3AACA

Small heat shock protein hsp14.0 with the mutations of i120f and i122f in the form ii crystal
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
123
structure length
123
Chain Sequence
MYYLGKELQKRSEELSRGFYELVYPPVDMYEEGGYLVVVADLAGFNKEKIKARVSGQNELIIEAEREITEPGVKYLTQRPKYVRKVIRLPYNVAKDAEISGKYENGVLTIRIPIAGTSVFKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Putative uncharacterized protein ST1653
publication title Dimer structure and conformational variability in the N-terminal region of an archaeal small heat shock protein, StHsp14.0
pubmed doi rcsb
source organism Sulfolobus tokodaii
total genus 23
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aacA00
2KLRA 3VQMA 2KMWA 3J07A 4RZKA 4YDZA 4YE0A 3EUDA 4JUSA 3L1GA 4YLBA 2WJ5A 1X5MA 4MJHA 5DS1A 2CR0A 1RL1A 3QORC 4PBDA 2Y1ZA 4M5SA 3IGFA 2CG9X 3Q9PA 2N3JA 2K8QA 4I88A 4JUTA 3N3EA 4FEIA 2JKIS 2O30A 2RH0A 2Y1YA 3QORD 3L1EA 1EJFA 5DS2A 4YL9A 3Q9QA 2WJ7A 3QORB 4M5TA 4PCKA 3QORA 2XCMC 4ZJ9A 3GLAA 3VQLA 1SHSA 4YLCA 1WGVA 1GMEA 3AABA 4ELDA 2MNWA 3GT6A 5LUMA 3AACA 2N0KA 3GUFA 2BOLA 1WFIA 1WH0A 3L1FA 2Y22A 3W1ZA
chains in the Genus database with same CATH superfamily
2BNRB 3BT0A 3QNYA 1JPGA 3KLLA 1PAZA 5ILTL 4F9PC 3KPSA 1AJ7L 3S5LA 3FB7B 5LCVH 3QPQC 5DURD 1EWHA 1R19A 4MBRA 1F45A 3HG1E 2K6WA 2WXJA 1DJSA 2XA3A 2VSKB 4GRWF 4O58H 5E9NA 1TZOA 1VFBA 4L1BA 2FJFA 3C08L 3UJTL 5DS2A 3S37L 4HZ1A 2EDJA 3SBPA 3OMZA 1T4WA 2WBJB 4X6DA 1TQBC 2R0ZH 1GKEA 1F3JA 3OSVA 4TQIA 5DJDB 4ETQA 1GMIA 1BYOA 2QQKL 3BWAA 3WHE1 4OF0A 4NNPH 2YPLA 3O3EA 3AU1A 4PRBA 4O5LL 2V5MA 4XP6L 1EX0A 3TO2A 3VQMA 1JE6A 4CN1A 3RWGA 2APWA 2VL5A 4I0CC 5I1IH 4LIQE 3UPAA 4R84A 5SWSA 3WO3B 5KBKA 3LPFA 3GDBA 5F0MB 1NLBL 1NAKH 3FXIC 1N3NA 1KF9B 4KX9A 2A6DB 2VR9A 3BAEH 3GMOA 4DESA 1JGVH 3BXNA 3ZL4L 3PJSA 5IQ9A 1M6UA 3NZ8B 2OP4H 3TNMB 4DEWA 4S2SA 1IBBA 3OKMA 1HU8A 2NNAB 2VL4A 5HGDB 3NTCH 5DFVD 4AGNA 3D85D 4I0PA 1Z6JT 2YAMA 2KLTA 4M3JA 5LAPA 5SX4H 3RLSA 4CW1A 1HYSC 3GKZA 1DBAL 2I60L 3OHXC 3R4DA 3MRQB 4ZUTB 1A9BB 2EIDA 1T04A 1BFTA 1QVOB 5JPNA 4L4VD 3PY9A 3RVUC 3L2NA 5E5MB 4LLDB 3QO1B 5KBNC 2HAZA 4MHHG 3NP4A 1IB5A 3MV11 4NUMA 4D2NA 3RIKA 5GRXG 3RIFK 1BJ8A 5J11B 4OIBA 1G4RA 3SDDB 1A0QH 4WWKB 4F5CE 1AR1D 5FGSA 3UG5A 4M48L 1F4XL 4TM9A 3QNZB 5GGSA 3WFHB 1ACZA 3Q5TA 4WU5A 3EGDA 2BX5A 4QRRA 4EBQL 2PTVA 2WN2A 4P2QB 5F6HI 2R2BB 3NA9L 3FQXB 4LBAA 2XG5B 5FYLE 3QEQE 3MODH 3L3OB 4HJGB 4YHYC 2A6JA 3B1TA 1LP9E 1D7FA 2J71A 4XN5A 4YX2L 1RULL 2J4WH 4FMVA 4DPRA 4TVUA 3CPUA 1TEYA 4U1IA 2ZUTA 2BFVL 2D3VA 3BP6B 3MUHL 1F86A 1P5VB 5ACZB 3BZFB 1PLBA 1MWAL 1DDHB 4NLAA 3VWKB 3RDJA 5JXAL 3QZOA 4KKCC 3HZYB 3K74B 1CDUA 4HJJL 3GM0A 2X05A 5HYJA 5DCCA 3KR3H 3QNXA 1I8UA 3G04B 1NFIB 4U6YB 1J0YA 3X3FL 4OZIE 3B2DC 3VI3F 1HL5A 1IIKA 2OFQA 3TJEH 1EFXA 1P4LB 5I30H 1J8KA 3JWOH 1OGPA 3VD0A 3D69A 4JPSA 1ND0B 4KFZC 3NESA 3GEWB 4S0SD 2E5EA 4WI3A 2EUVA 3BWUC 4R26H 3UGXA 2X4OA 3SPHA 1S7XB 4WK0B 4HISA 4IRJB 3OKNB 1ESOA 5B4MD 1S9VA 1P4IL 2WSPA 2P28B 2WWKT 1Q1JH 4UNIA 1FBIL 5CR8A 2NSXA 4L4TE 2WVUA 4Y89A 3G5YB 1EHKB 1KPRB 3ZK0A 5FB8B 4ZTOH 3ZKXB 2ZCHL 3O11A 2EXWD 1KGUA 1K3ZA 2DM3A 4XN4A 2DD8H 1MJJA 3NABH 5DJAB 1OARL 3G7TA 1AZZC 1JV5A 2CGZA 4A68A 1X9UA 3MCYA 3WAJA 3X2QB 2NY2C 3FFDA 3VGGA 1FFOA 3FCSB 3T3MF 3NIFE 1OD7A 5C08D 1EXHA 5I66B 3MA9H 4N0YL 3ULUF 4HIIA 4OM1H 1G94A 4JDVB 4A2FA 3NQIA 3IWUA 1EPFA 3QJFA 4YH6A 1E8XA 1T6WA 1G84A 3LKRA 2H6UA 3GXTA 1KXVC 1KACB 1LO0L 3OSKA 5BMFL 2LVCA 4KKLC 4Z7WF 4HJEA 1DJYA 3EG9B 1ES0A 3VQLA 5FYLD 2DKMA 3QEQD 4RWHA 2ATPA 2XPYA 5AWNH 2X42A 3BYYA 4I8DA 2YAPA 2EXYC 3CMGA 2FX7L 1T0NA 4HC1A 3T9WA 3D30A 2C7FA 4CDGC 3HBZA 1XCQB 2Y1ZA 4HHWA 3VGAB 1L7IL 3WBDA 3GJFK 1E3XA 4FXGA 4PW3A 2K1MA 5ADOL 4YSCA 4XC3H 1UWEH 1QFPA 1BZQK 3ZJAA 3HKFA 1HKLL 3NPSB 2EVIA 4JY4A 4PPTA 1JPTH 4OCWL 4X5LA 4JZJB 5D6DA 3JV4A 4JMXA 1MNUH 5MENA 2PTTA 3U48A 4JHBA 3UO1L 3SB3A 2WYZA 4JANB 5DWUL 3GSNA 4KTEH 2I85A 4QT5A 4TUUA 3CMOL 3MV8D 4JZNA 1Z1WA 4MJIE 5C92A 5EUKA 2YC1B 1JGLH 5EBWB 4O00A 2W81C 4PJ9B 3O8XC 4JFHE 3SOBH 2G2RA 4HV8A 5A2IH 4JRXE 1TTUA 3AAZB 2QSQA 4PRNB 3F7VB 4Q52A 1KLGA 4YDKH 5DEZA 2X4RA 4LPYA 1V7NH 3N5AA 4C54A 2YUVA 1KC5L 2VDQL 2ZUQC 4L2LA 3V5DA 4F7PB 1WUNT 1VHPA 2YPKB 4OGQC 4QOKE 5IGXH 5CF3A 4YDVA 4JJ5B 3FL7A 3LDBB 4CADA 4QKTA 2K9UA 5DJZA 5HGHA 3QQDA 2P5WE 2WUBH 2NXZC 4LSUH 4UDTA 4ERSL 5JOPE 4I0PC 5F7WC 2BNUA 4I18B 4LESA 4HH8A 2H45A 1AANA 3RTQB 3TN0D 4IK6A 4WEBH 4K94C 4HCIA 5JPNC 5KVFL 4OI9A 1YEWA 2APBA 2AXHA 4M7LH 1MHEB 2DICA 3DRQB 3G5VB 2YA2A 3NH7H 5FECB 4XC1L 4V33A 4WRLA 3IK2A 2CRIA 3F58H 3JWDH 4AE0A 4FTVD 5F7DA 1ICTA 5JQ6H 4N1HB 3K72A 4UM8A 1MUJB 4Y2LA 1YN7B 1A6TA 2ZJSL 5D7IA 4ZFZA 4N26A 5T5NF 1KTJA 3REWB 2V9QA 5KSAB 2GQHA 3C8KB 2E7BA 3PGDA 4DPAX 3MUGA 4XBPB 4MTMA 4YXHH 3BVDB 5FDYA 3CZUB 3HMWH 3GMQA 3CFQA 3IN0A 1T1XA 5IFHL 3BE1L 4P8QA 1I1FB 1QW8A 2QLYA 1CT8B 1QW9A 2JELH 4MNQE 2WXGA 3WFEL 1XGUA 1HOCB 1I1AC 3RJQB 4HKXA 5DZAA 2CDFB 3GMNB 3C60A 4R4BB 3BMWA 4YHKH 3ULSA 3WELA 3N04A 1MAJA 5MHSD 3N6YA 4Y4HB 1JPEA 3SKNA 1CICA 3ARGD 4PJBF 1DVZA 2OTUA 2FBRA 2Z91B 1I7ZB 3FTSA 1CIUA 1KPUB 1HIML 3LH9A 1IGFH 