3AACA

Small heat shock protein hsp14.0 with the mutations of i120f and i122f in the form ii crystal
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
123
structure length
123
Chain Sequence
MYYLGKELQKRSEELSRGFYELVYPPVDMYEEGGYLVVVADLAGFNKEKIKARVSGQNELIIEAEREITEPGVKYLTQRPKYVRKVIRLPYNVAKDAEISGKYENGVLTIRIPIAGTSVFKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein ST1653
publication title Dimer structure and conformational variability in the N-terminal region of an archaeal small heat shock protein, StHsp14.0
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Chaperone
total genus 23
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aacA00
1SHSA 2WJ5A 3GLAA 3QORC 2WJ7A 1X5MA 4YLBA 3Q9QA 4YDZA 4YLCA 1RL1A 2K8QA 2N0KA 4MJHA 2CG9X 4ELDA 2N3JA 4YL9A 1WFIA 4PBDA 2Y1ZA 5DS1A 3L1FA 2KMWA 3VQMA 4FEIA 4RZKA 3VQLA 5LUMA 3QORA 3AACA 3GUFA 2Y22A 3GT6A 1WGVA 3QORB 3W1ZA 1GMEA 3L1EA 4M5SA 4YE0A 2JKIS 2KLRA 3AABA 3EUDA 3N3EA 1WH0A 2O30A 3QORD 4JUTA 1EJFA 4JUSA 3IGFA 2CR0A 2MNWA 3J07A 4M5TA 2XCMC 3Q9PA 4ZJ9A 2RH0A 4PCKA 2Y1YA 5DS2A 4I88A 2BOLA 3L1GA
chains in the Genus database with same CATH superfamily
2UWEB 1ASPA 5HGAB 4HFWA 3MLXH 4UZSA 4XPFL 5GISL 4YDLC 3H2QA 4G5ZL 3ZR5A 4YHLL 4IRZL 2H3NA 2UVEA 2ADFL 4DP5X 3NH7L 1MUJB 4LGRB 4LP4A 3IEAA 3ET9F 4UBDD 4Y5YB 3VW3H 4G3YL 3PAYA 5DC4B 1ASQA 3U82B 1H3WM 2F9BT 4PV9A 1HN1A 4R7VA 1T3FB 4TTDD 4MXVE 5CSZA 4D2NA 4EUPA 1BQHB 3K71B 3TEYA 1EHXA 4LNRB 5GZND 4MX7B 3IMUA 3X1NA 4FQQB 1P5UB 4IIZA 3RWIA 1LEIB 4OD2A 4PRID 1IARB 3L48A 4JFEA 2EVHA 4RESB 1LJMA 4AGQA 5ANME 1Z5LA 4WNQB 3CSGA 2HFGH 4JO1H 3ZX1A 1BV8A 1IEBB 1Q0EA 3HS9A 1JGVH 4Y4FA 2F54B 3BAEL 1P5VB 1MNUH 4HIXL 2PTUA 1TVHB 2ZP9A 3VXTB 4KRLB 5EU7E 1DJYA 5DD1L 1N0XH 2R39A 2XG4B 1E4WH 1QLRA 3L17A 3S96A 1QSVA 1ZXQA 3QORD 4PRBA 5D96C 4BZ1L 5CD5D 3NJMA 4IMLA 2P3YA 3DTUB 5I6LA 3RFRA 3QPXH 3FBQA 2P44B 3HEIB 2BHZA 4L4TB 3ME0A 3JTTB 2ZUWA 5CINH 1XT5A 2IBZX 3L3OC 3IVKA 2VM3A 3B7TA 4I0CC 1BYNA 1BD2D 4D0DA 2P5WB 2VUYA 1UB6A 2XY1A 2WBKA 1IZJA 1AQMA 4AKOA 4XE0A 1UOKA 1EERB 4OFQA 4QO1A 5CHNB 2QKSA 2I85A 1INEL 3HE7D 1AIFA 3DV6B 3RE0A 4PV8A 2FSEA 1TKWB 3JTSA 4PB0L 2MTAA 3DO3A 4LLDA 1T6WA 4C58B 1EQWA 3RX9A 5LGHL 1PW3A 3ZW3A 3SDXB 1GZHA 4PJEE 3FQYA 2YPVH 4JPQA 1E9PB 2XN9B 5D7IF 1M7IA 3OV6A 3MKGA 1HHIB 1GIGH 4KHTH 1PFOA 1ZGLB 2PKDA 1OAQH 5B1CA 3BXNA 43C9A 3OXSB 2QQKL 1MG2C 2AEPL 1B9ZA 3BP5B 3CFKA 2QR0A 3EJRA 4LRIC 2YAHA 3ULUE 3TYGL 1PKQB 3EFDH 1NLBH 4PMFA 3J8F7 3PWPD 4JFYB 3G5YA 2DD8H 3IWUA 3CFTA 4HWBA 4KKRA 3B5GA 2ZKMX 1ETB1 3ZYJA 4B9IA 5D1ZA 4ZAKA 2FH8A 3PWNA 1FGNL 3Q0HA 1G43A 2EACA 2DQFB 1YEIL 1JPFB 1QSFA 4P5KA 5C0IB 3O6FA 3OD3A 3PDOA 5BRZB 5HYSG 1MJUL 2HKHH 2GSMB 2HVBA 4Y0GA 1AZNA 3V55A 1O7DE 2CHZA 1F8TH 1DO6A 5CN2A 3O45B 1TPXB 4N2BA 1OTTD 2OM5A 2P7TB 4S2SB 1T03H 4HFUH 2W95A 2IQ9L 4HUVA 4BQCA 1W9XA 2XWBA 3HG1D 3PRZA 5F7WC 2NY6D 3WKQA 4K3DH 1A7BA 3P4OA 1NWOA 2FX8L 1LDPL 2WGXA 5IGXL 5JXEA 1U41A 4CKQA 3TL5A 3HFFA 4HUWB 4NCC2 3FOLA 5A2BA 3QIUC 3TF7C 1A4AA 2Y5QA 4LLWB 1FNSH 4BFKA 4RFNB 3RJDA 4G1EB 4F9PC 5E03A 1JDDA 4PGDA 2WMPA 3ISYA 1MQKH 5DDHB 2ZX5A 1UM4L 3KPSB 3FQWB 3V0FA 1BM3H 2IFGA 1MH5A 1I4FB 2ZICA 4IMKC 2X4OB 1U6AH 5I1EH 3H1ZA 4RGOL 1CYXA 5KYWA 4P2OD 1LE9A 4KJYA 4KFMA 4HOMA 1F3DH 5I76A 1J5DA 1I9EA 5D2LA 3ZKNC 5DEFA 2VW6A 2G5BA 1NAKH 1AGBA 4K7PX 1P4IL 3QC5X 4FFZL 1CD1A 4IDJL 1Q1PA 3REWB 1AHKA 2IFFL 4MNQA 1SYVA 1OGAB 4I1RA 4H0IA 1KCLA 2APFA 1I1AC 2QGEA 3LN5B 4Z23A 2ZCHH 3F5WA 1BZDA 5EN3A 3SE3A 4NQCD 5AW2B 3VI4E 4QDGA 3QI9D 2X4UA 1A5FH 5HHOD 5DJ8A 2JXMA 5CCKL 1ZLVK 3STZA 5MEQB 4YBQD 4U3CA 2ATKB 2R2HB 4CSSA 5E08L 2J1WA 2QKIA 5D7KD 2XVKA 2M26A 4X5WB 3U9PL 1J8RA 4ZO9A 3VXOA 1K8IB 3UL4A 3H42L 1A6ZA 1LO5A 1MCWW 3FDWA 4U1NA 1I8KA 3GK8L 5CFHA 5KJ4A 1TETH 5IIEB 5FF6A 3L4VA 2IADA 1YAZA 4K94L 3HG4A 2AXJA 1EO8L 3QR0A 3WFHA 1ID2A 4NM4L 4YBLB 4OLWH 3CH8A 4HK3N 1PYWA 2GITA 2Z91A 3KPTA 5FGRA 4Q9QL 4ZW8A 3DJSA 4J8RB 2AJUH 1YY8A 4KTEH 1D3CA 3MLTB 3UTOA 3DX6B 2YUWA 2XVBA 4K23H 5SWQB 1E9OA 2MHAA 1WUZA 2EZ0C 1B3IA 3NOIA 4KOCA 5ICXB 4P2CG 2I25N 5KSBE 3WFDL 4OF5A 1XSJA 3SDCB 2Z31D 1TZOA 3VQMA 1V05A 2DQEL 1BXAA 4NQVB 4BZ2A 1B2WH 2HYMA 3V6BR 1E8WA 4DFHA 3VUAA 1OGTB 3CN2A 4NN7B 4PD4K 3Q9PA 3P73A 5F7NC 3H9SA 1XCQB 2CO7B 1C5DB 3Q8FA 4Y19A 4NNXB 4L9DA 2BOLA 2DYSB 5T3ZH 5DFVC 3MV9E 1DQQB 4LHUD 3LQZB 1I31A 1QNZH 1YEFL 4XC1L 5DJ0A 3WNOA 4Q0XL 4JO8A 1F4AA 1MHHB 3AMLA 3MJ7A 3FUMA 3JV5A 3ZDZF 4AVJA 3VRIB 2BJML 2C1OB 3GLEA 1CD9B 2ENQA 1IC0A 2KZ1B 4PG9A 4FMKA 3G5ZA 5IF0B 3T2QA 4LSTH 1D2PA 5ALCH 4U6HB 5C0CA 5HGBB 2VLRE 3GO1L 2EINB 3DPBA 2HX7A 5FYJD 2IWKA 4P4KB 1RZJH 2W0LA 2VERA 1Y1UA 3DXAB 4OZHF 4XMKL 5LBSH 2L04A 4L9LA 3SCMA 1JF6A 4IHBA 4BEIA 3HZKA 5HVHC 5A1AA 1A4CA 4TL4A 4JKMA 3IFPA 2V0AA 3MNWA 3SE6A 2LR4A 5E2UH 2V5MA 3ZRFC 4XRCB 4N24A 1JP5A 2ZYSA 4TVPH 2ZG1A 4F7PB 4J3OF 1EDYA 5C92A 3CDGB 3RLSA 2ZT9C 5AENA 5DFVD 3KGRA 1GOGA 2PPEA 3NA4A 1HNGA 4YH6A 3LQAL 2WUCL 5IQNA 5L4MA 2XXFA 4JRYD 1VADB 2EYRB 4KI5D 1R3KA 2FE0A 3KPOA 2ZAIA 4PM1A 4F8NA 5C8JA 5SWZB 3PL6C 2PWGA 2PXYB 5CEXB 4TPRH 3I2CL 1HT6A 1QHOA 4RQQB 3M1OA 4N8VB 