 4JZOA 3DLQR 4HD9A 3ZTCC 4I0CC 4F1ZA 3ZTEA 4NFCA 1SDAB 4OFYA 2O72A 3HNVH 2XLLA 1I7ZB 2Y5TA 1IILE 4LMQI 3O8XA 4XCCH 1C12A 1AHWA 2WAQA 2ZKHL 3MLPA 5KG9B 3KGTA 3U2JA 1MFUA 4CADB 1ZLVH 3FTGA 1CT8B 2I32A 3MBWA 4OQ1A 4NZRH 3WNIA 1K72A 1SYVA 2DF3A 4YXLH 2VW6A 1S9WA 1ZGLA 4EOWH 2APWA 3GXTA 1WISA 2DQDH 4C8XA 3MBXL 4BFGA 4WFHD 4TTGA 3FNKA 3E6HA 1R1CA 5FECA 3V0DA 4EVNA 2ZCHH 1D5ZA 4KDVA 3L45A 3REWA 1UC6A 2QPFA 4GQPH 3WIFA 2DLFH 4DGYH 4PJHB 5IFAL 5CINH 3GRBA 2AZUA 3G6JE 3KYOB 3BQUA 3U6XA 2CCLA 2HX9A 1ZVNA 2NXYB 4XPAL 4LVHB 3O0RL 1M56B 1S5IL 4YXKL 4Q9BA 1IGFH 4CKVX 1DP0A 5ENWA 1T5XA 3TC9A 2X9XA 4IDJL 2Y36L 1JGLL 2V33A 3BWUF 2XQYK 3ES6A 3GPSA 2ZUXA 3WIHH 3WI9A 2F58H 1R9FA 1SQ2N 1BFOA 4Q6KA 2W5PA 2X6CA 3A21A 3BEVA 3EDKA 5DJ2B 3CX5J 3SBRA 1CICB 3QIWD 4FFZA 4X8JA 1R75A 4AM0B 2ZG3A 4E41A 4OCRL 4FFWD 4F2ME 4HUKB 1N4XL 1W72L 3B3IB 5ELIA 4N6QA 2Y24A 4H25B 3RWJB 2W9EH 4KOCA 3PHOB 4PRHA 3MJ9A 5FGBC 4U1JA 4XBEL 4NGHL 4P9HH 2AGJL 4TOYL 2OMYB 5DVKA 4WTQA 3MRLA 4CAGA 3FU8A 3D18B 3I6KB 4AK1A 2W92A 1JWSA 5GRUH 5I1KH 4KKLC 2OMTB 4RNRB 3Q05A 4UDUA 3MRBB 4NPJA 3LJ3A 2XQBL 8FABB 3VGAC 2HJLA 5IESL 3S37H 1WTLA 5DUBA 1OTSC 3AREA 4MBOA 1LYQA 3QXWA 5JHDD 3RL1B 4LEBA 2NYYD 4M6OL 1PU0A 4XN7A 1P7HL 4M48H 4Y1AA 1G4RA 3PS6A 3U7AA 5J6HB 5L7XH 2LLLA 1LDPL 1AQKL 1MCLA 4KKRA 3V4UH 5IWLA 3D09A 4BZ2L 4FTVA 4NKIL 4ISVB 3N43F 3AQYA 3PGCB 3LIZL 4AQAB 1EZUA 3ARBC 1VGEH 2CO6B 2QZ5A 4JRWA 3BVDB 1LMIA 4TVPD 1Y1DA 3ATAA 2B1AH 2ENQA 5T3ZH 2GUOB 3EOTH 3H42H 4Y2DD 2FYVA 4M6ML 4HEPA 1J5DA 5JHLA 5IB5A 2J4WL 2PWFA 1I1FA 1A1MB 1E28A 1KYUA 5LCVA 2KUTA 3P3TA 1TTCA 3PPSA 4R2GD 3LNHA 3LIZA 3LOWA 1A1OB 1QW8A 4M1DL 4EQ2A 3S34H 3VI4F 4XBMA 2QQLH 2DL9A 3OMZA 3EADA 4YSSA 1RULH 1MHEA 1GC1L 1BF8A 7PCYA 5CU9A 3FU7A 1QQDB 1E5BA 2V2XB 3BKML 4RDBA 4I1NB 1MI5E 3WN5C 1NIEA 4MJ6B 3G3LA 1FJ1B 2BNQE 2DIBA 1RUAL 1KZQA 2VDRH 1ZLWK 4LPCA 3ARBA 4DP0X 7TAAA 5CN2A 5IR1B 2DQUH 2XN9D 4IKLA 5F6HJ 4M3JA 2WVTA 3DUUA 1RUMH 2FBJL 3GO1H 2F8XC 1PD0A 4XVJL 4LSQH 1AO7E 1OB0A 2R8SH 2FX8L 2NY6B 3WXWL 2VC2L 4Z3GA 4QHKI 1CE1H 4LCVA 1U8PB 3QCTL 1U58B 1VCBC 3MO1A 3Q0HA 1V5JA 2YMXL 3QJUB 3ZT7A 2ZP8A 1QUNB 3CFNA 1NGWA 4YDJB 3V4VH 4AMXA 4JHVA 4ODHH 3WLWD 4X9YA 1SLVA 5H4YA 4NQSB 4EN3C 2D0FA 5KS9F 4WSJA 4N22A 1NDGB 1UZ8A 4LPWA 3RUGB 4PP1D 3KM1A 4UTAL 3WBDA 4LCCC 3Q8FA 4GINA 3CDZA 1U4EA 5IQMA 4ZW7A 2IANA 3MGAA 5E56A 3OSKA 4HHWA 4UZUA 1SN2A 5AZUA 5I66A 1OAYH 3OJDB 2C9UA 2CO2A 3BVWA 3QUMB 5E08L 4HH9A 5LQBH 3KL3A 3R4DA 5I16B 4WJKB 3RY4A 4WSGA 3EGSB 4ZPVB 1MREL 5K9JL 1KJ2H 4PU2A 5SWZD 1M42A 2RQEA 1GC1C 2B0SH 3CFDA 4YHZL 1J9RA 2MSPA 4OAWB 3F7VB 2E7LA 1JK8A 1Q9OB 4I5BB 5IHZB 4RWYH 5C0RH 4TSBH 3S3JA 1OWRM 3JSSA 3S8FB 3EO0B 3LD8C 2C7UB 4P2OB 5A6LA 1QAWA 1TCRB 3LTVA 1X9UA 2VIRB 3IKCB 2HTKD 5DTFA 2X4SA 4L4JA 4PLJD 1OVZA 1QWNA 3HI6L 4QOKA 3FQ2A 5DMGC 5IQ7H 1B0GB 5F71A 2C5DC 1CLCA 1H15B 4HZLA 1GS8A 3VFGL 4XCYB 3MRNA 3SDAD 3O6ML 2FO1A 5LHDA 4M8QB 1T20B 2IDTA 3TU6A 1EWHA 4BZ1A 1J86A 3EYSL 1Q4NX 5TH2A 5DEJA 5I82A 1CZ8H 1BZEA 5D1XB 1IFGA 1E4XL 4LLUA 4FHKA 4ACPA 3QIUB 3BZ4A 3QQDB 2CLRA 2OTPA 3LZFL 4JN1H 3QK0A 2IQ9H 2W0FB 3L2LA 2YPVH 5SX5K 3TBCA 1KGIA 2B4CC 4HS8H 3CHQA 1AJ7H 1QX1A 1UZGA 4XR8C 3JWDL 2K9FB 2NY4B 2X5PA 5EA0H 5A43C 4F92B 5I1EH 5CBEA 5DRNA 2G75B 2XFGB 1S9KC 1G7JA 4W9ZA 3RKPA 3OKOA 3JWOC 4PJ8D 5H35B 3VXPA 1WAAE 1HNGA 3BWAA 3BAKA 1MVFA 5FYLH 1FPTL 4NNYA 2DQHL 3FAWA 4F93B 2FK9A 1MVUA 3A47A 2GSGB 2BSTB 5A2CA 2D03L 4I0KA 4JRFA 5C07A 4X9GA 2A9DA 4BHUA 4GRMA 1Q8MA 1MLCA 3OM3B 2Z93A 3S48A 3BZEB 1BM3H 4FLSA 3HC3H 4OD2A 1A3QA 4K07A 5LXGL 5DHYB 5LO7A 5TK2A 4M6AA 4WWKD 5K1JA 3AITA 3QYNA 5I1AB 2DLEA 4PJEF 4Z0XA 3UBGA 1FFNA 2VM4A 2QGDA 2H45A 1KJ2L 3E0GA 1PY4A 3NA4A 2HYMA 2YHGA 3NJNA 1VGEL 3U1PA 4C57C 3QZPA 3C08L 4O58H 1E6JH 1ZLSL 4MNHA 4FFYA 2YD8A 2Z8WC 2NW3A 5FOBB 3WSQL 4TSBL 4J2XA 3DX9A 4D3CH 4FFZL 3ARWA 1D5IH 1B2WL 1KCSH 3DPBB 2AJYH 3Q13A 2BP0B 1AD0A 1QR1A 4X6CA 3UEQA 3BPCA 1HIMH 2G9HA 1NOAA 3FUKA 3D3VA 4RRPM 3N85H 5CMAA 3QEQE 2JJTA 2UUDK 4J3OC 3MODL 2WWKO 2OSWA 5B39B 3MLVH 4YE4H 3MYJB 4HKZB 2HA1A 1J5HA 1TYRA 2ERJC 3S2AA 5ICYA 5CZXC 1GYCA 4JO3H 1EDHA 5GGVY 3MOAH 1IC0A 2F7QA 1F4YL 4GRWE 4XP4H 3FQUB 4LESA 3TO2A 2ZUUA 1QZNA 5EU6A 3AM8C 1KJ2B 5ADPH 3TT1L 2HT3C 5J12C 4OLXH 3PP3H 2W07A 4HA1A 4I48A 1WQVT 1EDQA 4KRNA 4JFEE 2GT9A 3IMRA 1WT5A 4BGLA 3MLUH 4JB9L 5GS0L 2PYEA 3WELA 3KPQA 2VUOA 2BSRB 3EJJX 5GGSB 1JGDA 