1E5CA

Internal xylan binding domain from c. fimi xyn10a, r262g mutant
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
87
structure length
87
Chain Sequence
TGCSVTATRAEEWSDGFNVTYSVSGSSAWTVNLALNGSQTIQASWNANVTGSGSTRTVTPNGSGNTFGVTVMKNGSSTTPAATCAGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XYLANASE D
publication title The Structural Basis for the Ligand Specificity of Family 2 Carbohydrate Binding Nodules
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 10
structure length 87
sequence length 87
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1e5cA00
2CZNA 3NDYE 1E5CA 1C7TA 1HEJC 1E5BA 1HEHC 5DHDA 2RTTA 1EXGA 1XBDA 2XBDA 1QBBA 3NDZE 2CWRA 1EXHA 1QBAA 5DHEA 1C7SA
chains in the Genus database with same CATH superfamily
4S1QL 4DPRA 1UOWA 4ZMPA 3BP7B 4J28A 1S6NA 2V8LA 2J57A 2ZG3A 1T4WA 4LEBA 3BISA 1BVLB 3DBXB 5ESVB 3IS0X 4MAYB 3RPBA 1I7RA 3VXME 2H47C 3KR3H 3WTYA 3CN4A 4YSDA 3AS3A 3OF6D 4NLHA 5F88A 3HC3H 3NESA 3HRZA 5L0QB 5DUPH 1MRFH 3GSQB 3VU1A 1JNHB 2X4QA 1ILUA 5JIKA 1F90L 4XP1L 2WQWA 1UT1A 2Z35B 1YNTA 1KBVA 3IFNL 5DI8B 2LVEA 4UILL 3BMVA 1E4KC 5BS0D 4OCYH 2G9HB 3DOHA 3SO3C 1ORSB 1IC7H 3K8MA 4IBUA 4KKBD 3F05A 1RLBA 3KPQA 2EAEA 4OCXL 1NGWB 3VJ6B 2EUWA 4QRRA 1J88A 1B4RA 1WGVA 1IAKB 3RVWC 1DFBH 5FA3B 4NO5B 3I6LD 4KRPC 4WTQA 1ZHBB 3DYOA 3V55A 2DLFH 4NQDE 2WZ5A 2NW2B 3HPJB 4FHBD 2DM3A 4N86A 4KTYA 3F7KA 3ULVF 4V1DA 2NQDA 1GPOL 1PKOA 5F7DA 3MNDA 1MLBB 1ZY9A 1CLCA 2YD9A 2RGSA 1OAUL 2Q8BH 4JDVA 3IDXH 2BOCB 3NCYS 1TJIH 3RTQA 3VFGH 1KJ2B 4PJBB 4X9GA 3TCXA 5I1KH 4FA6A 5GGRY 1JHTB 1F6LL 5E1GA 2AQNA 3U4EB 4UV7L 4Z7WF 3L5XH 4HD9A 1OWRM 5IUSA 2IMNA 4KRPB 4OZGE 4UCFA 1E5UI 1O7SA 3IDIA 2Y2YA 5KANG 1ZVHA 1KLFB 1SDYA 1SHSA 2V2XB 1NBCA 4FA8A 1JL8A 4E9YA 5KWYC 1WO2A 4LHQB 1SQMA 5LN8A 1JAEA 1UXMA 4IBVA 1GGUA 2PPCA 2VIRB 2V3FA 2VR5A 1A9EA 3O3AB 5GS1C 1QLEL 3IVKB 1AS7A 1BF2A 1HNFA 3QXAA 4AY0A 5CCKL 1TVHA 3Q2LA 5D1ZB 1G7JB 1IEHA 1YQVL 2XT1B 4MJIE 4L0ZA 1AR1D 4F57L 4QCIB 1RZKL 2J4WL 1U3NA 3G6JF 1CDHA 3V0GA 2C9XA 4JFED 5D71L 1FG2B 3NIFB 2X7LB 4KJQD 4G42A 1NDGA 3ZE0B 5FKPB 1BXAA 3KPNA 2YN3A 2YK1L 1I9RH 1ZHNB 3DROA 4G80A 3T3MF 4Z23A 1A4AA 3RL2A 2MCAA 1QFOA 5ICZA 1XQ4A 2R2BA 4QD2E 1QBMH 5KYWA 1HILB 5KSBE 5GS1B 3IJYB 1MHPH 1J48A 3CIAA 3PV6B 5EO0B 2VJ0A 1E5AA 1UWEH 3P2TA 2J8UE 4I8DA 1IB5A 5I6MA 2OW7A 5DZ9A 1A9BA 3D05A 1JK9B 4MNHB 1UM6L 3PWNA 3WNOA 4K7PL 2VDRB 1C7SA 1OB0A 1GW6A 2DMHA 4K15A 1CE1H 3ABZA 4AQZA 4OZFG 1LLAA 3FU6A 3HB3B 4Q14A 4AMXA 4D94A 2A6DA 5IQ9A 1QACA 4PIRF 3KMDA 3GSXB 2IBGA 3C6LD 3MLSL 4L9LB 3WFCH 5E70A 4WUKL 5LVEA 5D1QC 4J3UA 4ZW7A 3NSYA 1XGPB 3RFZB 4RNRA 1NEUA 4PRPB 4XODA 3AQDA 1ZJBA 4FJ6A 5HHOA 4KGLA 4AW7A 1QI3A 4M4PA 1UKTA 5I82A 1I3UA 1VFUA 4TUJA 3RB7A 1L4IA 4DVRL 2NCMA 2WY3B 3CFQA 4RX4D 5DS8A 4NRXB 1W9XA 1YDPB 2OYLA 3J7HA 3W1ZA 3ZDZF 2CHWA 3CC1A 1XH3A 1M7IB 2BOBB 4PQXA 2GKIA 1FGNH 3ARQA 3TO4C 2J6EL 4MZ3A 4X8JB 2IF7A 4BSVA 3E80A 3QZBA 2FNWA 2Y3AA 3D12B 2NYKA 2YA1A 5DZNA 3FSWA 1DTUA 3RWGA 4PJXA 2AQSA 4W9ZA 3I3EA 1IC5L 4ALAH 3ET9F 5KZCB 3VD9A 1TLMA 2V33A 2AJYH 1Z5LA 1XSKA 2XCMC 4GIOA 4N8VA 5IMKA 1E5ZA 3VE0A 1RJLA 5JUEH 3GK8H 1AAJA 5EIVA 2W0FA 3ALWA 3NJGA 4IOIB 3NJJA 3O9WC 5TD4A 1ETZB 2IPTL 2CBQA 4K0OA 3U48A 1DN0A 3VX1A 3C12A 5GGTL 2WXOA 3WUWA 4Z95H 3MCYA 2DICA 2XIBA 1URIA 4KKAD 4L5FH 3RDTC 1EERB 2JKJA 2AK4B 4NO0A 1O9WA 1G87A 5I18L 1ACZA 1YMME 3VXQB 1E9PB 4IJTA 4WO4D 2EP6A 3OKLA 4PJEF 2QFPA 3M1OA 4JFXB 1A7RH 4JRXD 4E9TA 2ICWI 3GGWB 2EEDA 1FL3B 2DN7A 1NANI 1C08A 1CFQB 5JLZA 4GUCA 1T04B 3O9WB 5BV7L 2A74C 1CQYA 1KY6A 1JXFA 4NN6C 3LQZB 3FONB 4WEMB 5CN1A 2NY0D 1XHHA 2J7LA 4ODSL 4BA0A 3V5HA 2UWEB 4FQ1H 4KI5E 4LOUD 3BZEA 2OL3L 3CU1A 2BX5A 4PJ8D 3TBCA 4OD1L 4RBPK 2J88H 4DZ8A 4HJ0C 4W9FC 4PVLA 1PL3A 1PLGH 1XO8A 4AQ8C 1BLNB 3F58H 1T7YA 3G5YA 1FLTX 1FNGA 2ZCHL 2YUWA 3MNMA 4HUXB 4QRSA 3OD3A 4KDTC 3WI9A 5E99L 1K4DB 1H3PH 5F96H 2VM4A 4PRDB 3DHPA 3EHBB 4LCWD 1U93B 2FD6L 2ZUTA 4FADA 3DVNA 4U1MB 5KAQG 3MUHL 1BQLL 4ZUWA 3ZL1A 5CGMA 2C7FA 3CVBA 4UZSA 1QR4A 2ZSVA 3DYPA 5DK2B 5DQ9B 5I6XB 1KB3A 1MAJA 1ZHKA 3N04A 3PWLB 1IM3A 4Y1AD 3W9DA 2B39A 4OCWH 3FQUB 3HMWH 2AABH 3CSBA 3V4VL 2GHWB 3EJPA 1ZGLB 1A5FH 2WINB 4GW1A 4M7LT 4P2QB 5F72S 4TL5A 2L7JA 4HX1A 2VRAA 4P9MH 4BK8A 4B9PA 1OL0A 2CJUH 2ADIB 2E6QA 5IEHB 4KK6D 3X1NA 1DCEA 2ZWSA 3A4AA 4PTUA 2CBTA 3CLEH 3BQUA 4JVWA 2JTDA 4OLWH 3ILPB 2DW5A 5I1HH 1CL7I 3QHZH 4HWEH 3KS0J 1JZ3A 4E41E 5JIDA 1E4XI 1D5IL 1SBSH 1R5IA 2X4UA 3WENA 3NQKA 2ZPKH 4AQ1A 1ZT1B 4LO9A 3V6OC 4RSYA 1GOFA 2Q76B 2Q20A 4XX5A 3Q2CA 3S36H 1TYEB 2DH2A 5FDWA 1BVNP 5EIQA 2D03L 4FFVC 3J27A 4G11A 1DSFL 3F12A 3UYOD 5C2BL 3EYFB 4IDJH 4ZUSA 4L3ED 1JXKA 1MCWW 4FMFA 3FYEB 1KCSH 5D7KD 1VCBC 5KSUA 3X2QB 2AC0A 3PQYA 2UUDH 2NUTB 1V7MH 4HCRL 1EXUB 3UTPE 4YBHA 2E8ZA 2Z4QA 3LV3B 3S8FB 2VKXA 1AKPA 4PGCA 2BHYA 2J55A 5T1DH 4BRVA 3OLGA 1CD1A 4GAGL 3GRWA 1D6VH 3PGCA 4MJJA 1KTCA 3OB8A 2IIJA 2BDNH 5KG9B 5DJYB 4JPSA 4LGPB 5CS7A 4AGOA 2LTQC 1CMOA 1U4FA 2FIKA 2XN9A 3DI3B 3HI6H 5L8KB 3QR2A 3KBEA 5L9DL 5E6YA 4A6YL 5DHVB 2HPOA 2MHAB 1BSIA 5CGBA 3HMXA 3DX6B 2G60H 4MDIB 1KJ2L 5GJSL 4G8IA 4PJCA 4DKEL 