3AACA

Small heat shock protein hsp14.0 with the mutations of i120f and i122f in the form ii crystal
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
123
structure length
123
Chain Sequence
MYYLGKELQKRSEELSRGFYELVYPPVDMYEEGGYLVVVADLAGFNKEKIKARVSGQNELIIEAEREITEPGVKYLTQRPKYVRKVIRLPYNVAKDAEISGKYENGVLTIRIPIAGTSVFKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dimer structure and conformational variability in the N-terminal region of an archaeal small heat shock protein, StHsp14.0
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Chaperone
molecule keywords Putative uncharacterized protein ST1653
total genus 23
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aacA00
2RH0A 4YLCA 4MJHA 3IGFA 4JUSA 1RL1A 2KMWA 3EUDA 2XCMC 3N3EA 2N0KA 3L1GA 2Y1YA 3L1EA 2MNWA 3QORD 2BOLA 1WGVA 4M5TA 3J07A 5DS2A 1SHSA 4PBDA 2Y1ZA 3GT6A 3W1ZA 4YDZA 1GMEA 3QORB 4ZJ9A 2WJ5A 2CR0A 3Q9QA 4I88A 3AABA 2WJ7A 5DS1A 3VQLA 3VQMA 5LUMA 3GLAA 3QORA 2CG9X 4RZKA 2N3JA 4PCKA 4ELDA 3GUFA 4YLBA 4JUTA 4YL9A 2K8QA 3AACA 4YE0A 2O30A 2KLRA 2Y22A 4M5SA 1WH0A 3L1FA 3Q9PA 1EJFA 3QORC 1WFIA 1X5MA 2JKIS 4FEIA
chains in the Genus database with same CATH superfamily
2IH1B 3VXME 5GGSY 3PHOA 4DO6A 4Z3EA 4FP8H 4KDVA 3MRLB 2VXQL 4J1UB 2SODB 3QUYD 3K6OA 3HZKA 1CF1A 1JK9B 4HMDA 1UXSB 4X98B 1XR9A 2OJEB 4X2UA 3I6SA 1MCOL 4UZGA 4IIZA 1P7KA 2X6VA 2J5WA 1M6OA 1MRCL 3KJ4C 2YKLL 3V9CA 1J18A 2O93L 3ULVH 3D05A 4F9LC 3FL7A 3FNKA 4NN7B 2WUCL 3F12A 4ODUA 2ZJSL 5INDB 3NRQA 4XBGB 4JFSA 5IF0A 1FVDA 5I82A 1CVRA 3F85A 1EZUA 4M1DL 2R7EB 4IK7A 5EZJB 4UT9A 2DJSA 2WD0A 3QUML 2FX7L 3MUZ1 1SMDA 1VIWA 1EGJH 1EERB 1CLOH 1TITA 2IFFH 5HP5A 3QDMA 3OKEA 4PM1A 2EDHA 5GGSA 3V0EA 3D6GA 4MAUL 4F3FB 2XG5A 1XXFC 5BS0E 3HA0A 4UQ3B 3CVHA 5I1JH 1QKZH 3VQLA 2CCLA 5BO1L 2FJSA 3ZL4H 4MNGB 2G3XA 3UADA 2VDML 3U1SH 5C2BL 3VGBA 1N70A 3DRQA 2FQEA 3EFDH 1E30A 2HH0H 4X42A 5F7BA 5ACZA 4YPJA 3NSXA 1IO4C 2WLKA 4ZNEE 4XNZB 3DSNA 1K6QH 1BAGA 4WK4B 3TPUA 5JHAA 3SE3C 4LOUC 1JHLL 3REVB 4NRYB 2OZ4L 3QB7C 4ADGA 1MVFA 1OM9A 3GMRA 4FXGA 4HD9A 4NO0A 2UV3A 3HB3D 2CE6A 3NZHL 3QVAA 1E6JL 5DC2A 3QORA 1KV3A 2P44B 1LP9F 1TCRB 3E3QC 3QDGA 4TNVF 2D0GA 4XTRC 4OT1L 3ML8A 2X3BA 4JPSA 4Z7VF 2VQ4A 2CXGA 1S8DB 4MDJB 1EV2E 3S34L 4PJ9A 4FG6D 1P4IL 4R4BA 4DN3L 4YZWA 2YBRA 3C60A 3MLRL 1OWWA 3TWCL 1NAMA 3K8LA 4WJKB 4U1JB 2LTQB 2WMPA 1QA9B 3ULUD 1VKXB 3H9SE 4LL9A 1HL8A 3DVIA 1EJOL 2OTUB 2XWCA 2HX8A 2MSPA 4PJ5D 4U1SA 4ETYA 4E9SA 3QUXC 4LOUD 2V7HB 3ORJA 4WU5A 3BYYA 4O2CA 1AS8A 2DL9A 2APVA 4PJIF 5LNEA 3QISA 2C4FU 2GJ6B 4ZX4A 1VZIA 2R2EB 3BSZL 3OPZL 1RZQA 2WP3T 3TZVC 5E1GA 5C09A 3IS1X 3IAPA 3VWKB 3O3UN 4PJCB 2MCPL 1PZCA 5K9QI 5CZKA 1B6DA 2CPUA 1DVFA 1JRHL 1NCAH 1J5DA 3ARED 4PGBB 4GFTB 3AGVA 1YEIL 4NQQA 4DTGL 1EVUA 3SDAB 3EXLA 3GLAA 3BUPA 1NCWL 3PXJA 4TLSA 3OPUA 2MQGA 2KPWA 2AZUA 5JZ7C 4WU7A 2QKSA 1YUHB 4H1LH 2VDQB 3VXSD 5JZ7D 4S0HA 4PIBA 3KPRA 1F18A 3MLSL 3QQDB 1MJUL 3N1FC 5CS7A 4XN9A 4WDIB 4Y1AE 1KLGA 1S5HB 1AS7A 3D5OF 2V33A 4P2QA 3ZDXF 3CDGB 1JDDA 1SEQL 3CN3A 4AV5A 1WF5A 2LT9A 2FWSA 1IB5A 3D07A 2Y3AA 4HWEL 5C07A 1CFQA 3VX1A 5AW9B 2VZ1A 2VXUL 1NGYA 3PP3K 2ZOLA 5CZRA 2VXTH 1OP4A 4HP5A 1ONQB 1M7UA 4A38A 1EAPA 4P48A 3KDPB 2O5XH 2LGNA 4IMLB 3RDTC 4OLXL 5F6HI 2WZ6A 2QELA 2ZQKA 4FQHB 1I85C 2JCCB 3WIHH 4LCVA 3MNZA 2GSIB 2ZWNA 3QYMA 1Z32X 2IPTL 2V9RA 3S35L 1JV5B 3BPOC 4JFZH 4CNIA 2VSKB 3MO1A 3O2DL 4HUVA 2HKHH 4NBZB 1RUMH 4PVMA 2D3JA 4IU3A 1MW1A 1AQ8A 4WJ5A 1A6UL 4Z77A 3T0XA 3STLB 2RAMA 1IAOA 1FZMB 1KPVA 3AY4C 3PAZA 1FP5A 5EF3A 4L9LC 4TNWF 5C71A 2A4EA 4K4KA 2A6DA 4K3HA 1P4LB 1E27B 3GXPA 2LU4A 5E9DB 5KYUB 2Q1EA 1V3LA 4Z78B 3ZIMA 3ZE0E 4A63A 2X10A 1UT1A 5KAQF 4JVWA 5HHQA 5ICZA 1OAXH 1VPOL 5K9JL 3PWVB 4LMQE 4O00A 4HWBA 5I8EA 4JDTL 4OZGE 5EBMA 1YNTB 2V9QA 3IDIB 1A9BA 3RDJA 3D2UD 2VDQH 1A64A 1FNLA 1FFRA 1G4MA 1T0MA 1NDMA 1WIOA 1HKFA 5GS2H 2V7NB 3QK0A 2JI1A 3W2DH 5KSVA 4JFUA 1GAFL 4LLAA 4U1SB 4APXA 3MNMA 4M7JH 1UKTA 2VDNB 1FLRL 5MEPB 4AQ1C 2J43A 4I3GA 3WSQH 5ES4B 1I9IH 2Y1VA 3KD4A 1IM9B 4PPTA 4I0KA 5CJXA 1ZKAA 3RBGA 1W80A 5E8PB 4NUPA 5D8JH 3RA7H 3MXWL 4NDMA 5KSUB 1A6ZA 2K9FB 2X4PA 3IWVA 3W82A 2VMEA 2ZSWB 2BVUA 2NXZC 3VXQB 1B6UA 5D7SH 2DMKA 3L4YA 2OJZL 3DIVA 1LJMA 4KX9A 2IANB 4Z7VA 2EJ1A 2M83A 2YMXH 4AYBA 3QRGH 2X2YA 5E6SB 5E99L 2R23B 3KBPA 2A9MH 4HUXB 3L7EA 1Q72L 3BE1H 4HS8H 4KDTC 4ODHH 1IBGH 2X6CA 4JANB 3KHQA 1JXDA 2ZPKL 2QZ5A 1S7WA 5DJAB 3AS1A 5FYKU 5CAYB 1NZRA 3UPRB 1SZNA 1AANA 2X4QB 5B1CA 4BHUA 3CX2A 2NRDA 3JTSB 2B5IB 4X98A 5AW4B 4EDWH 4MCYB 3NESA 1Z5LB 2Y06L 4K8RD 1OB1A 4MB1A 3CHPA 5D7LE 1CGYA 2G2PA 5EOCH 3BPOB 4XC1H 3SCMD 3QFJB 3TIEB 1KACB 1XT5A 2HLAA 2PTTA 3GYRA 1SXNA 4TNGA 4BK8A 2BO0A 3UBXI 4GG6A 4GUCA 1FCGA 1CE6A 5T3ZL 3T65A 1UWGH 2JQZA 2LFGA 3HE6A 1GKEA 4HC1L 5J8OA 1MI5E 4JHUA 4Y4KB 3DUHA 5ITBH 3VI3E 3B2XA 3QJHA 2EQDA 2LVCA 2ADGA 5TE6L 1ZV5A 5DT1L 2AEQL 4YHOH 1CG9A 2D7MA 1PAZA 5L8JB 3D48R 2RIKA 2WLNA 4N6QA 4PV9B 5JHDB 2L7UA 2W0LA 2BHYA 1JNNH 1AO7D 1XEDA 5B8CC 4Y4FC 1DANU 1ZHNA 5BUAA 1N6QL 2Y6SC 3MLTA 3PPSA 2IDFA 2FUQA 4XMUA 2WN3A 2J21A 1SY6L 3BEWB 4U05A 2YA2A 2X1XR 5I15H 4KGLA 