1Y6NR 1OIOA 5I1IL 3IJSB 1TJHL 3OJDB 5I8EB 3L95B 1ERNA 1TMCB 3BEWA 5CSBA 4Z7WB 3HCVB 4XN9A 1G6RB 4MASA 3GBNL 4HUCA 5L0QB 5GGQL 4J3OG 4M1CD 5L4FA 1CL7H 5DUPH 2E7CA 3L3HB 2OK0H 5DI8B 1ZEAH 1MZZA 4JM4L 4EI5B 3VFGL 4JANB 1VFBB 2Q0ZX 3QQDA 4B7IA 1WBZB 1YMME 1FFNB 3RX7A 1BJMA 4MXWL 2VR7A 1KJMA 4L8DA 5H37A 4MAYB 5E8OA 2E7BA 5J9PB 4YE0A 4LLYB 5EH1A 5PAZA 2VL5B 4OFIA 3WIHA 2JKJA 1YPZB 5K9OA 5LDUA 4JO4H 5GGVL 1S7WB 4D8PA 4GP8B 1MDAA 1IAOA 2DLHA 4GKSA 1T4WA 4TVUA 1EWHA 5B38A 3ZE1E 3SGDI 3WFBH 5C08D 1QYGH 2E5EA 2HB0A 3I6GB 2A6DB 1N5YL 2G3NA 2VE6B 1PY4A 4FXKA 4WI9A 4Z3JA 4H8WL 5KVEL 4KROC 1YECH 5FDYA 3K8MA 3K81A 3U79A 1B4JH 1PZ5B 4J23A 4AJ0A 2XIDA 1E6JL 1V5JA 1NBVL 4PJ5E 3NZHL 3FRPA 4WJ5A 1PX3A 4KKLC 2A5UA 1UKQA 4BCZA 4AY0A 1NH6A 2DQGL 4RLDA 4L1DA 3AXHA 2A4EA 3ZL4L 3TLRA 4GAFB 4DETA 5E2WH 2FRGP 1NCCL 4RAUB 1IT9L 4XMWA 4MHHG 5A2LH 1J5OL 1DVFD 1MCCA 3IJYA 3RIFK 4X6FA 3UJTH 4TOYH 3S88L 3P2BA 3RTLA 2OJEB 1X4ZA 4O2FA 4XXWA 5I6KA 4PY8I 1EBPA 2JMRA 4TNGA 2QGDA 1B90A 1LQSR 2MNUA 2FBJH 2BVQB 2XA8H 5CZXD 4PGEA 1OK0A 1JYVA 4X0KB 2SODB 4TRPL 4DKAA 1S7VB 1UYWL 4UB0L 4YGAB 1TENA 2B3IA 3GSRA 2VXQL 3OKKB 4X6BA 1IGCL 4JLRB 3ECWA 4H26B 1DLFL 1JCKA 4RAVB 5AB1A 1IGIL 1QR1B 4N2OA 2UUDK 3KM1A 3WTXA 4XWOD 3WU1A 2YPLE 3FFCA 3CC5A 4N6QA 1HIMH 2FYYA 4YL9A 1HEHC 1JS4A 2D7TH 4AE1A 1K72A 4NDMB 1USZA 2ZZUT 3P3UA 2B1AL 3A6BL 4NSKA 4S0TD 2XTJE 3US0A 3MCG1 3GLZA 1OGPA 4NO3A 5E9DE 5GHWL 3MV8A 3MUGA 1M7XA 2BMKA 1MJJA 3EGDB 3HFML 4NQEB 4G6KH 3D34A 3D05A 4PJDE 5KANG 1IV8A 3L5JA 1TSRA 3T8XB 2BNRA 3IMTA 4WKXA 3PNWA 5IMLB 4ETQA 3S35X 1OPOA 3ARPA 3FTYA 1QBLL 1T0MB 3GPEA 3VFSA 4DP6X 5KVFH 2X1XR 1ES0B 4RISH 2K78A 2ED6A 2HKAA 4RCAA 4G80B 3UP1A 3VXSB 2OXHB 3B6SB 4L29A 1A3QA 1NUNB 3RL1B 2E27L 3T3PE 2PP9A 3D7PA 4QCIB 5I17A 2VWEC 2IAMB 2WZAA 3D4YA 1DUYA 1ZHBA 2RFXB 1TZIA 5IB3A 4BQBA 2M8XA 4GLRH 1AO7B 3MLVH 3OPUA 1T21B 5JOEA 3LKPB 3MREA 3WL9A 1IM3D 4ZFOB 5BNXD 1VPOL 2YK1L 2VQ1A 3CNKA 1YNLH 4JGUA 1S3KH 4FP8H 1D6EB 1ZLSH 4RMRA 4Z7OB 3NJFA 3GSUA 4PMEA 3UC2A 5C7XL 4B6ZA 1EAQA 3KDMB 4TQEH 1UD8A 2IGTA 3QH3B 2R83A 4M7ZB 2AVFA 3QUYA 3DIVA 4AQAA 3C60B 1C5CH 2BM3A 3GS7A 1KEGL 1MRDL 5ABZA 1NAMA 3CUPB 3N40P 6FABL 2E7LC 1UM6L 1AGFB 3EJJX 1QLEL 2NY2C 2H9GA 4P9HL 1JPGA 3MBXH 2BDNL 4YSPA 4M02A 4XNUH 1A7RH 4ORGB 3P3TA 3QZBA 4C56A 5F7BA 3JXAA 2ZUTA 4NC1E 5E99H 1TOXA 5FYKD 3CLFL 4QJ5B 1CZ8L 4B50A 2ENJA 3ZTDC 2X1WL 1ZVHA 4KRPC 5ERWB 4NNPL 1HWGB 5F93C 3JWOH 3DJTA 4WSJA 4F57H 1AR1D 1XIWA 5C07D 2XBTA 4LVHB 2WQWA 5KN5B 5EO1A 1RJCA 2EE3A 1ZGLP 1I7TB 3MPCA 1TLMA 3U7YL 1RZ7H 1VGKA 2CHDA 2F53D 3EO9L 4JFEE 1P9MA 1E4HA 3UZEA 2ICCA 3QUHA 3C9NB 3WD5H 1IBFA 4YDVB 3TO4D 1RSFA 2QJDA 3IDNA 4QTIL 3H3PH 4J3XA 1HL5A 2Y1ZA 2VABA 2EDBA 3BW9A 1FZOA 1VEMA 3PWVB 3VSUA 5E5LA 1CF8H 1O9ZA 1YYCA 3RVWD 1RZ8A 1FI8C 1OTUC 2P4AB 3SYAA 4I8DA 1X6NA 2AXFB 1ZRUA 4YFLF 4PB9L 2HT3C 3JWDC 4NJ9L 1G6RH 5C6PB 5TQ0H 3T0VA 4ODVH 4YK4C 3DJ9A 1HC1A 2NY1B 4GBXB 4WO4C 2HT2C 1CDYA 2DJ4A 5EC2A 5CEYB 3BQUA 3TBVB 5I75C 3EGXA 2JJUA 4NO0D 1BAWA 1EGJA 5KBKA 3SIKA 3QNZB 3AS1A 5KYUB 3KWVA 4MS8C 1MG3C 2ZJSL 3KYMA 4YXHL 1DBBL 5MERB 2H2PC 2UZXA 3BPOB 3FCUB 3SY0A 4MMXB 2BWQA 4N6RA 1C12A 3LH2L 3CFJB 2OMBA 2XLLA 2AXWA 1DTUA 3BWUC 3LKNA 5DUML 5JPMA 4A2EA 4R4FL 1U8MA 1MLBB 3KCPA 1Q9OA 2OL3B 4HAFA 1I9RH 1WVZA 1S7QA 3DROB 5D2NB 2YD4A 4OZFG 3OKMA 2E75C 3D12B 5F3HB 3MBEB 1T66C 2OULB 2GTQA 3GIVA 3NJKA 2XBZA 5CU9A 3N42F 4FG0A 1QASA 4R5VA 2NCEA 1SJEA 1N64L 3GSNL 3SDDB 1AP2B 3VGFA 3X2QB 1EMTH 1UFGA 3GEWB 1CLYH 1MRCH 3VFUB 1UXMA 1E67A 1OWRM 1K3IA 5LWYH 4G1MA 2HKFL 3KVDD 2EYSB 3LOWA 1ET8A 4ZUWA 3LKQA 1YDPB 3TH3T 1C1EH 2Q76A 4PJ7B 4JGJA 1JV2A 3QJHB 3HS8A 2CGYA 3C8KA 3V9EA 3D0LB 3GPSA 4U49A 4UT9L 5GGRA 3QAZB 1X44A 3IDJB 4N5ED 1ETJA 2ZNXA 3WJLA 3NJXA 4DQOH 2OXGB 4TVSa 1QSFE 2VLME 1EZLA 2DIAA 1UVQA 2VLJB 3DGGB 4BK8A 4JZJC 2QHLA 5DMGD 4L8BA 1H15B 5EF1A 2LQRA 4E9LA 4U6TA 2ITDB 5JDSA 5EWIH 1YNTA 3PGFH 3I50L 5F1IB 2GJPA 4GAYB 2DWSA 4KZCA 4XBEL 5JQ6H 4ZMAT 5DFAA 1ZAGA 1LNUA 4CJ1A 2OYMA 5C0RL 4LPCA 4PJCF 1ET7A 1AGCA 2AQTA 3ZDXE 5FUOH 3EJYC 3FONB 4MCZA 1NCAL 4PP1C 4U1JA 2X44D 4OIAA 1A65A 3QDJA 1WV7T 1MVYA 1ACYL 3QQ9D 2IPKB 3FUEA 5GGTL 4PHXA 3CDZA 2L3BA 5EUOB 4APQD 3FSWA 1UCBH 4W9DC 2X89A 1NFAA 4ZQKA 3ASNB 2APVA 5CMAA 5EEWA 2YAEA 5I18H 3DI3B 1EUTA 5KSAD 4X4YB 4XVJL 3DSFL 3T71A 1XGTB 5CEZD 1A7NL 4LLVA 1AJ7L 2UY7B 1Q38A 5HHMB 4HS8H 3V52L 5E24E 2FJGA 4B9KC 5FO9B 2E6JA 1ND0A 4NGHH 1X7TA 4OIBA 5FA4B 1J5HA 5LN4A 4YHOL 5A6LA 2W8CA 5DMKA 1HSBB 4OLUH 1KCUL 4XNBA 1NEZA 4WTQA 1KXHA 2HRGA 2R0LL 2W07B 3W11D 3BP7B 2GW5A 5D2LE 3CHXA 3VD9A 4GQ9L 2VLKD 3LNFA 5FDWA 3AS2A 1A1MB 4V1DD 3QUXC 4HPYH 1WWWX 3GMPB 4DTGL 2CBOA 3RGVB 1SF5A 1QUNA 4AK1A 2RQ8A 5IVZB 5J7CC 2EQDA 4MNQE 1TMQA 2AXGB 5FO7A 4W6YB 2XQBH 3BZEA 3LJ3A 2W9LA 4XWGH 1BWMA 4OFYD 4TLKA 4QRAA 4UV7L 1ZWIA 3O6KL 5LAPA 1K2DB 2MFNA 5AWNL 3B3IB 5T1LB 1EJOH 4FULA 4W68A 1OOAA 2CA3A 3O11B 1JXKA 4H88H 3KL0A 3LAFA 1CR9L 2EYTA 5CIPB 4CILA 3KL5A 5FHAH 5KBMA 4LSUL 2D73A 3EH1A 4X9IA 4IBUA 4GT7A 5FKAA 4OFPA 1IBYA 3UAJD 5E1QA 5T3XD 4K9EH 5CJXC 5BPPA 5F7EL 1XXDC 4X6DF 3MODL 4POZD 4WEBH 3KYKH 