1ZIAA 4FG6D 1BGXH 1B88A 3QORD 1ZXKA 5FYLH 3FDWA 4I1RA 4GG6F 3HNSH 1N8ZA 2QQNL 5F7LB 2UY7A 1A3LL 2AEQL 5DZOA 3W39B 4X9IA 5KW9H 1NBYA 2HRPL 4P5KB 1RZJH 4QHLA 3TX4A 5DMGC 1JRHH 1A64A 1FC2D 3PFQA 2V17L 1MLCB 5HVWA 4DZBA 1EZVY 3CFBA 2FQFA 4NAMA 1TNNA 2WSDA 5E4IA 4Q6IB 5BRZB 3GTTA 3RDTD 3RNQA 5C1MB 3QFJB 5AVWB 1JPFA 4ICXA 5LGYA 4QOKD 2F2HA 2FQGA 3GSRB 3GSVB 5G5DB 3FRPB 3T0XA 5TJWK 1WA0X 1NOAA 4CNIA 5E1AA 2C1OB 3FRUB 1UXLA 2EYRA 2V8LA 2IGTA 3SPCA 4UCFA 3BC9A 1D6EA 4H44C 5AOLA 1M05B 3JYCA 5L2KA 3T6QC 3HN5A 4ALAC 3N1PC 2JJWA 1AKJD 1E3FA 4LSPL 4RBPK 2ED8A 3MOAL 1MFBL 4LKCA 3RTLA 2FD6L 4WSJA 1BOGB 4TQEL 3FN3A 1HWGB 1KJ2A 1CF8L 3SDYL 1QPXA 4FZ8H 1BVKA 2FRGP 3G5ZA 1QABA 3P77A 5I5MA 5A16A 1K4CA 2VDOL 3U0WL 3RB5A 3IFNH 4OFDA 1U3ZA 2R83A 1EDQA 4PRDA 1IC7L 4XNXH 1TR7A 5JYMA 1BAFH 4U33A 5AVYB 3DX8B 3FTXA 2E7CA 4APQD 4JHWH 4CC1A 2CRZA 3T6ZA 4B5ZA 1D9KB 1T83C 3FT4B 3MI6A 4Y5XB 1MCPL 4AJ0A 5F1KC 5DK2A 2IANB 3U6XA 3VDCA 5FO9B 1A22B 4IRSA 5EO9B 5GGVH 1NAMA 4RMSA 2WKGA 3T2NL 2LLNA 4IOSA 1W2KT 3BSZH 4WI7A 4UB0H 2VYRE 3WXVH 5E8DH 3F62A 5HYEA 1VLXA 5FCUL 1BIIA 2BK8A 3NJLA 4HIJB 3V9CA 3WFZA 4GNKB 2EUXA 5HJDA 3G08B 2BP8B 3S8WA 1O7DE 4X4YB 4B95C 3TWCL 5DVPA 1NCNA 1NMCB 1TYJA 2IC2A 1A6PA 2OK0L 1LL1A 4F2MA 4RMBA 2EXSA 4PR5B 2XRAL 4P4KC 3RBSA 5HYSA 4MQ7B 4Y16D 4FXGC 4KH2A 2ZG3A 3LPPA 4NO3B 4AXWA 4HOZA 1TQUA 3B1UA 1XF5A 1V54B 3ZKSD 3TL5A 5C09B 1NGYB 5IR1A 2A9BA 4PJEF 4HKBB 1IBGL 2OMNA 4OUOA 2HT3D 2A77L 2WUCL 3BJLA 2LE9A 4J3BA 5DK3A 3ZHDA 5D6DC 2VWEE 3OMAB 4C56A 3MQIA 2BNRE 2AK1L 2N7AA 5EMYA 3ECBA 2OSLA 2FYYB 2Y7MA 4G6JL 4B9FA 3V7AG 1RZGA 5I1DB 1HI6B 3WEBA 2G4GA 2OQJB 4R2GD 4YSTA 2KHAA 1ZVSB 2DLHA 4U2YA 4AZ8B 2OTPA 3E1ZA 1MFUA 4EUPA 4KQ4H 4NX0A 5E56A 1M53A 5G4MA 1DBMH 3SO3C 3PS6A 3A5VA 1JWUA 3I84A 3DK2A 1BDYA 3FTYA 4LDCA 4PJ7F 2P80A 4S1DC 4MAYA 2GJ6D 4DP6X 3CXDH 4ZYKA 3ILQC 1Z5LB 1HCFX 4LNRA 2HT2D 1NPNA 5EPMA 4JPIB 2XHNA 1WS8A 3INUL 3N41F 5C70A 1E8WA 5FKAB 5DJCA 4TUOA 5H37A 3VTMA 4O02H 4U6VL 4WWNA 2VERA 1Q0YL 4M43H 2ZOOA 3QUML 3U7YL 4YSUA 1M1XA 4O2CA 4FG4A 5LBSL 4Q14A 4N8VA 3CN4A 3ATAA 1LK2A 1OL0A 4OQTA 1I3GL 2HG5A 3KZ8A 1UB6B 3RUGA 2LVEA 3H3PL 4IU2B 3V5KA 1OAXL 1IFHH 2R0KL 3MJ9A 5MEOA 4DSYA 1WZAA 1J0KA 4WTXA 5C0CD 4MAZA 4X6EA 1KTLA 4WGWB 2ADFH 4RAVA 5I6NA 3QQ3A 2DIJA 5LDSA 1A4JA 4B50A 4Q8BA 3UGEA 1KT2B 3TBSA 2WQXA 4M8QA 1Z9OA 4P2QE 4FA7B 3TBYA 3ZMRA 5DR5H 1CICC 3GXNA 4Z78B 4G9FD 2AK4D 5T1MB 1KXQA 2BNRD 3R19A 2J6WA 1T0OA 1W0VA 3EHBC 2ZXBA 3EYVB 2WVVB 1E28A 3ESVF 1QTYT 5HGBB 1JZ8A 1FNHA 3S37X 4YMPA 1F00I 4NKOB 3UTTD 4N9OB 3M46A 2YLHA 1FVEA 5AKSA 3KL3A 3BP5A 3V0DA 4MA1B 4KUZL 4ZOEA 1NCDH 4BWUA 4IGBB 4YC2C 1P53A 5BO1L 4U1GB 2R1WA 5HGAB 5CJ5A 5DLMH 1XGRA 3TFBA 4F8NA 3TT1L 2R23A 2OX5B 1PKQB 3OZ9L 1NC4A 4B9CA 43CAB 2DI8A 1L9TA 4PBVC 3P2BA 1NM9A 3OR6A 2D03H 2WCSA 3GBML 1W8OA 5I8KL 1H3PH 1RJCA 3HZKA 3HCVB 1WUZA 4K9EC 4NRYA 1IAIM 3F3HA 1UZ6E 4X5PA 1ZS8A 1I1RA 1MI5B 3W81A 4G6KL 4JO2H 5J57B 2XIIA 2QDVA 3L1EA 5LGHL 2R9HC 3GS0A 2W91A 3L5XH 2XWZA 3QXVA 4FNRA 4HEPG 4HZLB 3WO4B 4DERA 2DQGL 5T5NG 3MLXH 4NHCL 4AQZA 4YR6B 1YUKB 1OAJA 5AG9A 1WFIA 1J5HA 2VC2B 4TNGA 4C47A 5EUOE 1ZHKB 3RGHA 1HE7A 3GJEA 2GFBA 3L1GA 1CIDA 2R29H 1RK1B 2JJSC 1AXTL 3C6LD 5DYOB 1FDLH 2WLIB 3ARUA 1UM4L 4ZMNA 1X7SA 5MERA 4KHTL 4FZEH 2OJZH 1N67A 1T0PB 4MJ6B 2ZKMX 4WGVB 1U3YA 2DS4A 4LASH 2AFNA 4WWKD 4GAJL 3DVNB 4IKKA 1WIUA 4M5YL 1ASOA 3UPCA 3QSKB 4U1LA 3UZVB 1T5KA 3BUIA 3LQZA 5HDLA 1U42A 3LKSB 1QHQA 4F7TB 4NM4H 4EZKA 1GZQB 1EH9A 1QFOA 3I9IA 3VTTA 5DI8A 4LLYB 3NSXA 1OT2A 1S2EA 4M4RB 3ARBA 2JTDA 2V9RA 5E99H 1O6TA 1OZUA 4AYFA 4LPXA 4CMMB 3CZLA 1BBJA 1AO7B 3FPXA 5LJYH 1EUUA 1RU9L 4Y8DC 4AJWA 5J06A 3APMA 3TP4A 2ZCLH 5DMJB 4LEBA 3G6JB 4ADGA 3NG5A 1INDL 1ASQA 1RLBA 3OGCB 3HUJF 5E2VL 4AOFA 1D5ZB 3CC1A 3N1QC 4IKNA 2HJLA 3D8MA 3KL0A 1X5KA 1I9RL 4LSSH 2KLRA 4D9LH 3S2AA 3S36L 3P54A 2EJ1A 4H0LC 1BXVA 3X13B 2J8OA 3FB6A 3MRDA 1WF5A 4BH8A 3FAXA 2X53A 3LH2L 5CZXD 1GSKA 2BDNL 1BMGA 5FK9B 1X5YA 1KJMB 4FQXB 1L9OA 4X0KB 4PJFB 3GB7B 1P7HL 2C9SA 1NDMA 4AQEA 4CVWA 4ZUWA 1LO2H 4AV4A 1JN6B 4NXKA 4P5MA 4DO6A 5IQMA 3EFDL 4GSDH 3L1OH 3BGFB 4A04A 2EH8L 4GUPA 1QSEE 3N40F 1FSKC 1PJ9A 2DJUA 2Z64C 3WXWL 1QG3A 2BY1A 1DO6A 4Y2OA 1F1DA 3ECQA 2Y3AA 3V4PH 1PIGA 2IVFC 4HLZG 4I4WB 3L5WA 1DEEA 3WS6A 5DRWB 1HSBB 3VX0A 4RFOL 4UQ2A 1IM3B 1URLA 3R7QA 3BEVB 1KZYA 2J8UA 1RJZB 1SJEB 3HZVA 2PR4L 4LCUA 4BQCA 2QPDB 4EOWH 4R7NA 2HFEB 1I7RB 1SF5A 3EXLA 2ZX7A 3DX9B 3TURA 4LCYA 4Y19B 1XD1A 1G6VK 2BC4B 4ECNA 3B2VH 5EU6A 1NDGA 4FCHA 3MR9B 1R24A 5HVHC 4S1SH 1LE9B 5EZJB 5DK0B 1FJ1A 4JN2B 1J88A 4HJIA 2VXSH 2XACC 3Q2NA 4BZ1L 1XGQA 1DBJL 1WTGT 1G9MH 2HVJA 3KWWB 1A3RH 3VI4A 5DD3H 5KVGL 1VACB 3K71B 4ZAKB 2IGFL 3AUWB 3GF8A 4FXKC 1J1PH 3Q05A 3PHQB 1OAKH 2MPAL 2CU9A 4LCWB 3KXFB 2DYPD 5DVMA 4TRPL 5ABDE 1XL4A 1AMYA 4NZFA 4J3SA 3QUYC 4GBXA 1ZLWH 3VXNA 3FQTA 2P8LB 3IDNB 3DVGB 4YXKL 1IC4H 3LZOA 3DGCR 4CMHC 1DQLH 4MS8D 4JJHA 1II4E 2X9WA 4PP2B 3V4VB 2A9DA 5EC1B 5FYKD 5C9KA 5MEPA 3HLAB 2C5DC 3ZZQA 2GJZB 2ZOLA 5DDHA 4A2GA 2WIMA 1VPOL 4URTB 5CGBA 4MXQC 2NT0A 1ETJA 1CG9B 1O5PA 4FQIH 1PLCA 2WXPA 5AOKA 