1ZT1A 5DS8A 1G6RH 1N3NA 4D3CH 2A0LD 1U91A 1ZRUA 5E03A 3VFVA 4AQAA 4JK0D 3P2TA 4TNFA 4NC0B 1J8HD 3RWEB 3U7WL 3MC0A 2X89D 1QFWL 5SX5K 3V0WH 1JZ2A 4GW1A 5D1XB 4A55A 3QWOA 4E0RB 4LCCA 3TJHC 1VA9A 4HAGA 2W60B 1LK2A 4IBUA 1T22A 3MR9B 4OCMC 5FYKL 3NCCB 4IDLA 1EGJA 1OQOA 2DN7A 2DQEH 4PJHA 3RUGE 2QPFA 3QXDB 4D7BA 2Y06H 1WO2A 4CGUB 4DGVL 2O26U 3V5DB 3UGXA 1VGKB 4G70B 4DFIA 1N12A 3JV6A 3OAUH 3AT9A 2Z4QA 4HQQL 1AKJD 4JM2A 3VWJA 1MOEA 3GBNL 4GLRI 2J8HA 1G9NL 3BUDA 3QWRD 3D52A 3DX6A 1ZK9A 4LASH 5B7FA 1DJWA 1MNUH 4E9LA 1DVUA 1AGEB 3VM7A 2ZWZA 5IW1B 3S4SB 3BZEB 3QIBB 5DZPA 4GOSA 4HAFA 5E8OB 3FQRA 1RJZB 3ZDYB 1RJLA 3GUTA 4JN2B 4F9PC 1H5BB 3PUUA 1YNKH 2J2ZB 2RD0A 4NYLA 12E8H 4H8VA 4P46C 2D2OA 4TUJB 3WJJA 4DVRL 3TEUA 1NGZA 3L95B 2K7QA 3GMRB 4FXGB 4KZ0A 3T2QA 1BHGA 2VR7A 3WHE1 5BJTA 2BVEA 3L13A 4JM0A 2Z8RA 3BWUC 3GQFA 1CIUA 3WNMA 5B3JF 3EH4B 3VFOA 4H2AA 3B6SB 2GJZB 2GBUA 1OARH 5D9SB 3VFUA 1W91A 1YHPA 2F61A 1EO5A 4JFHD 3RTQC 4KC3B 4LSPH 5BV7C 2K7PA 5HYJA 3LHPL 5D5ME 1PF3A 2GHWB 4GAGH 2HRLA 4P2OA 1TVHB 1WFNA 3HRZC 2WCGA 5D72L 2A7BA 3A4DA 2Q6WB 1A4AA 3O81A 4DQOH 1AZCA 3F3HA 4CVZB 4OAWA 3APFA 1BVZA 3K81A 4XNUL 4QIRA 4JPKL 2FZ3A 1R3JA 3QS2A 1YMMD 1A65A 1WZKA 1S7QA 3P40A 4LCUA 3WY2A 1QLFB 5E8EA 1NGPL 4BFIB 2EO7A 4PRAB 1ZANH 4PJ9C 4XOBA 5CBEA 2J5LB 1J11A 3MJ9A 2CAKA 3IFPA 3I02B 3V4VL 1YYLL 1DVXA 4BHUI 4Z7OF 5JPMA 1N8ZA 1T66C 3VMNA 1U3NA 5FFLA 1MFCH 5E2WL 1QI3A 4PWFA 4WFEE 3TV3L 3VWKC 5EF1A 3K1KC 1KGUA 1KJ2H 1XZ0A 4LEXH 4RVBA 2FQGA 4WGWB 4X9FA 5DJDB 3FTUA 4X7SH 2L3BA 2C34A 1WEJH 2E7HA 1ACCA 1OTSD 3ZPDA 3NZSA 4J1UA 1PIFA 2Z7WA 1HI6A 1KF9B 3MCLH 1ED3A 4JFYA 4P23D 3U9UB 1CFTB 3EG9B 4WWID 4IMKC 3C60D 4MWFA 3HC4L 1KBWA 3IMVA 4YDVA 5D96C 1T3FA 4GI9A 3ULVL 2ATKA 3DJRA 4OIIL 3H1ZA 3MHZA 4P57A 5JO5A 1AKPA 1P4LA 2YA0A 3GMOB 5DJYB 3RGVB 1KJMA 3MRCB 1ADQH 5K9OB 5J7CC 4XBGA 1IGJA 1F3JA 3N85H 1X9UA 3ZHKA 4OI8A 5C8JA 4Z8FH 1QSEB 3ZQ9A 1YNTF 4ONOA 5J6GB 3WJMA 3UACA 3CBKB 4FFYA 1ZGLP 1RZGB 2FGZA 2YPLD 2FSEB 5DYFA 3US9A 4UAHA 1MH5A 1CR9H 3D3VE 3AS0A 4N6RB 4ONHB 3IDIA 4GP4B 3TLRA 5JQIB 4R0LA 4NHUA 4P3CL 1DJIA 2YN5A 2XWRA 3F6LA 4YSEA 3DO7B 2Z8WC 4WW2C 3AQDA 4HUVB 2AANA 2N1KA 4H8PA 5AL8A 4UWQB 1DBMH 1PY0A 5DEGB 3KJ6L 3SGKA 3MNZB 2HFFB 4YE4L 1OM3H 1E9OA 3ZT6A 2Z34A 1AZBA 3CPLA 4X7DC 4N2OA 4HS3A 3ECBA 4TQIA 1GYAA 2HFGH 1RZFH 2FQDA 2NW2A 5HHMD 4BINA 1AD0A 1NBVH 2F53D 1AGBB 2EDTA 3DIFB 4KMLB 4FA8A 3SDXE 25C8L 4IJ3C 4OUUB 5D7IA 1Q38A 4AMKL 1YN6A 4UIMA 1FN4B 4TNVK 3SY0B 2E8ZA 3AQYA 4ZMZA 3TURA 2QHLA 3QRFM 4LNVA 1A6VH 4Q9RH 4AXWA 3LN5B 2WLMA 3RG1C 5KSBF 4U49A 1AGDB 1B2WL 1DTUA 5CLWA 4YDLC 1F6LL 3S48A 3FB8A 1SBSL 3OAZK 5FF6B 2J57A 4DEPB 3QH3A 3FUNA 3N1GC 1C8QA 3NFPA 4M7ZC 4XAKD 2Q8AH 4Z7NB 1DE4B 1E5YA 5FYJH 3L17A 3DETD 5AQ0A 1A22B 4HJGB 1HHJB 1KTLB 2WXJA 1VZHA 4JPWL 4GUOA 2JJWA 1V3JA 2G9HB 2F6AA 2NDFA 3ATDA 2VL5A 5SWSA 3EFOA 4DZ8B 5BRQA 1BQSA 1F1DA 3GI8H 5AW1B 3HC2A 3W0WA 3LXCA 1G7JA 2AK4B 2V5YA 2X7LB 2HG0A 2HLFD 3FXIC 3HE6B 5DS8B 3V2AR 2VQ1A 1T5XA 4Q0XH 1CJYA 1JHTA 5EUKA 1L7TH 4HF5H 1N5YL 3DUUB 3IS0X 2HRPL 2QQNL 1U3HB 4IOFC 5I18H 1NMBL 2I60H 3KPQA 3ZE2B 4AENA 1IT9L 4KVCH 3MRQB 3D9AH 3GSUA 3PAVA 4BA0A 1UXMA 3N43F 3IRPX 2F5BL 1AP2B 1EUUA 2VXSL 4W9KC 5BZXA 4BWWA 4DQAA 1UOKA 1I8AA 4XMWA 4Y16A 5L2KD 5FA3A 4ANKA 3BKCH 4XMVA 4M8RA 2EE2A 1ETJA 4DGYL 5CCKH 4L18A 1NFDE 3SQBA 4QNPE 3L5IA 1ZHLB 2HT4C 1HXKA 2PW1B 4N85A 3BAEH 3ZE0F 2KZWA 2C1OB 5FYLH 4EBQH 2R4RL 1NCNA 2MQ0A 4CAGA 5T1MA 3U9UA 1X9LA 1J0IA 1JYXA 4S1DC 2CJTA 2H2SC 2XWBA 5ID0A 1XH2A 4NFDA 3IJ7A 4BEIA 4WJG3 3M1BB 3NFSL 1F90L 3EGDA 4J2QA 3TIEA 4XCFL 4AC2A 4IYKA 1N0LB 1YPZE 2I9TB 3Q05A 2H6OA 4GQZA 3U82B 1INQB 1AGFA 4XOEA 2GI0A 5KSUA 2JXMA 1HIMH 1EJ8A 1VFBA 1YJDL 1OF2A 1CYXA 1OEZW 2W88A 3FC8A 4MD0A 1FGNL 3RDTA 5K1VA 3O4LE 1AHWC 3P3UA 2E7BA 3IDMB 3LZFL 3RPBA 3G6AB 4AVHA 5L0QC 2Z4QB 3TT3H 2HTLD 2JKWA 1BQHA 3RY6A 4K8RC 2KMWA 5KS9B 2XQ0A 4AZUA 2Z3FA 3HI6H 5AW6B 4C56B 4TV3A 5MENE 4X8GA 1ZHKB 1N26A 5CFAA 2B1OA 3NP3A 4I0PB 1XGUA 2UXTA 3ELAT 1TLMA 3OKEB 3GSVB 5I19H 5E8OA 2X6UA 3H9ZA 4MJJA 5J6HA 1BAFL 4R90L 5C7XL 2YA1A 2D03L 1TTAA 4BDVB 2QR0A 2EIBA 3CHQA 5A43C 3GXDA 2BNQB 4CJ0A 3GXIA 2FO1A 2X87A 1NANH 3DRQB 2BNRA 5BZWB 1L9QA 2NNAA 2VW7A 5KSBA 4Q74A 4DK6A 4PLNC 4F9PA 1UB6A 1HVXA 2W81C 2WQUA 5HYIA 3V4UH 4QRBA 3RFZB 1ZVSB 1LE5A 2RQ8A 1NLBH 4XX1G 2COQA 2OI9B 4Z0XA 4ZX5A 1GKOA 2IOIA 2QKIA 1MCKA 3CVCA 3FQ2A 2Y23A 4PS3A 2EDMA 5KS9E 4PJ8D 4Y1TA 1M7IA 2E74C 5CIPH 1D7DA 1KGCD 5ISZB 2VE6B 2AEPL 3WFBH 2EYSB 3SOBL 3Q9PA 2WP3O 1MCCA 5MP6L 1XGQA 3U48A 3EXJA 1HHJA 2LOEA 5C0DB 2AJSH 5AVQB 4E9VA 5IQOA 3UTTD 1DUYA 2G3ZA 1CFSB 4CMHB 4A7GA 2EVHA 4IHOA 3LKRB 5IB1A 1B0RA 5G5DA 3K6IA 2Q3AA 2VDLH 3F7LA 4AYEC 1BFOA 3T77A 4XCCL 3NTCH 3TT3L 1NGWB 1GS7A 2NNFA 4BQCA 5I6XB 4NRZA 4TLTA 1RZKH 4YPGB 4YHPA 4K94C 1QX1A 2HVJB 3WG7B 3C6LA 4BA8A 5LJYH 3CK0H 5DR5L 3PGDA 5C0RH 3O6LL 1L9RA 1EK3A 2ZP8A 4CRPA 1N67A 5DFVC 1A7QH 3OSKA 1NFDB 1SEBA 2OA9A 5K39A 4AM0B 1AY1L 2H0PA 2V9UA 3AAZA 4JLRA 1R19A 1P7QB 5GGTH 5KBMA 2ATKB 1CGSH 4NWTL 1M6UA 2BP5M 1KGJA 1NQBA 5JO5B 3JWOL 3JZYA 1W72L 3K2UL 1XH3A 1OTUC 3HNSH 4LSRH 