3O9WD 2Q3ZA 4X6EA 3LZRA 3PP4H 1UQSA 5EOCH 4ZS6D 1ZTMA 2WXJA 1OE3A 3DECA 3SZKC 1E9QB 3P0YL 1F3JA 1LO0H 3A4EA 1KPUA 2Z8WC 4LBEB 4LEOA 1KY6A 4Q6IC 5PCYA 4WFGD 1Y7VA 2Q8AH 4DP7X 2WKOA 3C6LB 5D7LD 2NR6A 2Z65C 1KPVA 4N2MA 3TNNA 1F18A 5FHBH 3DO7A 4PWEA 4WI0B 4L4VB 2QLYA 1H3PL 3QUZB 2OX5B 1FE8H 1PFCA 3U2SB 2DH2A 5KVDE 2PN5A 3GDCA 2C9AA 3CN0A 2PWEA 2WBJB 5DK2A 3QQXA 2YUVA 3DBSA 3T3MB 1L9OA 1HXMB 5J6GA 4CSPA 4A7GF 4PRDB 2DDQH 3APNA 3H9SE 4FFTA 4IGBC 4Y19E 2ZSVA 1HSAB 1WT5C 2OMXA 3KYOB 2EIZA 4AV0A 2F19L 3VFTA 5ITFB 4N0UA 4F7TB 4EIGB 2APBA 1U2HA 4XB8A 3LNEA 4ZX6A 1ANUA 5EU6D 1UFUA 1I8LA 2IBZY 2QSTA 4P3CH 2VZ3A 4FLHA 5C0CE 1QRKA 3NJJA 3RY6A 3S3CB 5L2KB 4F58L 2WQXA 2IH3A 4HJJH 1S7TB 5J5EA 5C9JB 4EN2A 2EDYA 2A73A 1XWVA 1SBSH 2VDMB 4OGYH 4M4PA 1T89A 4KJPC 1MFDL 2RHEA 4N8CL 2PWDA 3L54A 3NCYP 1MPAL 4E9SA 4P59H 3VDCA 4NX0A 1S9VB 5TFSL 5E6YA 4PP2A 3CMOL 2VUOA 3CFEB 4C8XA 5I0ZA 5DZOA 1OQOA 4JFTA 5MHSE 5TQ2H 2BIPA 2YKLL 3DMMA 3X1FA 1A6PA 5JIMA 4MCYB 4RZCB 3WEBA 4PRAA 2ROYA 3CZJA 1NFDF 5IY5B 3K1KC 3OX8B 5C09B 1H8NA 1UT1A 4ZMTA 4DEWA 2H5UA 2PTTA 3IFLL 4MJID 3RVVD 4M3JA 3L1EA 4ZUVA 5JOPD 5I9QC 3VWKB 2YEZA 4OIIH 3P11H 4XCFH 4XCYB 2BNUB 2G9HB 1DZ0A 5GZOC 5D7JD 4NC2B 2H2SD 3MDJA 3WMQA 4I1PA 4GW4B 4WWKA 1J86A 4DK3A 2CKBB 1PG7L 1T3FA 2I9LB 4K5PA 3K71A 1BQHA 3UTTA 4LNRA 3VD2A 4PN6A 2QSCH 1RULH 3QDMB 3T0EA 5BV7B 1NICA 1RQ5A 4F7MA 1HL4A 1OSZA 1WWBX 3O2WH 1LEIA 1ONQB 3K6NA 4GEJA 1PY9A 4KNUA 4KVNL 4U3HA 1UH2A 1HXKA 4WNQA 4X5XA 4QXTA 4BFFA 4JR9H 1IEBA 1JD7A 5E8NA 3VGAC 4K8RC 4XHQA 1J9QA 1EXUB 3UBXA 1W0VA 3S36H 3FPYA 2BP3A 3IAPA 4OAWB 4ZPVB 5TE4H 4UT7H 1HKLH 5E95B 4A6YH 4G83A 1XF3B 4PJAA 1J1OL 4P2RD 2XG4A 1G1YA 5A3IC 3O8XB 35C8H 1U8LA 3APCA 4MTMA 3H4HA 5BJTB 1K4DB 1AGDA 4KQ3H 5LBSA 1SXBA 3ARGC 3VU1A 3QFDA 1AIZA 1BBJB 3AM8A 4LIQL 3NK4A 3QZOA 3QUYC 43CAB 1C5BH 4L4TA 1CFNB 3ARQA 5CZRA 1XGYH 2WNXA 1OV8A 5D7SL 2ZWSA 1W0WA 1GW0A 2FJSA 4GOSA 2XZCL 4EJ1C 1UJTA 1WIUA 2I60H 2VSMB 3C5ZA 3QXDA 2CNYA 3D06A 4NYLB 1A9BB 2W59A 3BUBA 3ELAT 3HE6A 4R7DB 5KVGE 4CMMA 5CHNA 3RTQD 3ZL1A 5CP3A 1ZOXA 3F7VA 3CVIL 3W9EB 3MLRH 1WZMA 2AK4B 2ZWNA 3BDXA 4ZX4A 4KI5F 2HPTA 4K7PY 3UBGA 4OF7A 3FCTA 2PCFA 2BS71 2XN2A 3EDEA 2OMWA 3OWEA 4HDIA 4K3GA 5ESVA 5F89B 2BW4A 4AI7A 1TNNA 5EIIG 5EIVA 4MDIB 1RZPA 4K3HA 2ICES 2QZ5A 1JPST 3SPGA 5CR1A 5I74B 1K8DA 3SDAD 3DYPA 3ARDC 4BD4A 3ELQA 4F93B 1QSED 2XOTA 5EN2B 3S6CA 5FW7A 3M88A 2VR3A 1G9ML 1VENA 4I9WD 4P46D 4KK6D 2FBOJ 4POYA 3ARBC 3CZFB 4WHTA 1FBIH 2WCSA 1QPPA 2YC1A 3AACA 4JFYA 4JY6B 4WI3A 3GXDA 4NHCH 4KZDL 2VRAA 4OM0L 2P45B 3HBQA 4X4XB 5I1GH 2X4NA 3CZLA 5AVRB 3UTSA 3MACL 2UVFA 5E9AA 1QZNA 3BH8A 1G7LA 1RFDH 3ILQD 1P7HL 1JPFA 1QP1A 1MCPL 1QTSA 2YSTA 3KXFB 5F9JA 2JCCF 1LP9B 5BRZA 5DZPA 4QF1A 2FH6A 3R7QA 3SQBB 5C0IA 5F1KC 3ARTA 4FOMA 1I9IH 3ASWA 3OG4B 4R2GC 5DYFA 4PS4L 3FFCE 4N2GA 1CGYA 4JCLA 4W9JC 4S2SA 3QJZA 5DHYA 3KD4A 1J0IA 2FVNA 5SWSD 4GRMB 2A6IB 3FB8B 4YX2L 3U4BH 3ZU8A 2CJUH 5HD8C 1ZANH 1DLHA 1ZPUA 2R4SL 3DA0A 3MA9H 1WH0A 3S48A 3VSVA 1LL1A 3O6MH 2GSGA 3GJFB 3NSJA 1KSRA 1DSYA 3QUGA 4HIIA 3TH4T 5E8DH 3MV8E 1A9VA 3B9KA 2IXQA 5DS2A 2WKLA 1UZ6E 2F7RA 3EJZD 1OSPL 1T83C 3QYMA 1FO0B 4WUUB 1H3TA 2IDUA 2JIXB 1U8QB 3QA3B 3DUUB 2OJZH 2BNRE 1CDGA 4XPGL 2C1PB 2IH1A 2OYKA 5IQLA 1MXDA 4G9FA 1SLXA 3UP6A 1D5IH 1G7MB 1S7RA 3FQWA 3OQ3B 1I4FA 1L6PA 1TJGL 4KUCD 4JRXD 4NJAL 2AJXL 2CPCA 1QWUA 4QYAA 3U9UB 1SOKA 4AMKH 5SV4A 4X5PA 4OCXH 3WE6A 1JRHI 1K6QL 1NC2D 4KPHH 4NXSA 1FGVH 4GKZB 2JB5H 1X7SA 3PQYB 1J48A 3KJ6L 5I1HL 1UCTA 4MAUL 3D3VD 4R7NB 5DRXB 1R24A 3T5WA 1OGAA 4ES8A 4LCWB 3VVVA 3LN5A 2F5AL 5C9KA 3VG9B 2C9PA 3GNML 3NTCL 1X5HA 1KGIA 1SLWA 2GSIB 2OMZA 3F64A 3F8UB 3WAJA 3FTZA 4HLZH 1OKEA 3N6YA 3DHJA 4WI5A 3R06A 3WS3B 5MEQA 1W8NA 4Z7VA 1MVFA 4U1KB 4L1SA 1WE5A 3E1F1 1RPUA 4XX1E 4RMVA 1HI6A 3NP3A 2BZ7A 2ZUXA 1I1RA 4YVUA 3TZVD 2ZX6A 2XTSA 4P0DA 3LEXA 5FKPA 3VNYA 1EEZA 2A99A 2DYPA 2TSAA 3IXAB 4C56E 4K3JL 4ELMF 4F2MB 1TQVA 2F5BL 2Q3AA 2VXSL 3CSBA 5DZAA 4AM0Q 5IIEA 3EUUA 4OBRA 5F0PB 4RA0C 1EFXD 1J11A 3B37A 1S2EA 2GTWA 1DBKL 2NT1A 1I9JL 2F8IA 5D1QD 5LNDA 3NPSC 4J3WA 2ODHA 1WRFA 2B4CH 3WDJA 3UBHA 1YEEH 3BE1L 5AD0B 1DFBH 1KC5L 2OQJB 4J8RA 2XQYA 2Z8SA 4J12A 2A74A 4HD5A 4OLEA 4UOW1 1F86A 1LILA 1I7ZA 5IT2H 4OZIF 4Y4HC 3CSPA 3WUWB 4YHKH 5JHAA 1GGCH 4DVBA 5I6OA 2VDOL 2NNAA 4M8QB 4GRLB 5C0BB 5EO9A 1TTAA 1KBVA 2ZD0A 4TULL 1ZVSB 3U1SH 2UV3A 2FIKA 2B0SL 1D6VH 4WHYH 3WN5C 5INDB 5ES4B 2P47B 3INUH 2HRHA 4HKBA 1E3ZA 4ZBJA 2ZOUA 1UC6A 1O5DT 3PJSA 4M6ML 4AWJC 1OGTA 3KBHE 2CKBH 5KTEH 4YDJA 3WIFB 4XNQB 4CUCA 3BDYH 3LEVL 3N41B 2OV0A 5DUBB 5BV7H 2FLBT 3NYKA 2VDKB 1PIGA 4M7JL 3BVNA 2X9ZA 1O7SA 1INDL 4UNIA 4JHZA 5CUSL 2I07A 4W9ZA 4Z7UB 1MF2L 2EIJB 4RDQG 1S7XB 2W65A 4XPFH 2CRYA 4YHLH 4G5ZH 4IRZH 3BKML 4QGTA 2ADFH 5GSRB 1AKPA 3NH7H 3ZSTA 4AVIA 4L3CB 4G3YH 1ZT4B 3UJJL 5IF0A 1HCVA 1NPJA 1T80A 3WEXA 3FUKA 3MGAA 4HGWB 4JBSA 4WW1A 3OGCA 2HWZL 2DI8A 1OT4A 3MRBB 1GTNA 1BMZA 4AUJA 1CS6A 4WVRA 1RI8A 3BGFC 2VGLM 4JZOA 1EHLL 4CADB 1JERA 1D9KB 1FAKT 3JSSA 1GS7A 1Q9LB 1E6OL 5AVVB 4TSAL 3BAEH 3MGTB 1IE4A 2GCYA 4HIXH 4AH2A 1F4YL 1Y0LA 4HMEA 