1XBDA 4YQXL 3MHZA 4BFGA 3HOGA 1HI6B 4ZMOA 4U6VL 1U8JB 3WEXB 1LNUA 2JXMB 2GITB 2HWZL 2JCCB 4I88A 1F13A 2DLTA 2OR9L 1MHHA 2YD1A 4HT1L 3T0XA 3N41F 4UM9A 1N0LB 4U1HB 4YHOL 1YEKL 4RSVA 2P52A 4RA3A 4L4VB 3A6BL 5T33L 3IM1A 2FBOJ 1MSPA 3MODL 3P2DA 3WO4C 5F7MC 1HYRC 2PXYB 5GRJL 3U36B 5KN5B 2VJXA 4HUKB 5FKAB 3SDAA 4X5WA 2VN6A 2Z1PA 3C8DA 4RFEB 1HNYA 4EO5A 1JGEB 4OT1H 4NI6A 2F53A 4F15B 5BZDB 5EEXA 4XWOD 3Q43A 1SMOA 3HN3A 1WC7B 1UXSA 4F37K 2E7HA 1OAXH 1BFOA 4JZNB 3T04D 1U92B 1YJDL 1RJYB 4MSWB 3SE4C 2CD0A 3IRCA 1MJ8H 4UF7C 3VNYA 1KPVB 3MOQA 2WCPA 1HZHL 4OLUH 5DURD 3UDWC 3W0WD 3WO4B 1OT2A 5EEZA 4X7FC 1DDHB 1ZVNA 2ZX9A 3SBQA 1NC4D 5J8OA 3NA9L 1BD2B 1P9MA 4HS8H 3HEIB 3JV4A 1JFQL 5CD3B 1B2WL 4DP0X 1ZLUH 2WYZA 2A9BA 1XT5A 4Z3FA 1ETB1 3MXWL 4OJEH 2NSXA 3N55A 5I17A 3KBFA 1OCWH 2BVPB 4MQ7A 4L37A 3TS8A 3X14B 4P9HC 2A4CA 3UJIH 4MMYA 1H15A 4IBYA 1M1XB 1MWAB 1ILSA 1RZJC 4OLEA 3LEYL 3QO1B 2V6HA 4X98A 5C0AA 1X44A 3ARGD 3TP4A 1GC1L 3WFEH 5DUJA 1QMUA 3B6SA 5DHEA 2W07A 3QDJE 4IU2B 4PRHE 4JO3H 5FF6B 3ZE2F 4Q6KA 1RULH 2BERA 3QJHA 4J4PD 1TYRA 3P77A 3RVUD 2FK9A 1GS7A 1JN6A 1PLCA 4OFKA 5HYFA 2VR8A 3BOVA 4O2CB 4K5LA 4ZFFA 2VXUH 5T3ZH 4KDVA 2N0KA 3O8XB 4ELMB 3GXUB 2FECI 4FLSA 3BUTA 4JQVC 4Y5XA 3ATFA 2F19H 3SKNA 3HZKB 3CFDA 5C7XL 2KUTA 3HS8A 3BUBA 3SZKC 4X5PA 3L6FA 5D1ZI 3MLYL 4PS3A 1PDKB 2Z9TA 1MQKL 2DRUA 4PV9B 1JHKH 3KYOB 3C2AL 3HMXH 5EZOH 4HWNA 2GUYA 1YYMH 5E00A 1SDDA 3ZR5A 4JFOB 2X6UA 2C3VB 1E5YA 3L7EA 4Y2OB 2NXZB 1FH5L 3TEYA 4S0SD 5A7BA 1JPST 2PPAA 3SKOB 4G5ZH 1ADWA 1QTSA 4EZLA 3F01A 4X6FB 2Y7QB 1MFCH 4XC3L 4JFQA 3CU7A 5IW1A 1A7NL 4BQ8A 4J3OD 2AEOA 4QXWA 5DEFB 5GS2H 1X5YA 4U6YB 5C0NC 1CXLA 3PJNA 1UGKA 2OMYA 2WQSA 3QQ3B 2F54B 4I7ZC 1YNTF 2ZAIA 1J1XH 3VXUA 4CMMA 3SDCC 4J2XA 1KEMH 4NJ9L 4PUBH 5ISZB 4DZBA 2VDOL 4HD5A 3O11A 4ELKA 1GIGL 5TDNB 5AVVB 3T3PF 5SWSA 4ONHA 3FNKA 3LNEA 4EOWL 2EDDA 2ESVD 4LPYA 1BBJA 5A6MA 4A66A 5HDQL 2XVLA 3KEHA 2NT1A 1IT9L 4GKSB 4M29A 4YNYB 1NC2A 4GUOA 4H26A 4W9CC 2MOQA 4PB9L 5M95B 3TNMA 5EZPA 1R19A 4HEMA 1ET8A 5C08A 4OGAD 1AQ8A 1NBVH 2OMWA 1W8OA 2WXNA 2EC8A 5BJTB 3QDMD 1LK3H 2OXHA 4H8HA 3UAJD 4LVHC 3CDZA 2OK0H 2YBRA 3H2QA 5FYKE 5A2BA 1J1PH 5H37H 2XWCA 4QYOA 2K8MA 3F6IA 4AGPA 2A0LD 3IDYC 4PP2A 1VACB 3I6KB 1LQBC 1LMIA 2NNRA 2BSEA 1JWUA 2WQAA 3C5SA 5INDA 5EBWB 4Q0XH 2WBKA 4ZTOL 2J1YA 3MGOB 4YEFA 1VFBA 4XRCA 2BFVH 4QEGA 1S7TB 3RDJA 1XB6A 4ZMAT 2AQRA 3WLBA 2DQJH 4NQEE 2CCLA 2V9UA 3QEUB 4BFJA 3QUKA 4PRIB 1JZGA 5B38G 3KYKH 2VUKA 2UZIL 4YC2B 3DTXA 1MPAL 4NQXB 1FNHA 5LGHH 1V54B 2P8LA 4UQ2A 4WHTB 4MXQD 5E8OA 2BC4A 2K4WA 3NFNA 3QIBD 1HWHB 4NUJB 4Z76B 3ULSA 5EU7E 5I5IA 1UZ8A 2DTSA 1DBJL 5FUOH 2NR6C 5DJ0B 3RWFA 3F5WB 1PSKH 1E6JL 4K9JA 3T1FB 1JYNA 3W38A 1XGYH 4NZRH 1WAAA 2ADGB 4PGDA 5CILH 4DKAA 1PAZA 3RUGE 2XWJA 3PHOB 4ZYKA 2DJUA 3RWJB 3T09A 3WUZA 1OGTA 3RPKA 1GOGA 2BPBA 1YSOA 1I8AA 1VERA 4Y9BA 3VXSE 4B9IA 2R8SH 4KOBA 1A4JA 2VXTH 3FCSA 4KO9A 2RA1A 3E1ZA 3BIAX 3WDIA 5MI0C 5I28A 5JIPA 4UBDD 1KXTB 3D0LB 4RQQB 3MLPA 1J0HA 2NY4B 1R1CA 4BDVB 3I50L 3QUMA 3DX3A 1DVXA 3IBEA 5DJAA 2NW3B 4PJ5B 3KM1A 2XV6B 5HGDA 4W6XB 3TBWA 1AHWC 2J56A 3GO1H 3N6YA 1F02I 4F9LC 5EBMB 1UYWL 4WRLA 1JV5B 4OFIA 2GYSA 4JKWA 3AQYA 1FFNB 1B6UA 1ZTXL 1FI8C 5GZNA 2VLKA 1LO3L 1MY5A 5IZ7A 1NGZB 3CZGA 4GSDL 1X5KA 4M61A 3VRLE 4DGYL 1BQHA 1EAJA 1L3WA 2OXGA 2DZEA 4GAJL 4HEPG 1B90A 1U3HD 2QR0B 1OAYL 3AWGA 3F00A 3EJQA 4WWKA 5KW9H 2NY5H 1U95A 1A8JH 4MX7B 2VDQH 5GJTH 4HJEA 3IRPX 3I2CL 2JJTA 3QPXL 3I75B 4MJID 2CMRH 1D2PA 1RIUL 2X41A 1AE6H 3MXVL 4GQ9L 3PG2A 2WN3A 1ZV5A 4HUUA 4PJXF 1NGQL 2YC1B 5GGQL 5LG1A 4MS8C 4Q6IB 5ESAA 5D2NE 3HNVH 4LLVA 4HPYH 5FUZL 3OXSB 3IFPA 4LLQA 4DN3L 1FNEA 4QHKJ 4UIMA 1DLFL 1FHGA 4P2RE 2NX5B 3ZL4L 3SKJH 4XNUL 3I85A 3GIZL 4KXAA 2F8IA 4E68A 5FC9A 3QJTB 3WELA 4FTDA 1MIMH 1FN4B 5KSAD 4R4FL 4Z7OE 4IBLT 4DGWC 1RUKL 1UFUA 4P59L 4RMTA 4BZ2L 2VERA 3MVSA 5HYJB 1WFJA 4TUUA 4FFWD 4UUJA 4Z3TA 1X5FA 4P99A 3BUYB 4OLYH 4LT7A 4Q9QL 8CGTA 2AJVL 2LV4A 4N8UA 2QV4A 4AH2B 4HUVA 3GSNH 2CNYA 1BOYA 5GS0L 1EX0A 4X5XA 2OTWA 5HHQB 5EN3A 3EO9H 4AE1A 1VEMA 2RR3A 3CK0L 3DUUB 4YE0A 1CICC 1KBBA 2PWDA 3LN9A 1KJVB 4OQTA 1SEQH 1JPFB 4FQCH 4NKMA 4EE2A 3LNFA 4M6MH 1J0JA 1KXQE 1CR9L 3PWVA 4OV5A 3OJMB 4F3FB 2NXYD 4HBCL 3EGXA 3BPOC 3MR9A 3ZT6A 1E8XA 3QJZA 1OPOA 2AJZA 3S4SA 1MZYA 3ZSSA 3MNZB 5C09E 5K59F 4U1NA 1ZIBA 1F56A 4JDEA 1D5XA 3CHPA 5F7HA 4G9FB 3MRNB 4HHAB 1CI5A 3EGSA 1CICB 1NEZG 3E6HA 2Z4TA 4YLBA 3V5DA 1RD6A 1U91B 1BP3B 1TZOA 3WKML 4HIJA 1IZKA 1FIGH 1AGCB 1T1ZA 1TENA 2JI2A 4NAJA 4GYBA 1P5VA 2H26A 2OMTA 5D6CB 5EZJB 2PN5A 3BPOB 5HDLA 4BYHA 2NSMA 3P73A 5B4MD 2AMUA 3L48A 4ODHH 3PNRB 3EKCA 3O4LE 4N8CH 1BWMA 3QORC 1ASPA 3SCMD 4OJAA 4R26H 2PO6B 1Z3GH 5HYEA 2R0ZH 1H9VA 1N8ZA 2YPLA 2N01B 4YL4A 4ZG1A 3DX1A 3LHPL 3N0AA 3TZVD 3GMNB 5H4ZA 5FLVA 2MCPH 1BBDL 3WO3B 2FGWH 1UKSA 5DJDB 4OZHA 1P7QA 5ETUA 3V6BR 4M8RA 4B7LA 4KVNH 4L3AA 4JFHE 1K2DA 1KYOJ 3PP3K 2UXFA 4IRSD 3BRDA 1JWMB 1QRNE 4Q9RL 1KTDA 1CQKA 4QT5A 1BPLB 3ESVF 1BLIA 1DJYA 3MRMB 4E5XG 1PZSA 3BCFA 5JHDE 1R34A 5F9OH 2P43B 4NRZA 5CBAB 2VXQA 4D9QE 2OMVB 3B2XA 1T5WA 2E4TA 1A2YA 3DPBA 3CFEB 2WMPB 