4OZHF 4PJAA 1BEYL 5B22A 2NYKA 3DXAB 1GTFA 4LOFA 3EO9L 2VLKB 4WO4A 1TZ8A 2WTRB 1OCCB 3ZHLA 1U92B 1XF3A 1XB8A 1RZGA 3JZ7A 2ARJB 1PZSA 1R33A 4MB3A 2K0RA 3MBXH 4M3HA 4NKOB 4U6XB 1G9ML 4DKDC 4YDMA 4AUJA 4J4PD 1N8ZB 3ALWA 4HIHB 4YAQB 4ADIA 5HHOE 1T1WA 4AL8L 2GKIA 4P5TC 1QTSA 1XGRB 5E8DL 5IW6B 4ELMA 2X88A 5MHSD 3UTSA 4G8AC 4G5ZH 5SWQA 4PBXA 2Y1YA 2QGEA 4KI5E 5LGHH 2CLVA 1NWPA 4JZNA 1PPIA 5AUMB 3JUYA 4E42B 4IGBB 2JKXA 3H4FA 1VF5C 2WXLA 4E9YA 5E00A 1MW0A 1XSJA 1R5VA 3QZOA 1IU1A 2WVSA 4BZ1A 4PJFE 4X6EB 5TE7H 3CLEL 4Z5RA 4J8RA 4P23C 1J9RA 5KSBB 1J5CA 5JPMB 3BO8A 2ODIA 4M7LL 4J39A 3H6JA 5FM4A 1KDIA 3GLDA 5I76B 4NPKA 1KEML 4JG1H 1JE6A 3Q1SL 1NLDH 5PCYA 1MCRA 3HPLA 4YXLL 1U8JB 3L3OC 2P47B 5A3IC 4AT6B 4G6FB 5GQBA 3VXOB 4UTBL 2Z0UA 3Q13A 4LVOB 3GO1H 4Z78A 2I07B 1USZA 4I9WE 3QIWB 1GGCH 3GSNH 4F1SA 2ADYA 1IKNC 5DZLA 3OR7B 1QBLL 1SM3H 1IGIH 2E59A 2C8NA 4PVBA 3FQNB 3BPLC 3QQNA 2AXJA 1GMIA 1TDQA 3GZKA 1Z0NA 5LXGH 3B1UA 1IC1A 4WI5A 3JT0A 5I16B 8CGTA 3EYOA 4HLJA 1LEKB 2XPZA 4CC1A 3ULAB 2YK1H 1ECZA 4L8DB 4DO4A 3D85B 3KVPA 1RJYA 4BKTC 4I18B 1P1ZB 5FYJD 4EO5A 3JVFC 2VAJA 4HH8A 1D5MA 3NJLA 4NQSB 4PN6A 1HK6A 2QEJA 2BS9A 1Q94A 4JO1L 4HPYH 1FH5H 3NRFA 4AXWB 1JJUA 3O8XC 3S2CA 4APQA 2FJGB 3BH9B 4P3DA 3L2LA 1SEBB 1SXSA 1ZTXH 2TRHA 3ULVE 5GZOC 2CM5A 3C6SB 4M6NH 3RTQA 4MS8C 1JZDC 3OWEA 2PPCA 3ARWA 3P9MB 3WLWC 3VSTA 1DQQB 4ZFZB 3QCUL 4EQ3A 4G8EB 3PXHA 3ZOAA 4DKAA 4HZLB 2H3NB 4P2RA 2JB6B 3CPLB 2NZ1A 3TV8A 2JI3A 5FW7A 2BRRH 2W59A 2ZOWA 4ZUSA 1JSYA 3T4AB 1JPFA 2B1HH 4LPVA 5B39G 5LXVA 4Y2OB 3TIDA 3CZNA 2HJLB 4HUUA 1DJYA 4JG0L 4XXDB 2D7TL 4YR6B 1B4TA 2Q20A 3IU3B 3DROA 3ABGA 3OKOB 1NCUA 2HVKA 2QVTA 2HT3C 4LCCB 3TO4C 2ZCHL 3ARBC 3CNKA 3PCYA 2N1TE 4FKEA 4Y19D 3V6OE 2LU7A 2D8KA 3BGAA 4BKLA 2Q8BL 4DKFL 4MNHB 1V5JA 2HMID 4JQIH 2AQ1A 1A4JB 2DKMA 2YR3A 2OMUB 4JM2F 5EIQA 4EXKA 4KHXL 1AXSA 5F88A 5AW5B 2EILB 3L4ZA 4I0PA 3O3EA 3QR1A 1CT8B 5JDSA 4KHTH 4D9RD 2F54A 1JDAA 1BBJA 4WFGD 3KLQA 5ELIA 1XCXA 2PWGA 3HNTH 3G6DH 3VFNB 2F68X 4OLWL 4XCNB 1TR7A 2FB4L 3X3GL 5HYJD 1J1OH 5KUMA 2F9BT 5D1QC 2V8MA 4IKIA 5DC4B 5C6WH 1KEGL 4HIJB 3T6WA 1J1XH 3MBEC 1CQKA 4Z8FL 3S37H 1FG2B 1ZTXE 2XU9A 1L0XA 1HXYB 4OCSH 5DQ9A 1CU4L 3GNMH 1SHMA 3T0AA 3MNDA 3OL2A 4YHNB 3S88L 3TT1L 4X4YB 2WBJD 1YMMA 5AKVA 4W9ZA 1QPPA 4PJDB 3V0AC 3N44B 1J12A 4Z3GA 2Y1AA 3AU0A 3OKLA 1MCPL 5DVNA 1M4KA 1UOWA 5E8NB 2YQ3A 3JWNG 3BUYB 4RWYL 4AGNA 1ND0B 3PFQA 4LNRA 4M7LT 4CADB 1TZOA 3E7JA 4EPSA 5AVVB 4UDTB 1Y07A 2B0SH 3T4YB 3M17A 5I1HL 2HFGL 1U3JA 2NTFB 4K23H 1W9XA 3LZQA 2VC2B 4OCXL 2GY7B 3BPNC 2W07B 4EJ1C 1S6NA 2XXFA 4LDOB 1DZBA 4QHNB 1G7MA 5DHVB 5MEOB 1DR9A 3KXFD 5F6IB 5JMRA 4MZIA 3GHEL 5DEJA 2DKSA 4YXKL 1N0LA 2I32A 3G5YA 4TUUA 5IUSA 4NZTL 2DOCA 2A73B 4R0LC 1MZYA 5J12C 1QEXA 5D6DC 1TTRA 2XN9A 4MCZA 4R26L 5AW8B 2VLRD 4U3SA 2WK2A 2FLBT 4Q6IC 2X4NB 5CMAB 2IQ9L 3EUUA 2OZNA 1BQLH 2WWMD 2Z9TA 2NY0D 2FO4B 4Y2DC 1Y1DA 1IGYA 4DZBA 1NMCB 4OFPA 1P7QA 2IALA 5BRZD 4YAQA 1A6AA 2ZG3A 3ISRA 5HDOA 4XMLL 2PWDA 1XZ0B 1WZ1L 5C07E 1KN4H 3SE4A 1R34A 1R1CA 5IREA 1RK0B 3DK2A 3UC0L 1MFAL 1PKQB 3VI3B 3HI5L 4A6YB 4Z3IA 1NAMH 1FA4A 1J8RA 2L04A 1KWGA 3DX4A 2APTA 1ZLVH 4I1PA 1MI5B 3N9GH 5DUPH 5C0BD 1A5FL 3CD4A 3PJNA 5F9OL 1A7OL 3KPSB 4L5FL 3TPKA 2P28B 1T5XB 5J0BA 3WS3A 3RVVD 5CR8A 1A02N 3B34A 1TQCB 1F86A 2YPVA 3R0NA 1UKQA 2NY1B 3H2PA 2DWDB 3DETC 4MQXD 5GZND 5IWLC 3DUSB 5D1QB 2VXSH 5TH2B 3ZSTA 3E9TA 4X6BA 4MQTB 5GZOA 1W8EA 3CDZA 4N1EA 3SDCB 3QDGD 2C3GA 1LNUA 4KI5D 4DAGH 2G9KA 5DYOA 3ARQA 2J1WA 3BWUF 4MBOA 2RBLA 4P49A 2DI7A 2VE6A 1IEAA 2C5DC 3EYUL 5GRWA 6TAAA 4OZHA 2F0CA 1N59B 3O3BA 3GXUB 3ARGA 4UT6A 5EC1A 3PHOB 2XKSA 4OV5A 4P5TD 1SN2A 3RURA 1WBXA 1CL7H 2JNZA 4GFXA 4RIRA 3NDZE 2WBWB 4M6MH 4W9JC 5SX4H 2W9EH 3BXNB 3LQZA 4R96B 4CBZA 4U3HA 4ATWA 3FSWA 5EO1B 3CX5J 1GPOH 3JVGC 5JHMA 3SYQA 4UUJA 3AM8A 3LNGA 4FQ1H 3KH4A 3SCMC 2GCYA 2PO6A 1T89C 3MRCA 1DVFB 4GSDH 3KNBB 1TTCA 3AY4A 3QWOB 1ONQA 4PGBA 1MRDL 5ENWA 3SE9L 4AIEA 1NCCH 2ZXEB 4JPVH 1JBJA 2IDTA 1PX8A 2JLLA 4IRJB 5IBTH 3U79A 1GXEA 1U8QB 2X4OB 3M8OH 1RUKL 4Y16D 4QCIA 2JF1A 3V5DA 1QYGH 2NT0A 1ZVYA 1TENA 3K8MA 1C9SA 1F11B 1CFNB 1BOYA 2C1PA 2WINB 4JKPH 2QPEB 4W93A 2YEQA 2F2HA 3HHSA 2EUXA 4M4PA 1QFUH 3UTZB 5C0GB 3UL4A 5EU3B 1T03L 4OSUL 1DQJA 5JR1H 4L9LA 4ABQA 4O2EA 4WFFE 4HDIB 1N7MH 3B83A 1B3IA 4LSTH 4FKKA 5ICXA 1UA7A 4RRPM 4F8OA 3AGWA 2IFGA 2ILLA 3BI9X 3WTTA 2VDPL 1TOXA 4KTEH 4P04A 5E1AA 1RSYA 3BC9A 1FPTL 1IZKA 1U8KB 2FD6L 2B16A 2AITA 2J4WH 4RBPH 2Z64C 2H8PA 4UOW1 5AUMA 1XAUA 3FUHA 3QNXA 4ORZC 2GYSA 5CZXD 5H37G 1U8MB 1RZJC 4PRPE 2ZXQA 3QP3A 2FATL 2VZOA 1EQWA 3HLKA 4C54A 4U1JA 1PLCA 4PS4H 4Y9CA 4L1HA 2DQIH 1ECYA 2ALAA 3Q8BA 4U7MA 3QJXA 3UTSD 2OMYB 4ELKB 4M48H 2BRQA 4UILL 5BRPA 5EA0H 2UZYA 4JY6A 3UZVA 5CP3A 1B4JL 2IDSA 2H0JA 3MROA 3EGDB 1BXVA 2HJFB 4RCAA 1ZJAA 5AWNH 3D33A 1FCCA 3FO2A 1MREH 2ZWLT 3CK0L 3IBEA 4YEFA 1FI8C 4G6KH 4FG6C 5HHPB 3NCJH 2X70B 5CJQH 1OP5H 4QOKB 4N8PA 3D30A 1MHCA 3OJVC 3ZYOA 2L7JA 1PW3A 3V6ZB 2DTSA 3INOA 2XJLA 3QZPA 3VXPB 2QQNH 1TQBC 43CAB 4TQEH 1GZQB 2UZIH 4M62L 1Z7JA 2DS4A 2A9NL 5FCSH 1WTLA 2H26B 1HILB 5KVEE 3O8XB 3ZE2F 