3N9GL 2XVKA 1OCOB 1N6QL 1P2CB 1M7DB 2H0FA 4BKLA 1SYSB 1V8HA 2X3BA 4WV1B 5DUBA 4L37B 3UYRL 4M1DH 3WFCH 3TNNB 1B0GB 3FOLA 2AJZB 2VLJA 4AEHH 1FLRL 5BRZE 4DKFH 2HLFD 2V7NA 3RIAF 4XH2B 3FTWA 5GSRB 2EDEA 1CYWA 4MXVF 5E00A 1NFDF 2Z8WC 4IBYA 4GAGH 3QIUC 2DQFB 3ROLB 2VABA 1RZPA 2CHNA 4FYTA 5JIKA 1BF8A 1HDMA 4JKLA 2JLPA 4EO5A 1FO0B 3LKQA 4W68A 2GUOA 5ECGA 1GW6A 1Z3GH 5BZWA 3RWIA 5CEXA 2DN7A 3WV0A 4NQUA 1QBLH 4W9LC 3QG7L 4NBXB 3EJSA 4XCEA 3TTSA 4AMWA 1GGIH 4RMVA 4H1LH 4D0CA 4DTGL 2BSRB 1X6LA 5DRZB 2ZX5A 4DGVH 4XVTH 4RZCB 3QVAA 5IB1B 1CYGA 5E8NB 2VR7A 4ZDHB 3QI9B 2IPTH 2WYHA 4QYOA 3IVKB 4PBDA 1QR1A 1E7VA 2D73A 3V8CA 4QWWC 3T0ED 1IKOP 1IM9B 3C6SB 4P57B 3QDAA 4XHQA 1YEGL 4CDHA 4YNYA 2ZKXA 2EDDA 5DZVA 1D5IL 2IANE 3Q06A 1KBWA 3ARPA 2GB2A 4JO1H 3LRKA 4U1HA 1NGXB 2C9PA 2EH7H 4TNFA 4KI1A 2HWZL 3BP7B 2GY7B 2KUTA 4KNTA 4QYAA 3CE1A 1PF3A 1U8NB 3QJZA 4HWNA 4PJCF 5D1ZB 1DANT 3QRBA 4B60A 4PYGA 4KVNH 3KLAA 3AGVA 3D2UD 1F13A 3ELQA 2C1PB 5FUCC 3KPPA 3HTLX 5H4ZA 2IG2L 3TCTA 4S1RL 2CK2A 4Y4HD 5ICXA 4DGWC 2J5WA 3IMBA 3WSQL 2R0LL 3ALWA 4N2GA 5F93C 4G71B 1KCVL 3PGFH 1M6OA 2EABA 1U3HA 3PWNA 1MAMH 4GQ9H 4JM2F 3X11A 2I5YL 5F3FA 5LCVA 3HAEB 5LXVA 4OI7A 5L6YL 5C09E 5KS9F 3MZGB 1N68A 1OCCB 4UQCA 4JPVL 4KAQH 1K5WA 1J7VR 4YE4L 1QNZL 4H0IA 3CVCA 1E4HA 4IYKA 4OCSL 1CE6B 2PXYC 3RVTC 5BNXD 4MMXC 3BAWA 4KV5F 4N2OA 5F88A 1YQVL 5A43C 3VH8A 1NBVL 1SM3H 1V05A 1EXUB 1T1YA 3MRMB 3F64A 3HI6L 5F0PB 1DLFL 2DQCH 5CIPH 4UOW0 2PYEA 3QFJD 2NTFB 4C8XA 5BOPA 1CL7I 1QAWA 2DQHL 3GZKA 4MCZB 3RU8H 1INEH 1E9QB 1ZT1A 1MJ7L 1S4IA 2D7MA 3ARDA 4NO0B 3U4EB 5FYKH 3CZNA 1NBZB 2DWDB 2I07A 2EINB 4TSCH 4ILDA 3IE4A 5DQJB 5C3TA 3BKCH 2MTAA 1TFHA 5E94B 2W65A 4N2DA 2CO6A 2UV3A 2Q6WA 4XXCA 1XL6A 1IAOA 1XH1A 3C9NB 5GJSL 5ERWA 4I7ZC 3VJ6A 3LHPL 5G55A 1G5AA 2X6UA 1S7UA 2FJHB 5D1QC 5JPMB 4H2CA 3WIIH 4O2FB 2VDNL 1XF4A 1OF2A 2WVSA 3MRHB 3ZE1F 3C2SA 3Q7JA 2ALWA 4OKVB 1WZMA 2JVUA 4X80L 4ANXA 3AG3B 2ZSWA 4P23A 2QVTA 5DEJA 1KN2L 1KJ3H 2VQ1A 4NUJA 5E0FA 1BV8A 4M7JL 3UTZB 5IT2H 1BA9A 4Q9BA 3GLAA 4N85A 4X98B 5I74C 3GBEA 2F74B 3MRJA 1GC1H 1N59B 1UVQA 5BS0B 2IV8A 4PRAA 1W72B 2Q8AH 5DA0B 5D72L 4NN5C 2CK0L 2VW7A 3CPLA 2J57A 3FQNA 3T6VA 5CS7A 5F7EL 1ORSA 3BZ4A 4UQDA 2IH1B 1ADQA 3V10A 4OCXH 2O6DA 1S9WA 4MDRA 5F71A 3LZNA 2Z92B 4HPOL 2IQ9H 4AV0A 5INCB 3L4TA 5F7HA 1NDTA 3KPRB 3D39B 3NPZB 1YMMD 4HGMA 2PNDA 4XPAH 2HA1A 1KJVA 4GS7B 5BV7L 4L9LB 1KLUA 5C09D 2OTWA 4M56A 2DTSA 1BD2E 2Y6TE 3DI2B 2H9GA 2QVMA 3EJUA 3BW9A 5T3ZD 4QO1A 4H0GA 4H5SB 3LB6D 3V5HB 1HZKA 4XN8A 3WKPA 3ARVA 1E8ZA 4XT1C 1U8MA 4W6YB 4XTRD 3P11H 2WLLA 4W9JC 3SDAB 1LM8V 3C5ZB 4JY5H 1EEYB 3SE3A 4ZMTA 4NZRH 4UZUA 3MRGA 5JNYA 1U8PB 3W38A 3D6GA 3QJHB 3BVUA 3ZDXF 2L7EA 1P4BH 4MCYB 2BRRL 4KBPA 2FJUB 2L0DA 3H55A 4HMCA 4TTDC 4WY7H 1SOKA 1BVOA 4GT0A 1PKQE 4FQLL 3U0TA 1XF2B 3B2MA 4H4NA 3UERA 2IDQA 2V7HA 3FSWA 4H8QA 3HC4L 3WIHA 1TJHH 3RL1A 3WL9B 3OAWA 5BZDA 3LXCA 3O2DA 4NKQB 2IBBA 5DZJA 4ALAL 3IDXL 4GI6A 3VFSA 1NINA 1MI5E 2C9VA 1Q1PA 3DSNA 5AW7B 2R0WH 3ZW3A 3MYZA 2AJ3B 1ROWA 1RUPH 1A9EA 1A6ZA 4PV9A 2CA4A 3GZPA 3KLDA 3MLTA 1EQWA 4KMLB 1NC2B 4DVBA 5B7FA 2X4PB 1XIWA 2JFCA 1WBYB 1W0WA 3LJ3A 5IBUB 4GRLD 1EEUA 3F7QA 3S9DB 2BERA 4E5XB 4AGLA 5IB5B 3TO4A 1LE5A 2I9TA 3KPLB 4JFXA 4CJ1A 5KTEH 5CEZL 3GKWH 3WUWB 4KMTL 3D0VA 1A25A 3OJDA 3GLDA 4G5AA 5JW4R 3D3VA 3QQNA 4HX1A 3D85A 4XI5C 1FFNB 5D7LD 2DYSB 2DKSA 4HC1L 1MFEL 2IDTA 1AS6A 2XICA 2WO2B 1NEUA 3ILDA 2FDBP 5GS1B 1OGTB 2BINA 2DLEA 2FIKB 2QFRA 3GGWA 5D1ZI 3PGCA 2P8MB 3WENA 2D31A 3FMGL 5H94B 2YPVH 2X9ZA 3GSOA 1ZPLA 1MFCL 2HKFH 1R34A 4UIKH 1PU0A 1M2VB 3VNYA 1PG7L 3DTXB 3T1WA 1JZJA 5FGBA 4HDIA 4HBQA 4Z7UF 4ZPVB 1AO7E 4RGOH 2WTOA 1U3HC 4GG8A 4KI5F 5I1GH 1P7KA 3E7JA 3LOWA 2EP6A 3G6JE 2GHZA 1DO5A 4MBOA 5FYJU 3T3ME 3LNFA 3LIZH 4HS3A 2GUYA 1YJDC 5EU5B 5CWSA 2Z93B 3AADB 4KKPA 3ULUE 5ENWB 1L3NA 1M71B 3NCWA 3MFGB 4LP8A 4NYLB 3GSNL 5GGRB 5T5FL 4BFRA 1DBKL 2D7PA 5AOMA 3MGAA 2G3ZA 1DZBA 1QASA 4F8QA 5I71B 1G7HA 4WEMB 5C0JA 5DD1H 1ZSHA 5AKVA 4HEPA 3II3A 2GC7C 5DHVB 2G60L 2WPGA 3X1EA 5C0IA 4PJFE 2ZWKA 3HG1A 1YRKA 3LS5H 4FHKA 3ILEA 3MRKA 3ARDC 4KKZA 2MOVA 3MGOB 5KYXB 4PGBB 1CXKA 2Q3XA 3SQOH 4I48A 5T3ZH 3L54A 1CFVH 1CLCA 3U83A 4LNVA 4XOBA 3UJIL 1VGKA 3MCG1 3V79C 1RVFH 1BM3L 3ARED 4OLUL 2DLFH 3SE9H 2XKNB 4K3DH 2FECI 1HNYA 2PPFA 5T1LB 4PP1D 1BXXA 4G1MA 2WTRA 3UCRA 2A3TA 2GIYA 6PCYA 3D09A 2QMKA 4KJWD 1SJMA 4MA3B 4M7KL 4Q9QL 4GO6B 3VGEA 4PS7A 1YEDA 2DJMA 2BVOB 3CN2A 5HHNB 2GBTA 5GRUH 1FYTD 1SXNA 1IBYA 1I75A 2I32A 2R2EA 4YK4C 5A3IC 4JFPB 1LEGB 2E9IA 3UJJH 3DBXB 2H0EA 3MFFB 1KGCE 4MB3A 2GAZA 4L5FE 5AW1B 4Y19E 4KVCH 4X4ME 1CFTB 1LWRA 1A7PH 4JO3H 4OV6F 3O9WA 1X9LA 2R4RH 2FEDC 3IRZA 4R7VA 5E7FA 1KBBA 5J3HD 2UX7A 5HHMD 2RQ8A 3HA0A 3MNVB 2JQAA 3CBKB 3AU0A 4H1LG 4M9PA 1CURA 3AT8A 2YD9A 1S9YB 1RZKC 4K8RL 3WTUA 3ZO0A 3QDGD 3UAJC 4B9JA 1S7RA 3CUPA 2IFFL 4OLWL 5HHXL 2Q20A 4BFKA 3OR7B 5EOTA 5SX5H 2ZXWB 4FABL 2VXTH 1L4IA 2MNUA 4AM0Q 3S36X 1GTFA 1S5IH 3MRNB 3V52L 2ZYRA 3IGKA 4ZXBC 1EAOA 4LCWE 5CLTA 2OCFD 1HESA 3KXFE 1JVLA 2Z8VC 1J9QA 3ATFA 5I19L 3QEQA 1ZWIB 4RAUA 2Y3NA 5GRVK 1LP9A 2EYTB 4MDJB 5J13C 