4AM0Q 2KMWA 2OXGB 3FFDA 3D12B 4ZAKD 4F2MB 3A23A 4ZOCA 3AG4B 4DOHE 1KC5L 1ITBB 4ZUSB 5GJSL 2H6UA 2Y9RT 2MQCA 1OP3K 1CE1L 3IJEA 2OSXA 2OCJA 4JKMA 5KOVC 5I73C 3ISYA 3KNBA 3KGRA 2DQJH 1IAOA 4DF9A 4PB0L 5KVDL 4CILA 4LT7A 5A2FA 2E7CA 3NFNA 4ZNCD 4HALA 4U1MA 5FO2A 4GXUM 3WJLC 4FHJA 3V6OA 2HAZA 1MAKA 2IG2L 3S37X 2PXYD 4NQUA 3RDTA 3B9EA 3EAKA 1L9QA 5CEZL 1Q0YH 2CLZA 3SCMA 5MI0B 4PJ5A 4F24A 1EEYA 2CDEA 4AENB 1DVQA 3BGMA 1Q9WB 3K0WA 3PABA 4UM9A 1UENA 3ZDYF 1A5FH 3DGGB 1NLBH 3QIBD 4H13C 5KTEH 3L3KB 3VWKC 1INQA 2CALA 1V05A 4XPTH 3FRPG 5KYWB 4XC1L 5T1DH 2R23B 4YSRA 1JZ5A 3TWCH 1WIPA 4ODBD 5KUMA 4BYHA 1TEFA 1G9NC 1U2YA 3SDDA 3HR5A 2UX7A 2AITA 2EE2A 4RMQA 3PWPE 1LP9B 4RSYA 4ELDA 4YAQA 3QCUH 3KM2A 5D6CB 3ECWA 4LLVA 4WUUE 3IDJB 4UAHA 5KVEL 1L9NA 4UBDD 3H7BB 3QAZB 2GJRA 1TSHA 2PPAA 3FQTB 3WS6A 4DZ8B 2AJYL 3LKOA 1A25A 1UD5A 2P5EB 3WFBL 4HQQL 4W1TA 3NK4A 1O6SB 4P2OD 1LK2B 5ACZA 3DHUA 5F88B 4MZ2A 2VJXA 4A6YA 4HK3J 2ADFL 1HSBA 4XODA 3CZGA 5DHVA 4G9FE 2ZXCA 3ZSSA 3QR0A 1G9NL 2DWDA 1TTBA 4OR1A 1S7VB 3MAWA 1LEKA 3QSKB 5E5MA 2AXGA 1PJWA 1XO8A 3VWKA 2GITB 4OIBA 5EUOF 4MNQD 2XBZA 2EE0A 1KCKA 3D87B 3QNFA 3I3DA 1PZUB 4P23B 3VG9C 2ICWB 4JRXA 1WC7B 1HDMA 1HHHA 5DJXB 1T2QH 1UXWB 4PS7A 2NY5L 2X4QB 3WKQA 4WFGE 1EANA 3FB8A 4P57B 3CD4A 4XNZC 5J56B 1GIGL 3C2SA 3QIBC 2UXFA 5CR1A 3UZQA 1A47A 3U9WA 3MJWA 3FUJA 4OI8A 1E4JA 2H0PA 2YRBA 1GR7A 1RPKA 2DEXX 2X1WL 4XBEH 2CHWA 2IDQA 1FNSL 5EZPA 4MMYA 4ZFGH 4R5VA 1XIWA 3KPRE 2YAEA 3GI8L 4KJYB 1PX4A 4GXVH 3R4RA 4AEFA 5F8QC 4J4PA 5FW7A 1BZ9B 4WCYH 3P77B 3D4ZA 1C5DA 4G8EB 4HD5A 4PGCB 1HYSC 2VW7A 3O4OB 5LGKA 1KB9K 4FFYH 3L48A 1OGTA 4FQ1H 1UD6A 4ORGA 1DYZA 2F19L 2Q76B 1YDPA 4LP5A 5E94A 5E9AA 3ET9F 1JV5B 2OMZA 1FHGA 1XV8A 1RSYA 3ARVA 3QEQB 2V5RA 1JERA 1SBBA 4JFFB 2ATKA 2IAMC 3T2QA 5FKPB 4DPRA 4UQBA 1INEH 2NY1C 4A2DA 2J3SA 3Q6GL 2OMBA 3DTXA 4NP4L 5CU5A 3PWVA 1HKLH 1AS8A 3F7YB 3L4ZA 5C92A 5M7QA 4M3HA 1KBGH 3PWNB 2CO7A 5CNHA 1NKRA 3G5VA 1N8ZB 2MKWA 4N87A 1NSNL 1KLUB 3HKFA 4PJDF 4RFNC 1MRDH 3C6LB 3DOIA 2WBXA 4JG9A 2WBKA 2IFFL 4PWJA 1FORL 3BPOC 1XGPA 1II4E 2P5WB 4FABL 4BSWA 4WFEE 5C7XH 1IARB 2VLJD 1ZLUK 3BD5A 3RGVB 3WSQH 1UWGH 4CUCA 5HGBA 1HQRB 4PWEA 4EEEA 4OVUA 5I76A 3VRJA 5AW2B 1A6TB 1U8JB 2ZXAA 3SQOL 2I9LA 1SHWA 2PTTA 1DBAH 4PM1A 1MG3C 2ZXEB 2MMXA 2WLMA 3T04D 2YK1L 3GXFA 4OZGB 4EI5A 1O7DC 2FH8A 5I5IA 5J4MA 5J57B 1GZQA 4MHHG 1AIFA 4PBDA 3FBKA 3WFZA 5AL0A 4LOUD 1IE5A 4NQQA 4PJ8B 4FDWA 1AOZA 2APXA 2R69A 2ZYSA 2KS0A 3HFML 3NJMA 1GCFA 4OT1L 1E3ZA 1LVEA 3B1UA 5DURB 4RGNC 3ZKND 2HTLC 3VYOA 3AREC 4GLRH 1U4FA 1ADQL 3ZKQD 1U8OB 4KNSA 4BFEA 4IRZA 1FN4B 1IC7H 1R34A 5AOZA 2ZPKH 4AXWA 2HN7B 1N64L 2I60L 3O45A 3FCBA 4JPVH 5D7IA 3QHFH 5I75B 3D05A 5JHDB 1XF4B 2BSCA 1EBPA 1KGXA 3S8GB 1YMHB 4UTBL 4NHCL 2IOMA 2QEJA 4MD5B 3Q44A 4GT0A 1BYOA 2EVGA 4PJBA 1LXMA 5KYYB 4M62L 1R5VA 4IRJA 3BUYB 3RQ3A 3QIWA 4GP8B 2R2BA 3HLAB 4FTVE 4N2CA 3RDTC 4Z7UB 2V2TB 5IHLB 5D1XE 2VM9A 2VLRE 4DGIH 3EYOB 2BDNH 2JI1A 2DQFA 4BCYA 5EBMB 3VFSA 1MFEH 2EIMB 3MLSH 4PRHD 2AP2A 1BG1A 1TETL 4X50A 3RILA 4KZDL 1TZGH 4ELKB 2DM4A 3SO3B 2E86A 1SM3H 2VXVH 5E2TH 4KDTC 3SO5A 4HPYL 4HDIB 4JN2B 4PLKC 4Y9FA 3ZTNH 3EO9L 2LU3A 1KXTA 1JNNL 4Z7WE 5I73B 1CGWA 1QBML 4QXUH 3MRDB 2NSMA 3SOBH 3JT0A 3CDCA 3FPYA 3HZKA 3MOQA 1FRGL 3SY0B 2A38A 3GJFA 1BZQK 1DSWA 3VI3F 5K9JH 3PV6B 4XX1G 5D7LB 1PTZA 3L5XH 3ARED 2FWSA 4NJAL 4UMSA 3FOMA 2BWIA 1T1WB 4YSPA 1UURA 1JZEA 3S7GA 5DUML 2NXYD 3ZLQC 2OTWB 3KJ4B 3FQ4A 4AC4A 3B9DA 4R7VA 4UT7H 1TQSA 1UUNA 2L4OA 2ADGA 1JNHA 1FL3B 3RVVC 4NKMA 4X5XA 1VFOA 3GZKA 2FATH 3PQYE 5C0CD 4UQDA 4L4TB 4ZTEA 5AVVB 1FLTX 4X80L 1JXKA 4O2CB 1OHQA 4KDTA 4NO3A 1T1ZB 3VU1A 1G7HA 1ZPLA 3GZQA 2VN6A 1GXEA 2H3KA 1SXSA 3TGXA 2NT1A 1A22B 1EJ8A 2C9VA 1WFNA 3NP3A 1WYJA 3AWEA 4NNPL 4Y2DA 5FKAA 5LNEA 4J39A 4AIXA 5KJRL 4OCYL 5FLUA 4EDXA 1I8MA 1SZNA 3O9WA 4K71B 1A9BA 2BRRH 4X7SL 5EIIA 1J0ZA 5IVXA 1L3WA 1EVTC 3GMQA 3OMIB 2OJZH 1UCTA 1UM4L 3D48R 5F7AA 3ARPA 4M7KL 3V0VA 1MEXH 2HKFH 5D2LF 5CM1A 3BP6B 3FAXA 2J12B 3LB6D 1VERA 2CBTA 4LGPB 5LBSH 3OLGA 1E2VA 3FO2A 3QZBA 5KYUA 1IKFL 1NUFA 2JCCB 2WB1A 2D7TH 1Q0YL 3ABMB 5AWNH 1QACA 1R3JA 1WBZB 4Z3TA 4PS4L 3O3AB 5T5NF 3VD7A 4PJIA 3OKLA 3QQ4A 4J4PC 3FB6B 3O3AA 3ARBD 1HX0A 3NIDF 3O2VL 1V54B 3QFJB 4JFQB 2Y1YA 1HL9A 5TK4A 4CW1B 1ES0B 3BIAX 4FL4C 4DGVH 4AKQA 2XQ0A 1U3ZA 2APBA 4WCYL 3MV11 4J27A 5E8PB 5IVNA 3ULVE 3QHTC 4GRLB 4S1SL 