2EDBA 2ICWI 3CPUA 4NI3A 1OWRM 1PDKA 2GIXA 3V95A 4NJ9L 1NPJA 3POHA 1MUJA 4PJCE 5EDXA 3UJIH 3VXNA 3VXMA 1FO0B 1GYVA 3WIHA 2OR7A 3PAUA 3TZVB 1X9QA 1HAWA 1GJUA 5DRNA 1AOZA 3IKCA 3DHPA 4JY5L 5EBLB 1CI5A 3MBXL 1QFHA 4JFEE 4ODSL 3ZTNL 4XP4H 1T66D 1COBA 2NT1A 3IT8D 5KYUA 4V1DD 1REIA 1Q1JL 3WNLA 2LAAA 4LEEA 3MCKA 3VMOA 1OE3A 3GMNA 3KDMB 4K3JL 4A1RA 3HG0A 3LKPB 4K8RL 3D51A 1KC5H 4N9OB 2EAEA 4Z7WF 4WKXA 1FV1B 1MCHA 3AU1B 5DJCB 2UYLB 3VDAA 2ZX8A 2NX5A 2WXMA 2FGWH 3IPFA 1OIOA 3WFEL 2DMBA 4XBMA 3STLA 3NEEA 2AABL 4KUCD 4F7CB 1KZYA 2LQRA 4E42A 5I1DB 1KCRL 1SNRA 3PWNA 1UOLA 4IBLT 1QUNB 4LRIC 3RWHA 5LKNA 4AMWA 1Z66A 5CEXB 1CDCA 3ARVA 1W8OA 1BFTA 4HWNA 4JFFD 3BUBA 3TFBA 5TDNA 2KDYA 3H42H 4Q8BA 2BFGA 4ZYKB 2J7LA 4NKDA 4WHCA 5FWQA 2DH3A 2R4SH 3GKWH 5ACMA 3QEQB 1W0WA 4XP1H 3BGFC 4GRMB 1FNSL 4M7KL 5FV1L 4JJHA 3MKGA 3VFVB 2WKOF 5FO8A 3J27A 1R3LA 4KTDL 1CWVA 3BYTA 3QORD 2OMUA 4X5WB 1UWFA 3ETBJ 4QOKE 1MAMH 5DJ2A 4DKEH 4XH2B 3OR6A 1X5LA 1B9KA 1D5BA 4CU7A 4DTGH 1IQWL 1SVZA 3FUIA 3ZQWA 1L4IA 2ROYA 5F0JB 5GGQH 1RZJL 1XIWB 1OD9A 4NJ9H 4B0MB 1PSKH 4JO2H 3S97C 1S7SB 2A74B 1OPGH 4H25B 3U0TA 1XBRA 1HT6A 5BZDA 4XO9A 1BEXA 4XWOC 4Y2DA 4O4YH 4JHWH 3KPRB 1IE4A 5C08D 3OJMB 3P2BA 3L2MA 5TD4A 4JJ5A 3FQUA 5CIPA 4JRLA 2VWEC 1J05A 1YEFH 3PNWA 2PYFB 1UM5H 3DGGA 3VXSA 3VDCA 5B38A 3DTUB 3TA3D 2F54D 4NJAH 4NQUA 3RNQB 2H2SD 5FKPA 1DBKL 2G2RB 3N40F 2P7TA 3R06A 5C0DA 3N42F 3LRHA 1CGWA 1KENL 5I6NA 2GHZA 2ZOLB 5HYFA 1UA6H 5F9DC 4ZJ9A 4ODVL 2TAAA 3QG6B 1INEH 2DYPD 4OLXH 3KEDA 5DRZA 4AY0A 4ZQKA 2AJUH 4XPTL 4MCZB 4CVWA 4WWKB 3CBRA 2YKLH 5I1KL 2QSCH 5C09D 4PJ6A 5EFIB 5F2FA 3GIZL 1KCWA 4CDGC 4ELMF 1HILA 4UBDD 2HRHA 4MMXC 1UB5A 2PPEA 2FIKA 2P4AB 4QHNA 3WFDL 4LRNH 2BVYA 2PP9A 1E4KA 5KTEL 3V52L 1G4RA 3D3VD 1NMCC 1K8IB 3CFQA 4HIXH 1H3VA 4KK5C 1E43A 3MLYH 2Z1PA 3MYJB 2YD0A 4YWGL 5F7UA 4HA1A 4ODWB 2OR8A 1UM4L 4Z7UF 2LLLA 4N26A 3AT0A 1V3MA 3CDFA 1A1MA 3HG3A 4NM4L 5G2NA 5CJOH 1T7ZA 3PL6D 3UP1A 1FNAA 4GW5B 4DUWA 5F3HB 1KYFA 5LHDA 3EJYD 5GS3A 4PRHA 3B9VA 1N5AB 1YMHB 4MQXC 1DJHA 2X9XA 4X5QA 3WE1A 1PCXA 2R69A 4QHUA 4WI4A 3C09B 3KPMB 3OZKA 5JIMA 1G7HB 1M2VA 4TULH 1OT4A 4LGPB 1HQRA 2UWEE 4O5LH 1EDQA 2BVOA 3T9WA 3WSQL 4OT1H 2J8UF 2PF6A 2NTSP 3ARDC 4XN7A 3GDBA 1A14H 3GSWB 1HQ4B 1UJ3B 1CL7I 3GJFH 5IW3A 1M3JA 1I1AC 3WL9A 5CHNB 1FYTB 4K3EL 3MLRH 2X1WL 2QKIC 4UTCA 3O41A 3BDXA 4JS7A 1M71B 3NABH 2YD9A 5I8CB 1T20B 5ITFA 1G7MB 5DHVA 1TJGL 4JCLA 1FF5A 3D50A 3FU9A 4OZ4B 3LQAL 2WW8A 3BZ4B 1CFQB 3PQYA 5IESH 5DD5L 3KNBA 2ZKHL 4KI1A 4M8QB 5T3XD 3SDDA 5DD3H 2VC2H 5EO9B 4F20A 2YAHA 3IPEA 4CGTA 3U2JA 2F19H 3WEXB 1T1XB 5HD8C 3X3FH 1G6RB 1NMAL 3QFGA 4KV5F 2IDQA 5IR1B 3GJFA 4J4PC 3VNZA 3E80A 3EFFB 3G6JB 3RX7A 1C7SA 4I3RH 4OF6A 1FZOB 5EV7A 4GEIA 3PHQA 4QXUL 2WYTA 1RJZA 5JHDA 3FMGL 4TN9A 1SDAB 3M07A 4AYID 3P9MA 1F3RB 5D1XC 2YWYA 3BVUA 2BZ7A 2DL2A 1KBPA 2Y2TA 3U7YH 3IRZA 1C5DB 3RAJL 2IH3A 5I30H 2QHRL 2RQEA 1LO3H 3IGAB 1KIRA 3RHWF 1NIEA 3MI6A 3O2WL 4N4YB 3RB7A 3QARA 4PW3A 4TLUA 2J1KA 3HZ3A 3BP6B 2UZXB 1XF1A 3QEUB 4G7QB 5DFVD 2HPTA 3CDCA 4OH2A 1KB5B 4KTYA 5E6RB 2QADB 1I8LA 5DK3A 3SKOA 5JA9A 4NAQA 6CGTA 3MRJB 4XB3A 2ITCA 2P24A 5I66B 2Z92A 2I7OA 3G5ZA 1NAML 3BEVB 4PRNB 4IBTA 1LYQA 2AV7A 4FI7A 3X14B 4WQOA 4DVBB 1BM7A 4PRIB 4JHAL 3BFWA 5DYOB 1JMZA 4PJHF 3U30C 2PPAA 1GY2A 4ZTPL 4BK5C 3EHBB 2MOVA 1RUQH 3HTLX 4JKWA 3LQAH 2IXQA 2D3NA 3D39E 3UJJH 3UG5A 4L1DA 1Y6KR 2H3XC 2VC2L 3S8FB 2DWDA 2X1OA 2PTTB 1U8CB 3FO0L 1IGCH 3Q2CA 4GRLA 2NSQA 4F91B 3QNZA 2O72A 3D69B 1I3RB 2IC2A 5DHYA 4S1SH 3TEXA 4BFIA 3FSVA 2RFXB 5D2LA 2LE9A 1UQSA 2KPNA 2AJYL 1E7VA 1H3TA 3O6FA 2JLPA 1TQSA 1IBYA 4ODXB 2VRAA 3L7FA 4KZEH 1NBQA 1LO5A 1R24A 4M93B 2QGCA 2DTML 5D1XE 1JZIA 4QTIH 5GISH 3MCLL 2ENYA 1XH1A 3D4ZA 2VRQA 1CLCA 1PS3A 4HEPG 2CJSA 2Y2YA 4WHTA 2O30A 5F21B 2IG2H 3GMOA 3MLWH 1IE5A 2ESVA 2P8PA 3MRGB 4PWKA 2RALA 2AKRA 3MXVL 4YDVB 4YSSA 4OQ1A 3E2HC 2X89A 3T0ED 4Y0GA 3GSXA 1A0QL 2OTWA 2VDNL 3PHSA 5I1AB 3GB7B 1XTMA 4X9HA 8PAZA 4GKSB 2P7TB 3R06B 1MH5B 5E6UB 4K2UH 1FO0A 4N1HB 1J1OL 5A3ID 1IAKB 1LD9B 2VW4A 5IB4B 3ZDXE 5DJ6B 2DQCL 4FQIH 2NZ9D 3FZUC 4S0SD 2Z8VC 1DBJH 3S0PA 3I02A 1MJ8L 1NIBA 3PWVA 3WY3A 1DBML 2ITDB 3VRLF 3KPPA 2XN9D 3LRGA 4YBLB 4B9GA 4OZFA 4GQPH 1DQTA 4GXUM 5B4MC 4PRBB 5I71C 1UADC 3HC3L 2XPGB 4A7GF 3RX9A 4M1CD 3V7AE 2WLJA 1E9QB 32C2B 1K5NB 4MHHI 3TYFB 4CN6A 3FN9A 2L4OA 1WA2X 3LKQB 2I27N 2AJZB 2CGRL 2UY7B 1JPTH 1LTXA 1ZY9A 3O0RH 4KJWC 2NY7H 4N2FA 1T0NA 3FQRB 3AT8A 2DW5A 4YUEL 2XWEA 1ZLWK 4ELKA 5EOCJ 3S7GA 2YD6A 2BSTA 2ED6A 2QV2A 1XGYL 3UROR 5KVDE 3WY4A 4HJJL 3LB6C 3SGJC 1HCVA 4JRYD 3AREC 3FTVA 3L9BA 3EF7A 1FDLH 4AYSA 2Y9RT 1SYSB 3A23A 3VXUD 3I6GB 2YUWA 3VFTA 4UV7H 5K9KA 1C12B 5F8RC 4OCWL 5HDRA 2MMXA 3MV9D 3WJLA 4Q2ZB 4P2YA 4M8VA 4KOCA 4IRSB 4XVTL 3L08A 2UYLA 3BFQG 2VJXA 5T1LB 3P4OB 3WIFA 2CO4A 1MLCB 3BT2L 1E3FA 4ISVB 3N40P 1X5YA 1MIMH 4G8GE 5TF0A 3TO2A 3CQQA 3GI8L 2Y6TE 3VXRB 1EH9A 1XGQB 3DJ9A 1PFCA 1QQDB 1UZGA 2YD7A 1J88A 3WAJA 4TQPA 2C9VA 3SPCA 2OCCB 1S9VB 4DP7X 2H1PH 1GIGH 2PP7A 5AFAA 2AJVL 1WDAA 1DLHB 4OZGB 3ZL4L 5LBVA 1ZT1B 1CD8A 4HG4J 3IPBA 1JPFB 4YDLB 3QWQB 1NCJA 3CH1A 