3OAYK 3N91A 4NXKA 5HD8C 1NBYB 1XGUB 1TJHH 4QXVA 4YHML 1EANA 2QQKL 4R4ND 1T3FA 2OYPA 4MZIA 1BZ8A 2PP7A 2X6BA 3BIKB 3OR7B 1OO2A 2PYED 3NCEB 1NFIA 4FQLL 3TT1L 3TO2A 3B7TA 3ULUF 3FH7A 2A4ZA 4Y4HA 3VB9A 2H0EA 2HFFA 1BXXA 2C9AA 3QC6X 3ZKXC 1BQUA 2UXTA 4FZ8L 5H8DA 2YHGA 4LLMB 3U9PH 3RZCD 1KIPB 4GBXC 4N6RA 2Z34A 5AOIA 5BRZB 4ZD3H 2A9NH 3LKOB 1FORL 4QJ4B 3FOLA 4KNSA 2DTML 3U0TB 1R33A 4W9JC 3FRUB 1FYTD 4JO1L 4PJCF 2XZQL 4AE0A 3CZKA 1CDIA 3SPCA 4M1CD 2ZOLB 4OQTH 5DD6B 3PE9A 5MEOB 4AJWA 1TLKA 1IC1A 4ODUB 3HVNA 1ZLVH 3ZK0A 3C8KB 4PRAB 3HHSB 1CZ8H 4GUPA 4YDZA 3A22A 3AXLB 4XB3A 3JTTA 3QEHB 3LH2L 2V37A 5B39A 4P4KD 4XN4A 1U8MB 5AYUL 4LSRH 1I1FA 4GBXB 4FF9A 1M3IA 1M9WA 2XZAL 4KAQH 2VMEA 5AALA 1M57B 4NZ8A 2ZOKA 4YXKL 2FATL 2QGBA 1OP5K 3VDBA 3T4AA 4BZYA 4Z7WB 4K3JL 4XOCA 3P54A 1DE4A 1PNCA 2IXQA 4HGWB 2FJFB 4P2OD 5ADPL 1L6ZA 1ROWA 2CPCA 2BNRB 4PS7A 1AP2A 4R97C 4QRAA 2XZCH 4OI8A 2RCSH 4M4RA 3M1BA 3PY9A 4JMNA 1L9SA 1QFHA 1DLHB 3VUAA 5TPWL 4HIHB 3U6RA 3QPKA 2IFGA 1U33A 3EF4A 4PTTB 2JJVA 2XX1A 3VTMA 4LBEB 1ID5I 3BP4B 4LOEA 3HG5A 4ZZFA 5A3ID 1OZUA 3HG3A 3K5RA 3VWKC 4G1EB 1TEYA 1OWWA 3G6JB 3NSJA 4F8QA 2WNWA 2CIKA 4CN6A 1MRCH 1G0XA 1G9NC 1IGJA 3GEWB 1SYVA 5DT1H 5B7EA 4LASL 4JJOA 4UANA 4B0MM 5ES4B 4PVNA 5EEVA 3MBXH 3EJRA 3AMLA 1XR9B 3D0VA 5BUGA 3T3MB 5JQ6L 4I2XB 1IRAY 4JFFD 3VFSB 4BKLB 1AI1H 1PAMA 5KS9E 2X2JA 4K3EH 5B1AB 3GSVB 5KVGH 2QFRA 3P69A 1NDMB 2EECA 3UZQB 1I3VA 2HRPL 4PJHE 1V7NH 3GBEA 3MMEA 4NQDA 3HRPA 3GI8L 4JN1L 2HUEA 3QEQE 4LIQH 5J1TC 3PABA 3AMKA 2VXQH 1RH8A 3C87A 3FO9B 5L2KA 4CC4C 2I69A 4MTMA 4O00A 4XC1H 3DC0A 5G4OA 4J39A 1F2XK 3IU3B 1AIFB 1IBGH 4ANXA 3NZ8B 5JPNB 4HFUL 2K78A 3KL5A 4HS3A 3R0MA 3SHSA 1GKOA 1NLDH 2AJ3B 4Y5VB 3BZFB 4GAAA 1LE5A 4LLWA 3RQ3A 4JN2B 5CIPB 5FYJH 4OZGA 4LEXH 2KS0A 3QWNA 3WE6B 1CFNB 4ZS7L 2XKNB 3WY3A 4R6UA 3V9CA 1FSKB 1K6QL 5CLWA 4X5LA 3WL9A 4NPYB 1NOFA 1UJ3C 5HYSB 2IAMD 3KCPB 5D7HA 1QSFE 1Z5HA 3PFQA 3ZDZB 2J12B 1DEDA 3EO0B 3MBEB 1GXEA 4WU7A 4MCZA 5IJKC 1UACL 4AQEA 2C3HA 3O6KL 4PSRA 5FPIA 3M86A 4FEIA 3K8LA 2G3NA 5D72L 1GZPB 5I5JA 2ALWA 5ILTH 4TQ8A 2R1YB 2E6PA 4H25B 4ERSH 5GSVB 4Z3EA 4ZMWA 3QFGA 2HN7A 4TLUA 3UTTD 1QP1A 3PHQA 1G1YA 4UU9A 5J3HC 2Z93A 3RWIA 4Q9CA 3BYYA 3KPRA 3F7YB 3IJSB 5T3XL 1QPXA 1U0QA 2EVJA 4RAVB 3CJJA 3BEVA 3K6DA 3B4NA 1J8HD 1XSOA 4WU5B 4DH2A 1SXNA 4X9BA 1E42A 3DV6B 5FYLD 4XH2B 3IXAA 1U8KB 2DS4A 2J8UA 1CFBA 1PX8A 4LKCB 2K45A 2C7UB 3TTSA 3ETBJ 4JFZH 1TYJA 1R4XA 4PJEB 3D2UD 3QAQA 4JANA 1NGXB 2CA4A 1YMHB 4LRIA 3FQRA 2WXFA 2WCGA 4PD4K 3GB7B 2XFGB 3P11H 4QXTA 5F7WC 5I73C 1ERNA 3X1EA 1IGMH 4TNWK 4MZRA 2OSXA 3WHXB 5IMMB 1BM3L 2ERJC 3IMBA 1F1AA 4QXUH 3PWUA 4EDWL 1AS8A 2YRPA 1SXBA 2H6PB 1C5BL 4OZIF 4MNGB 2XWTB 5E8NB 3G5XB 1UADC 4X2UA 4HKBA 3ZE0E 1I7ZB 5AVYB 5AENA 4PCTA 2EADA 1D7CA 4WK0B 4M6OH 3KPOA 4HUMB 2P4AB 4JHAL 1JGUH 4M3KB 2X87A 2XNAA 2ZX5A 3LIZL 4N0UE 3NQIA 3LKNA 1VPOH 3UCQA 3NGBC 4GB9A 2YAQA 5IB3B 3M46A 4MA1B 4AL8H 2Y7NA 3V8OA 2ZG1A 4CW1A 1AKJA 3EJYC 5IEKB 5CSZB 5D1XC 1QBLL 15C8L 3K46A 1UENA 4D9LH 3ZGHA 4AC4A 3MCLL 1T22B 1WBXB 2HT2C 2XG4A 1K85A 1FC1A 4JQIA 4MJ6A 5JW4R 4PHZA 2F58H 3G5ZA 5IROC 5K9KA 2DYPB 3ARDB 1FVEB 3KPMB 1R24B 4JCLA 4O51A 1QWHA 3RFRA 1EUTA 2Y7LA 3DXAD 4Q74A 4RAUA 1LK2B 5DC9B 3BGMB 1MCBA 3KXFB 4NOFA 1MCJA 2P7TB 1KFAH 1X6LA 3CFKB 3NGBB 2VLME 4IKNA 4YDJB 3TF4A 4LSDA 1IU1A 2DJMA 3GJFA 2KZWA 1FDLH 2I5YL 4KKNA 4JFPA 3WS3A 4KH9A 3VFNB 1LHZA 4Y4KB 4APQB 5EC1A 3DHUA 1A6UL 5EHFA 4CU7A 4NHUB 1XMEB 1AQDB 2QQNL 1CK0H 4YK4B 1J5OL 3ATEA 4K8RD 1AD0A 3NSFA 4PSPA 4YXHH 1A1MA 3HG1B 2ITDA 5D1QE 4KXZH 5LNGA 3UJJL 1QHPA 3NUKA 4RISL 3L4WA 4K7PY 4XP4H 5KEZA 1K9TA 4AWJC 3KLSA 4KMLB 5E8DL 1INEL 1KY7A 1OLLA 2H45A 5T5FA 4F8PA 5TDPB 1KN4L 2X89A 4WGWB 5HHPB 2VDML 5D7EA 4LAQL 1UOVA 5CWSB 3D69A 1BX2B 2ED6A 1OP3H 1BOGB 4KROD 1MW0A 2FO4A 3VFOA 1OHQA 4KY1L 1JGIA 1KXHA 2WXRA 4P46B 2FHBA 1HT6A 5AW2B 4YOKA 3S3PA 1ROCA 4KTDL 1AHMA 1AOHA 3PYCA 1HU8A 1JD9A 3T65B 3MLVH 1TDQA 5LUMA 4BGDA 1BM7A 2YARA 3QUZD 3ULVL 1DZ0A 4J8QA 2HA1A 5DMIL 4QR7A 3QQDB 3K2UH 1V3MA 1A64A 4N0CC 4S1SL 4BQBA 4U3HA 2YD2A 2FUQA 1DCLA 1FV1A 1T20A 3DSNA 5F93C 1ITCA 4LK4A 5DVMA 3L9EA 5JMOC 5KJRH 3PL6D 2P8PA 4JO8A 4Z77A 3V7MA 5C3IA 3EH5B 3VXRD 2EC9U 1A3LL 1VB9A 4S2SB 2AI0L 5GZOC 3WN6A 2BIOA 1D9KA 2IGTA 3IPBA 4GAYB 2LLLA 3OR6B 2HKHL 4JRLA 4RFOL 1TTRA 1WUZA 3DWTA 1JGLH 2H4EA 3FH8A 3NA4A 3QFJA 4OF6A 4E41A 1P69B 1ODAA 1QNZH 2EDHA 1PX4A 5F70A 1MXDA 1CVRA 1DVTA 3QNYA 1EZSA 5JR1H 3X3FL 2QKSA 4GT0A 3A4EA 3EDJA 3HN8A 3N41B 3NN8B 3RIFK 1KGCE 2J8OA 2VN5A 5DJZA 1EEYB 2J5LB 5DGRA 3IJHB 1HAUA 4FXGA 3CX5K 3Q2NA 3BVNA 2OFQA 2JJWA 4H8UA 3OKMA 3O2DA 3DETC 4AYEC 1GGTA 1RUAL 4AGQA 5E5UB 1W0WB 2GEEA 2EICA 3SOTA 3NVQA 4KZDH 2EYSA 5EPMB 2B2XH 2A1WH 4UQEA 3OKDB 5E5RB 2YD8A 1J8SA 3QEGL 3WJJC 4P3CL 4OVUA 4JQIH 1UWGL 5LCVH 4R2GB 4Y4FC 2NPLX 3N40F 4CU6A 1ZCRA 3F7VA 1U58B 5E2UL 1HZKA 1UB6A 1NIBA 1UCTA 4PU2A 3GSOB 5C86A 1ZT4B 5ESQB 1E2ZA 1W0VA 1D7BA 1LD9A 3CZEA 4HJUA 1U8HA 3RY5A 4Z3GA 1ZIAA 2Z0BA 3RZWA 4JDZB 5DMKB 4FFYA 4UNUA 1RZFH 4WIQA 3D39B 3GBNL 3DMMD 3QNXB 4WDIA 2F8OA 4PWGA 2Q1EA 4ZXBD 1RP9A 1EFXD 3AS0A 4Y4FB 