1E5CA

Internal xylan binding domain from c. fimi xyn10a, r262g mutant
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
87
structure length
87
Chain Sequence
TGCSVTATRAEEWSDGFNVTYSVSGSSAWTVNLALNGSQTIQASWNANVTGSGSTRTVTPNGSGNTFGVTVMKNGSSTTPAATCAGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords XYLANASE D
publication title The Structural Basis for the Ligand Specificity of Family 2 Carbohydrate Binding Nodules
pubmed doi rcsb
source organism Cellulomonas fimi
total genus 10
structure length 87
sequence length 87
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1e5cA00
2RTTA 1QBBA 1C7SA 3NDZE 1EXHA 1HEHC 1E5BA 1XBDA 2XBDA 3NDYE 1E5CA 5DHDA 1QBAA 1EXGA 5DHEA 2CZNA 2CWRA 1HEJC 1C7TA
chains in the Genus database with same CATH superfamily
4G8GA 3ROLB 5DVMA 1RIHH 4ATTA 4H13C 2A9BA 4XH2B 5SWZE 3UJIH 5I71B 4JO3H 3BPCA 5ILTL 2EYSA 4E5XG 5F7DA 1OCWL 2VW4A 2D0FA 4QHLB 5F9DC 2G2NA 4P0DA 3CZUB 1M2VB 2QVKA 3OKDB 4KMQA 4PJ9C 4F7MB 1XH3A 5HI3C 2EIEA 2NNAB 4LMQE 4QR7A 2YARA 1SDDB 3VXUD 1YY9C 2W92A 3WD5H 1TZGL 2R2HA 1IFGA 1L5GA 3G6DL 1DQIA 2ZE0A 1R34A 4Z0XB 1A4CA 3MLWL 3V6FA 1B4JH 1MFNA 1JF5A 3FN3A 3OPZH 3EH1A 4X98B 3SBWA 1AGBB 1ZHNA 2HX7A 4BIKA 2FECI 4GKNA 5F3FA 3V4PB 4NRZA 4B9ZA 1SGKA 2PYEE 2Y25A 3PREA 3QUZA 5H35A 2F9BT 1E27A 1OF2B 5DO2D 5ANMB 3MRQB 2I69A 3QUYC 3MX0B 1B9ZA 3QUMB 3SKJH 3SDXB 4K8RH 3I9PA 2ZG3A 5DQDH 4AL8H 3QEQA 3X14B 2P5EB 4OD1L 2R0LH 1M7IA 5C09E 3AABA 1Z9OA 4I4WA 2ENPA 4FQXD 5DURB 5AALA 3WEXB 4HIXH 5D7EA 5CGMA 4OSUH 2XTLA 3DRQB 3QFJB 2NQ3A 1AGDA 1NGZA 3RVXC 2WWMD 4W68A 5I0XA 4NQCD 3UAEA 4N0UA 3WMQA 1LWHA 2RHEA 3DV6B 4HJGB 1IUZA 4R4NC 2VMEA 2XDHA 1IM3D 3FFCA 4NKMB 5HVGB 4NBZB 4PWIA 5E2WH 4QNPE 1JPGA 1MEXH 4E41D 3BUYA 4TTDC 4OJFH 2FX8L 4ZXBA 1ERNA 4F5CE 5C97A 5IFAH 2VCOA 3ARFD 2K7QA 1WIPA 3FQWA 2NNRA 3KVQA 