4K23H 1JXKA 3SE3C 3CZFB 1MJUH 2BHFA 3TXAA 2D0HA 2NY0B 1HK6A 2QZQA 1E90A 4NQSA 3GSXB 4XVSL 3IAQA 1RZ7H 1BFVH 3TC9A 2NUPB 1OE3A 3FBKA 4F1ZA 2CLVA 3S88H 1B0RA 4JFSA 4P2RD 1MLBB 1I7TB 2X4NA 3CNKA 3DWTA 5HI3D 1XGZA 4BDVA 2ZWYA 4FFWD 3GSWA 4NQEB 3ML8A 3OQ3B 1DL7H 1G6RA 2GCYB 2X7LA 5DU7A 5MP6H 1TTGA 4OZIA 3Q1EA 2PO6B 3AACA 1OHZA 4S11A 4XMKL 2HVKA 1M57B 1XGTB 2GIMA 3QWQB 5TDPA 3T3PF 5C8JA 2XQBL 1QEWA 3EUUA 1IT9H 2AQ3A 2XQ0A 1X7QB 1GGBH 1CQYA 1UB5B 3QT2A 3EFFA 2R69H 4JW3A 2XWJB 4MRBA 2NXYB 1SXAA 1U93B 2YXVA 5TH2A 3E2HC 1QHOA 3VSVA 1KJ2L 3MV8A 4LHUB 3NK3A 5EO0B 4WW2A 5JHDB 1D5MB 2HFFA 5I8CB 1DBBH 1WAAE 4TNWK 2JJTA 2XIBA 4HGWB 5F9OH 4L4TA 5LBGA 3DETD 1UATA 5HDQH 2F54D 4LF3A 2VDPL 3B4NA 3QRLA 4ZPTB 1XIWC 2AABH 4TSBH 4M02A 1RHHA 3ZT5A 1MFDH 4WDIA 3MLSH 4XMLH 3TO4C 1JGUH 4L05A 4AQ1A 4YQXL 3V4UL 2YLKA 4MJHA 1YEHL 1YG9A 1NKGA 2BFGA 1S7SB 4TVPD 4Z0BH 5F1IB 1NAML 4G43B 3S0PA 4FQ1H 3EO1A 2EDYA 1O6SB 3O81A 1U3JA 1FYHB 1E9PA 2H47C 3H3KA 1U3NA 5AALA 3SPVB 2IJ0C 1Y0LA 3BSZA 1YNKH 2RJMA 5FW8A 1NPJA 4HUXB 4A55A 5GZOD 3IJEA 3QIWB 3QAQA 1GGCL 3RJDA 1JS4A 1SEQL 3FQUA 3IFPB 2J5LC 2C9RA 3HVNA 1FZJA 2YSTA 5C0GA 3ABMB 5LQBH 1E6OH 3G5XB 4UF7C 2XXGA 1H6UA 3BUTA 5FGBC 1A6VL 3HFFA 3HRZA 4F3FA 5DC2A 1MCBA 3HNVH 4FLRA 3DHPA 5GRVL 2DBLH 1OAYL 2D7TL 4KVPA 2F19L 4Z0XA 5I0VA 1ZLSH 1RPQA 2DQDH 3S3SA 3N43F 2BMKA 3FZUC 2FWUA 5IVXF 3OKLA 3N44B 1SY6H 1WYJA 3FPYA 3M1BB 1RIHL 2QPUA 3QZPA 2W9DH 1QRNB 1U6AH 5A2CA 4Z7AA 2VLME 2ITDB 2QQQA 1JGEA 1B4JL 2V2WA 3IJHB 3SKUD 2UVEA 3NEXA 2H3KA 4NUGH 3JUZA 1HX0A 3VFNB 4TUKL 3P30L 4PV1C 1TQBB 4N8PA 4YDIH 5C0EB 2FR4A 4JM4H 1XF3B 1P0SE 5D5MF 4LDEB 5IB2B 3QFGA 3UFIA 4OGAD 3JTTA 1BLIA 5JORB 2JQZA 3R06A 4G6ML 4P5TC 1GYCA 3CLFL 4LPUA 1FZKB 3KWVA 4IIQB 3ECVA 4PCKA 2KZWA 3QORA 5ILTH 4GKSB 1IGIL 2WWMD 4H8WL 2XNAA 4IBTA 1A2YA 5DHMC 1KCSL 4F8LA 2DBJA 2HKHH 5L9DH 2ZX8A 3IDGB 3S4SA 3ZSTA 1P5UA 2EO7A 1HT6A 2IAMB 3WY1A 2GTQA 2MQ0A 3QAZB 2CCLA 4JRXA 4PJ5D 3U46A 3VXUB 1BIHA 4BCXA 4OF5A 5GZNC 2ZAIA 4C59B 3M07A 2Z6FA 1P6FA 2WLMA 1KN4L 3HS0A 3RDTA 3VSUA 2TSBA 2DZEA 2VAAB 3OHXB 5LLIC 4XP6H 1FH5H 3SKMA 4CRPA 4NRXA 2AQQA 4QOKA 2WZAA 2Q7AA 3QDMB 4W70A 1CTNA 4OQTL 1KIPB 4NQDB 4LPTA 2CO2A 4JBSA 2VMDA 4ODWA 2IWGA 3KLSA 4NZJA 3IB4A 2P5WA 1NLBH 5E08L 5DT1L 1ZT7B 3MJ9L 3O2WL 2FIRT 2WGNB 15C8L 3HE6B 3RI5K 1XB6A 3ZL4H 5B3JF 3BPCB 4MJ2A 3MRCA 1IM9D 3O9WC 3Q6FB 2CBOA 1AKJA 2AQTA 3ZT7A 5A2FA 3BUQA 3SSGA 1E67A 5BS0E 4DP7X 1DE4B 4LZKA 2VN4A 1IGJA 2ZWZA 3QUZC 2P7TB 2JB6A 3U6XS 4G3YH 3ZKMD 1ZV2A 1HSAA 5CMAB 1CLOL 1DBAH 5JA8B 2H2SC 2CO3A 2H6PB 2OR9H 2VKXA 4GOSA 4YHYB 4GINA 1Y6KR 1F3RB 2C3VB 1LEKB 1TVHA 2OZ4H 3I6LE 4LLMA 3CZGA 5D1ZD 1O75A 3FFCB 4L5FH 2C7UB 4ONFL 1MQ8A 2WQSA 2YD7A 1HEZA 1DSFH 2RFXA 1P6AB 2NZ1A 1T4KB 4APQA 4IIZA 2VDMB 5E2WL 3QJQB 4TVPH 2P3YA 2VLMD 4X7SH 5B22A 3KPRE 3D39E 1PVHA 2IPUK 3FT2B 1EBPA 2ADGA 5DHEA 1OIOA 5HHVH 2OXGA 1W16A 4G80A 2ZWLT 1XGPA 2Z31C 3ESOA 2P45B 2A83A 3NCJH 3A6OA 4RDQF 1I8IA 3FN9A 1DUYB 4FQHB 4Y5YA 1J8RA 3TBBA 4DKAA 4OCMC 3HC3H 4N87A 5E24E 2X4QB 3EH4B 2CJUL 4HKZA 2C9XA 4K7PL 3QXDB 5DRNB 4ZW8A 4LAQL 3L3KA 3SDCA 1TKWA 2Q0ZX 3GMLB 4TLUA 1EMTL 2ZOTA 1MWAH 5GRZA 1TZHB 2PYFA 5JXAH 5T1DL 4GKNA 4L8SA 4LCIL 3H7BB 3K4DA 2X5PA 2VRAA 1QWNA 1SQ2N 4K55A 1TZ8A 4KTDH 1RZIB 3OKKA 1T3FA 3MUUA 2L7UA 3RQ3A 3C87A 4HS8L 4ONHA 4OGYL 2QL1A 4QRUB 1T5XA 4PHXA 3WNOA 1EANA 3RGVD 4Q2ZA 1AIFB 2FTAA 1CFNA 2JJTC 1U58A 5K1JA 1PMYA 3KLQA 3S3BB 1BBDH 4NWUH 1FL6A 2OA9A 2VDLL 3N42B 3PP4H 3SY0B 2FJSA 5DJXA 3GUTA 2EKJA 5JDJA 2OYKA 4EMZA 4R97B 2R29A 2Z35A 4IEFB 1CC3A 4OTXL 3BVTA 2JV6A 1P4IH 1V55B 3UYPA 1WD8A 4EI6B 4HCRA 3LH8A 4XMZA 2Q1EA 1KYUA 1TJGL 4KRPD 4LBEA 1EVTC 2GJ6A 1CFBA 4KROC 1A1MA 1OP5K 4D3CL 3VTAA 4Z7VA 4UM9A 5IHUH 2N56A 4KJYA 1G7JB 2FNWA 1G7QB 3RPBA 1UJTA 1Z66A 5HHPB 4PJAF 2NUTB 2UZPA 4C83A 1KUMA 2WAHA 1FAIH 1A7OH 1FRGL 3KJ4B 1R6VA 4IOFD 3RE0A 3QXAA 4KRNA 2YJQA 3BT2L 4JRLA 5JXED 5ID1B 3ZHNA 2XTJB 3PLYA 1QLFB 1A4BA 2RD0A 2J2ZB 1U9KA 3I50L 4IBLT 3DJTA 2V4LA 3HHSB 3OAZK 1EGJH 1ZHBB 5FV2A 5K39B 3HRZC 4LVNC 3TYGH 4F7MA 4MAUL 3SYQA 1XXDC 2BIQA 1JNNH 3PREA 4LLUB 1E42A 2RQEA 2XQYG 4NKIL 5DC4B 3VW3L 3X1GA 1Z5HA 3HBQA 5HJBA 3GHEH 4HIHA 1YY9C 1I8KA 5CJ8A 3QEHA 3CDGB 4AJYV 2PR9A 3K8LA 1LDPH 5FM5O 3RAJL 5GGQH 4ZQTA 3F5WA 5C0CA 3DNKA 4FULA 3CXHK 3EH3B 4LPVA 1E9OB 3VYNA 1AE6H 2CHWA 5KYNA 3WTYA 5E6RB 5I0ZA 2B3RA 1A7QL 3EYUH 1HHKA 1PX3A 1MREH 3KGUA 3TPKA 3CFKA 5T1KD 4I2XB 3P69A 2E6PA 2NY5L 3PHOA 3QULB 2AK4A 1ZA3A 1NEZB 1KBGL 2EC9U 4N90D 2BNRA 5EN2B 1QA9A 4NO5B 2LFEA 1BX2B 3CWGA 3P4LA 4Z5RB 5E9AA 3FB7A 1HKLH 3RIFF 3UTTA 3JV0A 1C1EH 1WAPA 3QO0B 1SF3A 4OCWH 1MRCH 1RK0B 4KQ0A 3Q2LA 8CGTA 4JFZH 5AYQA 2AJYH 4TTGA 3UO1H 2WBJA 1XD0A 3LCYA 3L4WA 4WWOA 4KQ3L 1S8DB 5DJDA 1E4KA 4JFFD 1N70A 1EEQA 1QMUA 1NMAH 1USZA 4L1HA 4HJ1A 4Q6YA 1NCWH 2ARWA 2HXAA 3M8OL 3MBED 4WK4B 2WBWB 4RFEB 3SGDI 3F7RA 4XBMA 4PS4L 4R4FH 4MNHB 4F80A 4X7EC 1HAUA 4MRCA 4RVBA 2A6DA 3HN8A 4LSVL 5J7CC 1KC5H 2E8YA 3LNHA 2QGEA 1GIGL 3TNMA 4MMZB 3VGDA 3NDZE 2RA1A 1RIVL 2NNAA 1T20B 5HGDA 4JG1H 4F93B 1QKZL 1ZTXL 2UWEF 3U4BH 1N5YL 5D2NB 3QRGL 1TG8A 2COVD 4KHXH 