1BWWA 2FEEI 3IKCA 5IGXL 3CHXA 5HHNA 3SOBL 2P44B 5DD5H 5MERB 4Z7NF 4FZEL 4CMHB 3N50A 1BQSA 1NKRA 3IFLL 2UZXA 2IG2H 5DS2A 1R46A 3VRJB 2R2HA 4FNTA 2Y72A 1E5BA 1M7DA 3UBXI 2Y07L 3CC5A 3KPSA 2P5WA 2GJJA 4LGRB 4NN5B 5FK9A 2OCFD 5E6IA 5C07E 3FU7B 2CNZA 4LVNB 3V6OE 5AUMB 3ZE2B 2BWQA 4AENA 1CDBA 1AQMA 1KENH 3GXIA 4OZHF 5F3HA 4NQTA 3L9BA 4JJ5B 2WYIA 2EE9A 2O1AA 3HRZC 2CBPA 1FZMA 4KRNA 1TVDA 4GMSL 3DRQA 4LEOA 1CF1A 4TNVK 5FW6A 5HHME 5IM7A 1IFHL 4ZTEA 4G6MH 1U8IA 3WFHA 3QUHA 3DX8A 5DHMC 2QL1A 4FQXC 4U1GC 2K7PA 2LAGB 1L9MA 2XWZA 1KMGA 1RK0B 2GTZA 1I7RB 5HHVL 3ILQD 3GYRA 5IBTL 5CHNA 3C60A 1DO6A 3DJSA 4ORGA 1MFEL 3QHFH 4ZOBA 5T1LA 5LNEA 3VCLA 3QDGB 5HGAB 3OTTA 2VN4A 1HINL 2VO5A 2X4QB 4QOKE 1NFDA 4ALAC 2E5EA 1QOKA 1GCFA 2I27N 3SGDH 3HUJA 4NJAL 1YNTB 3FUKA 2P9RA 4LSQL 4L4VE 3R18A 3QJVB 3O2DH 3QG6A 3NZSA 5KVFE 3PWPD 5FO7B 4QRRB 1C1EH 1FGVH 3T3PB 1HIMH 5ITFA 1DVFD 1QFWM 5C0CE 2BWIA 4IBTA 2K8QA 2I7SA 4AV5A 1MI5E 3WCYA 1O7VA 4H0LC 3UG5A 3T71A 1KSRA 4KC3B 3MAWA 1ESOA 3QDJA 4PRHA 4V1DB 1IGIL 1QASA 3K1DA 4G7RB 5F7DB 1F86A 1ETJA 4JDVB 2AQ3A 3JV0A 3H85A 1KWKA 2G4EA 3RTQB 4U7MA 1ET7A 2V9RA 4JZJC 2BFGA 3IETB 2GBVA 2FL5A 3BVDB 3D51A 1TO5A 2B0SL 2FQEA 3IDIB 4ETYA 2MSPA 4FFYH 4K71C 2MRYA 3BPLC 5DZAA 4AVKA 2ED7A 2WGXA 4M3JA 3C5ZD 4HKJA 2YD3A 3FUIA 3FO0L 2RTTA 4HIEA 1FFQA 1A9EB 3RU8H 1SJHA 2XN2A 2O6PA 3QXAB 3CPUA 3U0WH 1TVHB 3QXVA 2BSSA 2OJ1A 2H3NA 3DX9A 35C8H 1RFDH 1WSST 3NJXA 5D4QA 4PGEA 3QK0A 1NCCH 3U46A 3ECBA 1F0LA 1HCZA 4K71B 3Q48A 5C0EB 2COVD 4G42B 1NDGB 1SJEA 3O0RH 3KPNB 5DUMH 4Z1PA 4Y2DC 3BKCH 4G80B 3DROB 1I8MA 1RZ8A 3RL2B 2VH5H 2R2BB 1E28A 2EACA 1HEZA 1TO4A 4IGBC 1TG8A 3CZLA 2F9BT 5DCCA 3VGDA 5CCGE 4Z7UA 3FAWA 5FW8A 2RALA 3ABGA 4EQ2A 2ZNXA 3VO0A 3QXTA 2QMKA 5IFHH 2V4LA 2RJMA 5DVPA 5SWZE 4FL4C 4Y89A 4JHWL 4MA7H 1A9BB 5K9OA 5I0ZA 4PYGA 4HCIA 4Y16B 4PY7A 2Z31A 2Q7YA 3K4ZA 3PWNB 2OKMA 3WIHH 2FB4H 1OM3L 2BCKB 3H9SD 4LMQE 4WNJA 5C97A 4EXKA 1E27B 2VDNL 1JPGA 2F18A 4OAWA 3K6SB 2A6DB 2VR4A 3MNWA 5IQ9B 1WD9A 2EIJB 1HJBC 2YXWA 2OP4H 2PTTB 1MUJB 4E0RB 4NZUL 5LJYH 3IDJA 5CXPA 4RNRB 3EFFA 4IJ3B 2AJSL 5I6KA 4LHUG 1HHGA 3PREA 4OZGF 1XCXA 5HHOB 3T0AA 2NY6C 1R5VA 2C9VA 2ATPA 3NPZB 1GW0A 4KUCD 3T2NH 3UAAA 5BO1H 4C54A 1KNOB 2DWEA 4AVHA 1NMBH 2PCXA 4XWGH 5C0FA 5IJDC 4XN9A 1TZGH 1XH3B 3RGVA 1JDAA 2ZXDA 3KR3L 2DM2A 1DANU 3L54A 3TEZA 1DBKH 1I7TA 5K33A 4BSVB 1C9SA 1VEPA 5TQ0H 5D93B 3HC3L 4JPQA 3I3DA 2IFFH 5DUPL 3RWGB 4PJXB 4M5YH 1L9QA 4MWFA 3MQIA 1Z5LB 4N8VB 2JQAA 3L2LA 5F9AC 5IMKB 2NY6B 4TRPH 4BUGA 1RJLB 3IK2A 5KTEH 1E9OB 2W0FB 4HSQA 4OCYL 4UOJA 3OHXC 4NQCB 1JJUA 1U8CA 2KPNA 3RUGA 4NN7B 1IC7L 1Q0XH 3LPPA 4MA3A 3GM8A 1DN0B 1CGSH 3QUYD 3WUWB 3GRGA 3BWUF 1W72A 1DFBL 1OAQH 4A1RA 3HE7A 5IV2A 1AQHA 3KLKA 4JFDE 3VXSA 3MV7E 4LPWA 2GJPA 1NKGA 3FN0H 3QG7H 2J8UF 4K9EC 2FX7H 2DLFL 3LN4A 4K4KA 2HFTA 1O9ZA 4NO0B 2WZPD 1ZEAH 1TF4A 2Y1VA 4FYQA 4PLKD 4F93B 4IKLA 4XO9A 1MAKA 3OKLB 4N26A 1FL5B 3WFBH 5FB8A 1M56B 4RGNC 4MAYD 1LEIA 8FABA 4JFVA 1C08B 3UABA 2Q8BL 5JLZB 2RHEA 4PRIE 3IDXL 1Y07A 4M1GL 1ZV2A 2PW1A 3Q06A 1TJIL 3VFGL 3WAKA 5BOPA 4FMVA 1NCOA 1NMCC 5C6TL 5I1KL 3FTGA 4JHBA 5EBLA 3V5HB 2D7PA 4HU2A 3HPLA 1A0QH 3L5XL 2XYBA 1I1RA 1S7XB 5FIEA 3LZFL 2JK5B 1S7QA 3BZ5A 3G5YB 4IMKC 3L9RA 3WLBB 4QRSB 4YSTA 3B5GA 2APVA 2PR4H 4ODWB 1GGBH 1MVUA 3RWHA 2I60H 3DVNB 2LW3A 3ZO0A 2WLJA 2E9GA 1O9VA 3HZVA 1KF9B 3CSTA 4ZUWB 4KKLD 4I3RH 5LBSA 3O45A 1RZQA 2EH8H 2ZSVB 2BY3A 1Y7VA 1HKLH 1FJ1A 4OY9A 4UB0H 1I1AC 1IM3B 5KBNC 1WA0X 3W9DB 4JDTH 1IUZA 1OM9A 4UAOC 5D2NA 1SOKA 1QABA 2W65B 5ERWB 4ZNCD 1OF2A 1LO2H 1YY8A 2WYHA 3OF6A 4FTVE 2N0MA 4GW1B 3T5WA 1PCXA 4HX1B 4P2RA 1AQKH 5EO1A 2ED8A 2CJ3A 1OTTD 4CSTA 4JKMA 5FYKH 1I9RL 1USZA 3K74B 1IZJA 4PTUB 5BRQA 4KJPC 2BH0A 3OB0K 4NYLA 1JVKA 3BQUB 4GKOA 1QBML 4PREA 4AJYV 4BWWA 1MHPL 3MV9E 1Q9KA 5FXCH 1YG9A 3CLFH 2H0FA 5BS0A 4KRPD 5D5ME 1UWEL 1R5IB 3OLDA 1XIWB 2X4UB 3B9KA 4OM0H 3NIDF 2DF3A 3HS9A 4AQ1B 1EHAA 4LLDA 2DQCH 5I1DB 1WTLA 2X1OA 5E6UB 4ZFOA 3EIFA 4NKQB 4JGJA 4OW6A 4B97A 1CE1L 1T5XA 1INQA 1JXGA 2GFBB 3L95A 2I9LA 5I66A 3WS6A 4J6IA 1NPNA 3WFCL 5D1ZD 2YGPA 1E0OB 1T7VA 2R1WA 4ZUSB 2Y0SA 5I8CA 3WHE0 4KI5F 1RUPH 1OB1A 3ULUC 1ITBB 1AIZA 5LBVA 5KSUB 2WNXA 3PQYB 5F7FA 1KXQA 1T5KA 5CJ8A 5TF0A 4HOWA 3TBBA 2Z4QB 3GIVA 3SPVB 3MO1A 4PGCB 1AXTH 3L7FA 1X5MA 3BH9A 4PLNC 3GBDA 1XD0A 3PGCB 1FGNL 1W72H 1P7HL 3MOAH 3TA3A 2DYSB 3MA9H 3TIDA 2HKFH 4PG9B 1PLBA 1K3ZA 3RJOA 2H2PD 4JE4B 4RMRA 5GGSA 4HC1A 5E23A 4ATWA 2WVVB 4FXKA 3CSPA 2AJYL 4H8VA 3H4FA 2DBJA 3L2MA 4C56E 4CILA 2WHVA 5JUEL 3GK8L 5A43C 3HB3D 4OR1A 1BVKA 5F2FA 1AOZA 4G8IB 4PJCB 3SDAC 3SDYH 4Z95L 1FYHB 5A2LH 1XZ0A 4YGAB 3U1SH 5BQ7A 5ID0A 4L5FL 4PRPD 3E7JA 5KBKA 4G6AC 4Z3HA 4XMPH 3N0PB 2BVUA 3D2TA 1R3IH 1MHHB 4X4ME 4LDEB 5E1HB 1UOKA 1A7RL 3TXAA 4F9PC 2FEDD 4UM9B 3QUXC 3GPEA 1CLYH 4N0YH 1XSJA 5AVSB 4I18C 4J5VA 4XHJC 1KN2H 2Q7AA 1YC8A 4KQ0A 2DQHH 5LBSH 5KYYA 3HE6C 4X5WB 5EUOA 1QRNA 1P9MC 2BSTA 3SDAB 3HS0A 2XTSA 4AIZB 4LCCA 5KZCD 2Q5BA 2GJ6A 2F53B 3IF1A 3LNDA 3VXTA 2YPVA 4NWTH 5JHDA 2WZAA 1PBYA 2J88L 1UXSB 1L7IH 1PLGL 4CJ0A 3IN0A 1BFOB 1Q0YH 4FKEA 2K7QA 4WI3A 5HI4D 