3GT6A 3OWRA 4JFVA 4Y5VC 3MLWL 5DD1H 3HHSB 4M5SA 3AREC 3UG4A 4P99A 2B5IB 2H6UA 3NIFE 4AE0A 3ECVA 3M1BB 1GAFL 4PJIB 4BZ1H 4GW1B 3K7UA 3VXQB 5TGBB 3WEOA 1VADA 2EYRA 2WVUA 3AQZA 2CM5A 3KWXA 4LCCB 1J9RA 2EDDA 4YSUA 3WNMA 5SWZA 3VO0A 5CEXA 4RFOL 4XI5D 5C0NC 5DK0A 1INEH 1UWYA 2A4ZA 5CCHE 1XDTT 1L3WA 5TDPA 5C0FB 4PB0H 4G8FA 1G7HB 2P5EA 3BLPX 1AMXA 2BXZA 3OJDA 4J4PA 4PJXF 3S4SB 2CBMA 4G42B 3IDUA 3BSZA 5LGHH 3VI3B 3BN9C 1H6EA 2B2XL 5EFIA 3HCVA 3QXWA 4FLSA 2BCMA 1Z66A 1G6RA 3QZMA 4OQTL 4AQ8C 1CURA 3OAZK 1FH2A 1DQJA 4W9HC 5I0XA 2J73A 3LRKA 4WTXA 3QDJE 1E5ZA 3H4FA 1R5VA 3U0TA 4D7BA 4ONGL 2PO6B 4QHKJ 3C6EA 2V5YA 4EI5A 5E6UB 1ZS8B 5BS0A 2QQKH 4OV5B 1WBZA 2AEPH 3OB0H 3LCYA 1FFNA 5L8LB 4AIEA 3TYGH 4Z3FA 1WF5A 1AYRA 4JFZL 1T89C 3BUQA 5IP4A 1FJ1B 3NZ8B 4R0LA 2VL5A 2V2XA 1YPZA 3ARWA 3E3QE 3FK3A 4PBVC 4P2QD 2MNWA 5JIPA 2XA3A 4IOFC 1FGNH 3G9AB 2VZTA 3NCBB 3GJFH 5T1DL 3CK0L 1YEIH 3GS0A 3Q1SL 2K45A 1XB8A 1N68A 1MJUH 1MIML 2K9FB 1MCDA 1VDGA 1RY7B 3FULA 2QVTA 5KZCD 4CSTA 4Y16D 4LARL 1PNDA 4LSQL 4A2GA 2VIRB 4NENA 4LPYA 2ZAGA 1FL5A 4QWWD 5BOZG 3ULUD 4W81A 1RZGA 1GZQB 4PPTA 5CGMA 4MCNA 5GGSB 1UWXK 2IQ9H 3KS0H 5DJ6A 1XR8B 1JPEA 1ZD6A 3VGEA 1MFEL 2A9CA 4Y5YC 2FX8H 1LDPH 2ROXA 2M1KA 2C9SA 3BWUF 4N2HA 1UB5B 3MUJA 3QNYB 5IGXH 2ZUUA 3LZOA 2MH4A 1XD1A 4RAUA 3JV6B 3WIIL 5D6DA 4MJ2A 2E9BA 1X6LA 3UYRL 2EIDA 2HUHA 1LE5B 1P5UC 3BT0A 7CGTA 3FCGA 5I16B 2DJMA 1CGTA 2AJZB 2BK8A 2KLTA 3VYPA 5AZEL 4XBPA 5A2AA 2RBLA 5GS1C 1DANT 1UM4H 1BX2B 4MQTB 2DWYA 4I0PB 2KT6A 3X1BA 4GKLA 5C0GB 1J1PL 2BVQA 4RGOH 1DJHA 4X5RA 4X0KA 1S7VA 2XICA 2X0UA 4AITA 4RRPA 4RMQA 5E6ZA 3FU9A 2R27A 4HEPA 2DLIA 1RPQA 5CZKA 4YXLL 2KL6A 1P4IH 3TA3A 1W0YT 3VD1A 4MDRA 1A3RL 4FFZH 4R90L 4IDJH 4HG4J 1XB3A 2IFFH 5CKGA 2RIKA 3AS0A 3EO1B 4G59C 1E8XA 3PHOA 2ZCKL 1PCSA 1WGVA 3MRIB 2IIJA 3TCTA 2CGZA 3FUHA 4YHNB 2Y6SC 5CCKH 3BVTA 3DETC 1B0GB 4OFDA 5E08H 1CCZA 2WIMA 4NN5B 4U2YA 3TCLA 3CVHA 1V10A 5FYLL 3UZVA 1WAAA 1Z9SA 5CP7A 3U9PH 2DTSA 5D71L 3GB7A 4Y1SA 3MJ9H 1DUZB 2YMXL 3H42H 5D7IB 3EXJA 3GMRB 4HLEA 3GK8H 5D5MF 2XACC 5JQIB 3AU0A 3O41A 5AW0B 5H8DA 4Y5XC 4UU9B 3BJLA 2Q86B 4N0UE 2R2CA 4K94H 4ZTOL 3R7RA 1S8DA 2YGPA 4NM4H 4R26L 3THML 1I8IA 4Q4EA 4Q9QH 5FGBA 1F2XK 3DTDA 4N9GB 3LS4L 3U46B 5D1XB 2VDKH 5EBWB 1UWEL 4M8VA 32C2B 5I15L 1EEYA 2X5PA 4GSDL 1NGQH 3WFDH 3C60A 2DQEH 1LO2L 3V6OA 3ZYOA 3CUPA 2R1YA 1OB0A 3CHSA 1WBXA 4EDXB 2Z4TA 1XH3B 3IETB 3SO3B 1N59A 2AKRA 2XWTB 1TPXC 1EHKB 3D50A 1F3DJ 2VAJA 3NGBB 4YS4A 1TTRA 4FFWC 3T2LA 1YEFH 3QXTA 4XC1H 3LVEA 5D8JH 4Q0XH 3F85A 2IG2L 5T1KA 5LG6A 1VACB 1QA9A 4DJMA 1CXLA 1H3VA 2GJ6A 2PYFB 5KS9A 1OAXL 1CVSC 2FD6L 4PWHA 4W4OA 2BJMH 4DKDC 4F8OA 5IJDC 2JCWA 3DNKA 4NP9A 3TT3L 1GKEA 4ZUTB 1P69B 4LLUB 4NO2A 4TNVF 4W9LC 1QLEB 3GO1H 4RFNC 2XETA 1AD0B 3OF6A 3UTTE 2FHBA 4XMKH 5K9JL 3T0EE 1T6BX 4D9QD 4PH8A 1TEFA 1XH2A 2X2YA 2RALA 2QV2A 2WQAA 3MV9D 4IKIA 4M7KL 1NC4B 3D85A 5ALBL 2ICEA 2XPZA 1A4KB 3C9NA 4UQIM 3V4PL 3L81A 4JFFA 5M7QA 4G8GA 1JSYA 3CMGA 3MRPA 1UWGL 3NIGE 3HC2A 5IB5B 1KZQA 3AW5A 3C5JB 2Q87A 5FFGA 1MCQA 2LV4A 2CH8A 3QUMB 1IRAY 1G94A 4J3SA 4Q14A 4UQEA 5KBPA 2ICWB 3RY5A 4PJAE 2VLRD 4UOW0 3U7WL 3PLYA 3O2DA 4MB5A 3F7RA 4PW3A 5JW4Q 5KAQF 4FQXD 3LQAH 2CDEA 2WANA 2EUWA 2WUCH 4ZMZA 3VDAA 5DO2C 1OE2A 4L4TE 3MQIA 2R29L 1OL0A 4GBXA 1DJIA 1DBJL 2C4XA 4HQQL 3TBVA 1OOWA 2N7SA 2FT8A 3QEQE 1JI2A 5KYUA 2NTFB 2VR6A 2Y23A 4BWUA 5LN8A 3I2CH 2FO4B 4AXWB 4TVPE 3T4YA 1T5WB 5I1IH 2ZKWA 3CFJA 4X98B 4JUTA 3K8KA 2NQCA 3F7PC 3WSQL 3MRCA 3SKNB 2N01B 2VR4A 4YZFE 3GBNH 3H8NA 5GGQH 4HWZB 3PNRB 1FLRL 3T0WA 4R9HA 5IJKA 4YBLC 3MBEA 4LF3A 4JM4H 2EXYC 1OW0A 3NFPA 3P0GB 3VFGH 4NT6B 1HDMA 3C5XA 3WI9A 3QNFA 3UDWC 4ONOA 4DT2A 5KAQG 4HV8B 5BOJA 3SDDA 2H6PB 1E27B 1RERA 4MXWH 2X6VA 4UYPA 3GGWA 4UI2A 3FCSB 2ZUYA 1YDPA 2Y07L 1YA5A 3QJHA 4W70A 3SDCC 4P3DA 5GGVH 4LOFA 3UTSE 3BD3A 2HRLA 4MD4A 3V0AC 1IBHA 5HJDA 2BFVL 4PQXA 2VLJA 2EO9A 5BRZE 3DGGA 4OW6A 1MCKA 1N5YH 5KVEH 3FJTA 1CC3A 3GZQA 2CCVA 4H8WH 3GSNB 4A6YA 3EIFA 3ZZQA 3EJSA 4GIAA 4LP8A 1A6UL 3ZDZB 1A7PL 1E6JH 4BFBD 5JYMA 1FNGA 1NBVH 3QIBA 4NUJB 1KGYE 3ZMNA 4PS3A 2D0FA 1KJ2L 4XZUA 5HHXL 3NZHH 2YO3A 1T1XA 2JKTM 3VXNB 2DQGH 3ZL4H 3B2PA 3AC0A 1NCCH 5JHDA 1PZ3A 1IT9H 2CM6A 4EZLA 4TNVK 4UQBA 4P4KC 3RY4A 1J5OH 3IKCB 3CTTA 1WHOA 2WK2A 4RMSA 3KNBB 3S88H 1IBDA 4K7FB 4QTHA 4HHGA 5D4QA 4BELD 4BHUA 1RVFL 1UEYA 4C4BA 2RQEA 4G9FE 1RIUL 2X1OA 4P5MB 4Z5RA 4BGLA 4Z7QB 3L7FB 3PWLA 2ZXAA 1ODUA 3EOTL 2Z35B 1KPRB 2CBPA 4ODWB 1DEEB 4PJ5D 3HG2A 4TRPH 5DHMC 1EK3A 1UYWH 1WITA 4UB0H 5HPMB 1IGCH 3BP7A 1U8KB 3C08L 1IGIH 2GUYA 5A6IA 4JKWA 1QEXA 1B0WA 4GS7B 1M56B 2Q1EA 3BUTA 1EJ8A 1X5GA 5KYXA 4PLKC 1OGAE 1T6VN 2B1AH 3A6BH 2HFEB 1CICA 1IKOP 1SN0A 4Y4KA 4OFVA 3GZPA 4NPKA 1V27A 5GHWH 3VFPB 1K2DA 2PXYC 4Z7VE 3B3IA 3HS0B 5T1LA 3UERA 3HFMH 2UX7A 4P23B 1GY2A 3O11A 2CXKA 4M5ZL 1W6WA 3U6RA 3W0WA 2K8QA 2K4AA 2YPLD 1FVCA 4X42A 1QBLH 3KR3H 1FQ9C 2FEEI 4NQDB 4AQ1B 5L0QC 3JWDL 4KNQA 2N1KA 3P4MA 1O6VA 2XTJD 3ESNA 3FN9A 2XPGB 5E9DD 1JTPA 4UCFA 4DO5A 1N70A 3ULSB 1A6AA 3T65A 3QJTB 3VB9A 4Q56A 2LTQB 4X6CA 5HVWA 4MAYC 3NA9H 4B97A 4LBEA 4V11A 2H4EA 