4EUPH 5IM7A 4X7CC 2QQNL 2VLMD 5F0PB 2ADJB 4E36A 5JPMC 1F6LL 1LEGB 1P1ZB 2WQVA 4GS7B 3DJTA 1G7MA 2YWZA 3IEAA 4AVHA 1JI1A 3D85B 1I8KB 2E74C 4XVTH 4LVOC 4XOCA 4Y2DB 4OZGE 2R8SL 2B8OT 1AD9B 1FV1B 4LPVA 3SDXB 1T22B 1K8IB 1G7HB 1T1ZA 2WHVA 5E2JA 5ECJE 1RIUH 2GBUA 5FYJH 4YLQT 4JVUA 4PRPB 3TA3D 3UGUA 4L4TA 4MXQD 1A3LH 5KVEE 4U49A 5IB3B 4EZJA 4U2ZA 3ECVA 4D0CB 5C86A 1FL3A 3TO4A 3MGTA 4X99A 3CHXA 2XA8L 3CC1A 2XT1B 2VUYA 1ZWIA 4XZUB 3BLKA 1QSVA 3NRQA 3MACL 4WKZA 4TQEL 5EC1B 1PZCA 1ZE3H 3GXDA 3FUHA 4EI5C 4I13B 1ZVSB 4IOSA 5BXFB 1L7TH 4HIQA 3GJFB 2XACC 4KO6A 3C5SB 1IGCH 4MVBD 1MZYA 1UB6B 1KPUB 4UIMB 4XE0A 1ZTMA 3BZDA 4JKPL 1LTXA 1TYEB 5CFHA 4JN2A 3T0BA 1KJMB 1OD9A 3MZTA 3QUXD 1FZJA 1N0LB 5BS0A 3SKNB 1KJ3L 3WJLA 1R4XA 5GRYA 1KCBA 5JA8B 4NQCE 4HPHA 3ZZ1A 4JHAH 3R06A 3VFSB 1HWWA 2DQFB 2XVBA 2X4TB 4N68A 1JRHL 2WXKA 5J6GA 3EYOA 1G6RH 5J9PB 4AZ8A 2HVJA 4HS6B 2FBOJ 3GC3A 2R2BB 3HLAA 3QIWB 2FVNA 2D2OA 1JDAA 3LEYL 4JQIH 4JR9L 1D9KB 4GG8B 5KYYA 3Q1SL 4YNYA 3MJ9L 2CZNA 2ZOWA 1YVLA 5BJTB 3VQMA 4AEHH 5HP5A 1CGTA 3II2A 4LSTH 3LKSB 1HT6A 2AXWA 3RWHA 1NC2A 1UKQA 4RISH 4ACTA 3LDBB 5CEXB 1R0AL 1MCCA 5DQDL 1KZYA 4HHAB 4J1UA 2H32B 2EILB 5DRXB 2VITB 3HMWH 3QVAA 1NCGA 2WCPA 3MRJB 3DO4A 1QG3A 5MHSD 5IK3A 2XA3A 2E7MA 1MHPL 3ULVD 3K71A 1PLBA 5AW7B 2PR4L 1VFMA 3A24A 2ICWJ 4PJ8A 3F83A 2EH7H 1ZKAA 4B5ZA 4WTXA 5K39A 3L4XA 2Z91A 4MA1B 3U9UB 1CUOA 4YHIB 1JHLL 4X0KB 4IHOA 3EYUH 4OW6A 1OTSD 4EI5B 5I1IL 4JFFE 3KXFE 4KO5A 3W3BA 5IGXL 1SNRA 4MXVE 3O6FD 1T83A 1KXVC 3P4NA 5D7HA 2H4EA 3CLFH 1CFNB 4Z8FL 2ZXWB 3MFFA 1A6TA 3QFDA 3Q06A 4U0QB 5I76B 3LKRA 2LAGB 5F6IC 2APTA 4A2FA 3BSZA 2VDNL 2AXHA 4PHZA 2FRGP 4JQXC 5E4EC 4IRZL 3KPLA 5DK2B 2CG9X 1EEZA 4YZFE 1FNGB 1LQBC 5L8LB 3T8MA 1RUQL 4BIKA 4I3SL 3DBSA 3U25A 3CBRA 3G5VB 3UMTA 4A55A 4EI6B 1NIFA 1OP3H 3FTZA 3PWVB 4QXVA 3BRGC 1PKQB 2YO3A 3DXAA 3FU6A 2JWYA 3U46A 2WD0A 2H6OA 4Q2ZB 1NCNA 2HSIA 2XXFA 4FOMA 3H55A 3V8OA 2ZUQC 4V2BA 2VDPH 3Q43A 1JV5A 4Y4KA 1XEUA 4N2DA 3DX4A 2JJTC 2EDWA 4DN3L 4HWZA 1YDPB 3NG5A 1CJYA 2UZXB 4ORGB 5FF6B 1OGSA 3VWJD 4B9GA 4NQDD 3DJZA 4G8EA 1BOYA 2DI9A 5LBSL 5EN2A 4AG4H 1HH6A 3SDCD 4KI5F 2GK0A 4H1LH 5B3NA 1CXHA 2X0UA 4PVLA 2NY3D 3UJTL 3W38A 5AB2A 5EZOL 3CXFA 3L1EA 4KKBD 5FO9A 2B4CL 3UTPE 4EZLA 1XF5B 3CSYB 4PP2A 3U36A 4P3CL 3GEFA 3S36X 5D96C 1E27A 5HYIA 1LHZA 3UP1A 2X0WA 4UI2A 3SKJH 5JPMA 4GSQA 5EUOA 4HJEA 3VXRE 1MWAA 5GJTL 2ZONA 4DPBX 5EPMB 1HZHH 3EG9B 5LGJB 5FUOH 1OP5H 1RIVL 1JYNA 3NESA 2ED6A 3CVHH 3HMXA 1R5WA 2NYZA 1HHHB 2ICEC 1UGNA 2WO2B 1WC7A 3OF6A 4Q74A 4FZEL 4GAYA 1FIGH 1T7YA 1W16A 4TYUA 4ELME 3HHRB 3L5JA 3O11A 1KULA 3GSUA 3F62A 4FMVA 3L3IA 2JB5H 3BZFA 1PQZB 5E5MB 3IJ7A 1LO0L 3CXHK 6TAAA 2VE6A 1LEKB 1QD0A 2Q8AL 4AMWA 3MFGB 3OPUA 1JZDC 2BY1A 5DHVB 2J20A 1FL5A 3SSGA 1U2HA 4CVUA 5F88A 4DUXA 5GJSH 1N0XL 1S7RA 4KUZH 4LLMA 4HGWA 3WEBA 1RHHB 2P5EA 4BEIA 2OMNA 1RU9L 1QBLL 5D2NA 4FG6C 4OGYH 3O2WH 4TRPL 4WY7H 2EEFA 3MUHL 2EDBA 2OP4H 1M2VB 3MTXA 4KZDH 3V2AR 5IB4B 1F90H 4YAQB 1WS7A 3S98A 2YLKA 4RBPH 4IEFB 3RFZB 4ERSL 5C1MB 3ARGD 1B4JL 1ORSA 2ORBH 2X89A 3CPLA 1HOCA 3UCRA 4ZG1A 4K7PH 5ANME 5BVPL 2B08A 2GTQA 4P04A 2CCVA 4N2NA 1SMAA 1NEPA 1QR4A 3RKDD 3ZSTA 1CDUA 3DGGA 1D5BB 5HD8C 4D0BA 2B9AA 2GAZA 3TH2T 2O93L 1JXJA 5JW4R 5JPNB 3TBBA 4E2OA 2CDEB 4K7FB 3WAKA 1I8LA 4PBWD 1BQUA 4CVZB 1VZHA 2CLZB 3SCMB 1TEGA 1OEZW 5D4JA 5DFVC 3RDTB 1MLBB 1D5XA 2A4CA 5EBWB 4Z0BL 4U1MB 4YUEL 3NFNB 3QR1A 2Z92B 4FP8H 1IAOB 1F1GA 1UACH 4AV0A 5A16A 4XNMB 4A2EA 4OCXH 3PJLA 1OGAE 3CBJB 4UINH 5SX4H 3TBVA 4KHTH 4CBZA 3RI5F 5ES4B 5EZOH 3FTWA 4ZUSA 4AMKL 4HJGB 3VB8A 3TIDB 3CQFA 1HKFA 2OXGA 3FFDB 4PS3A 4F2MA 3UJJH 2O6EA 2CBMA 3JV6B 5GGSA 3N9GL 2YMTA 1ED3A 2PYFB 5T1KA 2PYEB 3M86A 1S3KL 4KZEL 5FUOL 5JUEL 2QR0A 1GRWA 1QI3A 2DPKA 2R0ZL 4MQSB 2NLJB 5IVZA 1SHXA 2HCZX 1EDYA 4HSAC 3US1A 5C0AD 1WA0X 3DX1A 3X1BA 1T7WA 3EHBB 3MV7D 1RAMA 3FO9A 2VC2H 4WJG3 4L9LB 4F8TA 5JQHC 3QJQB 3MNVB 5EO0B 2JSFA 1S9YB 1UXSA 1OM3H 4PB9L 1ANUA 1LWHA 3RPIA 2FDBP 3MUUA 3WNKA 5INCA 1E4KC 4KI5D 2QKIC 4AUJA 5CMAB 1ROWA 3RGBA 1R0AH 4TM9A 1TDQA 2YD7A 5I8CA 2RACA 2VDMB 4P23C 2FB4H 4X6CB 2X4PB 1AD0B 1X5YA 3GK8H 4XPBL 4YHOL 5LUMA 1KGJA 2FEEI 1C1EL 3ILPB 3QPXH 1ZANL 2CIIB 2VDNH 3EF7A 4K15A 4MAYA 1TFPA 1I1AB 1W72B 1GMEA 2QADB 5L0QB 3UPRB 4G9DB 4Z3EA 5CJOL 1P6FA 3Q48A 5D1ZD 5DD3H 1R19A 1IGMH 4M00A 5TE7H 1OAUL 1F3JB 3IDIA 2AK4E 4ABVA 3HHMA 3WLBA 4NQVB 