2A83A 2RIKA 3F58L 1Q9OA 4AKPA 5EU5A 1H3PL 5F96L 2ENQA 2F1AA 2QHRH 5DXWA 1O75A 3OWEA 1QSEE 1MFBH 4K5NA 1LDSA 2AK4D 4PJAE 2X4TA 5DMJB 2VLRB 1F3JA 5C2UB 3FUNA 2V7NA 3HNSH 3HMWL 3JV4B 3AUVA 2Y1AA 2H41A 1BEYH 3NAAH 4C47A 4P9ML 5I17B 2CJUL 3O9WD 4R5VA 4MQ7B 4ZAKA 4L37B 3NSDA 3CLEL 4M02A 4NQSA 2JF1A 5L88H 1V55B 3CE1A 4OLWL 2YGOA 1H15B 3BWAA 4MMYB 1DBBH 3ZX1A 5I1HL 3QHZL 2YWZA 4HWEL 4X98B 1KCUH 5D6DA 5C0AB 3AG1B 1CTMA 4XBEH 1W91A 2VISA 1SBSL 2A9ML 2ZPKL 5E8EA 2W07B 2YGVA 4XPGL 3S3CB 4R7VA 3VGGA 1IM9A 2UYLA 4O02A 3QJHB 3S36L 1EFQA 4LP4A 3J8F7 1SXZA 1YEEH 5IHZA 1JN6B 3EHBD 5DRNA 5KBLA 5IBLC 2D4FA 5AL8A 3QHTC 2V2WA 4Y5XB 5J1AA 4KV5E 3SKNB 2WD0A 5KVMC 3CFDB 4IDJL 4HC1H 2AXFA 4F1SA 4WSKA 1KCSL 3L6FB 1OOWA 1J9TA 1MCRA 3EYQD 1V7ML 4P2QD 1NM4A 2BWDA 4XBGA 1JHLH 3RNKA 4WFED 5E00B 1SDDB 1A25A 3R19A 4N0RA 1F11A 3LHAA 3UGUA 3L7EB 3GEFA 4XNBA 5T1DL 3V0HA 1S7SA 1K8IA 1XWVA 4L1SA 3CCHA 3MUJA 1D6VL 1F1DA 3WIIH 3F7PC 2WKGA 3EH1A 1UG9A 2BDNL 4LSPH 2CDEA 4IQHA 3O6FB 4JFQB 4FG4A 1I1CA 3REWA 4W1TA 4JM2C 3SB3A 3HI6L 3TASA 4IRJA 1VZHA 3VSUA 4B9FA 3RG1C 3ZZLA 4N20A 4KXBA 3BVVA 2IH9A 2OMYB 2QBWA 3VM7A 1EHNA 3VXUB 1PZ5A 4CMMB 3WNKA 5KS9A 4Y1AA 5FHAH 2G60L 2V2TA 1SY6A 2ITFA 4DZBB 2D0GA 3O11B 4OD2A 3UBXG 4ELKB 4YDVA 5SWSB 2ARJQ 4ONHB 2QLVB 1YEJH 3FAXA 5JXED 1BBJB 1E8ZA 1NC2B 2BNRE 2YPVH 2VDQB 3QEQA 4H26B 4HKZA 1MCHA 4HSAC 5EZLA 3TX4A 3TNMB 1X5IA 2BP5M 5C08B 4IRZA 4ONGH 2CUHA 2OMWB 2EDTA 4ENZA 2ADJA 1QVOA 2GVYA 2VYRE 5F6HI 1RUQH 5INCA 5ANME 3CDZB 4KXDA 3F7QA 1F42A 3X1BA 4EF3A 4FFVD 4JREB 4U33A 4QYOB 1OQXA 5I8KH 3GMLA 5D4IA 3HZ3A 2YA0A 4OT1L 5J11B 1JWUB 1VRSA 5INDB 4OZIB 4HQQH 3SKMB 2HLFD 2P45B 1TZIB 3RX5A 2QELA 1CL7H 2B4CH 3BE1H 3KVPA 4XOAA 1VFBB 4XRCB 1QSFA 4I2XE 3WLWC 1OAXL 4K55A 1E4XH 4G8AC 2H1PH 2B5IC 3WG7B 1MJ8L 1TFPA 12E8H 2P46B 3GSNB 3QUKB 2BNUA 4UV4H 2EVFA 3PXLA 4OLUL 1ADQA 3DTXB 5IR1A 4H13C 1BVOA 2Z7UA 5T8IA 4UQ2B 5E8OB 2BC4B 5CGYC 1ZE3C 4UTBH 3NFNB 2D73A 2XWRA 3MRLB 2WQXA 3ULSB 2F7RA 4HS8L 4QHUA 1TTCA 1UZ8B 3RWFB 5DRXB 5E6SB 3LZRA 1E4KA 3PAVA 3DURA 3FU3A 4L4VD 3UTZA 3BHBA 3L08A 1R0AL 3COOA 2K6YA 4MYWB 4PGDB 1A3ZA 1FFTB 1OCWL 2PXYD 3VGAB 3OJ2C 4ZYKB 2C4XA 2AV7A 1OGTB 2EEAA 2ZYSA 3L13A 3ZTDC 1AXIB 3VA2C 5J57B 4Z7UF 3KL0A 3UJIL 2ZKWA 2O93L 1UM4L 1A4JB 3FCSB 4ZPTA 3KJ4B 4OM1H 3JWDC 5GZNC 1HXYA 2NOYA 3SPJA 5J6HA 3HKFA 3BAIA 5JXAH 4JO3L 4D8PA 2OZ4A 2Y7OA 1RULL 4A38A 5D7IE 3CWGA 1UM5H 3KAAA 4P07A 1SQ2N 3ML8A 4F7CA 3CFUA 4ZMLA 3BQVA 2APTA 2VXUL 5DJAB 5T3ZL 4WWKC 4PBWD 4ZQTA 1MHCA 4GW5B 5HDBE 5HGDB 3RVXC 1MHEA 4L3EB 1NH6A 2JJTC 1GGIH 1BD2D 3KLAA 2F19L 1HE7A 1BFTA 2XC8A 3KLHC 2L04A 4ZPVB 4NENA 1XBRA 1GHFH 5J0BA 3IMWA 4JKKA 4S1RL 1JHKL 2JJUA 2VLKB 4U1IA 1R5WA 2IBZX 3JTSA 2YS4A 5EZOL 1KPUA 1Z66A 3IE9A 1YYML 3QSKB 4M61B 1BQHB 3OMIB 1DL7H 2OXGB 2D7TH 1DHKA 4N0UA 3NDYE 1BCIA 1DUYA 5DC4B 5DEJA 2OI9C 3M7FB 4ONFH 3T0WA 4G5ZL 3FF7A 2EVIA 4I3GA 4WFGD 5F1NA 1KFGA 3T0DA 2FYVA 1U95B 2JB5H 1MFCL 3ZYIA 2EC9T 3U2SA 3SDDB 4I9WE 5CD5C 1CGUA 2X28A 1WS8A 5FDYA 5J56B 2EDBA 3LKPA 7FABH 2P47B 4H2CA 3V9EA 1HTYA 2CO3A 1JZIA 3IFPB 1FNEB 2JKTM 4UIMB 3GUTA 3M6DA 1J1XL 4GOSA 2VDLH 5A16B 4PI2A 4QUOA 3TYFB 5DFWH 2QHLA 3RUGF 1IAIH 3O8XD 4PUBL 2WXMA 5FS5A 4JCWA 1NCJA 4G8GE 2HVKA 1TVBA 3X13A 1OCZB 2H0JA 4JW3A 4KHTH 4CUCA 3UROR 3ZYOA 3MDJA 2P48B 2FDBP 4UUJB 5BUAA 2YD5A 1GGCH 4RBPH 2VQ4A 4UYQA 3GMOA 3D3VE 2HJLA 2NXZD 5C6PB 4HUVB 1L9RA 1LK3L 2VRKA 4X5XB 2XXMB 3KHOA 5AQ0A 2OTWB 4BRJA 1ADQH 3P2BA 4NFDA 4WSJA 1FZJA 4ZW5A 2OK0L 4N8PA 3QXWA 5D1QA 1J1PL 1BAFH 1N10A 4P5MA 2LFGA 4GRLC 3KZ8A 3IDGA 3C5JA 3HAEA 4MJ5B 5F9WC 3S3JA 2XJLA 4BUHA 1TKWA 3I6SA 3DECA 4NKMB 1G4RA 4R7NB 3PWVB 4Q0XL 4AI7A 3NZHH 4OV5B 2F54D 1AXSA 4WQOA 2LT9A 4N2EA 3ILDA 2BFVL 3EGXB 2F7OA 3H56A 2I85A 3MR9B 3STZA 3VRLF 5BXFB 5DMGC 3L4YA 1GS8A 2AJZB 5ISZD 2DQJL 2YFOA 2HT3D 3S4SB 4DAGH 1CYXA 1Z1WA 2ZIDA 4JEGB 3KYKL 4HGMA 4JRYE 2NY3C 1CI3M 3SE9H 2BNQE 2FWLB 4LVOB 4PP1C 4U1NB 4JDEB 2B59A 5LGHL 3B1UA 4P2YA 3EGSB 3ZDXF 4PGJA 2R9HC 3E6HB 3LN5B 3VWJC 3V5DB 1TJGH 3O6LH 1T21B 5D1XE 4DFHA 3KPPA 2LGNA 4HIJB 2R0WH 3Q5YA 1S9WA 5C0ND 5SWQA 1T1ZB 1XF5A 5FUOL 4B0MB 3WN5C 2E0PA 4OV6F 1PSKL 1TPXB 3NEEA 1NAKH 1P5VB 2H26B 2OMTB 4IOSA 3IAPA 4YSOA 4NZRL 3BH8A 2FO1A 3P73B 1RPQA 4TUOA 4Z7NB 1KIRA 2VT0A 5E2WH 3IAGC 5DHYA 3BXNA 5DSCA 5C0IB 4GSUA 2WXLA 3L16A 3RDTA 4Z7OF 2EZ0C 2NY3B 1BVZA 4RDBA 3BWSA 4YDLB 2R8SL 2VXTL 1N8ZB 2YPLB 4FQIH 4J23A 1U8QA 2PUQT 2EUZA 3VFMA 4X6EA 2PW2A 1OVZA 3K4AA 5F0LB 1MNUH 2A74A 1E65A 4OZHB 4PRID 4UT6H 1P7QB 5ETUB 1HHKA 3VU2A 4F7PA 3TA4D 1K2DB 3TH2T 2ZYRA 2N7SA 1IAMA 3APMA 4WNQA 4PW3A 1CYWA 2VXVL 4L1TA 5I75B 4QT5B 3GO1L 5ALCH 1M53A 2IALA 2WWKO 2KLTA 2VDRH 3HFMH 4Y4HC 1GH7A 4NC0B 4GKZB 1OXYA 4NRZB 3VH8A 5F7EH 1OTSD 3LTVA 5FFOA 3IJEA 1T5WB 4HA1A 4BFRA 1B0RA 3DPBB 2VM9A 4QRBA 3MJWA 4F7MA 2DB8A 2GC4C 1JYXA 1DQLH 3QNZA 2BK8A 5GSRA 5J5EA 4MMZA 2ICES 2AEPH 4JLRA 4MHHI 1OK0A 5DZPA 5KW9L 2L8AA 2NY5L 1T3FB 5TE4H 4DKDC 3QI9C 2VDQL 3CV5A 2M1KA 4NT6A 3WXWH 2CMRL 2VR7A 1S5HA 4RWYL 2JI1A 3ABMB 3TO2B 5CP3H 4Y4HB 3WE1A 5GRWA 2HFFB 3HNVL 3KDPB 1FUNA 2OTUA 2X42A 4HPYL 4UDUB 2NR6D 