3TBWB 3HI1B 3IMVA 1CCZA 2QHRH 1TCRB 1PG7X 4LLQB 4ZUTA 1A9BA 2DQTL 3TJPA 1QVOA 3WDIA 1WFJA 5KVFH 1E4JA 3HVDA 1UGKA 4YHLH 1I1AB 2AF2A 5E5MA 4IU3B 4LLDA 3QO1A 2DTML 4OM0L 1IC0A 3K8KA 4Q0XL 1YEKH 4X5RA 3V6OE 2DRUA 4QTHB 3KDPB 4B96A 1KY7A 1R5VB 1F4YL 1W72H 3OWRA 4WWKA 5FUZH 4DO4A 2PWHA 2YAEA 3QNZA 5E23A 3WFHA 3BAXA 1CDHA 2HJFB 2NNRA 3RZCB 1C5CH 3DDFA 3O6KH 4HH9B 1DVFC 4HOMA 1R3LB 5EO1B 2HG0A 4JFVA 4P2QA 3F85A 5B1KA 1DJHA 2R2BA 3FQXA 1OT1A 4HUCA 2XG5A 3CX5K 4Y5YC 5IFHH 1MPAH 1QRKA 5DC0A 5GJTL 3L3OA 4HJGA 5CJXA 2X9XA 2JI1A 1JHTB 3PWLA 1S6NA 2BP3A 3Q43A 2E86A 5AZEH 1ZPUA 2C4FU 2J6EA 5ACZA 4WNQB 4YDLC 3BP6A 3SDCC 1P5VA 3BZFA 2WZPD 1IEAB 5DGQA 1DDHA 2N0KA 4YDJB 3VWKA 2BW5A 2MCAA 2YMOA 4XO4A 3AWEA 2NLJB 4KDTA 3HZYA 5IOKA 2X1XR 4L8SC 1LGVA 2YK1L 5T3XE 1S9KC 1NGZB 4NQEE 3V0VB 2MMXA 3MPCA 2VR6A 3G04A 1NFIA 3KDMB 4N25A 4U6YA 1CXIA 4MVBD 5E5UB 5LWYL 4Z8FH 1K8DB 2DOCA 1JFQL 1P4LA 2YQ2A 4KITB 1ND0A 3ZZSA 4TOYL 1GR7A 3US0A 4U6XB 2YEZB 1KEGL 3HJEA 3QJSB 1HCZA 1SMAA 2V17H 3CFTA 1NGPH 3FCBA 4IBUA 1L9SA 1S7XA 3CBRA 1F90H 3I6KB 3STBA 4IRJA 3EO9H 3OKNA 5JHDE 4WFHD 3UC0H 3ZDYF 5K9OB 5J1AB 3SHSA 4YOKA 5H35B 3CVIH 4KGJA 3G5YA 3JVGA 3S97C 5IEKB 1KPRA 5FB8A 3MLYL 2Y1VA 4F92B 1SDAB 4QXUL 3BKMH 4OGZA 3ZZLA 4E41D 4F15C 1O7SA 5KAQF 2MKWA 1F42A 2VN5A 4BFBD 2QZ5A 3UBFA 1G43A 2AJSH 1EUTA 1CGSL 2O5XL 2QQLH 5EIIG 3BD3A 4K3JL 3P73B 5DJAA 1X5JA 1MFBH 1E4WL 3OKEB 5FOBB 1ED3B 3B5GA 2FGWL 4TQEH 2M26A 2VSMB 5TE7L 1KCRL 3EDKA 3FCSA 4MA8L 1YQ2A 3WTXA 2GY5A 3H54A 4ICWA 4RDQG 4FQJH 2EC8A 2PP7A 4JDVA 3DXAB 4MQSB 5T33H 4P4KB 1Z0NA 2K6YA 1JZGA 2CMRH 4IBSA 1MF2H 7CGTA 1LD9B 3WJLC 1FG9C 5JTWA 3CXHJ 1NIEA 2AQRA 2NY3D 4HK0B 4W4NA 5LCVL 1MCPH 4XE0A 2YFOA 4EAEA 1O7DC 1PY0A 3AJ7A 3EG9A 3MOQA 5IHHA 3NGBC 2Y7QB 4HF5H 1V27A 4RRPG 2I9LA 4PY7B 7PCYA 2R0ZL 4CSTA 4XGZB 3GD1C 2NY0D 1XCQA 4ELMF 1IBHA 5JO5B 2EDWA 4NNPL 5K9QI 4LSQH 1Q9LB 1BLNB 2UYLA 2AJUL 3OC5A 2PP9A 4EN3C 5DGRA 5B39G 4OFVA 2XRAH 1QWHA 5T3XD 5I1IL 1D5BB 4OFQA 2JQMA 1ZA6B 2OMXB 5IBLD 5KBLA 1J0HA 1YUHB 5IW1B 2W38A 4HJ0D 2PO6D 1OWRM 3SO3B 3BUYB 3DMMD 4JE0A 1IBGH 1HQ4B 3BAEL 4F9LA 1JGVL 3HS9A 2A77H 1TTFA 1VCBC 4JZJA 2FK9A 4C58B 4ONGH 4HBCH 2WBJC 5DUJA 2V33A 4JANA 3NTCL 2XUWA 4ACTA 1CLVA 4G6JH 2G5UA 5LHDA 1E4KC 1L0XA 4J2XA 2M2DA 3S98A 4LHUD 4OZGB 4HKJB 2CLRB 2YC1A 5GISL 5EBWA 1YC8A 4PJ9A 3VE0B 2E27L 4UIMB 1UKTA 3AAZA 1K72A 3VXUE 2EDHA 3B9VA 4OD3H 4PRNA 1FGNL 2MWCA 3F7VA 2EDMA 2HTLC 1QFWL 1F11B 1U8IB 5JMRA 1GY1A 2WQVA 4F7PA 4RBPH 3WNJA 2YPKA 1A0QL 4OBRA 4JJ5A 3QDME 3I3DA 2I7SA 1PD6A 2X12A 4NQDE 5DQDH 1FFPB 3PL6D 4Z3HA 3J27A 3QCUH 4OZFG 1SYVB 4N2AA 4NDMB 3INUH 5KVDE 5C0AD 5A7BA 1PBYA 4I18A 4D9QD 4J3OC 1ADQL 3QFDB 1BMZA 4QR7A 1RZKL 3MODL 3RTQA 1XVSA 5C6WH 2BZ7A 3IDUA 4HUVB 4EQ3A 2BXYA 1URZA 2J4WL 1T7ZA 4ABVA 3QUMH 4OFYD 3MNZB 1MHEA 4M8VA 3DRQA 3G5VA 5FECA 1AGDB 3CH1B 3GIVB 2IDSA 4D7BA 4ENED 2Y23A 3W0WB 3UIZA 3V0JA 2VQ4A 3PQYB 4ZMYA 4J5VA 2Z7YA 3FYIB 3H56A 6TAAA 1IC5H 2QPSA 1MUJA 1DQIA 1J9TA 1YN7A 3SDDC 4E9QA 5I1KH 4M03A 5IHLB 3FFCE 3FHAA 3EHBB 5F1NB 2CDEB 3REWA 4ZMLA 3N3EA 2EDOA 3KR3L 4ZNCD 3CX5J 3ESUF 3ME0B 3G6AB 4BIKA 5F9JB 3QPQD 4XBPA 1QRND 1IGCH 2BP5M 4L3CB 4OUUB 1VADB 4M5ZH 2P47B 3JWOL 5I30L 3F65A 2OXHB 5CJXC 1I1FA 1PD0A 2ZKHH 3B5TA 2JIXD 4YC2B 1CT8A 2EEFA 4LP4A 1ZE3C 2GSGB 3GZQA 4R26L 5KJ4A 2CDFA 3GMNA 4R4BA 4YBQC 3RWEB 4LQ1A 1EHNA 3NAAH 4OZHF 4Y4HA 1BPLB 2MCPH 3WD5H 3JWNH 4BFIB 4HFWB 5HDOA 3VWKC 2Z91A 1I7ZA 1Q1JL 3QBTB 2F18A 3U9WA 1KPUA 1R1CA 4M1CC 2ZG1A 1NLDH 4ZTOL 5D1QE 2R56L 2H3XC 3O2DL 4M00A 3AG4B 3JUYA 1F3DJ 3FUHA 2F61A 2B08A 1OLLA 3W39A 1KCKA 3A67L 1PIFA 1FF5A 2DD8L 2P5PA 3NVQA 3P2DA 4P5KA 6CGTA 2R2CA 1HHIB 2EDKA 3NABL 3VXUD 2B8OT 3GYRA 4KY1L 4YVNA 4HSCX 1IGTB 5JZ7C 2J21A 2FYVA 1MLCA 1Q8MA 4Z7QF 1HYSD 5T3XH 4IRJC 4Q6IA 5BRZA 3KMDA 5AYTA 5DZNA 4BSVB 5DHDA 1L9PA 5AW8B 3QFJA 4OM1L 2JKWA 4FX5A 5L88H 3GSRA 3GSVA 3JSSA 2ZCKH 2VR5A 4LHJB 4ORGB 3FRPA 5G5DA 3TBTB 4NQDD 2ZNWA 1WFMA 3EBAA 3JVGC 3RVUD 1GHFH 1BQHG 1KXTB 4GLRI 2C1OA 3FRUA 4BEIA 2RHEA 3CDFA 3ZDXE 3I2CH 4G6KH 4G8GB 4DKEH 5DMKB 3NBNA 3IM1A 1M05A 3MACH 4ESKA 2IDFA 5D6CB 5IW3A 1OM3H 3O3AB 4MB4A 2XTSA 2ZXAA 1AC6A 3DX0A 5AWNL 4N4YB 1BOGA 3IBEA 2ADJB 2V0AA 2XWTB 3KCWA 1H9DA 1L9RA 4OSUH 3DHJA 2DEXX 3GBNH 5IKCA 2ZAGA 2YWYA 2YPVA 4PTUB 1VEMA 1UM4H 2F6AA 1X5IA 4HWZB 2XTJE 5C07B 3DX8A 1U41A 2I24N 5E9DB 1HXKA 4OJYA 4XC3L 4PSRA 3UBXG 4F27A 1WA1X 3FT4A 3GIZH 4RSYA 4PWJA 3LIUA 4PV8B 2NCMA 2IANA 3F12B 5FO9A 3FONB 4YO0B 5HJ3B 5EO9A 1IQWL 2DQJH 4KKCD 4L29B 4GAJH 2H6OA 3LIZA 1KEMH 1OB1B 4M5YH 1QBBA 2K4WA 1MCCA 5SWZD 1BFOB 3SE6A 2MEJB 4R5XA 3IYLW 4HIJA 4JQIH 3TEUA 3QWRD 4KTEL 1B0WA 4PS8A 4P5RA 3FOMA 2XYCA 3OB0K 4OF6A 2B4CC 2BP8A 3G08A 3I9GL 4X4YA 4QNPF 1NIDA 4P3DB 5D7KE 1HWHB 1JGLL 3QCVL 2X4UB 3SOBL 1SBSH 3SJVE 1R33A 1RU9H 2Z0UA 1HZHH 3LKPB 4MQ7A 3WLWC 3LKOB 2P43B 2KZ1B 4NO3A 5I0XA 4PJGF 1MCLA 4ADJA 5C09A 1NGYA 4U4IA 4YDKL 4HKBA 3MV7D 1V7NL 4F9LC 5T8IA 5DHXB 1XB3A 2WVTA 5IGXL 1P1VA 4JFUA 4QIRA 2WGXA 3DECA 3U2IA 3H2PA 4YHOH 4P4RB 3MRIB 4BSJA 2FYYA 3SBRA 2WUBL 4LSUL 4LSRH 4Z7UE 5KAQG 3QGVA 1G5GA 5GSVB 5J1SC 5I1DA 