1S78C 4FFYA 6PAZA 2OMXB 2OMUA 3QQ4A 4X8JB 3D85A 2VLJB 1UB5A 4H40A 4HX1A 4JDZA 4ZFOB 4OLZL 5HBBA 1PKQE 4M9OA 4O9HL 2ZYSA 1AMXA 4Z7NF 5ID1B 2VWEC 3WBDA 1RUMH 1S3RA 3MV8D 3S37H 3SGKC 5IHHA 1IEBA 4R8WH 1A2YA 5E51A 4Q2ZA 1AGEA 2KLRA 3EJJX 3KPSD 2PXYB 1KT2B 3HCVA 2IANB 1MRFH 2YBGA 3KS0J 1FZOA 5DD1H 4BHUA 3W5NA 2ZUXA 3DTUB 3JVGA 2CLRB 4AUJA 5K5YA 1P4IL 5HPOA 2Y2TA 2ZCLL 4PTTA 2BNRD 43C9A 3AG4B 1BLNB 2WSDA 3BX7C 1TVHB 5DDHB 4DQAA 4BUGA 3RWFB 1HKLL 3TO4A 4AGOA 4FNQA 1DBAL 2A73A 5TF0A 2WXGA 1IQWH 2VRKA 4HEPG 2CHZA 4MJHA 3CXDL 4UILH 1A9VA 3EJCA 4PRDA 1KN2L 2F5AH 4NHCL 2BP5M 1QSVA 3HI6H 1ZE3H 4H2AA 1FL6B 1YECH 5KYXB 1AZNA 3W39B 4H25B 3IAGC 1P4LA 4ELMB 3Q06A 3OR7B 3L3HA 4ONHA 3KHOA 1T5KA 5D7IB 1BD2E 4BUHA 5CP3H 5IG7A 4YN3A 2A0LC 3BVDB 2BCKA 3I50L 5IQNA 3KVDD 3N1FC 1WRFA 1A6UH 4I3SL 1DQMH 2VDOB 5TJWK 1SJEB 2WBJA 4X8XA 4HISA 5G4MA 2JB5L 4G7VL 2VLKA 3NAAL 4G8GB 3O6FA 2MCMA 4BZ1L 4D3CH 1FC1A 1PLGH 4WDIA 4TSAH 2EYSB 2GJJA 4YHIB 5F7DB 2VXTH 4JFWA 5BVJA 2XVLA 4LOUD 1YNTA 1XH3B 3C9NA 2X6CA 4B5ZA 5C07E 2NNCA 1D5IL 5E1HB 1YEGL 1G9HA 4B53A 4ORZC 4HPOL 1MIML 5HYJD 1L5GB 1UM6H 3AQXA 1BOGA 4QOKD 3KYKH 5G2NA 4LIQH 4DGVH 1A6VL 3IU4L 1JERA 5E9DE 3V6FB 1OZTG 1KXHA 3A6BL 3O0LA 2OL3L 1Q0EA 1QUPA 4GKNB 5CINL 1JD9A 1YUHA 4QJ5B 4KRPB 1WD8A 2P80A 2DTSA 3QUZB 5H35B 1M3JA 1TTFA 2VISA 3K6FA 3PAUA 3FONA 3TYGH 4NNYA 4PD4K 4X8GA 5L2KA 1QVOA 2NDFA 9CGTA 1TEGA 3FSZA 2BY2A 5GS0L 1FNLA 3QEQB 3N06B 4OLXH 5BW7C 2OP4L 1AQMA 1M7IB 1ORQA 4Y89A 3MRDA 3FCTA 1IC4L 3OXRA 4BKSC 2H0EA 5JO5B 4KO6A 1TTAA 3GKZA 4I4WB 2J73A 4UNVA 1F90L 2JCCA 3KPRE 2WP3O 4M5SA 4NP4L 3PNWA 4K7FB 4KQ4L 1QOKA 5TF1H 3BWAA 3BCDA 4APXA 3D06A 2LLNA 3KLHC 2FSDA 2Y5EA 5DK0B 4OGXH 3SPJA 2EIMB 1YEFH 1TQUA 2EO1A 4N0UB 1NSNH 4Z7VA 4X7SH 5C7ZA 4MXQD 1ACXA 5I71C 4OCSH 3MV9B 2J25A 2YBRB 2WP3T 2O6PA 4LPTA 2BVPA 2BIOA 