3RA7L 4ABUA 3N85H 3V10A 4N6RB 1DJGA 2NY4D 3PAUA 4XNZC 3SKJL 2KDGA 5JDSA 1QX1A 3FOLB 2E9WA 3DIDA 4LSSL 4FQQA 4IIQC 5IVNA 2XV0A 3C08H 4GSXA 4PJ5D 1BYNA 1DQJA 1MIML 3HAEH 2D3VA 1CGYA 1N59A 2LABA 4NGHH 1AD9A 5CR8A 2UY7A 3CH1A 3SSGA 5A6LA 4HLJA 5C07A 5DJXA 3T0EC 4LSVH 3V6OA 4NZFA 2YD4A 3AG3B 4OIFA 4GUPB 1VF5C 3JTTB 1IX2A 4OLYL 2PPDA 3Q8AA 5E7FA 5B39B 2EUVA 3N1FC 4DOHE 3GSRA 2Y23A 5TH2A 4XP6H 1QQDB 3GSNL 1ZD6A 3ZUNC 5JORA 1IGFH 3TBVA 2ZTBA 3KNBA 2ZOKB 2VB5A 1S78C 2FQDA 3AFLA 4FNQA 3R7RA 4H5SA 4J3SA 1L3NA 3EO9L 1LEGA 3T4AB 4Z7QE 4XPBH 1GAFH 5EUOF 1DE4B 1GJWA 4ANWA 2NZ9C 4JY4B 3ISRA 1SEQL 2W9EH 2OMBA 1VZGA 3MRCA 4FQCL 1AP2B 4JY5H 1RPUA 4DP5X 4M6ML 4D9RE 5IG7A 4HKXB 1BF5A 4IKJA 1E7UA 2X9WA 2NX5D 3M1BB 4ZMVA 3P9MA 4DUWA 3VXMB 2NTFB 3OZ9H 2Q6WA 3U6RB 5EDXA 1MCLA 3D85A 4ANVA 3BH4A 5HGHA 2H3XC 4DUXA 5IJVA 2DDQH 3MRKB 1JZFA 4KX9A 4QOKA 5HYJD 2ZXQA 3KYMA 4WW2C 1IGJB 1UD2A 2ZONA 1SYVB 1PD6A 3KWVA 5F0PB 4GKLA 3EFDH 1FIGL 2ZKHH 4R3SA 1A4KB 1SVZA 4KK8D 4L8DA 4BD4A 1N26A 3D0VB 5T3XD 2QJDA 3T6WA 4UQDA 3AADB 4ODHL 2NLJA 2KDYA 5C0CA 4N8CL 5ENWA 1ZLVK 3FPXA 2A99A 2DYRB 4A7UA 3EJZD 1PMYA 4MDJB 1MI5A 4G6JH 3INOA 1N68A 1F41A 4NQDB 3ZT7A 1Z3GL 2R0ZL 3PABB 3MRRB 1J87A 4MA8H 3MUUA 5L2KB 3O6ML 2QTVA 5KSAA 2W95A 3WSQH 2NNFA 5JOFA 2MCPL 1CN4A 3VGBA 4JS7A 2VN7A 4N25A 3KVQA 4I0KA 3F65A 4UOW0 2WM0A 2VM3A 5E4AA 2G3ZA 4HS3B 4KVNL 4RRPM 2R23A 5B3JE 2WB7A 4LLWB 3CVHA 1DANT 4OZGB 2GIYA 1CICD 1ZGLM 5LN4A 4RA0C 3RRQA 4I0CC 2YA2A 3QQXA 4XMKH 4IMLA 2R2EA 4G8EB 5F9OL 3WL9B 4UZUA 4WFFE 4YSEA 4IM8A 5M7QA 2WCSA 4YS4A 1E8YA 1C8QA 2ZICA 4MS6A 4WWNA 2G3XA 1RHFA 4WU7B 2BCMA 4MCZB 1PKQE 3BWUC 3KGSA 1HCFX 5FOJA 3FL7A 3JZYA 2ZNWA 2W9LA 1TJHL 2XV3A 2YXVA 4OIIH 1RI8A 4WV1A 4X99B 3EGDB 5ICXA 2UY6A 3OKEA 2BMKA 3CPLA 4ENEC 1CDUA 2PO6D 3GMPA 5AB2A 4FE9A 2A9AA 4RGOH 1X9UA 2C1PA 2X4PA 3ERXA 3ETTA 3IBOA 3AROA 4EUPA 5BVJA 4V1DE 3KYNA 5EFIA 2HN7B 3NCXA 1QYGL 4X7DC 3PHQB 4UU9B 3RWIB 2Z93B 1JF5A 4XN7A 3KPRB 4AITA 4LRIC 5I19H 3LZPA 5GRVL 3FT4A 1ZS8B 3HZMB 1O7DC 2A9NL 5KS9F 3M8OL 3BEVB 3LNHA 2K4AA 1EEUA 1B3IA 4WI9A 1OAJA 4PJHF 4QWWC 4TVSa 1NUGA 4U7SA 4U7KA 4OQTL 2J8UB 5SWZA 1M2VA 1IGCH 1S8DB 3QFDB 4OCLC 1HOCA 3BP5A 5C0BE 3L4CA 2G75B 3KBHE 1FNFA 3K0YA 2CLRA 4JANB 3FB8A 2XY2A 1CZ8L 3RKDD 5DDHA 2JB6A 2VLJE 1JVOA 3FQRB 4M7KH 4LSRL 2IOIA 3MJ7A 2C3GA 2DQIL 1G9MH 1R3JA 3TYGL 4KAQL 2YFNA 3AY4A 1WCBA 4QXTB 1A6TA 2YO3A 5MHSD 2V8MA 4BK5A 1ZGLP 3HVDA 3PWUB 2OX5A 5IQLA 5K5YA 4GG8A 5DEGA 3FB6A 2XZCL 4HKBB 2AJXH 2NTSP 2QSTA 1NIFA 1FPTH 2RCSL 4ZMXA 1QTPA 3MRJA 5BRZD 1MFAH 5KVFH 3KPOB 3Q8CA 5JZ7C 1UXLA 2XNAB 2EIEA 2NY1B 3MNVA 5F1OB 3BO8A 5CKGA 5MP6H 3LKNB 2GIMA 3CQFA 1T03H 3GNML 4XPAH 2I07A 1UB5A 2P5EA 2IGFH 2DLEA 1OAZH 1U6AL 4CW1B 3ULVD 1GYCA 1CJYA 2YQGA 4R84A 1MRCL 3N43F 3ORJA 5DT1L 1UH3A 5E8PB 2XG4B 5JHLA 2D7NA 3CN3A 3MBXL 4MJ6B 4GBXD 3DK2A 2I24N 5K9KB 3G5ZB 1UOLA 4O51B 1AI1L 3VA6A 5KBPA 2Y2WA 3L4ZA 3IMUA 4MNQA 4RAUB 5EBGA 4NBYB 4XZ4A 1P4BH 2BVTA 3EYSH 4JFDA 3MV7A 4QIRA 1V7NL 5HHOE 3NIDB 4BM7A 1YMMB 2BNRD 4ZX6A 4LIQL 2AQTA 2AITA 3HC4H 4JFPB 2QT6A 2VXQL 5FWQA 2KKQA 1FYTA 4UQAA 2XUWA 3CSYA 5E9DE 3RAJH 2ZOWA 4G2AA 2X3BA 4U0QB 4XC1L 1MZZA 3DRTA 5ADOH 1IBGL 2XYCA 3TLRA 1MWAH 1A21A 1AD0B 1B4TA 5E0FA 1A1MB 5EOQL 2ITDB 1TIUA 2QZQA 1NLDL 1S9XB 3FHQA 1HNGA 3GM0A 2LR4A 3CXFA 5FYJL 1Z3RA 2A38A 4X0NA 1P1ZA 4LEXL 1SN0A 4HBQA 4ZO6A 4OUUA 1BG1A 2YKKA 4DP8X 2VITA 4J7RA 3EO1A 1MCEA 4LPCA 2WTRA 2B1OA 5HGGS 1E3ZA 1JOIA 3D69B 4DN4H 5DZVA 2ZUSA 2JV6A 4GP8B 2R51A 4DCQA 1VSCA 4GXVH 2FO4B 1D9KC 3VFOB 4P9HH 3DVIA 4FERA 1GMEA 3WUWG 3DLQR 4H8QA 1RZJH 2Z8WC 1TTUA 4GY4A 4AGNA 2WLIA 5ILTL 1WIPA 4OF3A 1G94A 4ERSL 2WWKT 2QMJA 3B2VH 1J0IA 2TAAA 4FTVA 4JR9H 3SDDA 3DSNB 1FV1B 1T20B 2YQ3A 4B9KC 2XIIA 3O3DA 4FXGC 1UZGA 2ZZUT 1B0GA 4K5PA 2P8PB 2O6CA 4Z77B 4YSAA 4NKOA 2X4NA 1TZAA 1OZTG 4ZS6C 3FN9A 1D9KB 4YUEH 4U3SA 3TN0A 2VZSA 3MV9A 4F33A 3T2OA 1NCHA 2UVFA 2X12A 3DI2B 3Q5TA 3QFJB 4E41B 4KNQA 4GRWE 3QZNA 1LWJA 2G2PA 5MENE 3B3IB 4ISVA 1HYSC 5ECGA 1F18A 3ZDWA 1MCPH 1WVZA 2CE6A 3QNYB 2OQJA 1YN7A 4JFZL 4TLKA 4CN4A 2FRGP 2XG5A 4P4KB 4RGNE 1WHOA 5DJZB 4ZMQA 1N7MH 2YRLA 4FXGB 4FQJH 3BVNB 4PRBA 4Y2LA 3RL1A 3OKMB 1ZANH 3EOBA 4ELDA 1QG3A 3UPRA 2H8PA 3P11L 3DO7A 1AHWA 1X5HA 3GZKA 3ZRFC 4HZ1A 1IGML 4Z78A 2EYSB 4F9LA 4QLWA 2MKWA 4QXUL 2XTJC 4LOVA 2J43A 3FRPA 3EH2A 4K23H 4XMVA 2D8KA 5JHLH 2FE0A 4TQEL 5K9JH 2EIMB 3HBQA 4EN3A 1W16A 3S2CA 4X6DA 3Q6FA 4M6OL 3KGUA 1JGUL 3F7VB 1UB6B 1ZK9A 4PMFA 2FAUA 1OT4A 3D08A 3D33A 3RTLA 5IFJA 4L23A 2AAAA 3L5IA 1VPOL 2DI9A 1W0VB 3IS1X 3U6XS 1VLXA 1LD9B 3AACA 2BZDA 4WFHE 4AL8L 4Y8AA 3HC0A 1GYVA 3H3BC 4HOXA 5D7JC 2R56H 5EOCH 1T7WA 4D9LL 2AV1B 1UVQA 5I76A 4WDIB 2H9GA 2XDHA 4MJ2A 4IBZA 1MFUA 4N2AA 1PU0A 1VADA 5I1JL 2N56A 2F58L 3IKCB 2OMXA 5HHNB 2ZE0A 3SKUD 1UXWA 2F5AH 2UZXB 4R7DA 2ZQKA 4XX1E 4NC2B 3VD3A 1KFAL 2R2HB 5HJBA 3K72A 3CDYA 4BCZA 4XX1G 2ZKMX 4CC0A 5KVEE 3PP3H 2K3HA 1M7DB 2YEZB 3CC5B 2P5WB 2Z0UA 5FK9B 1XAKA 1I8IA 5E6IB 4BIKA 3EZ8A 3QCVH 4X6BA 2AJUH 3TVMA 2BP3A 2SEBB 2XPYA 4AENB 4R7LA 2DIAA 3GI9H 5ABZA 4YE4H 1OHZA 3C60C 3MLTA 1G7IA 1CK0L 5F3HB 3UP1A 