4QCIB 3ZHFA 1J18A 3MR9A 4TS6A 5JMRA 1INEL 5JIMA 1A6AB 4P5RA 4PJIF 3H3PH 1IGTB 3FMGH 3WIIH 5DHYA 3MMEB 3D39A 5J1TC 4YDIL 1M7DA 2BW5A 1AYRA 3FU9A 3ECQA 4QTFA 2Z93B 1OAKH 4R8WH 3AAZA 3SGDH 1VADA 1AGCA 1WFMA 1Z9OA 2B7DT 3O3UN 3L7FB 3F2LA 4M4RA 1MFNA 4L8BB 4OLXL 4P9ML 2DBLL 2F18A 2OTUA 5C7XL 2W9DL 4NNYB 4DKFL 1SPDA 2ZX9A 4ZO9A 3BWAB 3IS1X 2X6VA 2CO1A 1S8DA 2OL3A 5AWNL 3OKOB 5CLYA 5H35A 2QGCA 2F1BA 4BQ8A 3RHWK 3QNXB 2C9AA 1AZRA 2A83A 1CTMA 2FGWL 2OW6A 2G75A 3ABZA 5JIPA 4I3GA 5DRNB 3ROOA 4LCUB 2E8YA 1JCVA 4OD1H 4YK4C 4EXKA 3RL2A 1R3KB 4XTRD 1LLAA 3K5RA 4XCFH 5AW3B 4EF3A 3KWVA 2CHDA 2KL6A 3C8DA 3VYPA 2E6QA 2VDQB 1B4LA 1I8LC 5T33L 1AXTL 5DWUH 3NTCL 3O2DA 2WBWB 3MCLL 3WFCH 2CLRB 3MUZ1 3WENA 1JE6A 4KGLA 4PJ9C 1YPZA 3GSQB 1CLZL 2Z64C 1B3IA 1IC4L 1SXBA 4OCWL 4APXB 5C09E 3PXLA 5TH2B 1A7QH 3PF2A 5F7EL 3WN6A 1IEBB 1XF1A 1T20A 4M8QA 4EN3D 2PABA 1B9ZA 3ARYA 4PJEE 1QNIA 1W72H 5KSBA 1H15A 2RMNA 4HZLB 3WDIA 3GMPB 4XAKE 3A67H 3SE3A 2NDGA 3TEYA 3KPMB 2L7JA 4A6YL 1MCBA 3MUJA 4LOEA 4GBXD 4OLVL 2X4SB 5DTFB 3G5YA 4IBLT 5C09B 1CU4L 4LARL 1KBKA 5IW6B 1P4BL 1GZPB 1KTLA 1AAJA 2D03H 1QZ1A 2FIRT 2LABA 4KXCA 5SWZE 1G6RB 4WI6A 4PRBA 4L3EE 2LQRA 4S1RH 2DIJA 3HI1A 4KK5C 4MNGB 3OKKA 3CHSA 4HWEH 4YMPA 1ZIAA 2MNUA 1JHLH 2QDWA 2BOCA 1Z0NA 3W11D 5B8CB 5I15H 3EGSA 3MV8E 2YQGA 4BRJA 5I16A 1NCOA 1I1CA 2C4XA 3DIDA 1MJUH 3KBFA 4HLZG 3OPZH 4HH9B 5I17A 4PJIE 3FQRA 5JIQA 1OE2A 2XU9A 4JM2C 5I66B 5DEFB 2X4UB 4KO7A 4ABUA 2EE3A 4KXAA 1Z9MA 3GIVB 2ADYA 4XWGH 3UTTA 1UEMA 4BWUA 3B56A 1T0NA 4AX3A 1LD9A 1X9RA 4M7JL 4GQ9L 3N04A 4Z9KB 1FL6B 1PJ9A 4WKXA 2NY3B 4KTDL 2YSSA 4YUEH 4FTVD 4NQSA 1QFPA 2DRUA 4GFTB 1P9MA 4PWGA 4XVUC 3TPUB 1FIGL 1QUNA 4LMQE 4X6CF 2BERA 2IDSA 5ICXB 4F33B 2NW2A 3CK0L 4X6BB 1GJWA 5D1QC 1U58A 3MO1B 4XMZA 3AMKA 3L3JB 1TMQA 3FONB 3LMJL 3TT3L 1ML0A 4OD1L 2HLFD 2QPEB 3K4DA 4JPIA 4LSTL 2NSXA 4LCCB 2GEQA 5CIPA 4RETB 4BKLA 2GFBA 5EF3A 1NEZG 1HCYA 3UAJA 4PJAA 3VB9A 4PWFA 1AP2A 1FG9C 4EE2A 1TENA 3V0EA 4RGMB 1IAKA 3OR6A 4H44C 2C3WA 1FJ1A 2VDLB 4G59C 4TF4A 5TE6L 4Z3IA 4UCFA 4MMZC 4HKJA 1HE7A 1IAIL 1ORQB 2IWEA 1VIWA 2IALB 4ZFFA 5KBPA 12E8L 3F7KA 3FSVA 4HXAL 4L8CB 3A4FA 5J1SC 3L2MA 2XXGA 4JO5A 4F9PC 5EBLA 3QGVA 4XO9A 5DD0L 4FFVD 3Q8EA 4RQQB 4XHQA 2W95A 1T7VA 3HE7B 4TULH 4U7KA 1NWOA 2NY2C 3AS0A 5MEPB 4GW5B 1WICA 3BP7A 4J5VA 3WNOA 4CGUB 5GSRA 4I2XB 5CD3B 3IGFA 2NCMA 2IH9A 3ABLB 1M9WA 4PCKA 4U1HA 2GEEA 1IIKA 5CGYD 2X7LB 1WCBB 1BPVA 4XP9H 2UXVA 2CO6A 3VVWA 2W65A 4ONFL 4FS0A 3RA7L 2W88A 4ISVA 2VDLL 4CNIA 1VPOH 4FTVB 4M9PA 5JHDE 3AQDA 1XMEB 1P84K 5J6HA 4QRRA 4IQHA 4R7NA 3GK8L 4GSXA 2BRQA 5HGAA 3ZDWA 4G8IB 1J1OH 2EE6A 3APNA 4YBLC 2V5TA 2VLLA 3GBML 1TTGA 1YMME 3WKML 2IAND 1HHGB 1KLFB 1J88A 2NNAB 3MZGB 2PYEE 5F0LB 3CLWA 4I18A 4Y4FD 5B1JC 4IOSD 5DUBB 1CDYA 2P8PA 2VRKA 4NSKB 3X12A 4XMXA 2DWYA 4KY2A 3MRBA 3FO1B 1CI5A 2PO6C 2YA1A 3MC0A 3MROB 4GUPB 5FYJD 5EU6E 4MYPA 4HP5A 2AEQH 4PJHE 3CZKA 3GSNL 3NZHL 3T2OA 3I6KA 4KTGA 4AY0A 2Z1PA 5BMFL 5D7LE 5GRWA 1JS4A 4DQOH 3MRLB 1KTRL 4AIOA 5GGTA 3D1MC 2JJVA 4U1JB 2NY2D 3T4YA 1X5GA 4PB9H 4JCLA 3KYMA 1BFVH 2EC9T 2FO4A 1JHTB 2X3AA 1LDPH 3V4UL 5ANMB 1FI8C 1HZHL 1SBSH 3F04A 3CVHL 3PUUA 4PJXF 2YSTA 2FB4L 3OG4B 3P4OA 5DJ2A 3BEVB 1BBDH 1EAQA 2EIKB 3MRKA 5E2UL 1J05B 2FE0A 5DJ6A 2BP8B 3LN4A 2FEDD 4PSRA 3BD3A 4PV1C 1T5XB 3KYAA 4GT7A 3ISRA 5ENWB 3TXAA 5JO5A 3EH4B 1L9RA 3HG1B 3WO3B 2X1PA 2VLRD 1CDGA 1A8JH 3D06A 1AGFB 4QAWA 4YBLB 1PLGL 3UJJL 5IT2H 3QUYC 2IH3B 5I1EL 3WIFB 1YEKL 3PFUA 4ONGL 4FA7B 2NUTB 4EVNB 1FFQA 2GPZA 3RWEA 5T8IA 2VR4A 1QBLH 4LL9A 4HXBL 4Y19D 2X4OB 1ZGLP 3O4LA 5J8OA 1LO3L 2WTOA 2BVPA 2FNBA 2E7BA 1FPTH 4IBTA 5K93A 2A5UA 3LHAA 1CT8A 4HAGA 4OKDA 1SDYA 2IADA 2E9WA 1AHWB 2GHWB 1IGJA 4H2CA 4JKWA 5E1QA 4K8RL 1BM3L 2BP5M 3IETA 2Y06H 1HEHC 4G72B 3F7RA 3TZVC 4DESA 1A7RH 3EYUL 4KQ3H 2NQ3A 1EZVX 1HHKA 2IWFA 3DBXB 1A14L 3FT4B 4MAUL 4FQXC 3UOAB 1LEIB 3WXVL 3I75A 3ULUL 5EU4B 1K3ZA 5C97A 4FABH 4QHUA 4U6VL 3KVDD 2QSQA 1KEMH 4RAUA 5E6IB 5BV7B 1BYPA 5DZPA 3QXUA 3S96A 2B14A 2CDFB 1FZKB 2MCG1 5CILL 4C4UA 4Z6AT 2HJFB 2B2XH 5GHWH 3C6LC 3EBAA 5KBKA 3ZL4L 1AQMA 1O7SA 5FXCH 4N6RB 5E4AA 3ZDYE 3VD0A 4XXCA 1KN2H 4FNRA 3G6JB 4R5TA 3WKNA 4IW4C 4LCWA 4J8RA 1HILB 4KNTA 3SE6A 3VTTA 4HFUL 4PW9A 1MVYA 5I1DB 5L4MA 2HT4D 3GXPA 4JFOB 1W8EA 2XN9E 4BKSC 4DP7X 3T5WA 1FFPA 4BFFA 1TVHB 5DMIL 5E00B 4ZSOA 5ID0A 3HG1E 3I2CL 2EACA 2PWGA 2JKSA 4LPXA 