2AAVA 5B1KA 3I6KB 2YK1H 5SX5H 1FZJA 1QATA 3Q6FB 4KUCF 4X50A 5C7XH 5KVFE 5AVWB 5HYQB 2J4WL 1VZIA 4LCYB 3AT9A 5DEGA 2GFBB 4FKEA 4L4VA 4ZFFB 5H94B 1KEGH 1NDTA 1MRDH 3HN3A 2OX5A 4CMHB 5E0QA 6FABH 2IPUG 2BOBB 1UM6H 5JIKA 4IBYA 1QLEH 1M7UA 3FO1B 2WBJA 4OZGA 4P9HH 1JGEB 3MI6A 1MY5A 1E42A 4YDMA 2V4LA 4X7TA 4IRJD 5LBVA 12E8L 3B9AA 1Z9PA 5C6TL 2AC0A 5ICZA 3CLFH 3L9RA 1B0RB 1CZ8H 1AQDA 4HUKB 3QFJB 1MHCA 1MCIA 4M5YL 2NXYB 2DW5A 4NNPH 2N56A 3RWFB 1Z9MA 2A9NL 1CXHA 3HB3D 4PWIA 1JZ8A 4BFIB 1P7QA 1HYSD 4UNTA 4ZQTA 2R1XA 4I18B 1S7TA 5JIQA 5IFAL 3GQFA 3B7YA 2WTRB 3S2CA 5AOKA 3U7YH 4A2DA 5LQBL 2NUPA 2UY6B 3EO9H 3QCVL 4JGMA 4KO5A 3WUZA 5H4ZA 4EN3B 2Z1PA 4WI4A 3CXDL 1LD9B 4QTIH 1CGSL 2VN3A 3TO2A 4IRSA 4PCSA 1F90L 3OR7B 4Y2DA 1AC6A 1T1ZB 4XBGB 3NJLA 3NUKA 3UJIL 1X5IA 4JDVB 4PVBA 4RX4A 2OMVB 5I1KL 2ITEA 5MEND 4HGKC 3F12B 4B9PA 5CU5A 4G6FD 1D2OA 1NCDL 4PB9H 1MCLA 1NCBL 5DVPA 5E8EA 1FF5A 4KXAA 2JLLA 1SXZA 4NJ9H 2HT4C 4Z95L 4ODXA 4JFED 5JW5A 4M9OA 2EXSA 2ZUSA 3EYUL 3TFKC 1R3HA 2G9HA 1N19A 2MNJB 5F1NB 3T77B 3AXLB 5T3XL 4UM8A 4Y4FD 3TIDB 4OVUA 4P57B 1AZZC 2ZJSH 3P69A 5SWZE 3WJJC 4YXHH 5I1LB 3CBJB 3HKZA 4GW4A 3BLKA 2ZXEB 1I85A 2CKBA 5IVXA 3LH2H 4F8LA 1AZVA 2P5EE 5DUMH 1ONQA 1OT1A 4G6ML 4R4FH 3TBWA 3KWTA 4F5CA 3MRHB 3REVA 2HP4A 5ITBL 2IAMC 1UZ8A 4KQ4L 3LZLA 4IRZA 3SO5A 3KGTA 4P48A 2QPFA 5BS0E 5L2JB 4XCCL 3TT1L 1J8HA 1N3NB 1O0VA 1N64H 1X5KA 3GSNH 2J71A 3P1VA 3FUIA 4TMPA 5IBLD 1A1OA 4FNQA 4JHUA 2XHNA 2KLRA 3IAQA 2FDBP 4FA6A 1CI5A 4KFZC 3S5YA 1K4DA 4D7PA 1CDUA 3P9MA 4ABVA 3D18B 1YPZE 4M7ZC 3ZKMC 4P5TA 3C60C 3RWEB 5I5MA 3AUWB 4UT9H 1F56A 5C2BL 3N85L 4PCTA 4LFHG 4XMUA 2VXUL 3D51A 4MRCA 4JN1L 3DARA 5GRXG 2F7OA 4NRXA 3I50H 3T6VA 4LSPL 4XBEH 5GGRY 4K5MA 4FI6A 4EMZA 1E2WA 1B4LA 5C0RH 4H1LB 2NYYC 4HCFA 3UG5A 4BZ1A 3MJ8A 3C09B 3K5SA 1F6LL 2ITCB 4J3OH 3HUJA 5DD6B 2UUDH 5TK4A 5IQ9B 1Q94A 3FHEA 5D1ZD 4ZAKD 1QRNA 1VRSA 4MDIA 4OD1L 1ACYH 1G7IA 3UBXI 4YDZA 5GGTH 1UH3A 4UTAL 5EF3A 1QSFD 3PGCB 1G9EA 3CFMA 3O6FD 3MNMA 4PSPA 3VFOA 4BSVB 4IBLT 4HBQA 4LVHC 2J72A 4ELDA 4GRWF 4JM2B 4JG0L 2H1XA 2IANB 4C4UA 4CBPA 3MJGX 1C08B 4XVJH 1HQ4B 2FHFA 1A7NH 2WOBA 3M6DA 2BSTB 1AJ7H 2WAQA 4FG6C 5JZ7D 4OZ4B 1RJZA 3V52H 4PJ8B 1U8HB 4XR8C 3DVNA 4JAMB 5A43C 3HZVB 2AV1B 4RETB 2A77L 1SDAB 2E9GA 2YR3A 2DYRB 4YHOH 4B9JA 3ROLA 2ZSWA 1BXVA 3QIWA 1KCUH 1LP9A 1OP9A 1U3NA 4XVUD 2R0LH 3QWQB 1AFVL 4L8SB 2K3HA 2YEVB 5DZNA 5I1CL 3A3YB 5JXED 1GCFA 5F1SA 4GQ9H 4B0MM 3O3EB 3ZPDA 3CQQA 4PU2A 4Q9RL 3KLHD 2YQBA 2OMUB 4QRTB 4DTGH 1S5IL 4PJEF 1X3DA 3UGUA 2WLJA 4GRMA 2NY1C 1E2VA 3BEVA 1LMIA 3MOQA 4N4YB 4PLJD 4QT5A 2YXFA 3HN5A 1AH1A 4IBZA 3GJFA 2PYEA 4UV7H 3O6KH 4MJJA 5AWNH 5EEXA 3BPOC 4I3GA 4MMXC 5DR5L 1GYVA 4WW2A 4GY4A 4P4RB 4YDKL 3LHPL 4YC2B 1SMAA 1CR9H 1WAAE 3DUUA 1GYUA 1HHGA 2ESVD 1U3HA 5E9NA 1A21A 1KB9J 2C1PA 4LSUH 3V2AR 5F88A 1AHWB 1FNEB 1OGSA 1PQZB 5LGJB 4MNQD 1G7MA 1GRWA 3N42B 5DLML 4FHBD 5D2NC 5F9DC 3ERXA 3O3AA 3QR2A 5F7EH 1N0LA 1YSOA 5L8KB 5B39B 3MODH 4IJ3C 2HCZX 1A1NB 4PRNB 3IMWA 4PRIB 4XODA 3U9UA 1XEUA 1KIUB 4PW4A 5IHZB 1T1YB 1DANU 1M1XB 4N0YL 2BWDA 3SDDC 1CXKA 5ADPL 2V5RA 3K3QA 1HOEA 3Q44A 4YXKL 3P0YH 2BINA 2P52A 5FM4A 3NACH 4BH7B 5ID0A 1ZV5A 2VLLB 4NRZB 4UIMB 4H8QA 3GYRA 3KHQA 2EXTA 5DRXA 2HRPL 2E46A 3FKUS 1XZ0B 3JT0A 4YGVA 3QAZC 2Q8BL 3BZDA 4PTUB 4S1QL 3NEXA 3QORB 4BKLB 1KIPB 1H3PH 4FJZA 4FQLL 1UD4A 1TVBA 2RJMA 3V5HA 3P2DA 5FK9B 3UABA 4K8RL 2UWEF 3V6OE 1KB5L 1TEGA 2Y1VA 2A6KA 4DK5A 2DQDL 4PJCB 4HUXB 4XMLL 5T33L 2X4QA 1BD2B 1FH5L 4XVSL 3MOAL 3NJHA 3SOBL 1A6WL 3CDFA 2ZG2A 1GPOH 1K4CB 2B9AA 15C8L 1YJDH 2X09A 3HE7B 2JSFA 1ETZB 1E5AA 2D9QB 2F19H 3EG9A 3ZMEA 5HGHB 4A04A 1JWSA 5KBNC 2GJ6E 1KEML 4YAQA 5KS9E 3F7LA 3BKJL 3DX7A 5C6WH 1P1ZA 3FQ2A 2R23A 3GSOB 5E2TL 2DKSA 3DURA 2X9XA 1X5JA 1R3JB 3SYCA 2FEDC 4KY2A 1X5XA 4G7QB 3HLAA 1P6FA 2OTPA 3ZJAA 4ISVB 4F58H 3FUJA 4TF4A 4H8UA 1D7CA 3WN6A 4FTDA 4Y19D 4GINA 5MEPB 2IDQA 3RX8A 3WTSA 4HJEA 1MFDH 2PCPA 2FX9H 3JZ7A 4N8CH 1PX8A 2CLZA 3VI4F 1KGWA 3TVMA 1MPAH 3GMNA 2DMCA 1ICTA 4JFFE 2JJTC 3CMOH 3PWPB 4G8GE 2EEAA 4XAWL 4OUUB 3N40F 1OP5K 2ZXDA 2LVEA 4HU8A 3Q2CA 3HG0A 4WHDA 2YKLH 1B2YA 1GMEA 1UH4A 3WEAA 2DRUA 3Q8EA 3R4RA 4JFOB 5I30L 3WIFA 3RGVC 5C0CD 3MU3A 2DLTA 2XN0A 1RV6X 2F1BA 1JI1A 3IFLH 5EC1B 5EOCJ 4EZJA 2XC8A 4R4BB 2ARJA 2R0WL 2XX0A 5EZLB 3SCMD 3APDA 3NSCA 3G3LA 3C2AL 3TCXA 1EHAA 4HUNB 2BIMA 4C57C 4ZTPL 5GSRA 3PHSA 4ZMQA 1N5AB 1LEKB 3SDXF 2H8PB 2EKSB 1CG9A 2AEQH 1MFUA 1GHFL 1ZT4A 2Q5BA 3HG1B 1J1XL 2NY6B 3QZWA 4E9RA 1WC7B 3D07A 3PWUB 3NRFA 2ZOLB 4KTDL 2IBBA 1PG7H 2TSBA 3G6JA 5E2VL 5AVYB 1DQLL 3S5LG 2IF7A 4U4BA 3FUDA 5IJVB 1I1YB 4ZT1A 3GJEB 4YPJA 2LE9A 3MRBA 4MA8L 4X6DB 1DP0A 3CVDA 4HZAA 5KSBF 1NIFA 4KVNH 1UASA 4LKXB 2NW3B 3ARFC 2R15A 1D9KA 2CHNA 2YUZA 4PRPD 5DJYB 3LPPA 1D5BA 2DBJA 3RBGA 3MLPA 4XP4H 3VG0L 3GMMA 5B4MC 1RUAL 2B1HH 4CC4A 3RRQA 4JFPA 3VD3A 3GXUB 4KMLB 5IZ7A 2R0KL 1J1OH 5F9AC 3ZT6A 2ALAA 4WGVB 3C6LC 1C16A 3M1BA 5DC2A 3WXVL 1KELL 3BAIA 1GSMA 1MCRA 4LIQH 4A39A 1ZTXL 3QUZC 3UTQA 3EHBD 1EO5A 2HH0L 1Z32X 2XZCH 2DWDB 2J6EL 1BOYA 4MRBA 1XMWA 1JXGA 2WBJC 3PYCA 2VLJE 3IXTB 4RA3A 3TF4A 1IJNA 