3LH2H 1HI6A 5AZUA 2Q87A 5GIRB 4NQTA 2OQJA 2V2XB 5B3SB 1OTTC 2VOTA 1ZVSA 4PIRF 4PJ9C 2EVGA 4AZ8A 3ZTJH 2B0SH 4MSWB 4D0DB 2XVBA 2O6PA 2NY2D 5DFAA 4M7LL 3N2JA 5TQ2L 1X5ZA 2MNJB 3F58L 3CC5B 4ODVH 5AD0B 5JQ6L 1JXJA 3FO9B 5IJVB 3TGXA 2AVGA 5F7UA 2HN7B 3L9YA 5BOJA 1LWJA 1J05A 1SHSA 1GRWA 2EIZB 3LDBC 3LNDA 1JF5A 1Z5LA 3RY4A 4Z1PA 1TETH 4M3HA 1F97A 4JPIA 1USQA 4KKLD 2XQYA 4LE8A 4YXHL 2XOTA 2KKQA 1F58H 5D1XB 12E8H 3TVMC 3RTQC 1K4DB 2YD1A 4FLSA 2JELL 4AITA 2EXYD 1UM6H 1HILB 2CKBH 4IRZH 4GI8A 4FXKB 1AY1L 5HHQB 5EEWA 2APTA 4YHKL 5D2NE 3SYOA 2FCBA 2FH8A 2WJ7A 5JIQA 1UB6A 5KVDH 1SBBA 4IU2A 4FQQA 1IGFL 2Z7UA 4CU6A 3P40A 1BGXL 3QUYB 3RX7A 3DYPA 5KSAC 4FLHA 2X40A 5FYLL 3HNSL 1UOKA 3KLHC 2OYLA 1GA2A 1IC1A 2WNKA 1ZJBA 4N8CL 2XI9A 4PJHF 3IMWA 4JJOA 4DPBX 5I18H 5FKPB 1RZJL 4J27A 4ZSOB 3CDYA 3VFUB 1JYWA 3IKCB 1MHHB 1AP2B 3QUKB 1KT2A 1WD9A 2VDRH 2YPLD 3GPSA 3Q5OA 5KANI 3TYFB 1S3KH 2I7OA 4UZSA 2ZP8A 4Z78A 3O8XD 1PZDA 2GBUA 2P4AB 2ZIDA 2Q2LA 4J3WA 5T1MA 5KVEH 4MQTB 5F2FA 1WS7A 3EYVA 4XAWL 4OD1H 5SWSD 3DPBB 5HGBA 3CN1A 4JMNA 4NKOA 1I8LA 3PUCA 1VFAB 5I17B 4QXTB 3QQ4B 1KNOB 2GJJA 4EKXA 3QC6X 3IFLH 4XMWA 2K8QA 3NIDB 1EAQA 4IGBA 1XCTB 2R69A 3B7UX 3QIUB 1VPOH 2X4SB 4TF4A 4DN3L 5HGAA 1JHLL 4WTZA 5HPMB 2IMNA 2NXZD 4FZ8L 4LGRB 4CGUB 4I9WE 4I0PD 2DQEH 1P7QB 2EYSB 4TUJB 2OX5A 1PKQA 4Q6IC 43CAA 3IFNL 4ADIA 1AQDB 2EE2A 4J23A 1WIOA 3IEAA 2WWNA 1M42A 4XNXL 3UYRH 4DP8X 5MEQB 1BAFL 4DUWA 1EEZB 1TSRA 4UTAH 2HB0A 5IK3B 2ITEA 4JHWL 5I1LB 1MI5A 1UD4A 4JCWA 3HI5L 2DYRB 5DLLA 1BREA 1KPVB 2K0RA 1PY4A 1HEHC 3QUGA 5GGVL 1Y1UA 2E0PA 1C08B 3FBQA 3J2PA 3QUXB 1N19A 4HZLA 3BSZL 3WXVL 3QC5X 2JJUA 4YR6A 5ADPH 4NPJA 2DLTA 3DUUB 3I9AA 2P9RA 3MJGX 1ZGLM 4R90H 2SODB 1S7WB 1ZHKA 3CD4A 3IF1B 4YGVB 1NA8A 3RL2B 3QG7H 1RK1A 1CJYA 5EZLB 1E4XL 2P8PB 1CGWA 4JHVA 2WLIA 2Y5TB 4JDTH 5DJ8B 4Y2DB 1I1AD 4DTGH 5IOPB 1VCAA 4MJ6A 4B9KC 1D9KC 4Y5XC 2OBGA 3MJ7B 2LT9A 5GS0C 2KS0A 3DXAE 2OAAA 1AQHA 1B6UA 3DVNA 5HYJD 1SY6A 2VUKA 3UZVA 4A7VA 5K9JH 3LKSA 4F7TA 1YEGH 4LLYA 1IE4A 1EFXD 4M4RA 1PL3A 2GT9B 1JI2A 2Z0BA 2F15A 2P5EB 1AS8A 1NMCC 3BAYA 4CMMA 1MCRA 3T6WA 1YNTB 4GIOA 1AO7A 2PXYB 3GFUA 4H2AA 3K6FA 4MMXB 5CILL 1IFGA 1WC7B 5FDWB 5KBDA 4KQ4L 3TF4A 2HKAA 2WZ6A 1C16B 3G6JA 4YBLB 1OCWH 4ANWA 1DBML 3OGCA 2Y9RT 1FPTH 1GY2A 2AXFB 2D9QB 3H9SB 1JPSH 1ZHNB 3GINA 1EERB 4K7FB 4ODUB 2JKRM 1J11A 3UTSD 3X13A 4DKDC 1VFUA 5A1AA 2F1EA 4WI8A 1X4XA 2QEJA 1ZAGA 4YZFF 4OLXH 5FK9A 4X0KA 1KJMA 3JWNG 1GW0A 4FQXA 1DSYA 4OCSH 3GB7A 4PJFA 5D1QB 3JZYA 1NCTA 3ASNB 3FQ4A 4UOW1 4M43L 4X6CB 2X38A 3O4OB 4JO4H 4ELMB 5BVJB 1JN6A 1UACH 3QZBA 4GKLA 3HI6H 4ZMQA 4PQXA 4OZGE 1I82A 4QXWA 5AB1A 3ZMEA 3VXQB 5I74B 1XV8A 1GZPB 5E6IC 3U1QA 3HW7A 5J4MA 1UQSB 5E2TL 2VLLA 5D5ME 1JNHB 2FLMA 1VEPA 3CGTA 4I4WA 4U31A 1BOYA 1NM4A 3HR6A 3PRZA 4ABWA 1LTXA 3LX9A 5GGTA 1J1OH 5CEZD 2X88A 4W4OA 4KRMB 4NN5B 3RFZB 1IM3A 3RVVC 2B1HH 2WNWA 1RMFH 1ZY9A 2ADFL 2EDLA 3BEVA 1HS6A 4YPGA 4GP4B 2DEYX 1WGVA 5C0NC 1RJZA 2BNQD 1SJEA 5JLZB 4XP9L 2ZXDA 5GGVY 4K94H 3BJ91 3SZKC 1I31A 2WP3T 5KJ7E 4X80H 1I7RA 1M7IB 1BZDA 4YUEH 5DR5L 1KN2H 1EJOH 4PWGA 1B9KA 1GZHA 2G3MA 3OF6D 4X6DF 5F8QC 1H3WM 2IMMA 3DX9A 4UI2A 5L4JA 4Y19A 3HMXA 3B2XA 4P4KD 4X4MA 2BC4A 3L45A 4ODXB 5KVMC 3MR9A 1OQXA 3QQ9C 4LLVB 1JCVA 3T2OA 1JOIA 1Y07A 3BESR 4LHUG 1LE9A 5EZJA 3K6SB 5DK0A 1D5XB 2YA1A 4JN2A 5IQNA 3W0WE 3CFCL 4GJTB 3CH8A 3PQYE 2X1PA 1AXSB 3R7RA 5ISZE 1YEFH 4YSRA 1NCDL 3KWWA 4X7DC 4HUKB 4PBWD 5C3IA 1NBCA 4ZS7H 1A9VA 3OLDA 4AUYA 1VACA 1QX1A 1KIQA 3K71A 3P9LB 4ZAKA 3LKNB 1M56B 2LU3A 3PHQA 1U33A 1YY8B 2QBWA 4C4KO 3U2SB 1TZIB 4NPYB 1F56A 5F6IC 4HPOH 4F7EB 2NY6B 3KXFA 4UQIM 1H3PL 3II1A 3KNBA 4Y7OC 2P8LA 1VRSA 2Y25A 3DVGA 3FU8A 3IDNA 4V2CB 5DHYB 1NIFA 4C4BA 1I8LC 4PP2A 3V4VA 2YIHA 3K8MA 5EC1A 3EGXB 4JO2L 1G1OA 4ZTEA 2GJZA 4S1DD 1WRFA 4A67A 4MA1C 1CVRA 3L5XL 4IGBC 4GW1B 5EZOH 2VXVH 1N12A 2EIBA 3ILQD 4U1GC 1TO5A 5CD3B 1SLWA 5HDBF 2W5PA 4CKQA 4XO3A 1CG9A 4ZZFA 1CDBA 3BZ5A 1P2CA 1M7DA 3B8YA 2X2IA 5CZVH 1SYSA 4WV1A 2JCCB 4NQCE 3P3RA 5J89A 2R29L 1G7PB 4L37A 5HDWA 3ZUNC 1FDLL 3TNNA 5B3NA 2BRRH 2LW3A 1B0GA 2AJZA 4HCRL 1PQZB 3ZT6A 1TTAA 2AERT 3K6NA 3L3GB 2BOLA 5HJGA 1RAMA 2WZ0A 2HFGH 3ILPB 4CUCA 5LKNA 2XZAL 4LSTH 3WO4C 1A14H 3ZPDA 1WAAA 2SEBB 4MASA 4ZOAA 4NM4L 5F7AA 2VLRB 4ALAH 5IROA 1MRFL 4GQQA 4C55A 3BCDA 2EECA 5E99L 2W07B 2Z1KA 2JK5B 4L1SA 2GBVA 5LNEA 4B9IA 3JYBA 1UT9A 2XPZA 2YGOA 2ZCLL 3E9UA 1EGJA 3QISA 2BSRA 5DRZA 3VAEA 3C60D 2WOYA 3D08A 3PQYD 4RZCA 5IB1A 2LFGA 3ATDA 3HPJB 4WJG3 1CICD 4QF1B 5E8NA 5C9JB 4ZDHA 1J8SA 3UAFA 4GLRH 3VQ2C 3QI9A 3DA0A 1E5BA 2Q8BL 3IVKA 1U8CB 3EHBD 3R18A 3OD3A 1IM9A 3C6SA 5CEZH 5GHWL 1WP6A 4LSSL 5JW4N 4D9LL 4KMTH 4JPKL 5E9DE 2WC7A 3T08A 3BSGA 1DR9A 4YSEA 3BDXA 3OHMB 4ZX3A 1UD5A 1CFSB 5F6HJ 1SDYA 3VCLB 1D2PA 2H1PH 1NGXA 3QPKA 4HUMB 4I85A 4X9YA 2QJDA 4XE5B 2A9ML 3BP7A 2IBGA 3GXPA 4ZMWA 1U8NA 2N1KA 5D1ZA 1LO2L 3FNKA 4J28A 5C6TH 2C1PA 1MFCH 3FSVA 3L1OL 1UKQA 3ULUC 4W9HC 2G75B 4Q4IA 4F33B 1JERA 1JZ2A 2VZVA 3P3TA 2Z4QB 3HAEA 4FKHA 1ZVYA 4FNUA 3V4PL 3ABLB 2M1KA 4GEJA 4WFEE 3C12A 4HS6B 5TF1H 2AQSA 2VE6B 2R9HD 3NQKA 4FQXC 