1L4IA 1CL7H 5IKCB 4ODSH 1PYWB 4W70A 1G7QA 2O5ZH 3LEVL 3T1FB 1LWJA 3EDFA 5K9KB 5DHMC 1N9PA 1KB3A 3AS3A 3DHJA 3MRMB 4ANXA 2QVIA 2AI0L 5LDUA 4XBGA 3CVIL 5C9JA 2XCMC 3OXSB 3MV7B 3WL9A 4GPVA 4KNUA 5E2VH 4WW2C 3JVGC 5ILTL 4DJMA 3IJYA 3LKNB 3FCSB 2OX5B 2GTWA 5T1MA 4OLWL 5JW4Q 1U92A 3FHAA 1DVYA 2DW5A 4HJTA 4L2LA 4QHKJ 1N26A 4YC2C 5DYOB 4OZIB 1RIUL 1AZBA 3NABL 3VW3H 2R9HC 1T3FB 4I1PA 4TULL 2VDPB 3L5WB 4XNAA 3DTDA 4HKBB 2VSDA 1ETA1 2K4WA 3MRQB 4FQJH 5F3FA 3VSQA 3VWJC 4Q9RL 5GISL 1WGOA 4QNPF 5DD1H 2HH0H 4D9LL 2B20A 3VXTA 3TFKD 1NL0H 3L17A 4N90E 1LE9B 2A0LC 4GMSL 1QSED 1S7XB 5DMKA 4PTUB 4U1GC 1V7NL 1KYOJ 4P4KC 5F1IB 3CVCA 2RTTA 3KLSA 4HW6A 5CIPH 4ODTH 1JBJA 4ZMTA 1U9KA 1UB5A 4JDEB 4JFDB 4ECNA 1GL4B 3DVIA 1JAEA 3KEDA 2AJZB 2DQMA 4Y88A 4EIZC 2XBTA 1GC1H 5LWYL 3B34A 4KRPC 2HLEB 2KQNA 4FXKA 3H4FA 5KTEL 1IL1A 4D7BA 1T03H 5ISZD 3CN4A 2F2HA 4FKKA 4TMPA 3D69B 2F08A 3B2XA 2H9GB 5FCSH 4N2OA 4N28A 4UWQB 1N2RB 1ZMYA 4G80B 5AUMA 3OTTA 4BA8A 4CC4C 3MRHA 3BXNB 5FO7B 1JPFB 4L9LC 4AL8L 5IJCC 1RJYA 5KN5A 3PIQA 4PRAB 4U4BA 1NICA 2H8PA 3WCYA 1HNYA 1G7IA 1O5DT 2LT9A 3FU3A 1ZOXA 2IWGA 4XNQA 4V1DB 5DT1H 4MDJA 3DPDA 3ZGHA 2YAQA 2WUBH 2XI9A 1MJUL 5LAXA 3L4UA 3NFPB 2G2NA 1PFOA 4Y16D 5FO8B 3DYMA 2YD1A 4Q52A 3MGOB 1Q94A 3VXRB 3TF4A 1UWEH 2X6BA 3RGHA 1WBYA 4ATWA 3KBPA 4L8SB 4PQXA 5D7JB 1TQUA 2AFNA 3NCBB 1BF5A 2Z1KA 3B2MA 3ABKB 3VCLB 4TNEA 3ARFA 4GLRI 4HX1A 4KKAC 3TFKC 1OW0C 1U8LB 3TJEH 1RPQA 2DIEA 4NXKA 1DL7H 3QJFA 4PJ8C 2WXNA 9PCYA 5E6UB 2AQ1A 2VDKH 3WEXA 1XIWC 1OCOB 4R84A 4PEEA 5G4OA 2L3BA 5BZWB 3A4AA 1KTJA 4D3CL 3QNYB 3WUWB 1F5WA 3RX7A 2ED9A 3ZPDA 2R1WA 5EO1A 4WHDA 2OXHB 1AQDB 2WNXA 3P4MB 1I3RB 5T1KD 1CE6B 3O6LL 1KYFA 3FCUB 5HDWA 2BW4A 3N85L 5EEXA 4Y1AE 2PP9A 4W9EC 4H0IA 4JUTA 2XV3A 3M17B 4DOHB 3U7YH 5DC2A 5CGMA 5C0AA 1RK0A 3BT2L 3KWWB 5I8KL 1ILSA 3VG9B 1YN7A 5EZIH 4Q9RH 1TJIL 4KHXL 4B9PA 3NVQA 2CGZA 3ARDC 2ZNXA 1YPZE 2GTZA 3A0OA 3A6CL 4LOVA 5JDSB 4JFFD 4LSPL 3QEQD 4XC3L 1E6OH 2JLPA 1XEDA 2UWEE 2ZCLL 4JY4B 4XVTL 4AGQA 1CBVH 3IGAA 3ML8A 1B0RB 2LR4A 2VR6A 5E8NA 4ZNEE 5CJQH 5HHNB 1BBJA 4CL7A 3PGFL 4NQDB 4NRYA 4ZW8A 3VWJB 5FYJL 1TJGL 3QEHB 4KQ3L 4HC1L 1A3LL 2BOBA 4YHMH 5KVGE 4NQXA 4R97B 4O2EB 5IBTH 5ACMA 2EC9U 2B3IA 1K6QH 2P3YA 2JFCA 2ZXQA 3ATDA 3CMOL 1OTTC 2VQ1A 1RP9A 3GF8A 4JY4A 4PV8A 2BC4B 2QELA 4U6VH 25C8L 2DQJL 4P2CG 1CF8H 4A7TA 3WTYA 4P2RA 2GTZB 1U3JA 1JYWA 1UD8A 1GGCL 2NNRA 2ZG1A 4YLBA 3E8VA 2CKNA 3OZ9L 2A74C 3FB7B 1YN7B 4QT5B 4YO0B 2N59A 3GB7B 3KG5A 4J8QA 4R5XA 3UYPA 3EJSA 4IKJA 4M61A 1PNCA 3OB0K 2WK2A 1OAUH 2VLKA 3FFCB 4AGOA 4G7VL 4HK3N 1YEHL 5MI0C 5KYXA 2F5BL 3UTQA 3K2UL 1LK3H 3CDGA 4JL1A 1I3RA 4KJPC 2OXHA 5GRVL 1S46A 5EO1B 5SWSD 4JZNA 1FUNA 1B0WA 1IGIL 1USZA 2WWNA 2IBGA 4UAOC 3WO4C 2BHUA 4EDWL 2XOTA 3W39A 5K59E 2HG0A 2RA1A 1KT2B 4AQEB 2MOQA 3NZSA 5F96L 1RVFH 2G60L 1MFMA 1RFDL 1CVRA 2VZ1A 3MCKB 4LLDB 1O9VA 5D7JA 1AIZA 2AQTA 3QEGH 3N50A 4JM4H 5G4MA 3PWLA 3MGOA 2FQGA 1JRHI 4E5XA 2K6WA 4FI7A 4WO0A 2Y3NA 5LCVL 3VDBA 3UTSD 3PWPD 1P7QB 1ZDSA 3K3QA 3QYCA 4HUWB 2KZ1B 5HI3C 4YE0A 5EDXA 1BFTA 1PD6A 3HFFA 3RIFF 4BCXA 5DSCB 3AQXA 1GZHC 3X1GA 2FCBA 4TV3A 1SVBA 1YPZF 5KN5B 1RJYB 2B5IC 1FBIL 3RWGB 4JZJA 3S88L 3HC4L 3MRHB 4U0RB 1QI5A 3BDXA 1N2RA 4G80A 1VKXB 3P2BA 1NBCA 4QR7A 1N5YL 4OZFB 2ZWZA 3G5ZA 2R1XB 1OGAD 5IMMA 2OMVA 1DUZA 3HC0A 5FDWA 4MCYA 4JY5L 1SM3L 2VXVL 3L7EA 1X5ZA 2WZ5A 2B1OA 2GKIA 2IH1B 4LKXB 5AEAA 4X4MA 1J8SA 3AUVA 4UV7L 2QSCL 3N0AA 4PY8I 1INDH 1NCDL 4XWOC 1GTFA 3L3GB 2H7WA 1BVOA 2I9TB 2JJUA 1A02N 2CJ3A 5DMKB 5DZVA 1S7XA 4H26B 2WQUA 1XB8A 5GGRA 1MQKL 5F9AC 1KIRB 2JV6A 3JUZA 4JKKA 4NDMA 3VD2A 3CQQA 3IB4A 35C8L 3MJGX 1BD2D 2Y6TE 3PWJB 3V0WH 3L5WA 4YXHH 3V52H 3QUXC 4R4BA 5CHNB 4JQIA 2JF1A 1RI8A 1DVUA 1UH3A 4NWTH 3S4SA 5EU5B 4DVBB 1U92B 4TXVB 5CP7A 1GMIA 1Z7JA 3EYVA 3SKUD 2WXRA 1BFVL 2OMUB 1NGXB 2EAEA 3P0GB 3OXSA 1IB5A 5EIIG 1CTNA 5DR5H 2H0FA 3MV9E 1KCVL 1TNNA 4KNQA 1GAFH 1JN6B 4UF7C 1DVSA 1YY9D 3S0PA 3G7TA 1OANA 5AG9A 3FCTB 1G7QB 3NCEB 1PYWA 3INOA 4GKLA 4K5PA 3IVKA 1ACYL 3GIZH 3LS4H 1NBQA 2HFEA 4GMSH 1L9MA 4PAZA 2IDFA 4Y9GA 3MRPA 4FQIH 2XZCL 3IN0A 4CVXA 2VWEC 1NC4B 1JGVL 3BW9B 4P3CH 5I1DA 5L9DL 2LU4A 2DMHA 1A6WH 4B3EA 1HILA 4LCWB 2E27L 1EFXA 1IEAB 3TWCL 3P0VH 1UM6H 2YK1H 5AAWC 1PY9A 2YARA 3HJ0A 4IIQC 1JOIA 5MP6H 2CXKA 3S5YA 5DZ9A 4ZMPA 3MJ8A 1URIA 2O61B 2NCEA 5GS2D 4HU2A 3QCUL 3OQ3B 3MLWL 2CIKB 2CDFA 3S96B 4E0RA 