4G43B 5T8IA 2NNFA 3CVIH 4NP4L 4HJ1A 4LCVA 3QI9B 3HNSL 5ETUB 5C0FA 4WIQA 5HHOB 2EXWC 4ZXBA 2WHVA 2BP8B 3S4SA 4P07A 3WHXB 2FT6A 1XSIA 4XVTH 5ISZA 1I53A 1OTSC 4Z7NE 5C86A 2KYIA 4Y2OA 4OZFH 3LHAA 4OCSL 4RMTA 1JNHA 4IKLA 4JX0A 1ZS8A 3GM8A 2ZKXA 3GLDA 4YDIH 5JHDE 4EDWL 1N2RA 4NKOB 1AHMA 2WVTA 1G9MH 3O3BB 4NCDA 1OSYA 4AUUA 2L7EA 5BXFB 4Z7AA 4RMBA 4G8EB 3NZ8A 5DMIL 1KGJA 1URIA 2EKJA 3W82A 2BSDA 4KZDH 4WLCA 1KBKA 4OM0H 1EVTC 3VCLB 3MACH 3NDZE 1I1AB 3ML8A 5CINL 1NFDB 3A6CL 3LKSB 2UZYA 4Q74A 1MCPH 3GSQB 4KKBD 2X6MA 1IX2A 1ZLEA 3U4KA 2VZOA 4KGLA 4R97B 1T7WA 4N2IA 2BOCA 3QYNA 1SPDA 1EA9C 4PS4H 5CSGA 2O6CA 3DOSA 4K71B 4MDJB 4KTYA 3MCKA 3V9FA 3VWKC 2BSRB 4PY7B 1MI5B 2NQDA 2ADJB 3AY4C 3QGVA 3WGVB 1G5AA 4YX2H 4KKAC 2R4SH 2XWRA 2YPVL 3GWJA 3HI6L 1D7BA 5AB9A 3FB7A 2CJ3A 3HZYB 3KM2A 1RIHL 4LHUB 1NGYB 1UB5A 2X70B 5IBTL 1Q72L 1PX4A 3IU4L 1SLUA 3VD4A 1OAQL 3MGOA 2ZOKB 2HTLC 4LSSL 4ZMYA 1QTYT 5CBAA 3T4AB 3TN0A 3W0WE 5BV7C 3PDDA 1CTMA 3FFCD 4XPGH 1NLBL 4XN2A 5I16A 4CDHA 1WA0X 2R2EB 3RWCB 3FTSA 1DCLA 1TJGH 1U91A 3D2UD 4L3EA 3ZE1F 2CDFB 4NJAH 2AJXH 1MCJA 3CWGA 3MX0B 1EZSA 3JWNC 2J5WA 3GXIA 1HXYB 2MPVA 3MV8D 2WXOA 1K6QH 4N87A 4ZW5A 3O8XC 4X6CE 1DDHB 4AEIL 1V7NH 2YHGA 1VFAA 4H13C 1E7UA 4GMTL 3KJ6H 1C7SA 5E8PA 5HHNB 2BNRD 5I1HH 4MAUH 1ZKAA 3POCA 2XIBA 4HFUL 3QEUB 1E8ZA 3DHPA 4ZMXA 4PWGA 3FSAA 3FU3A 1MWOA 2F5AH 2C3GA 3GNMH 3NTCH 1T1WA 1U8PA 2LT9A 3MRIA 1JBJA 4MA7L 4L4VE 4UT6L 2D7OA 4L0YA 3K72B 2WCPA 5IKCB 5CJBA 2VXQA 4JRYB 5HYSA 1JGLL 3QJFB 3CSYA 4OZGE 1SBBA 4Q58C 2J25A 4GAAA 5KBDA 1XSKA 4HJGA 4H5SA 5D7IA 5JLZB 3GMRA 4NZUL 3ZE0F 1U8OB 3EH2A 2F5BH 5DRZA 2VXSH 5E00B 2ETWA 1BM3L 3ABGA 3M17A 4JDZB 2W5PA 2O6PA 1IILE 3U7AA 2FUQA 1DBKH 4XH2B 1I9JH 3G5XB 5TDNA 3T8MA 4JCWA 1IGYA 1NMBL 3BE1H 2Q9OA 4LPTA 3U4EA 4WI6A 2VDLL 3ECQA 4N9GA 3U46A 1KJ3H 1YLBB 2X4PB 3KPLB 4ZODA 5FGSA 3SBQA 5E6RB 3HBPA 5EBWA 3WDIA 2R1WB 1ADWA 3PDGA 3WAKA 2VDOH 4C56D 2JCCB 4PTTA 1CDCA 2ZCHL 4ZMPA 3HG5A 1DVZA 1CF1A 4MNHB 4TULH 4OB5L 2B0SH 5DVNA 3S8WA 5ILTL 2P9RA 3NCXA 5DJCB 1CDJA 3MBWA 3HNTL 4M6MH 1SZNA 2YD6A 1ZVNA 4HUUB 1MIEL 1B6DA 5DLLA 3IETA 3SBPA 1BOGB 4JDEB 4ANVA 5GS3A 4NRYB 1XIWD 3LEVH 6PCYA 2XPYA 4RIRA 1INDH 4IW4C 1IBZA 4N0CC 5EZOL 5CUSH 5C08B 2AQ1A 1MF2H 2VXVL 4LQFL 1J7VR 4EE2A 4NQUA 2WLLB 3A4DA 1TETL 3T3PF 2C4FT 1FFTB 1RUKL 1VACA 1K5NA 4PR5B 2V7HB 3WKPA 4Z3GA 3M46A 3MROB 5FFOA 1ZLUH 3BKMH 2JJWA 2X87A 3M7OA 2P8PB 5F7DB 4DP8X 1G87A 1MELA 3RVTC 5I1DB 4ELKB 3UJJH 2F7PA 3MLSL 3FQUB 1SMDA 4LLUA 1J8KA 1U3ZA 5GJSL 3KGUA 2ZE0A 2AW2A 3IJEB 2JQZA 3V9CA 5IVXE 1HFUA 5FOBA 1NFKA 1GS8A 1AXSA 2HWZH 4YHIA 3RZWA 3ZIMA 4LL1A 1WA1X 1EHLH 1DVFB 1M7DB 5C0DA 4DP4X 5HDWA 2CDGB 4F5CE 3FHAA 2CE6A 4L1BA 3BZFA 1NIAA 1RLBA 3OMAB 1E6OH 3BQUD 2XX1A 4TSAH 4XMPL 5E1AA 1LHZA 3LKRB 5FUCC 3VYOA 1F4YH 1A4BA 2YD8A 2VJ0A 3E6HA 1J8HE 5IMMB 1G84A 3MLWH 4N8VG 5ID1A 1L7TL 2E9IA 3D39A 1L5GA 3OMZA 2ZYIA 4MVBD 5J1SC 1JZEA 2B59A 1GAFH 2YSSB 5IEKB 5DJAB 5T3ZL 3VG9C 3NK3A 4XP6L 1CGUA 2ED8A 4MD5A 4N1HB 1RZKC 1RZIA 3V4PB 4TUOB 3KYNB 2VKWA 2NTFA 3PS6A 4AGOA 4MA3B 3EH5B 5DD0L 4MB3A 4JQVC 4Q2ZA 5ALCL 2BCKB 4KUZL 4RFOH 5CD3A 3U25A 4I77H 2OCCB 5EZJA 3B5TA 3WMPA 1U8CB 1SYSA 4M7LT 3OR6A 3O4LA 3QQ4B 5J8OA 3SKNA 3OZLA 2IBGA 2B2XH 2VRKA 5SX4H 4OQTH 1IAII 2K9UA 3HUJE 3B2UD 3HHMA 1QRNE 4XVOA 2HTKD 4ONGH 3KWWA 3CX2A 4U1GB 5AW7B 4NT6A 5AQ0A 4DGVL 4ZPTB 3T6QC 3I02A 4KK5C 3V4UL 4AGPA 4OZIB 5DHVB 5L9DL 1E3FA 4DQAA 5EU3B 4KDVA 3GSVB 4ZSOB 2WXNA 3C75A 2MQ0A 1MHEA 5GS0C 4JFZH 1R46A 2G60L 4ZO7A 3TA4D 1IKNC 4GRLC 4ADIA 1I8AA 2RTTA 3U36A 2Y4SA 2QVFB 1IM3B 3L08A 1SOQA 3DVGB 5T1DH 1KNOA 2NY4D 1WZAA 2VR8A 3E8UL 2D3JA 3CK0H 4HKXB 4RMWA 1UURA 3Q1SH 1ZDSA 3QDJD 5IV2B 2I32A 4I3SL 2CNZA 3DX8B 1LP9E 1MIMH 2QVMA 2GC4C 4AIXA 5HYJA 2O5YH 4LARH 3A23A 2IWEA 4LSQH 3GSNA 2X89D 5JYLA 4YHZL 2H41A 1UJ3A 3TYFA 4UZGA 2MIZA 4LL9A 5EOQL 4JVUA 1RMFL 2IDTA 2XJKA 1QPXA 3L7EB 1NCTA 1LEGB 4DK6A 1BQRA 3ZHDA 4NUJA 4PJGB 1RJYA 1MFEH 1YY9C 3P0VL 4UT9A 2CJSA 2PYEE 3VQ2C 3LMJL 2R56L 4OZHA 3WIIH 3I85A 4ZUSB 4RGNE 3KJ4B 3UYRH 3CQPA 1RUQL 1RU9L 4ATTA 1T20B 4NNYA 2D31B 2DMKA 2LLNA 5AZEH 5BQ7A 2X4RB 4TN9A 3L13A 4CDGC 3BGMB 5C07B 1D9KC 3SYPA 2JQAA 4ODWA 1J1PH 5FX3A 5I6MA 4MJ6B 2V9UA 3L8QA 2F53B 4CC4C 3MNVB 3GTTA 5GGTA 4Z3IA 4FNPA 3VGHA 4WNJA 3TO4B 4CVZA 2VM4A 4YXLH 4AIZA 2B5IC 1QHPA 4HS6B 3BUIA 4QI3A 1XF2B 4R90H 1BVOA 2IOMA 1L9TA 2P1YA 2E6PA 2A0LD 3NFNB 4EXPX 2ZCKH 4LCCC 1XF4B 2YQ2A 4X80L 5IEHA 2ATPA 4S1SL 4AUYA 1P7BA 1KLFA 1ZJAA 2Z7WA 5GRVL 3VFPA 1OQXA 5T1MA 1RIVL 4IHOA 3QO0B 4OY9A 3RFZA 3PHQA 4YE4L 3QUKA 3OG6B 5E5MB 5FYLH 5AL8A 1O9VA 4WNSA 3IS0X 3NIDE 4NO0B 3TJHC 2BZCA 2CBTA 2H3KA 5D71H 2J3SA 2DOCA 1KJVB 1WUNT 2YMXH 4L1HA 1QAWA 2SEBB 3IJHA 3LQAC 1CPUA 5BVPH 4Y7MA 3L1FA 5DC9B 3RPIB 3OKOB 2QFRA 4FFVC 2NR6D 3BD5A 4NKMB 3GC3A 4QRUA 5IBUG 2PO6C 3BX7C 4WWNA 4ZTOH 5D2LF 2CLRB 2DM7A 3KS0J 4R26H 4MLIA 4QHLB 1FAIL 1MHPL 3THMH 3ULSA 2IQAB 3RQ3A 4FS0A 2Y2WA 3LS4H 4XXDA 1X9RA 2XWDA 4RFEB 3SBWC 2F1EA 3MOBH 3K4ZA 3FQRA 2Z4QA 4KK8D 4HIJB 1UWEH 4Y9GA 4YOKA 1JYNA 2R7EB 3BUPA 2D7TL 5FPIA 1NGWA 5I15H 4NAQA 5IROA 3DOIA 4GSDH 2NZ9D 