2Z7UA 2HJLA 4YIQB 1HYRC 3MAWA 3S37X 4LCIH 2XTJC 1LE9B 3IDMA 3BLKA 2QSTA 5IVXF 3NIGF 3B56A 1JFQH 4N90D 1MFMA 1JXJA 3MCKB 3MR9A 2VSDA 3BSZA 1CICA 4N8VA 1AR1B 3U6RA 1G9NC 2EDRA 2WIIB 3V6OC 4JM2D 3VWJD 3FT3B 4IU2B 3QEGL 1V8HA 1OAKL 2MOGA 2W65A 4DGIH 4YUEH 4ANWA 1KLGB 2F8VA 4WFHD 2Y7LA 1K4CB 3CMOL 5CJBA 1CXIA 3SPIA 3QORC 2ZP0T 5T1KB 3WKPA 5IHUL 4F7MB 1NBYB 1GC1C 5KJRH 3NFNB 1ZA3A 3KEHA 3MUHL 1QWNA 3LEYL 5F9WC 5JXED 2J1ZA 1OAUH 3ZZ1A 2NNAB 3NIDF 2JMRA 4PU2A 4BM7A 2W9LA 4Z23A 2UVEA 4V11A 2YGPA 1P4BL 3FHAA 3HE7C 2MKWA 2XWTB 2E27H 4FJZA 3LNIA 4Y1AD 4NZFA 2ZONA 4LPWA 4XVUC 5GRJL 4PSPA 3BCDA 1DBBL 4GI6A 1U2HA 3EO1B 5GS0D 1XF4B 5D7KD 2YPLA 4PLOB 4DP8X 1QO3B 4NHCH 4AQOA 3JV4B 4E5XA 4KK5D 4H0LC 4N2CA 4JFOB 4D9QE 2H4EA 4FRWA 1E9QA 2M8XA 3TYFA 4EDXA 4EZJA 1PQZA 2QMKA 5K1JA 4WSGA 1YA5A 1JRHH 2OXGB 4NPYA 1I3VA 2CLVB 4AJ0A 3GTNA 3JV0A 4I88A 4WCYL 4Y9EA 1ML0A 2OMTB 4LLYA 2XTJE 4GBXD 4YFLI 4ZO9A 4WO4D 3A6OA 2X28A 2QZQA 1A4BA 1CTNA 4CMHC 1D7BA 1UFUA 1M9WA 4J3SA 3GSUB 2C7UB 5H94B 3ARFD 1F6FB 5IBUB 4Y8AA 2EH8H 4J6RL 2PUQT 4GAJH 3QQ3B 3GKZA 1N10A 1MWAH 4Z7WE 1HFUA 1I31A 4GAYA 3H9SD 1LO0H 4CSZA 3GTTA 2CKBB 2IDUA 3U9PL 5DMIL 3JWDC 1P6AB 1MG2C 1OO2A 2GJ6E 3F04A 4X4ME 4X8XA 2DB8A 3X1EA 5F7EL 1Z1WA 3T6XA 5AW0B 1Q0EA 3FN3A 1F58L 3WNKA 4LIQH 4Y5YB 1SUJA 5FKPB 3SPJA 4JKLA 3AFLA 2PTVA 2G2RA 2GPZA 2A2QT 3HN3A 2UUDH 1HOCA 3KM1A 4XCCH 1X7SA 4LDEB 2DDQL 4K3DL 4L3FA 3CQPA 1P5UC 4FZ8H 4GLRH 1CGVA 4ZX6A 4H40A 3W0WE 4JFEB 2ZXWB 1XWVA 1RZKL 2HTLC 4XP5H 3CH1B 2QQKH 1NBZB 1F3DJ 2ZAGA 5K59F 3QW9A 5AB9A 3NA4A 4WWKA 1HNFA 3FO1B 3JWDH 5TQ0L 1VSCA 1G7IA 4JDZB 1YN6B 5EULV 3AACA 2HVBA 5E6IC 1S7XB 4XCEB 3D0LA 5I1IL 3FFDA 1KIUB 3P11H 4KKLC 4POYA 2NLJA 2F8XC 1H6FA 1EAOA 1JF6A 3U6RB 4R5TA 1KXHA 4PJ8A 4UMSA 3B2VL 4YHKL 3OKYA 4GH7B 1NFKA 3ZZLA 3DMMA 1Z9NA 3EDJA 3LS4H 5FUZH 5DZJA 1ICTA 1X4XA 3IGAA 4P2AA 3W81A 3KYKL 4NXKA 1R0AH 3LMJL 5C0FB 4PI2A 2CIKB 1G0DA 1ZWIB 4OJFL 4WI6A 3ILDA 1L9OA 3BEVA 4PRNA 1DN0A 4IBYA 5HDBF 1F13A 4KJPD 5MENB 3NIFF 2A38A 3MRMB 3DXAA 4UAOC 2MCG1 1EFXA 3D69A 2JCCF 5DSCA 3QC6X 1WFUA 1ZLVK 5LLIC 4JKNA 3X17A 5TE4H 1RZFL 4HKXA 3RFZA 2IGTA 4F27A 3O4LB 1VADB 5DA4A 4X7FC 4N3TA 1JGIA 1R5WB 5ID1A 5HHXL 5B39A 2WJ5A 3ZTNH 5I8KL 4WW2F 1WWWX 3QDMD 2TSAA 4KKAC 4HBQA 4NAJA 5BZZA 2KZBA 4YQXL 1XB3A 1URZA 2G75A 4GMSH 1BECA 1HEHC 3RNKA 4G2AA 3ZTDC 3PP4L 4RDQF 3TJEH 5EEVA 1NBCA 4LRIA 2X0VA 5GRXG 2QT6A 4P5KA 3ESPA 4F7CA 3E1ZA 3APDA 1JGLL 2EICA 4GIOA 5TFSL 3BSZH 3HR5A 5FO9A 2DWEB 5GGVY 5EOTB 3POCA 1EBPA 5IT2L 4L3ED 3CIQA 3UZQA 2EP6A 4YO0A 1G0YR 2P52A 1SUHA 3VGAB 2CZNA 3PWJB 3Q2VA 4DW2H 2XKNB 2OMNA 1AAJA 4G43A 3MOAL 3ZE2E 5E6ZA 2BW4A 1IGFL 3KM2A 4U1IA 3I3DA 1ZGLM 2HRGA 5I1JL 1MSPA 3N55A 1R0AL 1FE8H 1OGTB 3LRMA 1A3LL 3DSFL 4OGXL 4QD2E 3CHOA 1NFIA 5E6IB 2AK4E 2GT9A 2ZX5A 4L4TB 4AL8C 5KS9A 4L1SA 3F7VB 1GOFA 4P9HL 1RUAH 1FVCA 3QA3A 1P9MA 5EZIL 1HOCB 5CBAA 1T83A 2VDKB 3MQIA 1IC0A 4XN4A 4O58L 1Z0MA 1C5CL 4O4YL 4Z7IA 4KJQC 3UBXG 5HPMB 3MNVA 3GJEA 3IN2A 3K5SA 1AQHA 1XQ4A 1RHHB 3F5WA 3MRFB 5BVPL 1EIBA 3KPNA 1A7RH 5EU4A 3A6CH 4ODUB 5INDA 4OZFH 2Q7AA 5KBLA 1JGUH 2BVQB 2IADA 4IOSD 3CUPB 3THML 1A7BA 4J3XA 1KN2H 4A39A 1JTOA 4FQCL 2BVPA 5DF0A 3U4BL 1BZ7B 1AFVH 1YEHH 4U31A 5KYXB 4WW1A 3FFCB 1HIML 5IMKA 2OMXB 3OJ2C 4E36A 2EIZA 2FLMA 4F7TB 1G87A 4M1CC 4MRCA 1HESA 3BJ91 1DLFL 4R8WH 2XA8H 2C1OA 1TVBA 4MXVF 1G7HA 2QPSA 2DD8H 2IOOA 4TSBL 1CICC 4N3UA 4XAWH 3BVTA 2E9BA 4I77L 4RBPK 2ZKWA 4OD1L 5E94B 1ODAA 1SOXA 3MLVL 5D55A 2YZ1A 5C0GA 2IAMB 1ZLUK 4PQXA 1VEOA 2XZCH 4J8RB 1KXTA 1SDDA 1R3JB 2XY1A 2I9TA 4FMVA 4FX5A 4MZRA 1U95B 5ANME 4PJ7F 2BNRD 2HN7A 2M2DA 3ASOB 3KPSE 4HETA 3I6KB 1AXSB 5F88B 3W5NA 1XF4A 3FN0L 1ZT7A 3ABMB 2GTQA 2DQTL 1YYCA 4NQCB 4U6YB 4JNXA 3LRSB 5AYUH 4NCC1 4PJ9D 4MNHA 2VDRH 5IFHH 1ZD6A 3LPFA 1CUOA 5DHVH 4YDJA 5LO7A 1TQWA 2Q2EB 5CU5A 1TZIA 1CICB 3AM8C 3AITA 1E4XL 2DWXA 1E4KC 1BMWA 1AE6L 2XTJB 4R83A 3PGFL 2FB4H 2H1LM 3WIFB 2EVIA 3WBDA 3FB8B 5FF6A 4OFYD 3LPGA 5LXGL 2HT4D 4GRLC 4WY7L 4HZ1A 4QJ3B 4RGOL 2CPCA 4PH8A 1DANT 3Q6GH 5EDSA 1GC1H 3STZB 1K4CA 2YK1L 3PWPD 3IFLL 2AQQA 3L5XL 3ML9A 4OV5B 3C5ZA 2JIXA 3GMPB 4AQEB 3QIWC 1JD9A 4HZLA 5DQDL 5MP6H 1SJEB 3PWUB 4ZXBD 1QRKA 3TONA 3DI2B 2ZE0A 3IB4A 5CP7B 3HB3C 3MLUH 3MDJA 1XDTT 2WVVA 2I5YL 5LQBL 1EJ6A 2E86A 2FSEA 4Y4KA 4TOYH 5FC9A 5ITFB 3WIHL 1M42A 3LS5L 4AKQA 3DROB 2FJGA 3BH9A 3MZGB 4P3DB 1HZKA 5I17B 5HVHB 3HS9A 4OVUA 4ZO6A 1ZCRA 1WS8A 4M6NL 4H0GA 4FLOA 1XF2B 5IFJA 5L88L 4OU3A 2WLLA 3U6XA 2BS8A 3GSNB 1C12A 1NDGA 3V7MA 3QUMH 1FZJA 4NT6A 5KVGH 1JWSB 3T5WA 2X0UA 3QWRA 3QUXB 4L4VB 2YPKB 4P2QD 5H35B 2EH7H 3EBGA 1BIHA 3U0PB 1YPZA 1UM6L 4GP5B 2P8MB 4EN3D 3SPVB 2CIKA 2YD3A 1B0RB 1AD0B 2KI6A 4APXB 4AQAB 2PR4L 2A6KA 2MHAB 3G04A 2BJMH 4BSWB 5KVMC 4OCNC 1K3IA 3ALPA 4LCWD 3FO9A 3FT1A 4KAQH 1TZHA 4XTRD 4MJHA 1JZJA 3GMMA 3UMTA 3O9WD 4HJ0C 3PF2A 4BH7B 1IKOP 2FO4A 4DZBB 3WTXA 2QVIA 2IALB 1NCBH 1D5MB 4G6JH 2GSMB 1B3JA 4PS8A 2EDWA 3NUKA 4PJCA 1J1PH 4IJ3B 3MJWA 1ADWA 1Z5YD 3MREB 5FHAL 3D18A 1PG7L 3QQ9C 4KROC 3CFIC 3PXLA 1UCBH 3H7LA 3WUZA 2VN4A 3IU4L 3OHXB 2FT6A 1NAKL 5FCUL 2WZPA 3AW5A 4XNQB 3MLXL 