4LMQI 1LTXA 2M1KA 1WUNT 1Z3RA 1JPGB 4O51A 3BUYB 5A2IH 2YXMA 4KKPA 4KVPA 3CFCL 4ZXBB 4HS3B 1JHLL 3S5YA 5DUBA 4WK2B 1BDYA 1FGVL 3VRIA 1ZXQA 1KCBA 1U3YA 3FQWB 5DJ8A 1ZT1B 2GJ6D 1UXLA 4LPYA 2OMUB 3QQ4B 1KBGH 3D85B 1GYCA 1UB5B 2RR3A 2DRUA 4YBQD 5EWIL 3K0WA 4HX1B 1QSFB 4LSRL 5A2LH 4R5XA 4XE0A 1FE8H 2WZPA 2PW2A 4JFHD 3O4OB 4RDQG 4LEOA 2HVJB 4PYHA 5ETUA 5C0RH 3HNVL 3EJQA 4V1DE 3H3PL 1MFAH 3P11H 4OI8A 4XMLH 5K39A 3UZVA 2WQXA 4RZCB 2HRHA 3QNFA 4N0RA 4WFGD 1IEBB 1KGXA 1UUNA 4Q2ZB 1AGEB 1AE6L 3QXWA 3L4WA 4JHVA 2QKIC 3RWCB 2AGJL 1FZOB 2UYLA 1KFGA 5L88L 3UTPE 1F6LL 2HUHA 4Q0XL 1KN4L 3HC4L 3GS0A 1FFTB 4KDWA 43C9B 5DHDA 1E42A 4QY8A 2F68X 2IBZX 2J6WA 2X89A 3VRLF 1URZA 3TO4B 4R26L 2A73B 2BSED 1NKOA 4Y5VA 4BK4A 1UOWA 3LRKA 2AFNA 3SJVE 1GGIL 1JWUA 1KJMA 1MHPL 1NAKH 1BIHA 2YD4A 3C08L 2N7BA 3IGAA 4PRDB 3VMNA 2EDBA 5B1CA 4KQ3L 1QSEA 3KXFA 3QIWA 3GB7A 3KJ6H 5ERWA 1P4LB 3PWVA 4ONHB 3L3HB 2FL5B 2Y2WA 4MVBC 5D7JA 1QO3A 5IG7B 3MYZA 1PG7L 2BCKB 3C60D 5H37G 3Q05A 2D2CC 3FPYA 4TQHA 5EZPA 2WBJB 2B0SL 2IAMD 4ZMAT 2ZP0T 3K1KC 2VLKB 5L4FA 1H6FA 1AZZC 1ZGLP 5D9SA 1NUGA 3B7YA 3CK0H 1G9EA 3SO5A 3SPCA 2PYFA 2WANA 1U8JA 3AGVA 2ZF9A 5JHLH 32C2B 5IEKA 3L4XA 3T8MA 1SEBA 4LCCA 5EIVA 4UNUA 1YNTB 4BA0A 1E5CA 5E1AA 1NCAL 1OB1A 1JBJA 3SGJC 3GBMH 2VLRE 2VR9A 4G6KL 4QXTA 1BOGB 4YQXH 5LXGL 2QVFB 4ZT1A 4MWFA 5CR8A 5F88A 4DK5A 2VDKB 4ADIA 4JO4L 4TNEA 4X7EC 4EIUA 4FRWA 3K81A 4P3CH 2ZOOA 2LFEA 1B4TA 3QZWG 4MJ5A 4Q6IA 2VXQH 3S0PA 4BK8A 5ALCH 2YD0A 5I1DA 3U7WL 5I73B 3FONB 2FHBA 2QSQA 2NY2B 2WV3A 3PDGA 4NNYB 5L2KB 5AW5B 2ODHA 2FHCA 3RX8A 1S5HA 3DVIA 2B1AL 2D3LA 1MOEA 3UTTE 3MRDB 2Y6TE 3FCTB 3OXRB 3UADA 2Y06L 4M1CD 1F1GA 1G0YR 2BSDA 2Q3XA 2W88A 2YRPA 1A6WL 4TQEH 2JCCB 3U0TB 3PNWB 1XL4A 5AOIA 1A9BA 2ZSVA 5AYUL 2XXMB 3BWAB 3G04B 1HK6A 4APXB 2VB5A 4DFHA 1IC5L 5ADPH 4RBPH 5LQBH 3S8FB 