1J88A 2Y24A 3RJQB 3G08A 4FLRA 5CGYD 2Y2TA 3VFWA 2YXWA 3JV0A 1ACXA 3FUFA 2QZQA 3RJOA 1BQLL 3Q6GH 1AS7A 1P53A 4F3FB 3AGVA 4J28A 1WLHA 3LB6C 3KPRD 4QR7A 2UYLA 3F7YA 3H54A 3KPMA 3NZUA 1ED3A 4GSQA 4E9WA 2LHAA 3DK0A 2CG9X 1G4MA 2F8VA 2NDFA 4XGZB 1NCWL 5AVXB 2IG2H 4MJ5A 2AP2A 1AYOA 1GZPB 1NBCA 2BH0A 3FB6A 2Q10A 3VACA 1OAXH 2FD6H 2CUIA 4HX1B 4PAZA 1N10A 3ALWA 4ZOBA 2DIEA 3D0VB 2CA4A 4IU2A 2YAQA 3DMMD 4E68A 2VISB 4OGAD 4R4ND 5L6YL 3K4AA 1FIGL 2G0LA 3G6JE 3QRLA 1J0YA 3BRGC 1KIRA 1ACZA 5K9JH 5JPNA 3FT0A 4HK3J 4A68A 1K85A 4I0PC 4UOQA 3RWGB 2YARA 4M7KH 5ALBH 3TH2T 5KSAB 2ENSA 2DMHA 1WTGT 3V4PH 1M05A 4XNMB 4EXKA 5I6XB 5IJBC 4F2FA 1UWGH 5EU5B 1IE5A 1AGEA 3M45A 3NESA 1JF1A 3SPVB 1T1ZA 2KHAA 4TNWF 3RZCA 1Z2KA 3B9EA 3JYBA 2HZHA 4WWKD 3OAZH 4PWJA 1PZBA 4J6IA 4PUBL 1DQKA 3F12A 3LS5L 2LFGA 3UTTD 3T0ED 3RVXD 2EC9T 2PPFA 1RZFH 2VLKB 4V1DB 4HZ1A 3NQKA 3L3GB 4ENEC 2R29H 4E41D 4U1LB 1DBJH 4HQQH 1GSKA 5DHVH 4NN5C 4FRWA 3TIDA 3ZK0A 4P57A 1ECZA 4I87A 4NXKA 1TR7A 4UQAA 5I1LA 1XO8A 5IQOA 3I75A 5D5MB 4U6XA 1HE7A 4RNRB 4S1RL 2H32B 1BVNP 3II2A 2QGCA 4NO5B 4J1UB 3WSQH 5EUOF 4LP5A 4L5FH 4ZYKB 5IM7B 2JB6A 1IAIM 2HJFB 5ISZE 1PLCA 4BFRA 1QFPA 1TTUA 3ETSA 2LAGB 3Q3GB 2WAHA 1M6OA 3U83A 1FLRH 3AG2B 3H3PL 4UTCA 2Q6WB 2F68X 1FL6B 1MCHA 3EFOB 2X40A 2HMIC 3QEQD 2GJJA 1P6WA 5D1XC 1UGNA 1IQWL 3C5ZD 5DHEA 1SJHB 1YEDA 1OANA 3HE6D 3P77B 1QLFB 3O9WB 4M6NL 4A66A 3ARSA 3HRZA 4I2XB 3QUXB 2BVPB 3KG5A 4S10A 4KBPA 2Y07H 3D18A 3STLB 3BH4A 1IGML 3ZGHA 3CH1B 5E5UB 2A4CA 1UUNA 4HWUA 4UINL 2HVJA 3TIEB 2XG5B 3MCYA 3OXRB 5B1BB 5D7LB 1V55B 2BFVH 3FT3A 3SO3C 2WWMC 2GK2A 4WDIA 5C0JB 4ODBD 1OF2B 3U0PA 3NGBC 3S9DB 1UM5L 2YLKA 1JNNL 4Y1AD 3WKNA 3FH7A 1A6UH 5AEAA 3TBYA 4B5EA 2EVGA 2PCYA 2ZCLH 3P02A 4L05A 5HHXH 1KJ2H 4EOWH 4UIKL 5IQ9A 3UTSD 3WTVA 2WJ7A 2BHYA 3QXVA 5BRZD 4BSVA 4HJUA 3T09A 2WINB 1WFMA 5DQJB 4QYOB 1MRCL 2DEYX 4FKHA 5DT1L 5KVEE 3FF7A 1X5AA 5EU6B 5LWYL 4DF9A 3TWCH 1DBML 1RVFH 3FO9B 1KIQB 3MJWA 2MCAA 1RIUH 4OZ4A 4PJ8A 5HHQB 1TU2B 3H0TA 3EOTH 4UM9A 2V2TB 4Z77B 3MRKA 3LKOB 2X3CA 4L3EE 5TD4A 4QRSA 3IRCA 6TAAA 4OZFA 1ZJBA 1S9XB 3IS1X 3SHSA 2EDQA 3IMVA 2JK5B 4TNWK 4JE4B 4L8SA 3C08H 3CFCL 4UDUA 3B9KD 4I85A 1LWHA 1LO4L 2YPKA 1QOKA 4YR6A 2OMUA 2X2HA 4QRTA 3EYFB 4E9TA 5JQ6L 4TV3A 3VWJA 4O2EA 4DKFL 3WE1A 1Q8MA 3B8SA 1AY1H 4G9FD 4HIEB 5MHSD 2WSDA 3ZZ1A 4ABWA 2IVFC 2ZP8A 4MJIB 4PGCB 1L9PA 4EIZC 2EUVA 1E7VA 2GTZA 2JJSA 4M61A 3CQFA 2OSXA 1U95A 1HHJA 2R9HD 4GG6B 2X7LB 5KOVC 4GNKB 4BE5A 3DBXB 2NY7L 4M5ZH 5E5RB 1KCSL 5JW3L 3LN4B 3BWAA 3HHRB 3ALXA 5D7JB 5DEZA 4AYFA 5K1VA 3H9ZA 5J89A 2DEWX 3C6SB 2I24N 5D7IE 3RL2A 4RBPK 1MQ8A 3JWDH 5C0EB 4KU1A 4Q7DA 5LDSA 1FZKB 4NOBA 3X12B 1BIIB 1T5XA 4HKZA 2P46B 2EVJA 4JFSA 4GXFA 1YEGL 4PW9A 2E47A 3FN3A 1KIUA 4OLUL 4LOEA 1M1XA 2NUTB 1KGCD 2O5XL 3PREA 1HU8A 2E86A 4AJWA 2Y7QB 3D33A 1A8JH 1DVQA 4FFYL 4BH7A 3V6ZA 5IUCA 5DVKA 1QO3B 2WLMA 4UIMA 2X9YA 1G0XA 1XB6A 3BPCB 4UQ2B 5LXGH 3D4ZA 3Q05A 1CJYA 4XCNB 3MXWL 1XZ0A 2DYPD 4E42B 2J4WH 3S35L 5LNGA 4P2RB 5TDOA 5I9QB 5HP5A 1KIPA 2HJLA 4WUKL 4DZBA 3F05A 3QHFH 2Y7MA 5FK9A 1D5XB 5B21A 3BYTA 2DLFL 1EIBA 4TXVB 3V8CA 2XCMC 4N2DA 4KOBA 1U93B 1NQBA 1QI3A 2J43A 4ECNA 2HLFC 4ZFOL 1AANA 1YEWA 2EE9A 3FO2B 12E8H 4ZX3A 2QQNL 1JRHL 5J1AB 1IC5L 4OGZA 4ES9A 4F1SA 2FAUA 2FATL 2VB5A 3ULVC 4N0FA 3FTVA 4UZUA 4DGWC 3D8MA 1SDDB 2GT9A 2HFFA 4HJTA 3RILA 2VDNB 1O6SA 1R3JA 1IIIA 4JHVA 4E0RA 2A9NH 1JV5A 3LTVA 5ICYA 1KV7A 1KXTA 2IGFL 2PABA 2VH5L 3GSXB 2XRAL 3TOPA 1DQIA 4NZDA 2D2CC 3SDAB 2G0KA 5LB1A 4FYTA 2UZIL 5IFAH 1QSEB 5AYUL 1N6QL 3TBSB 4RSVA 5LQBH 3FB5B 3AS3A 2V7NA 3FT4A 3L4CA 3QCVH 4P46B 2O5NA 5K59F 2ZCZA 3B7UX 1KYUA 3CXDH 4TUUA 5B22A 1CGSH 1BXXA 1TCRB 3RNQB 3AWEA 1A14L 4JEGB 4LQ1A 1F90H 3L3OA 4JKLA 1JGUL 5DJDB 4XTRD 1SXNA 1PDKB 3FO0L 1R3LB 4PI2A 5FAAA 4JFOA 4ZUVB 4GS7C 3UJIH 4CU7A 3VFVB 5JIDA 3DPDA 3C5SA 5I1KH 3D39E 2MJWA 4L1TA 1PU0A 4NPJA 3IMRA 3JT2A 1NCDH 1QHQA 2A38A 1NCBH 2FCBA 4KXDA 4KJWD 3UEQA 4Z95H 4NHUB 4FXLA 4BSWB 5MI0B 5K33A 2FO1A 3EYUH 3MZGB 4Y1TA 3P9LB 3EOBB 1XD0A 1HZHL 4AV5A 3HS0C 5SWSB 5FLVA 5T3XH 3GS4A 4P23C 5I66B 2XKSA 3DX4A 3JWNG 2ZP0T 4NERA 4QRPA 2C4FU 3NZSA 1FVDB 4LRIA 3EFFB 5D70L 3G5VB 3NCCB 3UC0L 4HJJL 2MWCA 4AQ1C 3ATFA 4XAKE 1I1YA 1BWWA 1MLCB 3O4LE 2ADYA 4G6MH 3K8LA 4OGYL 1L4IA 3ZT5A 2EC8A 5DJZA 2HVKB 1DEDA 5ITBH 2JH2A 5DS8B 4KQ4H 3VFNA 3WXWL 1HH9B 2LTQC 2FT7A 1PTZA 1PSKL 4JMXA 4U05A 4XCCH 4A7UA 3N1GC 1CFVL 5SWZD 4XX5A 3W39A 5I0YA 4JRXB 4BE6A 5IB2A 3FQXA 2YD7A 3J7HA 4DVRL 2YGOA 2APWA 1FYTA 3HG3A 4M8UA 3HKFA 3TX4A 3RI5F 1PKOA 2P5ED 5HPOA 1UZGA 4J4PD 4YWGL 3LXUX 1KWKA 2OL3L 1OE1A 4CNIA 2Q7NA 2Y1YA 1F11A 3P11L 4OIIL 5GGUB 3NAAL 1Z3RA 3L3IB 3KLAB 4CMHC 1J0HA 3D3VB 3N85H 3OHMB 2IOIA 4O9HL 5DWUL 1N8OE 5DJXA 5E56A 3UTZA 4A7GA 4GG8A 3IXTA 3O6LL 1YUKB 4JFWA 5ESAB 4ZFQA 3CXHJ 5HYJE 4JN1H 2WXRA 2YJLA 3E6FA 4G43A 5BS0D 4PJBA 1NBZA 2BFGA 1G9NC 3ARXA 2E7DA 3QI9A 4LSPH 4YSSA 5FCUL 3QIUA 2D3LA 4WKZA 4Z0XA 2BP8A 2X88A 3KPNA 3OAYK 3ZL2A 3WJMA 2KZWA 3NP4A 3ZDZE 4F9PA 1M2VB 4HCIA 4JFXB 1JZIA 1YN6B 3TZVB 1GOHA 3S37L 1FFPB 4IMKA 4BV1A 1JGDB 2NXYC 4XHJD 1PY0A 1KZYA 3QULB 