3S98A 1T6VN 3Q0HA 4NKMB 1BLIA 4RISL 4NN5B 1UB5B 1LP9A 5DLLA 1PKQA 2GFBA 15C8H 2X12A 1S4IA 4L8SB 1M7DB 4NZRH 2CM6A 5D2LF 3C87A 3CMGA 4X6CF 4ERSH 2HZHA 4GG6B 2APFA 4P2RE 4FFZA 1XGPB 5GRUH 4FXKA 4LLYB 4PUBH 4X83A 2ZSWA 5I1AA 4JX0A 3C5XA 4MX7A 1JMXA 3A5VA 4M4RA 4BXVA 4KRPD 4AYMC 5F7HA 1SFHA 4NLHA 5GSVA 1RP8A 2R83A 2CNZA 4JRXB 2GSIA 3T8VA 4X50A 2EYRB 2JKIS 3MV7A 4XE0A 2P8LB 3L16A 1CXFA 1JD7A 2P5WB 4IBQA 4GAYB 1SLVA 4Y8DC 1FIGH 3CZJA 3MLZL 5M94B 2KL6A 3DOIA 2WXQA 3BD3A 3LKOB 2BK8A 2BZCA 3JWNE 3WDJA 2YMTA 5E2UH 3Q7JA 4HK0B 4YGAB 4XB8A 1C1EH 3RZCB 1AC0A 4P5KB 2BP0B 4P5TA 4JZNB 1ITCA 2XWZA 3C2AH 4GY4A 1TO5A 4Y5YA 2ESVD 3UABA 3SDXF 4KAQL 1IFHH 2JIXB 2EDOA 3HHSB 1FNFA 4JAMA 3G5VA 1HC1A 5KOMC 4F7KA 1SM3L 4MYWB 1CDHA 3GK8H 4Q6YA 4JO5A 3UAJC 5B38G 5B3NA 5CEYB 2BCKB 1ID2A 5AOKA 3VTTA 3FBKA 4AG4L 1GZHA 2DLFH 3R7RA 1SHSA 1AZUA 4LSUH 4C57C 3QZNA 1QBMH 5IMOB 3X11B 5DURD 1TKWA 2VDNH 4NN6C 3BKYH 3SJVD 5AD0A 5HYEA 1NGYB 4AK1A 1A9BB 4IEFB 4XRCB 4XMLH 5FPIA 1K8DA 1PZ3A 4UU9A 4AZ8B 1U21A 4G1MB 4U1LB 2O5XL 3BP4B 3KS0J 1GA2A 3R19A 1ASPA 1T5WA 3H6AA 1KT2A 3MUGA 3LIZH 4HH9B 4LMQI 4ERSL 5BPPA 4DCQB 2B2XH 4FL4B 3QFJE 2H45A 1I3GH 4P2OD 1L7TL 5F9OH 4XP9H 1BBJB 2I60L 4PGDB 2FBJH 3AAZB 3BSHA 1YJDC 1LM8V 3VTMA 4DSYA 4H20L 5B3JE 3FF7A 3VACA 3WE6B 3PHAA 1IAIL 2BNQA 3NT0A 4G42B 5TF1H 3P2DA 5C92A 1JHKL 1AGEA 4IOFD 4KKLD 3QFDB 2VKXA 1T1YB 1WP6A 2XTLA 4XP6H 3S3PA 3S8WA 3LNHA 5FOJA 4M29A 3RVUD 1E28B 3QIUA 4PJFB 5F70A 4RAUA 2CCWA 3HPJA 3UDWA 4ATTA 4FQ2H 2IAAC 4PS7A 5FECA 1QFWI 3II1A 3HFMH 4ZD3L 2A6IA 2XI9A 3UYPA 1JPEA 2D9CA 2WIMA 1N64L 4X4XA 2OJ1A 4W9IC 5C3LD 3WTWA 3IVKA 1FFNA 4AX3A 4QWWD 2B15A 4JFDB 2EKJA 5EG6C 4N5UA 1YJDH 1H19A 2BVOB 2GUOB 2PNDA 1CIDA 5IJDC 5K9KB 3OXRB 5FOBA 4CSTA 2DQHH 3FAXA 5FDWA 1X6LA 4GG6E 1WHPA 4PJEA 1AXIB 3CAFA 4XVTH 4XNXL 5I1EL 1NAMB 4PJDE 3TN0C 2D3LA 1MI5A 5FK9A 4FQJH 4UT9H 2Z7YA 4PRIE 1AQKH 2A9AA 4JY4B 2FNWA 3TO2B 5BV7H 2QDVA 1Q0XL 3SE3A 3O2DH 4AQEA 4QRAA 2RACA 4GSDL 2W0KA 1GR7A 3SZ6A 3L5HA 2G3NA 2VLKE 3SHSA 4S10A 1ORQB 2EC9U 3VU2A 4FNLH 4R90H 4E5XG 3MV7B 3UZEA 5HVGB 4ENEC 2VOTA 1MFNA 1NKRA 1KELH 1WICA 3ZE0B 2F74B 3GLZA 5IV2B 5D8JL 3RA7L 3ZGIA 3B7RL 5CEZE 2D03H 5DZNA 5E9DE 3TT1H 3ARRA 4KTGA 1FL3A 5HTSA 2FEDC 4XN2A 4K94H 5JOFA 3RQ3A 4FG2A 2FX9L 4HK0A 2N0KA 2FJUB 1CD1B 5LBSL 3ZZQA 3IDNB 2J3SA 1D6EA 3VI4A 5DUJA 4F2MA 1V27A 1J7VR 4QXTA 2CCVA 2Y7MA 3HHMA 5DJAA 3UYRH 2DQ6A 4HFWA 1U8MA 4QTHA 3EGSB 2Q0ZX 3QA3B 4B3VA 4HUNB 4CW1B 2ED7A 6PAZA 2PCXA 5CJXC 1CZ8H 5CLYA 3MLSH 4PCKA 1LEGA 1IBHA 5K9OA 3EYFA 5K9JH 3EDFA 4GQQA 2BCKA 3CXHK 4N0FB 5IVOA 3MLPA 1V7MH 5DCCA 2ENPA 4N20A 1W6WA 2ZAHA 3M88A 4KJWD 1J5IA 5I26A 3ARXA 3MRFA 3GRWA 4XZUA 2AEIT 1HH9A 2F7OA 3C6LD 2ZUSA 1MF2L 3O6FC 4ZOAA 4GKOA 2V5MA 4XNZC 5AVTB 5JYLA 5F97E 2A9DA 2XQYA 1XD0A 4HIIB 3ZW3A 1E0OB 5E2TH 1TVBB 1NCDL 1DEEA 3JWNC 4FFZH 4QRPE 3NDYE 4XXWC 3R8QA 1EA9C 4OD2B 2CHXA 1S7UA 5CLZA 1I8KB 1UOVA 4A2EA 3U0WL 3IFNL 2I9LA 4NNYB 4M1DH 3AQZA 1ZEAL 4MAYB 4KXCA 3OHXA 1WFIA 2DJMA 3P30L 5J56B 1IQDA 2DY2A 1AYOA 2NTFA 3EDEA 4G59C 4GBXC 1FYTE 3F58L 4KVNH 4YK4C 1GGBL 3BKML 3E6FB 2XCMC 3V6FB 3IDXL 1KSRA 5IBLD 4TTDC 4KY2A 2CK0L 3BT0A 4A6YL 1SXBA 1RU9H 3QQ4B 4GRLB 3KWWB 2UZPA 1DQJB 2P43B 1MG3C 1DZ0A 2UX6A 4NFBA 5FO8B 4KJYB 4NO0D 4PB9L 1F45A 2AQ2A 3HMXL 4J3OD 2YO3A 3HG2A 5DK0B 1CE1L 4RGND 4NQCE 5FM8A 4KPHL 1DJGA 2QQQA 4LHQB 3FB5A 5CP7A 4XNQA 3NH7H 2BOLA 1GW6A 1XIWA 2GJZA 3H9HB 4C56E 4ANUA 3RWIB 1NDGB 2X05A 5ICZB 4ZMXA 1K6QL 2R2BA 5F89B 5EU6D 4MB4A 3R4RA 1KTLA 2V3EA 4HPOH 4BCYA 1M1XB 4YH6A 1G7PB 3FT9A 4GO6B 3CHRA 5TDOA 3HBZA 5IB1B 1I9RH 1S3RA 1WAPA 2VL4A 2Q7YB 2AP2A 4FF9A 4G6ML 4GKZB 1YC8A 2OSLA 5AVZB 3CC5B 2DEXX 1C5DA 4P59L 3DARA 1DVZA 4KXZI 5CGBA 5FGCB 2WUBL 4JMNA 3QEQA 1KFGA 2P80D 3NN8B 4HIEB 4RGNC 1YPZB 5CINH 4YPGA 4PJCF 4DEPC 5F93C 3OKDA 3RJOA 1B4LA 5BQ7B 2FX8L 5A2BA 1K2DA 1OT2A 2X38A 3SDDD 2BINA 4HAKA 3CLEH 4XC3H 2HN7B 3STBA 1MHPH 2VMCA 3ISYA 3O9WC 4PCTA 4LKXA 3K4AA 4Y2LA 2NX5B 4PTUA 1RKRA 1N68A 1TZGH 4FNUA 4KK8D 4KRLB 2L7QA 1JDCA 3P3YA 2ADFH 4ZQTA 1NGQH 2EC9T 2D3VA 2LTQC 4RZCB 2D73A 2FHCA 4KJPC 4EN3C 3V0VA 1U6AH 1FNEA 2CIIA 3HMWL 4KH2A 1OSZB 4UT6L 5F72S 2F7IA 4LO9A 4Z18A 3WGVB 5C0EB 2D0FA 4U1MB 1RIHH 1NC2D 1GZPA 4UQ2B 1TZAA 1UYWH 4U1HA 3K2IA 1OAYH 5I2IA 3HMXH 3HZYA 3OJDB 1HHHA 1YYML 1UGKA 3KPRE 4A04A 3ARDD 2O6EA 4YSPA 5I8CA 1CE1H 1NIAA 1NOFA 4LEBA 4HLZG 2ZXAA 4KPHH 2OBGA 1I1AB 4QHKJ 3DJTA 3FTYA 3NCBB 4U1NA 5E4IA 4Z0XB 4N8VG 4J3OH 1ASQA 3WNIA 4EI5D 1IM3D 3B7UX 3LV3B 4ZFOB 1ETA1 2YC1A 5J89A 2AS5M 3GRBA 1BQHB 1T04A 2MIZA 3DWTA 1HQRB 1X5HA 1X9RA 3GMNB 3J07A 1U8PA 1MIEH 1NCGA 3TCLA 1Q9OB 4LSDA 1WD8A 3P1VA 3WEMA 1OB0A 1YNKL 4YHIA 3IFPB 1FFPB 5K93A 1RVFL 2EEBA 1OGSA 1QI4A 1TJMA 3P77A 3Q3GB 4L3CA 5E56A 3REWB 3IGLA 2VXUH 2NY4C 4BQ8A 1WBZB 4MRBA 1KBGH 2Y5QA 3Q5OA 4HT1H 4I87A 3TV3H 3ZL2A 4PJBA 3SD2A 1KENH 4R97B 5JW3L 4XO3A 3VXMB 5J12B 1OGAA 2W1NA 4HD5A 4OM1L 4AYFB 3F6JA 5H4ZA 1I7RB 4XNMA 4NM8H 4TVSa 1KDJA 4LPCA 3P4NB 1MCWM 3FQWA 2VDOH 4CC4A 3D4CA 1T7WA 2BZDA 4QRRD 1UD3A 3EYSH 5DVPA 1F4WH 2NY3B 3RDTB 5DMGD 5LG1A 1QRNB 3P9WB 3ZTEA 3UCRA 1HKLL 