4CVXA 3OAYH 1MCCA 4YXHL 3TONA 4LEOB 3DRQB 5IM7B 2FYYA 2YSTA 3UJTH 2XN9E 2WBWB 4XP4L 1KYDA 3W56A 1U8IB 2LOEA 3MKKA 3ULUE 2CO1A 1QLRA 5F1KC 3DX8B 3OM3B 4A39A 4FABH 3IFOB 1ZLSH 4KFMA 4ZOEA 1EVTC 1B9ZA 3LEVL 4MXWH 3WTWA 4LBAA 2GTZB 2JIXA 1EQWA 2IMMA 3GTNA 2DYPD 2JH2A 3ARDD 3GJFK 5ALBH 1CXIA 2H32A 2R0LH 2CAKA 1VDGA 3L3OA 4RIRA 3JWOC 5CHNB 3C60B 3KXFD 5DS1A 4ORGB 2AHIA 3FT2A 3ZHDA 5T1LB 1QSEA 3RVVC 2E7CA 4PJAA 3ZTEA 1XF2A 3W9EB 4LPVA 3FCUB 2GCYA 5JW3H 1C12A 5FYJU 3MLVL 5IWLA 1T7ZA 1O6VA 1OGAE 3EJYD 4YEEA 4Y4KD 4RGMB 4APQD 3K2UL 4UZGA 3VW3H 3IRZA 2HJFB 3NCJH 1GY1A 4ZO7A 2VE6A 2HT2D 2IPUK 4B60A 1XF3A 2LU3A 5KJRL 2WXGA 2O61A 3ZL2A 1M9SA 3QG6B 1LMKA 1O6TA 2ICEC 1GA2A 5IROD 1YEIH 2EIZA 3G6DH 5JIQA 5HJ3A 4G43A 2EDLA 3HG1D 5LQBH 3D4YA 1S7UA 1VGEH 1HHHA 1JGLL 1WDAA 2MFNA 4XNMA 1OP5H 1NCNA 5G5DB 1QNZL 2J72A 2IQAA 1KJMA 3B83A 3VQ2C 3O41A 5JR1L 3QDJB 4PRHB 5F0MB 5JNYA 1D7FA 4Q4IA 5PAZA 2ZWNA 3L1EA 1E3FA 1RK1A 4WWPA 1AVAA 1X5GA 2VDKB 4P46D 2F5BL 1J0ZA 3JV5A 1ED3B 1GKEA 2OULB 2J5WA 1QI5A 4O5LH 1ZXQA 2KLSA 1A3RH 2FL5B 3LXAA 4OLZL 4AT6A 4KZDL 5DHDA 3EYVA 5T1MA 2B2XL 4CAGA 5IMLA 4YJZL 2A1WL 2K0RA 4K94C 4NNYA 2GT9A 1HHIB 2VMDA 4NBXB 4M43H 2YLKA 4HKJB 5LCVL 3K1KC 5KOVC 5AZEH 2HMIC 4WGVB 3WFDH 3E1F1 1F4AA 1HSAA 3P30H 1IKFH 4OCMC 1SJHB 3QXUA 4AZ8A 2K70A 5C0AE 3EDEA 3DX9B 4GQPH 3WEMA 5IUCA 3M17B 5CBEB 4LCYB 1AGBA 4PGEB 2WBJA 3PS6A 1FAKT 3U46B 3U7AA 3MTXA 4PGZA 1T0MA 3QW9A 2HTLC 3A67L 3B34A 4KVCH 4WZ9A 1RZFL 1SJEB 3EDKA 1I8MB 1RZ8B 3D48R 4PRNA 4HDIA 1E28B 1HEZB 2I7OA 3VGEA 5I74C 5C9KA 4YO0A 3L1OH 5GZOD 5DD5L 5F1SA 2J73A 4Z7UB 1Q1JH 3QAZC 4P05A 2IG2L 3LB6D 3RGBA 1S7RA 1DQQA 2HT4D 2FQGA 1WWCA 3D06A 1R3LA 1OQOA 3H7LA 5CEZE 3ARBB 1KZQA 3GFUA 2Q9OA 4PY7B 2Z31B 2Q7YB 1JTPA 2WAHA 3AITA 1TR7A 4AM0Q 4R2GD 3RGVC 1Q4NX 4AJ0A 1JPGB 1RIHH 4OAWB 1FF5A 2ARWA 5D7SH 1DBAH 2F7QA 3MNWB 5HVFB 1KENL 3ZRCC 1LWRA 2N3JA 3UO1H 4CDGC 1G7MB 3ECQA 4OSUH 2PWHA 2WVTA 1KIUA 3IDJB 3ZKMC 3EFFB 3QAZB 2NY2B 4DP2X 3DGCR 3NG5A 4G6ML 3TCTA 5L8LB 1BJ1J 5IT2H 2QGDA 1FA4A 3HR5B 3O81A 1R5VB 4ORZC 4G3YH 2ATPB 3D39D 4WHDA 2GY5A 5AVWB 1OP4A 2DWEB 1SBBA 5JW5A 5HVHB 2WGNB 2WVSA 3LKRA 4Y4FD 2VSMB 3TL5A 2I9TA 4NQEB 4NFCA 4GW4A 1AZBA 4KK5C 4C83B 3Q1SL 4TPRH 1I7TB 1TQVA 3Q3GA 1TTGA 3QHFL 1H9DA 4L3CA 3GINA 1J5HA 1F4XH 2WNKA 2WLZA 3VSTA 1NIAA 1WTGT 3N3EA 3WBDA 4HEME 4FXTA 4DQOH 4I5BA 5DFAA 2F68X 4GRMA 2RAMA 1LM8V 2V9TA 3CFNA 3WNPA 3VDCA 1IV8A 4LHJB 4LRNH 3UMTA 3Q6GH 3RUGB 1ZVSA 3O2DL 5AL0A 3CSFA 5D4HA 2M2DA 2ZUVA 1JI2A 4MA3B 3LXUX 4FRWA 5EU6A 5BUPA 1C1EL 1FGVL 1U8LA 1HIML 3QISA 3AT0A 3SGJA 4D0DA 1W72B 3HE7B 5IV2B 3VXSB 1WP6A 3QIWA 1TCRB 4BJLA 1TMQA 2IOOA 3LN4B 1H8OA 4ZMZA 4GMTH 5E2JA 5FB8B 3TJEH 5CCJA 3WTTA 3UTSD 1MXGA 2QSCH 8FABB 2KI6A 3MUY1 5D7IA 5L2JA 2E9BA 2PW1B 3BAEH 4OFYA 4EKJA 4PI0A 3B43A 3OZLA 4PWJA 3GLEA 3QDGD 5TFSL 1U36A 3FTGB 5EBLB 3DPDA 3HPLB 3X1GA 4AV4A 3ZHLA 2AVGA 3OKKA 5D2NC 4WY7H 4BE5A 3EOAA 3HC2A 4FFYL 4GQZA 3UYPA 4BWUA 2VQUA 4LARH 1UJ3A 2IDUA 3H1ZA 2CK0H 3BLPX 3S6CA 1S7QB 4PCYA 1WAAE 3L9RB 5IJKA 4X50A 1MVUB 4I3SH 3RWHB 4Y5YA 1DSYA 4QRRD 3JV6B 5JOEA 3BFOA 4KTEH 3RU8L 3HZVB 4BCXA 1TZHA 2E74C 3FDWA 3O45B 1L7TH 1WG3A 3BAKA 3RVTC 3G6AA 3U0WL 1L9PA 2K6WA 2Z8RA 3G08A 5DK3A 2E6JA 1DUZA 5AFAA 3B9KC 1FJ1B 4RAHA 2ZUWA 3ZDXB 35C8L 1RFDL 3RURA 1X5LA 5D2NB 1NCCL 4JPVH 4V1DD 2Q2LA 1YY8B 3CZUB 3UADA 3B2PA 4P2RB 3RYMA 2EDNA 5EO1B 2KT6A 2CQVA 3KVDD 1WFTA 3O0RL 3GXDA 5DUML 4MB1A 3BKCL 3RTQD 2IH1A 1A8ZA 1Y0LA 2VH5L 2CALA 4NYLB 5AVTB 4PREB 3WNLA 1JDDA 3P40A 4IS6A 4Z7OB 1Q9KB 1J9RA 3FCTA 1FWXA 4O9HH 1KDIA 3B9KB 1EHXA 4K3HA 5DYOA 2XWXA 4FG0A 4MA7L 1IGTA 4LLDB 1WICA 3GDBA 1DVFA 1SPDA 2F08A 2P80A 2YEVB 3QWQB 4QRPE 2FB4L 3D3VA 4WUUE 4FHJA 4ZFOB 2PP8A 1BQHG 3ARWA 3MRPA 3MJGX 3KLLA 3ARRA 1INQB 2HRLA 4NQUA 2I9LB 1G7PA 3IGAB 4WF7A 2Z7YA 1UWXH 5I9QB 2OP4L 3CBKB 3U2IA 2WXHA 2R1WB 3TC9A 5I8CB 4FXLA 4N90D 2DWDA 3E9UA 1KTKE 1OB1B 3B9AA 1G9NH 3UBHA 5JA8B 3FB7A 2HLAA 1GZHA 2ZUUA 3DSFH 5E1IA 5DTFB 4Y19E 5AW6B 2YAHA 5K9QI 2VSKB 4U4BA 4XOBA 3T2NL 3GIVB 1YNKH 2BO0A 3MO1B 5AAMC 1M2OA 2PLTA 4WJ5A 1AR1C 2AEIT 2BRRL 3L7FB 4XWGL 5DVLA 1TZGL 3BH9B 2WWOA 4PGBA 1NCDH 1DBKL 3LRGA 4JRYA 5EN2A 5C09B 4KJQC 4LP5A 2BNQA 2QVKA 3TA3B 3QO0A 3TIDB 5I6OA 5J12C 5TQ0L 1QLFA 4LOFA 2Q0ZX 1JUFB 3OHMB 2IFFL 2K9FB 4AUYA 5GGSB 1VJSA 5DJ2B 5D1XA 4Y16D 4FXKB 3ZKNC 3PAYA 4W9LC 5E4OA 2J6EA 3ESUF 2DMKA 2Z7WA 4TRPL 3WD5H 3BKYH 4OB5H 4WO0A 4X4YA 2PMZA 4CVZA 5C1MB 1I7UB 1XGRA 2O6DA 2X1QA 5KTEL 4MQXD 1BVKB 1IBDA 2FJGA 3DARA 1WFOA 1Q0XL 1QEWB 3O4LB 3QYNA 1JF1A 2IC2A 4P2AA 4HIQA 1XZ0B 3HS0C 4UNIA 5BQ7B 4LCCC 5ID0B 4PBDA 1OAQL 3WY4A 2OJEA 4PJDE 3AG4B 5D5MF 3X3GH 1IVLA 1YLBB 3FN0L 3QG7L 5E2TH 2FX7L 5HHOD 5I16A 3C6LC 1ZEAL 3BD4A 1VIWA 3NDZE 3CFJA 5DC2A 1N3NA 1X7QA 3WFBL 1ND0A 4PFEA 3P0YH 4TLSA 1JI1A 1RERA 1A22B 1KLGA 1N18A 3S4SG 2A6JA 5KYYB 1PY4A 3WTUA 1KBWA 2ZWLT 4YBLB 4NXSA 1T66C 5EUOB 1QRNB 2BSTB 2GPZA 3CSGA 6PAZA 1A0QL 3VXTB 2YRBA 3IF1B 5CF3A 3IDUA 5IREA 1JZ5A 1LEKA 5JHDB 2ZF8A 2NY6D 2BVQA 3FQXA 5IHUH 3W5NA 1ES0A 2LE9A 2A83B 4NQCD 1Q9OB 1RZKH 2IADB 5EU5B 4X6DF 2IH8A 2PR4L 5FX3A 1GGBL 2KMWA 