5I0XA 2JKRM 5F89B 1SY6H 2NRDA 1FYTA 3OKDB 4LCWE 2DMKA 1XL6A 2B39A 3T0WA 2CK2A 4N0UB 4W6YB 3VFOB 5TQ2L 3VQ2C 1EHAA 1BEYL 1IAIH 2R4RH 5JW4M 5J6SA 5I8KH 5EUKB 5B38B 3TLRA 2VR9A 4PRDB 2VISB 3B2VH 4EN2A 1BAFL 3C5JA 2WSKA 4P9HL 4TOYH 1UVQB 1DEEB 1CGSH 2WBJC 2MOVA 1ETZA 5BVJB 3LNFA 3SQBB 1GYUA 2IADB 4MJHA 5AW6B 2WLKA 4NYLA 2UWEF 1TXKA 5TFSH 1DBBL 3NUKA 3CN2A 4GOSA 2BVPB 1MJ7L 2CPCA 5IFJB 1EO5A 5C2BH 3RWFA 3CH8A 3MACH 3EDDA 2P7TA 4PGEB 4A38A 2CK0L 3MNMA 2R2HB 4IBQA 2EEAA 1IE4A 5J5EA 2BSED 4RA3A 3ETBF 4LASH 5D1XD 2JQMA 4XB8A 1GOHA 1UKTA 4W4OC 5DJZB 5GGQH 5DEGB 3QPQC 3HG1A 1DVFB 2Q5BA 4JDTL 4PJ9A 1D9KC 2I5YH 4KH2A 4XT1C 4IGBD 2NY3C 2C9XA 4OFQA 4ENEC 3BN3B 3CZLA 3MRKB 4WU5A 4HG4K 5E4IA 2CKBH 4XNUL 2C7FA 1A2YB 2Q3AA 1TUPA 3BUTA 1MCRA 5A2IH 2CNYA 5EUOE 5DF0A 3IFLH 3CQPA 3UBXB 2WZAA 2P4AB 2WWOA 4F7TA 2CE6A 4X6DA 4YXLL 4GEIA 1M05A 5JNYA 1F8TL 1DR9A 4A7GF 1F6AB 2IPKA 2C1OA 5IP4A 4QTIH 5DUPH 2OBGA 1UWEL 1YG9A 3GXIA 3KYMB 5EO9B 3T4YB 5ILTH 3N91A 4JQIL 4JG0L 3VD9A 1NH6A 5CJQL 1E9QA 1DBJL 4YGAB 5ACLA 3T8XB 1E30A 3HNVL 3MU3A 2VZOA 3SDAC 2XTJD 1GJIA 4YGVA 4HMDA 2CDGB 3KLLA 3P3RA 4LVNB 1NDMB 4MJIB 1H3UA 3HS9A 3BGFC 4ANKA 1NMCB 2ARJQ 3MROA 5HHQA 5H37H 2XC8A 2WGNB 3AU1A 4ABWA 3RBSA 3U6RB 4X8GA 4N0RA 1IT9L 3ZE2B 5JHBA 3V7AG 4I18B 4O9HL 1CFTA 3AT0A 3ESOA 4FNUA 4FEIA 4N0CD 2HKHH 3FH7A 3SE9L 1X4XA 4ZQKB 3CVBA 1F11A 3I50H 4WGWB 3W9EA 3UTZB 4Z5RB 2YKLL 3N44B 5LKNA 2IPUG 4XO8A 4S11A 4FNTA 3TBYA 2WUCL 1HHJB 3O4LD 4FZ8H 4RA0C 5L4JA 3QORD 2XBDA 1QLEH 4AT6B 6CGTA 1TKWA 3KPSB 3L3OB 4FQCH 4U1IA 1C5BH 5B7FA 1TJIH 4TUOB 2DICA 1OSZB 2LAAA 3TIEA 4N3TA 5E8OA 4E9VA 4LRNH 3RIKA 5C0JA 2FEEL 2X4NB 3BAEH 3DSFL 3T6WA 1WCBA 1X5FA 1JK9B 3H6JA 4G6KH 4FNLL 2ZOOA 5F7WC 3K4AA 4U1HB 2ZTBA 1D5MB 5ALCL 4I77L 2G4EA 1K4DB 3ZRCC 5TGBB 1L9PA 4F7KA 4WNSA 3HB3D 1X7QA 3VAEA 5MEPA 3UACA 2ICES 4YXHL 4JG1L 1REIA 5EOQH 3HE7A 3V4PH 2HLAA 5CEZD 4P46C 4H0GA 4WWKC 5ESAB 5IB2A 4DUWA 4YS4A 5GXBB 1VJSA 4HUXB 1YEGH 2VLJB 2TAAA 4XVUD 3PL6C 2WZPD 3D7PA 1EQWA 3GRGA 1K4CB 4HMEA 2GY5A 2IALA 3MOBL 1AXSA 3ULUH 4HKJB 5I30L 3ZQXA 1A1NA 2DI8A 2D0GA 1HXMA 3L2NA 4TN9A 1IAKB 3OR6B 1ADQA 1ET5A 1NBZA 3T4AC 4WHYG 3OR7B 1AP2B 3L6FA 4LCWD 4PJAB 2DJ4A 4IIQB 5CILH 4MZ3A 4BKLB 1CMOA 2L04A 2QHRH 2BLFA 4LCCA 5DFAA 4C55A 1ETJA 4P5KB 1N5YH 3W82A 3F7PC 4KKPA 5DVPA 3FONA 1CFQA 5C6TH 4GI6A 3WLWC 1ZT1A 4UUJB 4ZUVB 1WZAA 4QF1A 1W9XA 4Z1PA 1MOEA 3HA0A 3PU7A 3L9BA 4U0RC 4A7UA 1UXMA 2VDKB 2ZKHH 3WFEL 5LJYH 5LG6A 1OWWA 2YSSB 4N8UA 2C4FT 4XP6L 3NIGF 3X1FA 4AE0A 3IJHB 4P59L 1CLVA 3DETD 3DMMA 5EEWA 2CMRL 1T0NB 5IBLD 4U1NA 1ZSDB 1CLOL 4WGKA 3E80A 4QRQA 5SV4A 3FJTA 4ZAKC 5C0NC 3FRPA 3V52L 3IWUA 1JPSH 2OSLA 4X6DE 4F8QA 1NBYA 5GZOA 2AK1H 1U21A 1TQBC 3BPLC 2C9SA 2ALWA 3ZX1A 2V7HA 2UZYA 1RZGB 3MRGA 4LSUL 1QSEA 1BAWA 1DEDA 2WQ8A 4Y2OA 5B8CA 4X2UA 3U0PB 4MNQB 3EJPA 3L13A 1E90A 4W6XB 4F3FA 3P3SA 2DD8L 1HCZA 2OJZL 3HI1B 1GGYA 3M6DA 1SOXA 3Q8BA 5FHAL 4AOFA 2EUVA 1Z9LA 3NIDE 3DTUB 4NT6B 4LXFA 2H2PD 5F1SA 1RUML 2FBJH 4AL8C 3L1OL 2VL4A 3ZUCA 4OUUA 3HZVA 3GBNH 1QFWL 2J8UA 1YMMD 4GXUN 4GH7B 2YD3A 3NAAH 3KPMA 1PZDA 1ZPUA 4NX0A 4G43B 2R9HD 4DFIA 4WW1B 1LK3L 3QDMD 1OB1A 3KE0A 5KSBB 2BOLA 1WWBX 4OZFG 1SEQL 2V5YA 4DN4L 1DQLH 5TF1H 4Z8FH 3G9VA 5DC0A 4APXA 3ZYOA 1YNLH 1YYCA 4L48A 2WN3A 1RP8A 3TONA 4Q6YA 3MLTB 3QIBB 4HWBH 2MCAA 3ZMEA 1NCAH 2BVEA 4IMKC 4DAGH 3RPBA 2AV7B 3J8F7 3QI9B 1PMYA 1R3KA 2XICA 5KJ4A 5C0EB 1GGBH 3HZ3A 1YYLH 2R0KH 3ROOB 4QGYA 5CBAB 4X8CA 4DERA 2PXYB 4R26L 2A83B 3OKMA 3QNXA 3OX8B 5DR5L 2HB0A 2I07B 2QBWA 3WE6A 3DJ9A 4J6RH 43CAB 3BX7C 2RFXB 3MXVH 3VACA 4BE5A 4PI0A 4F37F 2W1NA 4XB7A 3GRWA 1OXYA 3CFBB 4U1GB 3BMWA 3OAYH 3LZQA 4XP4L 2Z31C 4YSUA 3M7FB 4GW1B 1FGVH 5T3ZL 2JMRA 4V2CB 1EO7A 1DJHA 1N5AA 3IRPX 3CPUA 4K8RD 5DMYA 4Z7NE 4M4RB 3L7FA 3BHBA 1KWGA 2R69L 3HBZA 1AGCB 1PCSA 1VADB 12E8H 2Y1VA 4Y1TA 4HSCX 3GHBH 4MZRA 4JY5H 3G6AB 2Q87A 3D39B 3E3QE 2EH8H 5D93C 4CN6A 4JLRB 3GSVB 4O4YH 4ODUA 3ATFA 3NRFA 3V5KB 4AG4L 1QSFE 1O6VA 3H9HA 1CS6A 4FZ8L 3K91A 4ALAC 3MR9B 5HDBB 4QCIA 1AO7B 1IFRA 1F3JA 1INDL 5ESVA 4BK4A 1L7IL 4NKDB 4MAZA 3NSYA 3EJRA 1CZ8L 4GSRA 3QZWB 3KHOA 3OBAA 3NSXA 3D0VB 2OV0A 4AIZA 3DHPA 4OZHA 4QRBA 4HKXB 2WYZA 5C0IB 1DUYA 1NC4D 3A6CH 4DP4X 1THCA 2JH2A 2WNGA 4IS6A 4R90H 4FG4A 4Q6IB 4MCMA 1JGEB 1RIHL 1WWAX 4LSQL 4P06A 2W60B 4NQEB 5IUSA 1U8IA 4X4ZA 2IOOA 5DK3A 3NP4A 1XHHA 4HEMA 4PYHA 2DDQL 2D31A 