4WI0A 3ULUF 2IWGA 4LLUA 3D1MC 2BH0A 3HS0B 1S9XB 4HKZB 3WHE0 4F33B 4MVBC 3E8UH 2D7NA 2E9GA 4YDIL 2VJ8A 3VB9A 1XFPA 3OX8A 2O5YL 3E3QE 3VM5A 1FO0L 3QXDA 4ODBD 5CEZL 5BZDB 1JWUA 3PAYA 3L9EA 1GHFL 3Q8EA 4E41B 4MGXA 1OGTA 3WY1A 1PL3A 1O9ZA 2B14A 4Y2DD 5BUGA 1O6SB 3QS3A 3PL6C 2CDFB 3NACL 4FYQA 2GK0A 3CV5A 1MRFL 2Q8BH 4XNBA 3BH8B 1OGPA 4R4FH 3TCTA 5EU6E 1J9CT 1DBAL 3SYOA 3C5ZD 1HHGA 4FCHA 5A2KH 3CGTA 5EEZA 2ZF8A 3TS8A 1H3XA 2W0FB 1C5BL 1AP2A 4F37F 1ZOXA 3T1FA 3L5WA 1R46A 3MV8E 1INDH 3BIAX 4DGUA 3JBG7 3VFWA 3MACL 2DPKA 3MJ6A 2D2CC 4RA0C 5JTWA 3IU4H 1H3PL 4PTUB 3KL5A 1FLRH 1SN5A 1E50A 4JB9H 4XP4L 1ORSA 3P0YH 5EZOH 1S7VA 3PV6B 4RAUB 4G1MA 1D9KD 1NPNA 2VH5L 1DQQA 5CSZB 5ANHA 4ZFZA 2VDLB 5FUOH 5DUML 4E9QA 2EXYC 3MRDA 4LL1A 1D9KC 4HISA 4DP2X 4HSCX 2BWDA 3TBTB 1G43A 2Y69B 5DD1L 5D1ZB 1NIDA 1A4KB 3NJIA 4DK3A 3G9AB 4QRPB 4ISVA 5HHOA 5F7DA 2APBA 5IY5B 3S5YA 2PYFA 3BQVA 3DGGB 4H88H 5B38B 3SO5A 5GXBB 2E76C 4XMZA 3SGJA 1SQMA 4MKMA 2O61A 5AZ2H 5KVDL 4M43L 4OJCA 3T3ME 3LZOA 4CMMA 4HULB 1UUSA 5D7JD 4ZYKA 5JIPA 3R7QA 5LGKA 2MPAH 1DSFH 3B9KB 4UIMB 1MY5A 1LQBC 5KYNA 1TUPA 4K15A 4X80L 3HAEA 4ONFH 2EXWD 1FVEB 2WLHA 4MSWA 1GGCL 3GSNL 4EUPA 3ZKXB 1QASA 3L2NA 2V3FA 5IHLB 1QHOA 3L4UA 4TPRL 3TBYB 4FAAB 2VDMH 4IBZA 4ZUTA 5HGDA 3SDCC 1Z9OA 3TH3T 4FZEL 5E5RB 5DWUH 2XZAH 4U1GB 1MFEH 4DGYH 1AOHA 3RY6C 3H0TA 4R6UA 4DKTA 1X7QB 2DQDL 1KIPB 3QJFA 2BDNH 2DLFL 2R4RH 3GIVB 4P2CG 4ZMYA 1JZ5A 3FBQA 1V3KA 1HE8A 2AEQH 4A7UA 3K71B 5E70A 1OD7A 4GG6F 3QUHA 1ZA6B 3Q6GL 1GCYA 4FMKA 2A99A 4OCLC 5BMFL 2JKSA 4L8BA 2HJFA 4YHYB 1SOKA 2OK0H 1OCZB 1XVSA 2YGOA 3HS0A 3MV11 3DTXB 1DVQA 3LB6D 4B95C 3C9NB 3BX7C 1PLAA 3O6FB 4MNQD 4Y4FD 2XRAL 2ICWB 2YFOA 3TVMD 3S5ZA 3RVWD 4S1RL 2YXWA 4Y4HB 3NCWA 5D4JA 5HGAA 2CO6B 4LBEA 3II3A 1I8UA 3EJCA 4FQXB 4NQDB 3N3EA 2C9XA 2IH9A 4H20H 1VDGA 1C08A 3PP3H 5J13B 1JZHA 2DQEL 3RWCB 4F7PB 1QSFD 4PWHA 1JYNA 1A25A 2J44A 3HBGA 1RIVL 1UJ3A 3D8MA 3T2LA 4MAYA 3ARZA 1PZ5A 1CLZL 2A73A 4RNRB 4B7IA 1N19A 3GSRB 2VLJA 1HINH 2MQCA 3HRZB 5JW5B 5EB9A 1DEEB 1P7HL 5ICXB 4YHNA 4FNSA 2YN3A 5C7ZA 3TPUB 2IWFA 3WDIA 3B3BA 1A3ZA 4W68A 2FHBA 3N1MC 3OWRA 4NZDA 1PZUB 2DIBA 1EZVY 1QFPA 4OCWH 5EZLA 5ILTH 4QHMA 3CN2A 5GSVB 4WWOA 5HDBE 3HI1A 3GTVA 5IFAL 5J9PB 5KANG 1RULL 4PRHD 2WQ8A 3I6LD 4GINA 5I6PA 4WTXA 5D1QE 5EMYA 3TO4D 3X13A 1O5PA 4XCNA 4WNQB 2AMUA 3BUYA 3W2DL 2VERA 4MQSB 1L6ZA 4FHKA 2KC0A 5T5FA 2JCCA 3O11B 3TWCH 4M7JL 4J3VA 3L4XA 1QI5A 3SYCA 5GGSB 1J1PL 2IAMC 2N56A 3E0GA 1KLFB 3WFHA 2Z0BA 3ZT7A 4R3SA 1WBZA 3RIFK 1FZMA 3FF8A 4QLRA 3QIBC 4G8GB 1QSEE 3ESMA 4X4YA 1XF3B 1NC4B 4HJGA 1XR8B 1RLWA 1VZGA 4J8QA 5C07B 5L9DH 2AMGA 4HW6A 3GT6A 2GBAA 3TNNA 3B9KA 5EBGA 3QNZB 4UB0L 3S96A 3ZJAA 3OAYK 2I85A 4MDRA 4Y2OA 1BZ9A 3T09A 5FAAA 1T21B 3ARFA 4FTVA 2HX7A 1Z9PA 5F9WB 4NXSA 5F1IB 1JHTB 2XXMB 2WSDA 5EUKB 1T03H 5CKGA 1DQVA 4X5WA 1L0PA 2BOCB 4QO1B 1WE5A 1VFAB 4DK5A 4F8LA 4LVEA 1CT8A 1R3IL 5JDSB 1QO3A 4B5ZA 4DP6X 1BQRA 2B0SL 3QXAA 3HEIB 4ZUVB 3ARPA 2XWJB 5DLMH 2AI0H 5CCKL 3WN6A 1TO4A 2CRIA 1QPXA 3PIQA 4FULA 3DJSA 3PLYA 5DGQA 1M05A 2O6FA 5FFGA 3LKNB 5JHLA 2K6ZA 5A2AA 4CN4A 4OF8A 1EXHA 4OQTL 1E9PB 2HLFC 3ARGD 3L9RB 35C8H 1RLBA 3NRPA 2Y5EA 2ESVE 5GJTL 3TU6A 1R47A 4JRXE 5JW4M 4YL9A 2AC0A 3SQOH 5I5JA 2IPUG 3MRRB 4HUUB 3PY9A 1BD2B 3WCYA 2ZCKH 3N0AA 4CC0A 1OZTG 1D5XA 5HDQH 1T5KA 4F57H 4I18A 1HDMB 1QFWM 3OKNB 3PABB 5HI5C 4BFJA 2VXQH 1DLHA 3H2WA 1DQDH 4PV9A 1EAPB 1ZV9A 1CGXA 1E28A 3QIUB 2CLZA 4PYHA 5D5MB 2DJUA 1Q8MA 2XN0A 2UXVA 4MDIA 1WZ1H 4C4BA 4JZJB 3H9YA 4UT7H 5DMKB 1JYVA 1S7VB 1RXLA 1RZPA 2XN9E 4KUCF 4KROB 4KFMA 3WXVL 3VJ6A 3JYCA 3Q2LA 2QQLH 2RB8A 2Y36L 3LAFA 4P2RD 5JDJA 1GGYA 4FEIA 3QUZB 3HG1E 2E4FA 1SQ2N 4D3CL 2WKGA 2WN2A 2DQGH 5HYSG 1SDDB 4RFEA 2X0WA 5FO2A 2ARJQ 2W95A 3U1SL 3OQRA 2HUHA 4I18C 1RAMA 3UBXB 1J87A 3EFDL 4JHAH 3X12A 1IBDA 5I16A 4LSVL 1BMZA 1LEKA 1NBZA 2O5ZL 1JCVA 2F1BA 4ICWA 2DMGA 1NCHA 2B7DT 4R2GC 3VMPA 1CTMA 5BOPA 1FAIH 2VAAB 1JUFB 1S9WA 5DK0A 1KCUL 5IMMB 1ZT7B 3GGWB 4PRHE 4UNVA 2WV3A 4CJ1A 5C2BH 2A83B 2OR9H 3ABZA 1UUNA 1QNZH 2E9WA 4M56A 4S11A 3T65B 4YE4H 4A66A 3D2TA 4JANA 2JVUA 1N6VA 1U8LA 4L4VE 4ZDHA 1UEYA 2BHFA 1U8OB 4ZSOB 5CD3B 1BYOA 4B97A 2IEPA 2R29A 3FRUB 4H8UA 4OLVL 5F7MC 2I69A 3UAJA 2FBOJ 5F96L 5EWIH 4ELMB 3TGXA 4U0QB 5KSAA 1JGVL 1I9RL 4LLUB 1OB1B 1NA8A 3KPMA 3CXHJ 3O6KL 1GAFH 1FZKB 2QBWA 3T71A 5TQ2H 2Y3NA 3KPSA 1AJ7L 3VD0A 4U6TA 1QZ1A 1U4EA 1Q9WB 5GZNC 1BXXA 5HYSB 3GS4A 4L8SA 3VFMB 4KKQA 4XNMB 4GP8B 4C4KO 1CD9B 3FOMA 4UCFA 4ZAKC 5FHBL 2R29H 3RWDA 3S9DB 1ZA6A 2K4WA 4HZAA 2NPLX 3VXQA 2Q8AL 1XD1A 3WXVH 4P46B 2EEAA 1JN6A 3UTPE 4FXLA 1Q72H 3BE1L 4HS8L 3W5MA 4QRRA 2NUTA 1BW8A 2BY3A 1IEHA 2Q76A 4ZS6D 2CKBH 2IMNA 1XB6A 3HE7D 3CVHL 3C9NA 1K3ZA 2DYRB 5JHDE 4M7KH 4UNUA 1JNHA 4ZS6C 1OSZA 4FXTA 3B9EA 4IBSA 3O3EB 3BVWA 1NFDA 2XFXA 5MEQB 5E9NA 1OQXA 4YHLL 2DBLL 1D5ZA 1P5UA 1QKZL 3ME0A 2VSMB 1M7XA 1BVNP 1W0YT 3HOGA 3S4SA 2CALA 3SPVA 1QW8A 2QPUA 4AH2A 5CCGE 2W07A 1ROWA 1WIUA 4XVJL 1NFAA 3CU1A 4ZAKD 4I0PC 2YPVH 3P9LA 5A7EA 2FIRT 4WJ5B 4MXQD 2Y25A 5T33L 4U3XA 5EOQL 2OZ4A 2IGLA 2R0LH 2D4FA 1YEFL 4UQ9A 4I3SH 3S3BB 3QI9B 5BJTB 