4PR5A 3AU1A 5LAPA 2I60L 4ZK8A 4NM4H 1CFVH 3GSUA 5HVWA 1IJ9A 2FLRT 4FFZL 5D6DC 4GQQA 1HL5A 4I3RL 4YFDB 4OGXL 1QATA 2W80C 3H42H 2EH8L 3AREB 4NO0D 4XCCH 1F3JB 4UB0L 1HKLL 2V7NB 1SXSA 2E76C 4JDTL 1BMWA 3W5MA 1TQCC 5EIIA 4A37A 1LO2L 4KKAC 3MLUH 1PFOA 3CFIC 2AEWA 3DUSA 4B9JA 3CFCH 1AQKL 5D7LE 3KH4A 2VDPH 4K8RL 4KJWC 4P4RA 4RZCA 5FYKL 4Y1TA 4ZAKB 4X8CA 4NQSB 5DD0H 4Y8DC 5EDSA 3SBWA 3WMQA 3ZJAA 4EI5A 2CXKA 1MLCA 3BWAB 3INUH 2OBGA 5EN2B 1HL9A 1AH1A 1EZVY 3RIKA 2CU9A 2VISB 3N9GH 1B0IA 2X4RA 4OM0L 5E8EB 3BUPA 3O4OC 4JVUA 1ZSDA 1IBHA 1G9EA 2DQCL 1G6RA 1TQCB 4QJ3B 1ANUA 3PXJA 4LOUC 1C5DA 2UYLB 3P4NB 1HVXA 5IHZB 1F4YH 2COQA 2WZPA 4ZMNA 2V2WB 3CLWA 4GG6E 5J1AB 2ATKA 2QPFA 4N4YB 1KXVA 1IM3D 4IRJC 1RUPL 4NM8H 1AGEB 1TEGA 1WPCA 3SE6A 3RX7A 2XXFA 2G0KA 5D70H 3KG5A 2Q3ZA 3A24A 3MV8E 4V2BA 4XBGB 4CBPA 1U21A 3RNKB 4BZ1H 1F5WA 1G9HA 3MJ6A 3LQAC 5GRXG 1AXTL 4FGMA 1S7SB 5LB1A 1YECH 1J9SA 3BQUD 3CCHB 5AW7B 2A77H 2A7BA 2VC2H 3NMEA 3R1GH 3ZTJG 4O2EA 4RMUA 2EDKA 1W72L 5CEYA 1CTNA 3MOAL 3MA9L 3L4XA 2HKFL 4PJAF 4KK6C 4GAFB 3REWB 5F0JB 1XIWD 1ORSA 1VKXB 1LWHA 5IOKA 4IRJB 2W0PA 4IHOA 2C9PA 3GXFA 5FA3A 5ACMA 4N5UA 5B39G 1EWHA 2YSSA 3H9YA 1JRHH 1V3LA 1FCGA 1PZ5B 4N2NA 4EN2A 2YMXH 5KS9B 2V2TB 3HPJA 5JIHA 2GAZA 4L29A 4OD2B 3ARFA 3FMGH 4FYTA 4YDVB 3UAFA 1K5NA 2DWXA 4A6YA 2ZYHA 3POHA 4W68A 3GS7A 3SDYL 1MLBA 4PJHB 3U1SL 4DEPC 2B9AA 5IMOA 1MIEH 1V05A 3PQYD 3QEQB 4HKZB 2GTQA 2X4SA 4XNYH 3T0EE 4XMPL 1JHTA 1UZ6E 1R3IL 4HGKC 3I02B 3HTLX 4XMLH 3D87B 4I1RA 3MLWH 1S9YA 4TQHA 2ADJB 1QVOB 3PPSA 1CLYL 2NUPA 4N0YL 5INCB 2VAJA 4G1MB 4MXVE 5JOPD 2W92A 2VDLB 1KN2L 4ZNEE 3KYAA 4NO2B 2ZKYA 5T3ZD 2DQHL 2FEJA 1SFDA 1UT9A 1WK0A 1JVLA 3P3RA 4F91B 4Q8BA 3GMLB 4KV5F 5LHDA 1JNNH 2XN9D 2BXYA 1P2CA 3VMOA 1UKQA 2DMGA 3ULUD 3CHOA 4A2FA 3P3SA 3KEDA 4OFVA 2Y6TE 1OEZW 4NWTL 4R4BA 4TNWF 4AQAB 3OPUA 1N19A 4FQXA 1L7IL 1QSFB 1S3RA 1YAIA 3O3EA 3O3BA 1Q0YL 3C09C 1PKQA 4ADGA 3UG4A 1HK6A 2PCYA 4XP9H 2BNUB 1XMWA 4U1SA 1L0PA 3SIKA 2QHRL 2CWRA 1JPEA 4I1PA 5J06A 2N1KA 1RURH 4M9PA 1MFBL 4EJ1C 2XQ0A 4NSKB 4XGZA 1HILA 3HNSL 3N43B 4QHUB 4BFIA 1G6RH 4DSYA 5L2KE 2O5NA 5GS2D 1QRKA 5JPMA 4UM9D 2Q87A 1UJTA 2E9IA 3DURB 1BEYL 3SO3B 3UTZB 1EVUA 3BHBB 3NAAL 3EBAA 3VD1A 4JUSA 1NAMA 3C09B 3V8CA 1KB9J 2AV7B 2CKBA 3SDAD 2GBAA 4FYSA 3DOIA 4OJDH 3TBTA 5CKAA 5JHBA 3HLAA 3T08A 1DBBL 3MJ9H 1MW3A 2F53D 3P9LA 1KCUL 4QF1A 4ZPTB 6FABH 4XBEL 4H7VA 5C0BA 1IEBA 4TNFA 1UD5A 1HXYB 1XCWA 5J6HB 1FZKB 4TUKL 4EVNB 1E5CA 1S5IH 4D8PB 3RFZA 2VLJA 4DT2A 2C34A 4Y0GA 4XWOC 4QY8A 1YEEL 5FYKU 4F7CB 2R15A 4JZJA 5CSGA 1A1NA 1DP0A 2J1ZA 1MHCB 2ZAHA 1ZA6A 1MHEB 3E3QE 2VLRD 3BUIA 1VEOA 3RB5A 2CRZA 3FQTA 2Y2TA 4HC1L 1ZKAA 3CIQA 3BGFC 4HIXH 4KVPA 1D5ZB 1MCOH 2BOBA 5CJXC 2YAOA 4NENB 2WLYA 1WV7T 3KPRE 4JFYA 4ICXA 1SVBA 1Z9LA 4U1IB 5SX5K 1R5WB 4DF9A 3JTSB 4QMEA 1JHLL 2AAVA 1KPUB 3DJRA 4NLAA 2ZXCA 4N0UB 3NZUA 1CUOA 1DUYB 3ZSTA 4RMVA 3S9DB 3OAZK 4UT9A 2CHXA 4PEEA 3WIIL 4B27A 1PLAA 4PW9A 3MTRA 4Q7DA 3MUGA 2EDJA 4X6CE 4XO3A 5F1NB 4EAEA 5C0AD 3KL3A 4LSPL 2ALAA 3MYJB 4AYGA 1U3JA 3U2SB 3FQYA 4XXCC 1NCAH 3H3PH 3V4LA 1IBBA 4N0FA 5F7YC 5GJSH 1DJSA 1SOXA 1T89A 3LKPB 3S37X 1D6EA 1PPIA 4HAKA 2V5MA 4RESB 5ITBH 5LGYA 3FQWA 4U6VH 3GUTB 5F21B 3T8MA 1A6WH 3B2UD 3UH8A 2EEFA 4Y2DA 4AG4H 3ARGC 3S98A 3CXHJ 1O7DE 1KJ3H 4IGBA 5FHAL 3VXQA 3Q9PA 3IT8D 3VRIA 4HJIA 4OGYH 2HVKB 3GGWA 4YHOH 4C58B 4ES8A 5C8JB 1TVBB 4J4PC 3X13B 3SY6A 1I53A 1YEJL 2VTFA 3B9EA 4HIIA 4JFWA 1CFQA 2VZ1A 4N1CA 2ORBH 3DV4B 2YPVL 5K69A 5GRJH 2DPKA 4TSBH 1Q9LA 3X1FA 5CEZD 1AO7E 1SF3A 5D9SB 2MQ0A 5E9DA 1NGYB 3F83A 3GMOB 3K2MC 1GTNA 4ONGL 3NCCB 2HJLB 2WTPA 5HPOA 4GO8A 5D8JH 5D7IF 5F9DC 1RUQL 5B8CC 3RIFF 4L0YA 1FZJB 1KGWA 5D1QB 5HDBF 1UASA 3O6FD 1BLNA 3PDOA 3UC0H 1KTLA 1QZNA 1F4WH 3I9AA 5I8KL 3IDGB 3C5JB 5GGVH 3HAEB 4N87A 4ZX3A 1TKWB 2MCG1 2VAAA 4PW4A 4HUNB 4HQQL 4UNVA 2OR7A 3BEWA 1AXSB 2RBLA 1CL7L 2B4CL 5C6WH 3AT8A 1KZYA 3BE1L 3VXUD 3NA9H 1ZMYA 4J3OC 3STZB 1NAMH 1JZ6A 5DRWB 5IVZB 2Q7NA 2PTVA 5AG9A 1E4XL 2H1PL 3TO4B 2CKBH 1B2WH 12E8L 1IARB 1YN6A 2LU4A 4GO6B 4XXDA 3S8GB 4UV4L 3CAFA 3TEUA 4P2QA 5SWSD 4W9GC 4R83A 3ESOA 4K7FA 3OB0H 3NH7H 2J44A 2ZP9A 1A14H 1NC2D 2B59B 3NIDE 4FI6A 4FLOA 4UTBL 3MV01 3KPPB 3IU4H 2W1NA 5C08D 1PZAA 1S9WB 4D2NA 1VZIA 1XF5B 4QKXB 2XFXA 2Y5TA 3OHXA 4R5XA 3BH8B 4ODXB 4ZO8A 4UWQB 1OSYA 4TUOB 1KIRB 4G83A 5DHYB 3BXNB 5DSCB 1CBVH 4N2DA 4OGAC 3DIFA 2IPUG 5GS3A 2EKSA 3RDTB 4AMKH 1KT2A 4AMWA 5MENA 3EOYG 3VGFA 3OX8A 3QPQD 4B3EA 2BSED 3DJZA 2DQEH 2W0KA 3RHWK 2GY7B 1WFIA 3FO1B 2FR4A 1U8QB 2IWKA 4OM1L 4X6EB 1X5AA 2ITEA 3OZKA 4KQ3H 2PW2B 3VFMB 1J9QA 4F2FA 5I0VA 2A0LC 4KKQA 1G1OA 2CBMA 4TVUA 1ZDSA 4LVEA 3SJVE 5JXAL 3AABA 1YYLH 3DX2A 1KDJA 3WFZA 3FO2A 1DQMH 2A74B 4UT9H 4NN6B 1UM5L 1MQKH 4MMZC 1WCQA 4LGSB 1HHKB 4F27A 4FP8H 3P02A 1NFAA 5JYLA 2CGRH 4WNQB 3T8XA 1JWSA 4YXLH 1GGIL 2ENJA 3LS4L 2IALB 2IWFA 3ZXAC 5SV3A 1GHFL 4TNVF 3VH8B 3KGRA 2OSLB 5DJYA 4IMKA 2JNZA 3IJEB 4ZFZA 4HZAA 4CC1A 1B0RB 2OJZH 4TULH 4F7MB 4N2MA 1HX0A 5C9JB 3OQ3B 1DL7L 2D7TL 3M45A 3QNZB 1SHXA 3MREA 5GSRB 3FBQA 4MMZB 3VFPA 4ONFL 5DHVA 3QFJE 3QRGH 5B1JC 3FUFA 5BO0D 3S97C