1CE6A 1GGYA 4YEEA 4AGPA 1AIZA 1IJ9A 4Y4FB 5F3HB 3UTPE 1EXUA 3MRMA 4UQEA 3NJFA 1AGEB 2ZUSA 4EOWL 4YSQA 1J9CT 3VFGH 2G60H 3BGFC 3EOTH 1QSVA 2NTFA 1ZHLB 2QV4A 3NCBB 4MCZA 1E9QA 5K93A 2ICES 4GXVH 5BVPL 3B2VL 4NO0A 1A6UH 3U4EA 4YXLH 2DWDA 5DQJA 3E8UL 2XFXB 5E94A 3WMQA 3O3UN 5KYWB 2FZ3B 3UJIH 1VESA 5K59F 2VMJA 2VXSL 3C9NA 1BM3H 4G8GD 4OLUH 5AUMB 3CFJB 1U8QB 1G9ML 1BCIA 3C75A 4IDLA 2FJHA 4IOSD 4DOHB 3BP4B 5JPMA 4QCIB 1A3RL 5DD3L 4O2FA 4XP1H 3MRHA 1T7VA 1J1PL 3QP3A 4OKVA 1K2DB 4FS0A 3B34A 4MCNA 3AQYA 5FV1L 1OAKL 5CEYB 1SGKA 1T0MB 3VU1A 3BGMB 3RBGA 5D1XE 3DO3A 1A6WH 1GZHC 3PDOB 3SODB 3UTZA 3FU7B 4X98A 3B6SB 2F74A 4A38A 1AHWB 2UXFA 5C07D 4ZO9A 4W6XB 1N59A 3UMNA 5BS0A 5LDUA 1DQLL 1W72A 4XHJC 4XXWA 3GTNA 4ZXBB 4NT6B 4JHZA 5JIDA 4DEPB 4C56D 4OCLC 3FTVA 3IXTB 4FHJA 4X9HA 1RFDL 1H6TA 5JXEA 2IH1A 4ZAKC 2RH0A 4FQIL 3VFMB 2ZE0A 4XNQB 4XCYB 3NFSL 2Z92A 1FGVH 5INCA 1JXFA 3WEMA 3EADA 3D39A 4M1DL 1PDKB 3NIGF 3WFCL 1ROCA 1FG2B 4L9LA 2Q7YB 2OZNA 3TEYA 4AEHL 1A6AB 1X4ZA 3B7SA 4D7PA 2JJVA 1P6WA 4JE4B 2P80D 1RH8A 5ECJE 4B53A 1RZ8B 4GAGL 4H5SA 4YSDA 3V5HA 5HDRA 5C97A 3DURB 1QOKA 1JTTA 3C5ZA 3FSAA 3SDAA 1EEYA 3EBHA 4RFNB 5D7IF 2MNWA 1ZGLB 2E9BA 1U8PA 2V37A 5F0LB 4LEOB 4XVSH 3QJHA 4LVHB 3LZFH 4NUPA 3ZE2B 1QBLL 2F8VA 2NX5E 3IMRA 5T1KA 3VRLF 4GIAA 4NN7B 4MCYA 5I5JA 4ZMXA 2WJ5A 2ZUVA 4TLKA 3QDJB 2H2PC 4YL4A 3BVNB 2H1LM 4DGVL 5B38B 3B8SA 4XVTL 4NLHA 1NMBH 1RIUH 1SJVA 4K9EH 2DWTA 5INDB 1XF2A 4PG9A 3APNA 1HH9B 1W80A 2OI9B 5C7XH 1V3KA 3ARSA 2IPTL 3SGKA 2MJWA 3EW3B 4JGUA 4KGLA 3WL9A 1N6VA 2JMRA 1BYNA 3TIEB 1OCZB 2AHIA 5IROC 2X2HA 4Z7NF 2XETA 5DSCB 3MLVH 2O4EA 1KJ2H 4FL4C 2BH0A 4JO1L 2AJ3A 2ZYIA 1I3RB 4R0LC 4LL1A 1LK3H 4JY6B 1MXDA 2EH7L 3WE1A 3IGFA 1VF5C 4Y2NA 4K3HA 1NC2A 3ETSA 4KVNL 3CDZB 2X4PA 3D9AH 2PETA 4TL5A 1WBYA 1KCWA 4E5XA 3W5MA 4M5TA 5IB5A 3QI9C 3PGFL 3KPLA 4YQXH 3LS4L 3FB8B 4HFUH 4WHDA 1MAML 4GQ9L 3L4UA 3QUYD 1YEHH 3WUWA 4X8XA 3DOIA 1NAMH 3D0LB 4P04A 1J5DA 1JZ6A 4A63A 3OGOE 4KAQL 3GBDA 2YZ8A 1ULVA 1FFNA 1JDDA 4PLOB 1ITCA 4FFYH 4DW2H 3BZEB 5GS1A 2YGVA 2DY2A 4MXQD 4BQ9A 3F7YB 1GGCH 1OGTA 4PD4K 1SM3L 2FIKA 2I26N 2P8MA 2OS7A 5H94A 4YL9A 3FSOA 4TULH 2ENPA 5DVKA 1U95B 4U1MB 4WI5A 1M2VA 3K0WA 2P5EE 3DTXA 3V9EA 1E2WA 4PRIB 1FL5B 4L0PB 1A6VH 4ZPVA 5F7NC 3RU8L 1INEL 4LOEA 4P5TB 4AT6B 2D7TH 1L0PA 2F19H 4I3GA 1ET8A 3ABZA 1WWAX 5FYKL 4BM7A 4ZMVA 1XH3B 3IU3B 4P3WA 1FV1A 1NBQA 3UZEC 5EU5A 2Z93A 4FA6A 1RIHH 3C09B 5IMLB 5ENWA 1DVUA 1HKFA 1IGML 1M71A 2VSDA 3BRFA 4NYLA 2YXMA 3H9SE 1P1ZB 5GGRA 3QIUD 3UAAA 2JKIS 1CI5A 1ODUA 2Y6SC 3WIIL 3CCHB 4TUKH 1NL0H 1Q9KB 3P30H 5IVOA 1J86A 5AAWA 3AG1B 5DHVA 1OHQA 4EUPH 4ZMAT 1T21B 1RD6A 2QADC 4P49A 1UA6L 2AI0H 2WZPA 4PM1A 4PS3A 3MAWA 5IT2L 1QPPA 4G6MH 5EZIL 4YFDB 2BVQB 3CLFH 3MGOA 5KYXA 4X6CE 4ELME 1GC1L 4AL8C 3Q5YA 5DTFB 3BUDA 3KPTA 2NY4B 2Q8AL 3AS2A 4XVJH 1S7QB 1HYRC 2XKNA 3L13A 1JI1A 1OPGH 5T1LA 3T2PA 2F68X 2W60B 4QWWD 3KH4A 4PMEA 1UHVA 5FFOA 5I73B 5B1CA 2F7PA 2COQA 5H37H 5CD5C 3EOBA 4Y1AE 4OCXL 5C6PB 3VXSE 4MA3A 5IV2B 1LQBC 3IJ9A 3EFOB 3JXAA 1KN4H 1TIUA 1ECZA 1UWXH 2IQ9L 3K6OA 4LKXB 4NHUB 2BVOA 5HHNA 2N0MA 4XPAL 1NCJA 3DX7B 3H53A 2EXTA 2AITA 3DUSB 4KKBC 1AOZA 4JFPA 1LEGA 3FO1A 3DBXA 3MFFA 3O2WH 2XN9B 1CFTA 1TSHA 4P0DA 2GITB 2VH5H 4MS6A 3VFWB 3H2QA 1DCEA 1DJXA 1QUNB 2NY1C 2VN7A 3P11L 5F97E 2B2XH 3CJJA 3NJXA 3MNVA 2Z31B 5E6YA 3CSBA 3X14B 1FORH 4JY5L 4NZRL 4PVNA 1S9YA 3CV5A 2Y06H 3UEZA 3V6OA 1CLOH 2AXJA 3S5LB 2PXYD 4NNYB 4OW6A 4PG2A 1I3UA 4IMLB 4TNWF 3AM8C 3RVTD 3DPDA 4BE6A 4XNAA 4JS7A 4KO5A 1CZ8L 3OR7A 1BECA 4L9LC 4PRPB 3MRFB 5L4FA 3OLIA 5F44A 3VD3A 4MJJA 4Z7OF 3MRRB 2H8PB 2WY3B 5E2WH 3T6XA 3SDXB 4PSPA 4XBEH 4AGQA 3H9SD 4JKKA 5KZCB 4ONOA 4TNVK 5CJOL 1ZWIA 3FK3A 3TO2B 4AYMC 2EYTA 2WNXA 3D50A 3H1ZA 4MDJA 4MDIB 3SDAC 3C5ZC 2LAAA 2HT4C 3CZFA 3RUGF 4WENB 4ZFFB 1V10A 2R0WL 3ZR6A 3FTZA 4XAKD 3IU4H 5TE4H 3GSXA 1RUPL 3ENEA 1QBAA 5D1QD 2NUPA 1EAJA 4R4NC 4M6ML 2P46B 1PG7W 1AAJA 2XWRA 2PWEA 1I7TA 2P49B 5IMMB 4PHZA 4K7PH 4V1DB 3RY6A 4S2SB 2GCYA 2PO6A 3T4AA 5FYKU 4UYPA 4DQOH 1XGTA 1MFAH 5CLZA 1EMTH 3W5NA 3SGKC 5KBMA 2FL5B 5EU6D 4NAJA 1MW0A 2KMWA 1CMOA 1ID5I 3GKWL 4N20A 1AZUA 1DFBH 2VDNB 4OFKA 4XN7A 1UB5A 1E6JL 3GC3A 1SN0A 5G4OA 2LU7A 2F0CA 4QI3A 3ZIYA 2XWJA 5ANMB 3W9DB 3H8NA 3UROR 1U93A 3KPNA 1OD9A 3MNMA 2ZSVB 4HS8H 5HP5A 4LHUA 1O7VA 1UOWA 5EO0A 1D5MA 1KB9K 5I8CA 4DKTA 1I9JH 4NIKB 2XQYK 4HGWA 4FD0A 4RIRB 4BZYA 4CVXA 1TZAA 1MCJA 2VLRE 2VDLH 3NCYS 2YPVL 2P48B 4ZPTA 2HKFL 3IS0X 4UIKL 4U0RB 2Y72A 2XZCH 4RETB 5CHNB 1QEXA 3J7HA 2L4OA 3PWJB 4NB7A 4G5ZH 1W15A 5I1GL 3Q44A 1W8NA 1S7SA 1IJNA 5F1IA 4G43A 4D3CH 3LIZL 4EZJA 4WNJA 4NFCA 3K46A 1O6SA 2PWFA 4GP8B 2R1YB 5SX5K 4N6RB 4PB9H 3SPVA 4PD4J 3QIBB 3MCLH 3LPWA 1B90A 4XO5A 4KZEH 4HUXA 2K9FB 4QHMB 3TH3T 4AVJA 3QIWA 4JQIA 2QKIC 5SV3A 5BV7B 4FOMA 1OP4A 5FHBH 4U7MA 5DD1L 3IFPA 1N4XL 2OV0A 4M29A 5CKGA 2Z8SA 3G5XA 3ZRSA 1OK0A 3NZUA 1YZZA 1JNJA 3LS5L 4MAUH 2YD0A 1SVBA 4NKIH 2WINB 3SQOL 1VZHA 2A6KB 2UY6B 3BI9X 4L1DA 4TTDD 5T3ZL 4BWWA 1CFVL 3O4LB 4CC4A 4F9PA 2DH2A 3T2LA 3M1BA 3RI5F 1RVFL 4DP1X 1XH0A 5J1TC 2HUHA 1QRNA 2DLFL 2XA8H 3SE9L 5AL0A 