3LYRA 2ZKYA 4GRWH 4MA3B 5IBUG 4N0FA 2PO6D 2KHAA 1DBKH 3AMKA 1MWAB 1CTOA 5D7LB 4CU6A 5DJZA 4I4WB 1R3KB 4FQHA 3KW8A 3F12B 5KS9F 4ZNEA 4QRFA 4HWEH 3MRPB 4UYQA 5D1ZA 4LSSL 5B1JA 4P2OC 3VRLE 1PU0A 2AJXL 4JR9H 1ZHBB 1JZEA 2FJHB 2VNCA 4WK2B 4J3OG 1SGKA 3CN0A 5IVNA 2P24B 3P4MA 2NY2C 2JKTM 1U8HA 1X4YA 3N1QC 5ERWA 1MCNA 1UT2A 3FFCE 3UDWC 3BCFA 1OALA 1CB4A 3QHTC 4N8CL 1FC1A 2IANE 4CSSA 5B8CA 5CFHA 2WB1A 1G6RL 4IHBA 3PREA 4PRPA 2XVBA 1WLHA 4LPUA 3KR3L 1AYRA 3GIZH 4F7MA 3DX9B 3PL6A 3T0VA 4IRJC 2C3VB 2J6EL 5FO7B 2G0KA 1YEGL 3PDGA 2DKUA 3EH1A 2X1PA 3TNNB 4DPCX 4NO5B 4CN1A 3H9SA 2PABA 5EO9A 4X9IA 4Y16C 1OARL 1PTZA 2IO5A 1K72A 3K0YA 3GC3A 1KEMH 3VRJA 3QPXH 1MFBL 4F58L 5FUZL 1MPAH 1THAA 5CZVL 5I1CL 4MAZA 4HBCH 4F7EB 3RWFA 3OF6D 2X9YA 1FZOA 1JI2A 2J20A 3KYKH 3DKHA 4GO9A 1JWUB 5KVFH 1PJ9A 3PHQB 3APCA 1ORSB 3JV6B 2RCSH 5TTRA 1A8JH 3WV0A 5LAPA 3RGBA 4OI9A 5DJDA 3WUWA 4I5BA 4YNYB 5C9KA 1H0DB 5EIIB 4JY6B 1W6LA 3ARBA 5CF3A 2IAMA 5EF2A 2ICCA 1MJUH 4MQ7B 5DU7A 3EO0A 4BZ1L 2WNWA 1HHGB 1LK2B 2WMPB 1A9EA 3IJHB 3NGBC 3KPLB 2JQMA 2H32B 3ZZSA 3IFOA 4BFEA 1K4DA 3BHBB 4UDUB 2JJSC 2Z31B 3KJ4B 2X70A 1TPXB 2EIZB 3I6KA 3P3TA 1LNUB 4F7TA 4JJOA 2E56A 4JO4H 3PABA 2YQBA 3ZY7A 3CFCL 4Y1AA 3TBBA 4KQ3L 3U2SB 4MA7H 2CD0A 1CE6B 4MA8L 5I9QB 1MCLA 3BAIA 5FGBA 5DFWH 4P4KD 5GGRY 3DMMD 4EE2A 4F7PA 4M6OH 3GFUA 1IM3A 1RCYA 2FX8H 1ZLEA 4KX7A 1RZ8B 2C7FA 3PWLB 5FLUA 3PG2A 4Y5VA 5IB5A 3CFTA 1DL7L 3EO1A 4OLZL 4LBEB 4E9TA 4L3CB 4OLUL 3TBCA 1GZQA 2VB5A 3L4VA 5DD0H 4XOAA 5F8QC 5I1GL 4FQQA 5D70L 3QUYB 3F7YB 3A21A 1HWGB 2B39A 2DYPA 4MAUH 1E4WL 3MJ7B 2BRRL 3UC0H 3V0IA 2NNCA 4PLJC 4XBEL 3DOSA 4K55A 3LQAC 4HOWA 2A4CA 3EJZD 5I0DA 3FCGA 3TN0D 4MD4B 1MPAL 4HCRA 4L3EA 4JPIA 2WGXA 4V1DA 1UWGL 4WNQA 2DLIA 2IWEA 1YYLH 3Q01A 1TETH 1MCIA 3B37A 5L7XH 1CGSL 2BVQA 2IADB 3NMEA 1MCQA 5DHDA 3IJ8A 3MUY1 4GT0A 1P6FA 4FEMA 4RETB 5BO0D 2NCMA 2CWRA 3IF1B 5J1AB 3RAJH 3U2IA 2UXFA 2BNQE 5D71L 3DV4B 4G8GA 1JI1A 2QFPA 3TCLB 5CP3H 4H26B 1N6UA 4R5VA 3L5XH 4UV4L 4NQEB 4F1ZA 3WFHB 1VGKA 3QAZC 5CILH 3HNTL 5GGUA 2E46A 2GAZA 4HUKB 5E4EC 3ILQC 5G4OA 3QDJD 2Y07L 2ZCLL 1AIZA 1KIQB 2VQ1B 3C5SA 3F7PC 4RA3A 4ZTOH 5IB2A 4OIFA 3S36H 1I7UB 2WCSA 2VL5B 4JN1L 3BZ5A 4JEGB 4E0RA 3CFEA 1QFWH 1DHKA 4QI3A 1D5IH 2P5ED 4N2EA 3O6MH 4K3DH 2WLYA 3AUWB 3SE8L 1U8OA 4ZSOA 3QC5X 1UXLA 4FC3E 1F3DH 3EBAA 4S1QL 3ZLQC 1A1OA 4L5FH 1EUTA 2YMXL 4JCMA 1R3HB 4PJDA 1E90A 1HDMA 5DD0L 1O0VA 4B9IA 4FTVD 4M00A 4PJ7A 4LF3B 4KH9A 4LCYA 1I9EA 2P8MA 1MRDH 4MNQE 3SE9H 4WIQA 3DO7A 2XOTA 3RWIA 4HH9A 3MRLA 2Q9OA 3L3HB 4FNPA 4DZ8A 1ET5A 3GBML 4YDZA 4NWUL 3MRBB 3VFRA 5T8IA 2V2XB 3MRHB 4ZW5A 4KY1L 1W2KT 4MAYC 5D7HA 1PMYA 4NQVA 4FERA 5JPMC 2X3AA 1IUZA 1D6VH 1JZ6A 2WQWA 5LWYH 5A2JH 5HVHC 3P3SA 3NVQA 1X3DA 2CJUL 1EJFA 1TJIH 1AACA 1FYHB 1ZIBA 4D0BA 1IQWH 4JZJA 1QFUL 1R5IB 2G3MA 3MGAA 4MA3A 3T08A 5IHZB 2WVVB 5C0CD 1JXFA 3LRKA 5AVYB 1BZ9B 5AVUB 1N7ML 4GUPB 2FVNA 4JFWA 3QYNA 1U8NB 2VDKL 1JWMB 2F5AH 3AREB 3VI4F 5HYQB 3I50L 5BS0B 5JQHC 4PJXA 1A7PL 2CSPA 3RWJB 3UO1L 1ACZA 2E7DA 4K2UL 4XNYL 3NYKA 4NI6A 1HS6A 1IBBA 2O6DA 4MXWL 2NW2B 3FKUS 4MJID 2NY4B 3A67L 1PDKB 2ZX6A 3TN0A 2IPTH 4OBSA 5DZOA 1WJ3A 4KUZL 5T1DL 4Z7NE 3DGCR 2N0MA 4HKBB 3FYIB 3TH2T 2I5YH 5LQBH 1A7OH 1ZE3H 3QPQD 1W0WB 4PRPB 2BMKA 3LSOB 1BM3L 1E5ZA 2DM7A 5H8DA 2NXYD 1AZZC 3WJJC 4MJ2A 3RU8L 2DQJL 1TTUA 5DS1A 3UBHA 1EGJL 2NQCA 2OL3L 1KB5H 2ZOKA 2CHDA 4X7TA 3FB5B 3U36B 2V2TB 3ZQXA 5L6YL 3WNOA 1TLKA 1U8LB 3L45A 4ZDHB 4G8IB 4AVJA 2ID5A 5J6GA 3AZUA 4IKLA 1I8MB 5C08A 1WTGT 3PQYE 2CBPA 1JVKA 4OD3L 4Y9FA 3TO4A 4Q4IA 4HUWB 4M3KB 1OAJA 2VMDA 2PW1A 3FHQA 1AO7A 3IEAA 4QHUB 1NL0H 2VDPH 3P77B 3Q3GA 1VKXA 1F4XH 2YQ2A 1G9NH 1G7QB 2Q76B 5LWYL 3UEZA 3OMNB 4BDVA 2J4WL 3SOTA 4NSKB 3OAZH 4IKKA 3ASWA 4JQIL 4F57L 4FHJA 3P9LB 1HCYA 2WYZA 5ICYB 3X1BA 2BLFA 3TZVA 2ZOOA 3N44F 3OB0K 2N59A 5E9DD 1JFHA 4G80A 5CEZD 4P0DA 3BRGC 1NGXA 4NBXB 4P5MA 2HWZL 4K5OA 4G6AD 1JUFA 1KXVA 1S9WB 2BIPA 4Q7DA 1H6UA 5M7QA 1HL5A 2ED8A 4TULL 4OM0L 2VW6A 5LUMA 3IDNA 3L3KA 2W92A 2ZG2A 4LAJH 1PX3A 3QCVH 4N2BA 3LX9A 3TVMA 4U6VL 5IM7A 3B6SA 4YE0A 5CLTA 3VH8G 1JZ3A 1FNEB 5GGVH 1I3UA 4L8CA 2FIKB 2FR4A 3GPEA 4B50A 1FL5B 5EF0A 4Z5RB 4NPYB 1SMAA 3LJ3A 2AK1H 5IQ7L 2GI7A 2VISA 3KXFA 2E6JA 3OM3B 2ZF9A 5F71A 1YEKL 2XA8L 2EEDA 3ALXA 3HPJB 2DQMA 3EOAB 4XMXA 3BQUD 4NRYA 1DVFC 1LO4H 3DYOA 3ULSB 4PV8B 3L7FB 4NIYE 4OGQC 4YVUA 5SWSB 3QFDA 4NX0A 3ZKSD 1T89A 2F19L 5EZJA 4G9FE 1J5OL 1A6TB 1WH0A 4L0PB 4HIHA 4M6AA 1YN7B 4OD3H 2VZUA 3VXUE 2HXAA 4R9HA 3OXRA 2NUPA 1E8WA 2F8IA 3W39B 4NKOA 1BZOA 4NUGH 1RSFA 5C0AB 1NGZB 3L95A 5EFIA 5I1LA 3C5JB 3L3OB 1WCQA 4NZTH 4M03A 4UNTA 4PY7A 4UQIM 4WUKH 1RULH 3BJLA 3IMTA 4WHYH 4L05A 2KLSA 3INUL 2CUIA 2IH1A 3ZYIA 3SGKC 1BEYH 1E4XH 4DVBA 2VGLM 2G9HA 1B2WH 1PKQE 3TBTA 1DQML 4XMTA 3QULA 3ZDXB 4R7DB 1SBSH 4DJMA 4BV1A 1N4XL 3UJTL 1K85A 5IG7B 1HH6A 4NO2A 4ZTEA 5IJKC 2IFFL 4GKZA 4TVPH 5IMOA 2Y4SA 1X7TA 1MVYA 1S9KC 4POZC 1BDYA 1QOKA 4QYOA 1II4E 1CN4A 1MFAH 4Y4KD 3SBRA 1U9KA 3AXHA 4JFXA 4FGMA 4KVCL 5A2FA 2HVJA 5T3ZE 5DUPL 2VR6A 4TLKA 1CI3M 5HXMA 2NYYC 4U1LA 4X8JB 4G8EA 1KT2B 1UWEL 2NQDA 1V55B 1P5VA