4OD1H 4R6UA 5J3HC 2V3FA 3D25B 5BZWB 4UTAH 1HJBC 2HFTA 1HWWA 4OZHE 5E4AA 1JK8B 1EFXB 2EE0A 2QL1A 1SJVA 2V33A 3NIFF 4G7YL 4LGPB 5D1QB 4I18C 3V4VB 5IQ7L 4JG0H 1HHKB 1RURL 2VDPB 1EUUA 4FEMA 4EN3C 2XFXB 1YJDC 2ZOWA 2BRRL 4Y88A 3WLBB 1HCZA 1I1AA 2BNQA 3FU7A 4OQTA 3ZOAA 2A77H 4X8JA 3VSQA 3D4GA 4BWTA 4NBYB 1P2CA 5I2IB 8FABB 3A0OA 1X5MA 4OGQC 4PGBB 3AT0A 2CR3A 5I1CH 1AFVH 1CFSB 3QJQB 1CUOA 5CLZA 1KN4L 4LKCB 2I69A 2E3VA 4Q9RH 4JVWA 1FPTL 3MLRL 1YEKL 3OZKA 5I8CB 1S5IH 1J18A 5KSUA 3ES6A 3FCBA 4P49A 1MI5A 1OAZL 3T1FA 2X4TB 3ZR6A 1QVOA 2VERN 2K4WA 4JRFA 3RBSA 5BQDA 3WIAA 3QDHA 3MRDA 1JNJA 5CO1A 5DR5H 4BH8B 4DZ8A 1ZLWK 1THCA 3VH8G 4YDKH 3LHPH 4N86A 7PCYA 3PIQB 4LESA 3TA3D 3RAJL 2V8LA 4LCUB 5HJBA 4C55A 1FBIL 1YG9A 1JFHA 5DTFA 1PG7X 1M3JA 5DLMH 3VA2C 1OP3K 1YMHA 2Y6TE 3JZYA 2Y5EA 3QHTC 1I8UA 4OD3L 3DDFA 5F1OB 5EIIA 1EHNA 2AK1L 4E5XB 3T0XA 2G2NA 4N0YH 3MVSA 4YQXH 4AW7A 1DDTA 5ADPH 3NRPA 3SN6N 1FFOB 4OGXL 3RVUD 3N1PC 1NJ9B 2TRYA 2F58L 3OZ9L 4FQPA 4NI3A 2GUOB 1SOXA 5CLTA 4E9XA 4LE8A 2EDHA 1SLVA 4JPIB 3NSXA 4MWFB 4S1QH 4G11A 2F6AA 1XGUA 4FQLH 1BMWA 3QG6B 2GIXA 4Z7UF 5HDQL 5FC9A 4K8RH 4GAJL 1KB5H 2NY3D 1JWUB 2DQDH 3I84A 4XMLH 2DQTL 5G5DB 5T33H 2CO6B 3CZKA 5CN3A 3QT2A 3RWHB 1FH5H 4XVSH 4NQXA 3MOAH 1RAMA 3SOBH 3WUWG 1NANI 1AG6A 1A6WH 2CIIA 1I8MA 1SHXA 4UV4L 2GHWB 3OVUB 5CJ5A 3C09C 1NBYA 4YHPB 15C8H 3MYZA 4PJ6A 5AW4B 4MNGB 5J6HB 4C83A 2OCFD 4PYHA 1KEMH 1C7TA 1TZGL 4P3WA 2GHZA 3BKJH 4JJ5A 1BVLB 4MQ7B 1FG9C 5E2TH 2WO3B 3BVXA 4IQHA 1QX1A 5GRJL 4JM2C 1ZT1B 1LTXA 4P9ML 2X4PA 2XDHA 1OVZA 1ZHLB 1JPTL 4JFDE 3MRLA 5LAXB 1AE6L 1R0AL 3AREB 1TJIL 1SEBA 1WSST 4PJ8C 4QHNA 2JCCA 1G5GA 4MNHA 5DQ9B 5T1KD 5CJQL 4PJIF 2NRDA 5JTWA 1BZQK 4L8CB 2GJ6D 3UG3A 4JPKL 3UTPE 4P2QB 1E0OB 4QXUL 4PJEB 4KITB 4J39A 2GVYA 3PFQA 5I30H 4PWKA 4JDEA 5HI4C 3ZTJG 2I9TB 3IPBA 4MZIA 3PL6A 4NRYA 3GXTA 2ZWZA 5EO0A 1DJXA 4PRHA 4DKTA 2VDML 2P48B 3EJQA 3OF6D 2R0WH 2OMTB 1A4JB 3FQTA 1SHMA 4Y16B 5KZCB 3NQIA 4ANWA 3QR1A 3C2AH 3FTUA 3AFLA 3CXFA 2PLTA 5JORB 2JJSC 3D85D 1DYZA 2V7HA 3MLZL 1VAHA 4I5BA 2GK0B 1JNLH 3KLDA 4ZTPH 4JFFD 3VI3F 5K9KB 4G8GD 4OCNC 4RAHA 2G2RA 3R1GL 1H8OA 1FCGA 1GHFH 2NNCA 2W60A 1WDAA 1J1XH 2HA1A 2ZYHA 2AVGA 4YC2C 2FBRA 1CT8B 1CB4A 1WBYB 3FQUA 4BK5C 2OW7A 2O30A 3K4DA 4KTDH 1NCIA 5E2VH 4GQQA 5AUMB 1DQLH 4PV1C 3HI5H 1UKSA 1AHWC 1Q9KB 4KX7A 2UX6A 4PCKA 4MA8H 4TTDC 2ISDA 1D7DA 5GZNC 4Q9BA 4M4RB 5EBLB 4FQHB 2B9BA 2YD2A 4L23A 4MZ3A 3MMEB 1G1OA 1AC0A 3E1ZA 5FW8A 5AL0A 4GBXD 3L2LA 3FSOA 3VYNA 3VG0H 3INUL 4WK4B 2IWFA 1HHHA 3W9DA 1RUAH 4KMTL 1IB5A 3CFBA 3M8OL 4G9DA 4YHMH 2G4EA 4JRWA 5IMMA 1BA9A 3EYQD 4HULB 2R0KH 4YPGA 3ZDYE 3ZO9A 1ROCA 2CLVB 2M2DA 1RJLB 2NY0D 5AW9B 1OLLA 1DJGA 2BC4A 1MAJA 4FAAB 1KELH 5LVEA 2RD0A 3TM6A 3QORC 1ZTXH 1J0KA 2PR4L 1TZHA 2BSCA 3QRGL 5DJ2A 5CD5C 4NFDA 4ZFGL 2XKUA 2HH0H 3BSHA 2NOYA 4WWPA 4B9CA 2J6EH 1S78D 3U6XA 2V3EA 5A40E 5BW7A 2EC9U 4RWYL 4MA3A 2YUXA 2OSLB 1WFJA 3V4VH 4MMZB 2C3VA 2BCKA 4ELMA 4NP4H 3OKDB 4YSCA 3HNSH 5DGRA 2ADIB 3H53A 4AGLA 3WFZA 3HE7C 5ACMA 4QMEA 4O51B 1IMHC 3ILPB 3QXAB 3HA0A 3X14B 3NIGF 5GS1B 4LIQE 3QJVB 4X2UA 2UXVA 1ASOA 5DRWA 4FC3E 2Z93B 2R29A 1ZE3C 3SYOA 2C9UA 4OCSH 5AOIA 3PABA 5MEOB 3FFDB 4PJAF 5DHVA 2VLJD 3POHA 4EDWH 4FHJA 2YBGA 1NGZA 4M7LL 3VI4B 4IIQB 4WRLA 3S5LB 3K2IA 2Y5TA 5DMIH 1TYJA 1GTFA 4D0CA 3D69B 1OO2A 3SPJA 4PYGA 4LVNB 5E1IA 3I74A 3QIBD 2FSDA 1P7KB 3A6CH 5HI3D 3TEZA 1D5MA 5IV2A 1BZ9B 3QG7L 5AFAA 3QQ3B 3LNHA 1OB1A 4K5LA 5FO8A 2N3JA 3F04A 4ODHL 4HSQA 2DWXA 1LK2A 2YMOA 5JHDD 2YRBA 2ADGB 3B9VA 5DYOA 1FN4B 3FTWA 3GF8A 3ZKQD 4YZFF 1XR9B 1NGPL 1RP9A 4DUXA 4AQEA 2BVEA 2FQFA 5C2UB 5EOTA 3CD4A 1UD6A 3L7EA 1NTDA 3IJ9A 1OTTC 4JO2L 2X05A 3HI6H 1KLGB 1N8ZA 1JJUA 3MO1A 4N9OB 4Y5XB 4XN7A 3T2PA 1GL4B 1RIHH 2VNCA 2NY6C 5IBTH 1Q72H 3IU4H 3BUYA 2W0FB 4XXCC 4YO0A 4Z0BL 3OHXB 2P80A 4LSSH 3UYOD 1BREA 4PREB 5AYTA 4URKA 4AZ8B 5KSBB 1R17A 1XTMA 5B1JC 2Y7LA 5IR1B 1T20A 4L1LA 2DM4A 3IDGB 1JOIA 3L4WA 1JN6A 2N0MA 3K74B 5FB8B 3BGMA 4HHAB 4R3SA 4JZNA 2LOEA 4NWTH 4QRQB 2BVOB 3VRLF 3T04D 2O93L 4OLVL 1CICD 2A83B 1VESA 4Y4KD 1KJ2A 2OMNA 2FWLB 1CFTB 1OALA 3JV4A 2YN3A 3MV9B 4LSVL 4DSYA 3HR5B 1FO0L 3BHBA 4P2OC 5EZIH 2W92A 1DJZA 4CL7A 3MRFA 5K39B 4MQSB 1URLA 2E7LA 2WBWB 3BH9A 3ZRSA 4AEIH 5IK3A 3W0WD 4GMTH 3EYVA 2A1WL 1JMXA 3ZHFA 1QTPA 1WCBB 3U48A 3V8OA 4NUQA 2KQNA 2VLRB 4Q6KA 4G72B 3GMLA 1G6VK 3MRRB 3IU3B 4MA7H 4GRWH 4UT6H 4DWHA 2ZYRA 3MRGA 4FQXB 5LKNA 1WZ1L 1DL7L 4WV1B 3EDKA 3PG2A 3LY6A 3GIZL 3AUVA 3SDYL 1JGLH 1HILA 1HH6B 4PJXA 2CWRA 4U3SB 5J12B 3KW8A 4AT6B 2R51A 2VW7A 3EGSA 3QI9C 4HVBA 2DAVA 4NO0A 1CFBA 4YBQC 5H2BA 1YVLA 3UZQA 4FHKA 1H0DA 3UPRA 5HGDA 4NZUH 4F27A 3HZ3A 4OJCA 3RPIA 1HYRC 3NN8B 1RZKL 1RK0A 2KBGA 3FYEB 4HKJB 5JQHC 1ZHNA 3OAWA 4UQ3B 1NCGA 2CLRA 3RDTD 3BFOA 4DN4H 1NMBH 1YC7A 1IEHA 1DCEA 4ONFL 2BY1A 5TF0A 2VDLH 2FJFA 3EBAA 4V2BA 3ROOA 2WV3A 4BUQA 5KOMC 2MQ3A 4BWWA 1G7QB 2TAAA 2WZ5A 3Q5TA 1HL9A 4OH2A 2DS4A 1N7ML 4WEUD 5DA0B 5IMOA 1IGJB 1WO2A 4AM0B 4JQIL 4TSCL 1YZZA 4J6RL 4UUJB 2H47C 3FTGB 4OB5H 1W80A 1AD9B 2ZX9A 5ILTH 1X5ZA 1T2JA 2FEEL 4WO4A 1I75A 2YD5A 1NUDA 3HNTH 4R97C 3T08A 1A6TB