1KXHA 3BJ91 3HZYA 3GDCA 4DO4A 2EVJA 1ZEAH 1KIPB 5HHME 4WZ9A 2CNZA 1A7PL 4UOW1 3CC5B 2PTUA 1UXSB 1HEZB 3V9EA 3MNVA 1BZ7B 2FWOA 5GS0C 2KLRA 1DLFH 3FRUA 3FO9B 5T1DL 4ZX6A 3AQZA 1CGUA 1NAMB 5D1ZA 1Q9LA 1EO8H 1KIUB 4HHGA 1SYSB 5I5MA 4YDVB 1G84A 1A9EA 1KNOB 4IBWA 3C5ZD 4HCRL 5EZLB 1ZTXE 5IVZB 2NLJA 2MHAB 5HVHB 1R33A 3SGEH 2YRZA 5C2BL 3KPPA 4PG2C 2H3NB 4HZ1A 3K2KA 1ED3B 2PYFA 2UUDH 5T1KB 2EDYA 5E99L 4PW3A 3D0LA 4F1SA 6PCYA 3VSVA 4O9HH 3JV6A 3R8QA 4ZMVA 4GG6F 1H6FA 2Q86A 1T4KA 4Z76B 4G8AC 3QDAA 3TIDA 4HJGA 1AVAA 2C3VA 2HRGA 3JTSA 4N8CH 1TTUA 1IFHL 1OTTD 3MLZL 5C6TL 4GIOA 5I0YA 1CIDA 5KVDH 3QUGA 3K2UH 1QUPA 1A64A 1NGZA 3SKMA 4POYA 4B60A 2G5BB 3DURB 3V4PA 2Z35B 3KYKL 1AQ8A 2HG5B 4JY6B 4YSAA 4F58H 3RNKB 2OMXB 4PJDE 1AXTH 1D5XB 3DJRA 3TEUA 4OBSA 4PV9A 5DJCA 4JFYB 1J8HD 4MLSA 5AENA 5IB1B 3QWRA 2NY4D 5ID1A 3FQ1A 4IRSA 5J13B 3TA3C 4Y16B 3ZOAA 3Q6FB 1F58H 3LN5A 1GTNA 4NC2B 5I6NA 3MV7E 2BVOA 4IOIB 4AYGA 3C6EA 2GAZB 4K2UL 4XCEA 1J8KA 3CE1A 5I6LA 4U1LB 1D3CA 3MUGB 1CTOA 5CGYC 1KOAA 2J5LC 1U91B 5DQJB 5J1AA 2ESVB 1Z0MA 4OLVH 5F3HA 1GYVA 1WSST 3RKDC 3FQWA 3MV9A 3PWPB 3T3PE 5C08D 4FHBD 5F6HI 1GW0A 3QQ9D 1PG7X 1U8NA 2DB8A 1E4HA 1VACA 5BQ7A 1RK1B 5CEZH 3IRCA 2VKWA 1I75A 5DFVD 1AE6H 5GS1A 5ICZB 4LLMB 2FT8A 1S7RB 3IS0X 3SD2A 2FUQA 4CSPA 5INDB 2OM5A 4C83A 1C5BL 1CVSC 1BVZA 4HOWA 4GI8A 1P4IH 2BNQA 2ARJB 2Y7SA 4NKOA 1NLBL 1I7TB 5F70A 1PZAA 1KEML 3POCA 3UTOA 3VXSA 4XE5B 1KBGL 3REVA 2CJUH 1BD2A 4WV1B 3GSXB 2E9GA 3US0A 1NAKH 5HYQA 2C4FU 4GAYB 4XP5H 4PCYA 2Z34A 3DSNB 3S2CA 3T3PF 3FFCD 5IZ7A 1R5WB 3FUIA 4PWKA 1XAUA 2FUTA 4UTCA 4ZFZB 5AZEL 2EEDA 4RX4A 2VAAA 3UAEA 3EG9A 5LGJA 5EPMA 3BRFA 4P5TC 5AKSA 3RIAK 2AJVL 3QJHA 1WITA 1E27B 3QDJB 3B9KB 2VW4A 4PP2B 1XF5A 4FRWA 2PUQT 5DZOA 3U36B 1S7QB 3ZKMD 1B4RA 2R59A 2J6WA 3WMPA 2HZHA 3D2UD 3BT0A 2DS4A 4MXVF 2WMPA 4IBYA 4AZUA 2FEDC 2NMSA 2GK0B 1EAOA 4PY7B 5F7BA 1TR7A 4JEGB 4G71B 5EN2B 1NOFA 5IFHL 2ODHA 4F58L 4ZMNA 2OP4L 5HGHB 3H8NA 2ED8A 1GAFL 3QDJE 4TVSa 2WXPA 2W8CA 2IC2A 3QZOA 4JS7A 3VDCA 5JIDA 3NCXA 3EOBA 5TDOA 5C0GB 1EERB 3VFWA 2FD6L 4OFDA 4H8WH 3MBXH 3O4LE 3LS5H 2A2QT 1X5LA 1N8OE 2J25A 1J8HE 5LAPA 1G43A 1J9QA 3L1GA 1HL4A 1N64H 2I60H 4WNQA 4XCNB 1CYWA 4Z95H 5JOFA 4Q2ZA 4HOXA 2Q8BL 1V3MA 3RURA 3ELQA 3MXVL 1V7ML 3CGTA 4YE4L 2LTQB 3PHSA 4EI6A 5CWSA 2F5AH 4TUUA 1A6ZB 1YEWA 3RRQA 4AV4A 3J07A 2ZYHA 2F61A 1FNGA 1MF2L 1EEZB 1JGLH 1RZQA 3VD4A 3TS8A 2E7LC 4R4FH 5HHPB 4LFHG 4XGZB 4N2EA 5F1NA 2FJSA 5F3BA 3PPEA 4DP6X 1U8MB 2HT2C 4GRWB 1TU2A 4IRSC 2HRLA 4C47A 3CNKA 4R2GB 4LLQA 4XMWA 4YEEA 1A7QL 4JBSA 1CFNA 5CJBA 2IOIA 3P4NB 1DBKL 4ZXBA 3P02A 4OZ4A 4LLYB 2Y5EA 3QZNA 3RU8H 3W1ZA 2NZ9D 1MIEH 2R7EA 5E1AB 4CBPA 1M3JA 4PD4K 2Z91B 3RVWC 2BIMA 3GGWA 4I9WE 4L37B 5D6DC 1DLFL 2WLYA 2YGPA 3T0EB 2Y22A 3WTSA 1F4AA 5GRUL 5I1KL 3OG6B 4NHUB 5HYJD 3ENEA 4XN2A 5IK3B 4YBHA 2IJ0C 3QUZC 4XCCL 5HVGB 4RBPK 4N0YH 4ODHL 2YMOA 2VTFA 4M56A 4E9RA 5DRXA 4J1UB 1RSFA 3MJ7A 1FGNL 3GQFA 1MJ8H 4GG6A 3TTYA 4HV8B 5GGUA 1WS8A 3MLXH 2ZF8A 1AY1H 4PJ9D 3UX9B 5JW5B 5BUPA 2FATL 3OWEA 3S36L 5BJTA 4JM4L 1QSFB 1TJHL 1KCRH 2QPUA 2DBJA 4PLOB 4FYQA 4YNYB 5C3TA 4BQBA 3Q3GB 1ZHLA 3D25B 4HMCA 3F3HA 3ULUD 1BVLA 5BQDA 1NAML 1VFAA 4N4YB 1XXDC 4AZ8B 1CG9A 5EG6C 5CJXA 5ISZB 3BMVA 5J6GB 3F01A 2X4TA 2OK0L 3K6OA 4JFED 1NCAL 3RG1C 1AHKA 3L3HB 4LQFH 1EPFA 1DFXA 3S3PA 4PLKD 5A40E 2HFFA 4GYBA 2PCXA 1W6WA 2BVTA 3QULB 3VFRA 2NR6D 5L2JB 3KS0H 5AG8A 1IGYA 1YEJH 1UASA 1ZVHA 1OTUC 2ZX7A 1KPUA 4Q89A 3S34L 4M9OA 4GP5B 4XXDA 2X9WA 2HRPL 3MNDA 2H1PL 1M3IA 4I1RA 2GG1A 3C5SA 1E65A 1MW1A 4LHUA 1IVTA 3FQXA 5BXFA 1ZVSA 5I71B 3PAZA 4JFXB 2XYCA 3EOTL 3H42L 2DY2A 2EKSA 1NCBH 4GQRA 3U9PL 3T6VA 4OJFL 4U3XA 2VDML 5FX3A 2VXTH 3TEZA 1NTDA 2XN2A 4NENA 5A2BA 4L1DA 3EYSH 3PDDA 4R2GC 4A63A 3DV6B 4X99B 1MY5A 3QORA 3VXQB 1P1VA 1QLRB 3X3FL 4D0CA 5IB3A 3EH1A 2PP8A 2XNAB 1KDIA 4PRPA 4W9LC 1H3TA 4YHLL 1P7KA 3VXOA 1NFKA 4LHUG 2YAMA 3JTTB 1K8IA 1FV1A 4OKVA 1UM5L 3IK2A 3MBEA 2RD0A 7FABL 1GCYA 1I8KA 1ZTXL 3D85A 5C8JB 4HIEB 1VGKB 1SEQH 2Q2EB 4ETQA 1UM4H 1AS6A 4WI8A 3U4BH 4P46A 4JL2A 2YBRA 1T21A 4QRSA 5GRJH 1DSFH 1LEGA 1V3LA 2DTMH 3OJVC 2PNDA 3K2MC 3RVUC 2Y6SD 2VXUL 1PIGA 2YPLE 3PFQA 3DIFA 4GRLA 5IM7B 3WNMA 4MNGE 4UTAH 1PLCA 2PCPA 4G6AD 5AD0A 3G9AB 1FGNH 5E8PA 4B9YA 5GIRA 4BH8B 2XWDA 4OD3L 4FJYA 5IHWA 4OM1L 3PYCA 5HBBA 1T89A 3D3VE 4KKAD 4PGDA 1NINA 4PTTA 4NZJA 5DGRA 1IEHA 2X6AA 3FB6A 