4NQXB 2ITDA 1PSKH 5A2BA 4QGYA 1OW0C 2BOBB 3IJHA 2AAAA 2W59A 3W1ZA 5I1HH 1IRAY 3KYOB 3VFNA 2GJPA 1XFPA 4NUQA 5IFJB 5C0EA 5DJ0B 3ISWA 3DYMA 1A7QH 1XF3A 3U1SL 4AM0B 2HJKB 4O9HL 5IB2A 5IUCA 5DJ2B 2A1WH 1EHLH 3RGBA 5C0BB 4OB5L 4WUUB 5B1AB 3U4KA 5EWIH 4KNSA 3ZO9A 1ZGLP 5GRUL 1FZKA 4IIQA 1KBGH 1H19A 4LB8A 2ESVB 3T4YB 4QNPE 4GKSA 1LWHA 3UJJL 4BUQA 2Y5EA 4PWEA 1E40A 3AT9A 2IWEA 4KVCL 4F7KA 2RCSH 1A7PL 3IDGA 4UT9A 2YMTA 4PJGE 5D4HA 4JFEB 2IAMA 3ZKNC 3VXUA 5BUPA 2A74C 2FBJL 3M1OA 3MV9B 1Z0MA 4ZUUB 2CAKA 4G2AA 4XI5D 4Y4KC 3SQBB 4E9LA 5C71A 4LEXH 4NP4H 2BIOA 1FZMB 3ZE0F 3OHXA 4DOHE 2Y7LA 4IRZA 3SPGA 3OV6A 3QDMA 1JF1B 3TFKC 1KIPA 2H1XA 4NQDA 2VXTL 1DQQA 4HWBA 2P52A 4J6RH 3ESPA 4NNXB 4ZX6A 1S5IL 1ZT7A 4XNBA 4LSVH 1KELL 1U8LB 2AV7B 4JM0A 1U3HD 3BPCA 1GIGH 2FB4H 4OAWB 2BO0A 3Q6FA 3MSPA 2RTTA 4GI9A 1VGEH 3APDA 1SN5A 3OAZH 4K23L 3QEGH 2GABA 1BQLL 1DVFB 2P7TA 4P5SA 1MJUL 1ZTXH 3BZDA 4HD5A 5I8EB 3HB3B 3EOYG 5AVUB 5CMAA 3V6OC 1I4FB 2ZXEB 4EF3A 1RZ7L 1BFVL 1X9RA 2H6PA 2ZP0T 3V0HA 4Z95H 5CLWA 5IQ7H 3S88L 2C3VA 4UMGA 1LEKA 4AK2A 3FFCA 5AAMC 2WQ8A 1RZFL 3OJMB 1UXMA 1SXZA 2C7UA 1DL7L 4B9YA 5D9SB 1T4KA 2J8UF 4OM0H 4Q0XH 1DQTA 4KZ0A 5MP6L 2CO7A 4FI8A 1H15B 2PF6A 1EO7A 1Y18B 3ARDD 5LG6A 1UCBH 3FT2A 1IT9L 2LU4A 1GGBL 4Z76B 3WHE0 1F8TH 2YD5A 3W3BA 2R69L 4CJ0A 3TESA 2LTQB 1MELA 3HHRB 3TBCA 3QWRA 4IOIB 5HYSG 4AUJA 4CBZA 4FQHA 1FCGA 2C3WA 2PP8A 1A8JH 1OZTG 3KPOB 3NJJA 4IMKA 4LPCA 1BF2A 5F9OL 2X4QA 5HDQL 1FVDB 3QXDA 5DRNA 1CK0L 3V6FB 3MREA 1OV8A 2X6AA 1K6QL 2AABL 2CXKA 2EE6A 3F2LA 4TSBL 3VI4F 4XX1E 2J72A 3GMLA 1MFDL 3MLSL 4XMLL 3ZE2E 3OG4B 1JGUL 1TZHA 4UTAA 4TNEA 1JWSB 1OGAB 2YGQA 4TN9A 4X99B 3WNPA 4NC2B 2YK1H 3H7BA 3DOSB 3QDJE 4JKWA 4JRFA 5A3ID 5HHOB 2CHZA 2OL3B 4P2OB 3DHMA 4F15B 2CBTA 1RZIA 2NXYC 2HP4A 3KGTA 3MDJA 1JNLH 2BCMA 2ENYA 3TPUB 1MDAA 4QRUA 25C8H 1MH5B 5AZ2H 1YNKL 4WHCA 4EUPG 1KFGA 3QE5A 2FEDD 1B4LA 2VC2L 1DN0B 1AIFA 1G7LB 2YGPA 4QHPA 5LB1A 2BP0B 3QPXH 4PREB 4AVKA 2DM4A 1KEGH 4UM8B 2A2QT 3DV6B 1OSEA 3SY0A 5LN4A 2VZUA 4HU8A 4DFIA 3NJIA 5LQBL 1E6OL 3KM2A 5ID0B 3E8VA 4IEFA 3F8UB 3MUGB 1HHGA 3K2KA 5LG1A 3HNVL 3UAJD 4BSWB 4EI6A 5E6SB 1NFAA 2DQDL 2FVNA 1ZLSL 3D05A 3RWJB 1KGXA 4EJ1C 5H37G 3ZQWA 4YHIB 4W9KC 3ABKB 1SY6L 5HSFA 4ZXBD 1G7JA 4APXB 4JN1H 2W9DL 1N2RB 5HHPA 1U6AL 1QWUA 2NUTA 3SYPA 2ED7A 2IBZY 3MOBH 1PZCA 2BVPB 5KVGE 1ILUA 4I87A 1M2OA 4NUGL 4P05A 4N8VG 5ID1A 4QHKJ 3BCFA 3HKZA 4J3VA 1JDCA 4YDIL 4QJ3B 1QLFA 1KCRH 4JM4L 5TE7H 3BEWB 1KGYE 1UH2A 2J2ZA 3R0MA 3RWCA 3HHSA 1N8ZB 2F7RA 1ZHBA 4PJIA 2OMTB 5K39A 3P9WB 2AMGA 3BPNB 4LLUA 4EN3B 2G2NA 2LR4A 3RG1C 3OAYH 4JVUA 2IOOA 1UJ3B 3BQUC 4N86A 4CC4C 3CDGA 4P9HC 5IESH 3RY5A 3OBAA 4GXUN 4PRIE 1UYWH 1FQ9C 1MIMH 3AS1A 4Q7DA 4FNPA 4QLRA 4Q9CA 2VM4A 1YJDH 2HKHL 4GAYB 4QEGA 5L9DL 5ALCH 2ZUWA 4OVVA 4ZFQA 2Y2WA 1E9OA 4PY8I 3M88A 2ZT9C 1MCHA 1NCOA 2G3NA 4A2MA 1YEEH 4DGYH 4WCYH 4EI5C 5FXCH 3QJTB 5AEAA 2G4EA 2NW2B 2AJUH 2ILLA 4I2XA 3FKUS 3MN8A 5GS3A 1FH5L 3QULA 3O8XA 1MVFA 1NEZA 1T6VN 1CXFA 4IIQC 3V95A 5EN2A 4YLBA 4OH2A 4NO5A 1T89C 2YRZA 4GEIA 1XIWD 1BX2A 1OCRB 3ZDZB 1HH6B 2B15A 4Z5RA 2CG9X 3LV3B 3QO0A 4XZUA 5TE6H 2FHCA 3TO4D 2N01B 1F3DH 1G87A 1RK0A 4JM2C 5GGTL 2VN6A 2GKIA 2WLZA 3CFUA 4JG9A 2ZF9A 2IAMC 3QAZC 2MKLC 3IS1X 3DO7B 3D3VD 4LOUC 3EH5B 3QG6B 1S8DA 4PCSA 4GSXA 2GEQA 4G3YL 4JUSA 4WFGD 2Q9OA 5GISH 2DMGA 2OR9L 4AKPA 4JRYE 2E27H 2XJLA 3VXTB 2OZ4L 3MXWH 3FU9A 4L5FL 3HMXL 1FGNH 1XB8A 3A47A 4RISL 1DSFL 1QFWH 4MNHA 3ZHKA 5DO2C 1BIIB 4YHZH 4TVPL 3HE6C 4JREC 4X7SL 4HWEH 4MMZA 4X5WB 3ROOB 2CDGB 3HE7C 3LNIA 5EN3A 4X4XB 5AW5B 3FZUD 4AI7A 5HHVL 4F2MB 4X9FA 2UX6A 3TEZA 4U4BA 3NCJL 1SPDA 4QHNB 2R59A 2XN9E 4U1KB 1ADQH 3TBWA 4H20H 3HI1A 4OQ1A 2UUDH 1TCRA 5DJYB 2MQCA 1RZKH 4KXZI 4UOJA 1RLWA 5D93B 3HC3L 2EIKB 1FZOB 3CHRA 3HHMA 5ESVB 2J88H 1I1AA 2MHAB 2OYMA 4IU3A 4KTYA 3EO0B 5KYUB 4JQXA 4R3SB 3WJMB 5AW2B 1UEYA 4QTHA 3HG1D 3QA3B 4F20A 4P5TD 1R5VA 4H88H 3V4VL 4QRSB 3UPRB 3VD4A 2FQDA 3WNNA 4PRPE 2XC8A 3GMRA 1LNUB 2F53B 3RZCA 4HH9A 4KTDL 1R3LA 5EO1A 5IF0B 4DCQB 3SDXE 3BRDA 3R0NA 2BM3A 2IQAA 2QT6A 1UENA 4GAFB 2IPUG 5DD0H 4KXBA 3A4DA 4IMKC 3KYAA 3P9MB 1JHTA 4UNTA 5GZND 1BBDL 3PAYA 4NWUL 3PP4L 4WNQA 4JFDB 4OU3A 1PW3A 2ZPKH 4WI2A 5JA9A 4JCMA 1IEAA 2A38A 3VYPA 2XT1B 3TJHC 2NLJA 4N0CC 1P84K 4Y9BA 1NGZA 3C6EA 4XPBH 3WIHH 4V1DE 3V0VA 2DQIL 4OJDH 2UXVA 3KDMA 2W80C 3UTSA 2R56H 3O2DH 5IHUL 1K8DA 2A9NH 4RQQB 3PXJA 4MFHA 1W6WA 3KVPA 5EUOB 3WKQA 3A67H 2X87A 3O9WD 4PJDB 1FAIL 4LDLB 1A7OL 2BY0A 2K78A 1F5WA 1JGIA 5MI0B 4U6XA 4KY1H 4PJ8C 3QUZD 5ANME 1KTRL 3I6KA 5I82A 4R97C 5AVVB 4NGHL 2WP3O 1EGJL 1V3JA 1ZMYA 2H2SD 4Z77B 3KPMB 5CN3A 1PD1A 3ARQA 3TYGL 5K9OA 1GS8A 1T2XA 4HK3J 1JNNL 5J1AA 3B9AA 5H35A 2XLLA 3TOPA 2OR7A 1EIBA 3GHEL 3QHFH 3SCMC 4BRVA 4DNLA 1PGRB 5IEKA 5DZ9A 1A4JB 1T83A 3V7MA 1LDPL 5FYJE 5GGQL 4QRRE 2W0FB 4OCNC 4B3EA 1UUSA 1I8MB 4M1GH 1D7DA 3ARXA 3KJ4C 3P73A 1AE6L 1RKRA 1G9NC 1OVZA 3OKEA 2OMZB 5FOBA 1ED3A 2Z31D 2BNQA 3LXBA 2WB1A 4LFHD 2XTJC 3EYUL 1MREL 3GSQB 4Y88A 5A2KH 1LYQA 4WKZB 4X8GA 3U36A 3OF6A 3DXAA 4UT6A 3TV3H 4P4KA 2A99A 1VAHA 1SMDA 4PRPD 4U3XA 1BPVA 1LD9A 5D2LB