4PJEB 3QQ4B 1YZZA 1ECYA 2BVQA 4RCAA 1XZWA 4TNFA 5E6ID 3VI3E 1R46A 1R3JB 4I3RL 2YWYA 4J6RL 2CR3A 2IO5A 1G6VK 2JCCA 1DVTA 3IJSB 5GIRB 4BH8A 4FQHB 3QWOA 3BP6A 2HT3D 3DARA 5AD0B 5AZEH 2PCPB 3PNWB 2VDQL 5D9SB 2VZTA 5AKTA 5EIIB 1T21B 2OZ4H 3U2SA 3VFTA 3O9WB 4L0YA 2J8UF 1VGKA 1NDTA 2EP6A 1WCQA 5FKAB 4YHNA 1OK0A 3MBEB 4MXQC 5K1NA 5CJ8A 4WUUD 2ZCKH 5JIKA 4K3HA 1O6TA 5TDNB 1P7KB 4FQLL 3VXOB 4H8QA 2BY3A 1IGFL 4ZOBA 2X09A 2XNAA 3ARRA 4AEHL 2WOYA 2FEJA 2WANA 2YOAA 3V0FA 1R6VA 3HNSH 4NBYB 3X17A 4LEEA 1ID2A 3DVFA 4ZUWA 4AC2A 4YHPA 4HF5H 2OTWA 4HWUA 1EGJL 2VLRB 4BRVA 2ATAA 2GVYA 1DN0B 3HMWL 5L4FA 4JFHD 4R90L 1JF1A 3EJYC 5B1CA 4JFXA 3TEXA 3BUDA 5D7LA 1ZT7B 2HRHA 3PV6A 2V7NA 3B8SA 3QA3A 4LHUB 3SY0A 1YSOA 2ZOTA 2G2PA 3HUJE 4RAHA 5D4QA 2WSDA 3VJ6B 5GGTL 2GI7A 3MRDA 5FUCE 4DEUA 1I9EA 2D3JA 4M8VA 4B97A 5DLLA 1KXTB 4WW2F 1ASQA 1IGYB 5BOJA 5FYJE 3SYOA 1XXFC 4LL1A 2FT7A 2QHLA 3MTRA 4WFED 4RGND 1YMMA 5I75C 4GBXB 2AQRA 3BZ5A 4U1SA 3WEOA 2VT0A 1KTDA 4N85A 4PREA 3JT2A 1H6UA 3GLEA 3ILQC 2GIXA 4X5RA 1ZXQA 4Z7UA 1HI6A 2V2TA 1BVLB 1XB3A 1KGCE 4JFVA 3BUYA 2HPOA 4IRJB 1OAZL 3ZDYB 3EJQA 2LGNA 1PIFA 3LQAH 3Q3GA 4WF7A 3HE6C 5CJXC 1AR2A 1HAUA 1XGYH 1QSFA 3LCYA 1IZKA 1DBJH 4JG0H 4MD5A 4O5LL 4AW7A 3KLQA 1Q0EA 1YMHA 5JW5A 3TWYA 1TJMA 1XF4A 4IRJC 4F27A 4ZFOA 5JHDA 4K7PY 1IBYA 4AXWB 4XC1H 4KROC 3MCG1 1YY8A 1NQBA 2E59A 3H9YA 4NZ8A 1RZ8A 3S35L 4G3YH 5KVFL 1DL7L 1JGIA 2AK4D 4M43H 3MCYA 1JL8A 4OJCA 3EZJB 3KZ8A 2E3VA 2HKHL 4URTB 4IK7A 1H3PH 4DNLA 4JGNA 2NYYC 2L7EA 1JUFA 4PCTA 4Y89A 5E1AA 3E2HC 2YUZA 1H8LA 3CHRA 1KN2L 4X7TA 4GUOA 4ZQTA 4ZXBB 2VLJE 4F2EA 3FULA 3GBMH 2I9LB 2PTTB 4ZTPL 5CCKL 1TCMA 4F91B 3SGEI 1U42A 4XNBA 4PJDA 1U8MA 4G8GA 3RGVA 3DX2A 4NOFA 2XZQH 2VH5H 3NJLA 4HBCH 4IIZA 3CSGA 2F1AA 2Q7NA 3E9TA 1XGPB 1EEUA 1B6UA 3GWJA 4YFLI 4LNRA 5TD4A 4HLEA 1JZJA 3ULVL 3V5DA 1VRSA 1UD2A 4YQXL 4K3EH 1KLUA 4POZC 1BX2B 1I1AC 2BFGA 2PR4H 4KJWD 5L0QC 3H3BC 3QZLA 3DVNA 5K9QG 1BAFH 3DTXB 1QKZL 5IV2A 4P3DB 4B9IA 5FKPA 4JFFA 1NGYB 2I26N 4BFIB 1FQ9C 4WNQB 4OB5L 3H9ZA 1KXQE 4YXKH 3SYPA 2ZP0T 4IKKA 5KOMC 4ADGA 5F7MC 2YZ1A 3FQNA 5JXAH 1G7LB 5JORB 3O9WC 3DOHA 3EOBB 3BOVA 4NRXA 1QATA 2P47B 1MKFA 4S2SB 5DD1L 1KN4L 2V2WA 1DN2A 4HZAA 4J3OF 4YHLH 3BO8B 4MB1A 4FQ2H 1FYTE 1ACXA 3SJVA 3UTSE 1YYML 3CX5K 2NSQA 2WMPB 2A6IA 4RH4A 1DHKA 4FXLA 4MMYB 5TE4L 3HI5L 1MW2A 1YEJL 1F3RB 3ZZLA 1GY2A 5KSVB 1A7BA 4N2MA 3TNMB 5HJDA 3QDJA 2ZWLT 2OSYA 1OARL 1E4XI 1WAEA 2D4DA 3MLVL 2DQHH 1MIML 1MCHA 4GI9A 3B7SA 3FB8B 3QEUA 4H1LG 5J06A 4UM8B 3G5XB 3VH8G 3KW7A 5DA4A 4RWYL 2EYTB 2R29L 5DMJB 5D7KE 4JRXB 3UG4A 2PW2B 4JFHE 1F8TH 2QTVA 2FD6H 3N1QC 1JI2A 2LVEA 2OYMA 4YWGH 1SVCP 1H8SA 3REVB 1PZ2A 2GITA 1X4YA 3VWKB 4Z7NF 1NMBL 1NUGA 2H1XA 1CXFA 2DQIL 3L9RA 4FA8A 4ZXBC 5H37A 1RZJC 4D9RE 3WY4A 4B9JA 2BNQB 4K5LA 1CN4A 1JPSL 4F7CA 2JKIS 4KH9A 4A6YB 5FYKE 4C83B 4XNZB 5INDA 3ABGA 4N8CL 2QL1A 4F9PA 3P1VA 3CLEH 4Q14A 5GS1B 2DQGL 1NIAA 3D08A 4G9FD 1RK1A 3ILDA 3H7BA 2HWZL 5H2BB 3X14A 4WSKA 3IMSA 4P2QD 3HFMH 4DKAA 2WB7A 1CLYH 3D33A 2PP7A 1KELL 3MV9B 3QQ3B 3HR5B 5J0BA 2LFGA 3V7MA 4HS8L 2ENSA 1O5PA 3ZMNA 1OZTG 3MUGA 3MV9D 2YN5A 1INQB 2BH0A 2ZXDA 3X3GL 1OV8A 3TF7C 1AGEB 1WZLA 2DH3A 5CKGA 3A5VA 4IOIA 1Q9WA 4DP8X 4Z23A 2GJJA 3HN5A 1XDTT 4G9FB 3KXFB 4I3RH 4JDZA 3FFOA 4LAQL 1KMGA 5ID1B 3QRFM 4FQPA 1VFBA 5IB1A 5IBUB 4FZEH 3ARFC 5DJCB 4PV9B 2F53E 4CA4A 1TO5A 4R83A 3RNKA 2ZJSL 1JPEA 2MH4A 1P5UC 4KHTL 1NMCC 4UNTA 3N1GC 35C8H 2EKJA 1FNEA 3KNBB 1JVKA 2YD0A 2UY7A 2WP3T 4JO2H 1EJOL 3KPRB 1KB9J 1M71B 3JTSB 5E6YA 4NPYB 3I9IA 5IJKA 1O75A 3RY5A 4JM2D 1T4KB 3C09B 3W9DA 1JGDB 4JRYD 5HJ3B 1NSNH 2WJ5A 5GRJL 5BZZA 3D0LB 4KXDA 2WYIA 5I1GL 4QJ5B 3DI2B 4WJ5A 4DTGL 4TRPH 4WY7L 3O41B 3NIGB 1NKGA 5IREA 2AMGA 1N67A 3N2JA 1BFSA 2AEWA 3N5AA 4I48B 2W07B 1L5GB 2QFRA 1CDBA 1KJ2A 3D2UA 3AS1A 5AW5B 4JFTA 2MCPL 1Q9LB 5D1ZB 1NAMA 5IY5B 3MRCB 4H88H 3T0AA 3DRQA 1BZ7A 2FWOB 3LXUX 5ICYB 3NH7H 4MX7B 5FCUH 4B5EA 1WAAF 3PGDA 4HLZH 5DQ9A 2AEIT 2D7OA 2PN5A 4OI9A 2D31B 3ZDXE 3GLAA 5HHMB 3D3VB 1EXUB 1U8IB 4X5WA 3ARQA 3BPCB 4JK0D 2F0CA 4I4WB 4Q6IA 4I0PA 4IS6B 4Z18A 1RJZA 1A21A 3DPBA 4N25A 2DM2A 4H20L 4NN6B 1LL1A 1DUYB 5C0IA 4D9QE 1TQTA 4Z7QF 3UBHA 3D0VA 5BUGA 4L5FE 4FQXD 5SV3A 4PJ7F 4KDWA 4L4VE 1MFDH 3QZWA 4FQ1L 4YSTA 3SODB 1IC4H 4DP9X 4BZ1H 2Q7YB 1BHGA 2ZAGA 4NKDA 2PXYC 3FT3A 1B90A 4G42A 4F8PA 1YEIH 1XR8A 3P0YH 5KBNC 2XWTA 4NWUH 4XVOA 2M8XA