4AGLA 2W0KA 2EQDA 3WS3A 4Z7VB 3TA3D 4N2GA 4DEPB 1QZNA 3E3QC 3JWOC 1IGYA 5JOPE 4JGJA 4HU2A 3CNKA 2ZAHA 3P9MA 4X4MA 3HI5H 3S6CA 1CXKA 5DUBB 5EU6A 4M6ML 2NY5L 3OLIA 4XAKD 1DUYB 4XX1G 1YPZB 3MJGX 4GQ9L 1N9PA 1NM9A 5DJ8B 2FX9H 3IFNL 1ZVSB 3SBWC 4XP4H 4OJCA 1Z3GH 2PW2B 4MNQD 4JFXA 3S8WA 4KRPC 1BM3L 3SGEH 4GOSA 1KB9K 4LEOB 3QUZC 4JY5L 3U9PL 4DUVA 4YXLH 1NCCL 3UZVB 1U3ZA 1X5GA 5I1JL 3A21A 3W1ZA 3WU1A 3N3EA 1OGTB 1KYUA 3D69A 1HNGA 1MIEL 2AF2A 5HYEA 1VGEL 2O4EA 2R7EA 5F7YC 4ABWA 5I18H 4MMXA 4NN7B 1UADC 3DWTA 2RA1A 4MQ7A 1AI1H 3K72A 3RHWF 4XHJC 4LLYA 4EPSA 4JFFD 1IILE 4OBSA 3SYCA 3B4NA 2XIIA 5KG9A 3V0WH 3PGCA 3MV11 1U93B 1NZRA 4IOIA 4Y5VB 4G82A 3L3GB 4P46A 4ONGL 1OM3H 1NMBL 1JWUB 3IGAB 1KJMB 3IJHA 4PJ7F 3O4LA 1QSEB 5ANME 4LQ1A 3QIWB 3RJQB 2J88L 3F83A 3GB7B 3ZPDA 2VSMB 1LQSR 2XFXA 3PWVB 5ERWB 3SDXE 1HJBC 4XO4A 5AW8B 2CGZA 3OSVA 3ULVH 3C5JA 5D7JB 1QO3B 4AW4A 3BFOA 5D7LA 4K3GA 3QZLA 2OTPA 2ZYHA 3RU8L 2LU4A 5INDA 4TRPL 5FOBA 4Q8BA 1RUPH 1KCSL 1RUQL 2DBLH 5FWQA 1OY3B 1QASA 2AK4B 3QFJE 3IGLA 3O2VL 3QBTB 5F89B 2LGNA 4LAQH 3H7BA 3ULUE 3MTRA 5I5RA 2PYFB 5DHEA 1U8JB 5KVEL 2Y72A 3LKSB 2QQKL 4XNUH 1BXAA 4LCCB 4IRSC 3NJLA 4QMEA 4XMXA 5D72H 4EJ1C 4M1DH 1QYGH 3R7QA 3ABGA 4DAGL 5E1AB 2RACA 3EDDA 2Q20A 3ALWA 3QS3A 4A7GF 4X5LA 3RPBA 2HFGL 3BHBA 1U92A 2WXHA 4MWFB 1BW8A 3QIUD 1GOHA 2VLJE 3T3PF 4ZRGA 4CILA 2E56A 2J3SA 1N64H 1H3GA 2YAOA 3DI3B 4HHAB 4ES9A 4MJ5B 2HRLA 4M5YH 4Q6IB 1NL0L 2CM6A 1UCBL 1BEYH 5I1DB 5BQ7A 3EH2A 2WW8A 4XXCA 3LKQA 4B50A 3ES6A 1CD0A 4UT6L 4CBZA 1S5HB 2XWDA 5ICXA 1THAA 1A4KB 1TTBA 1XCWA 5I8OH 2VLLB 4YHOH 2IANE 4OD3H 5I66A 4NQEA 4HCGA 4HGMA 3GSNA 2QADB 4NBXB 3WN6A 3VE0A 2OMTA 1TMCB 1BG1A 2UZIL 1MCJA 3HB3C 5FYJU 4LLUA 1YYCA 1A9BB 1CICD 2ZSVB 3ILQC 1AYOA 1PW3A 3O45A 2WBJC 4FLRA 2MHAA 2V17H 1CXHA 1OE3A 3GC3A 3FQRA 1WWAX 5GGRY 4XBMA 1UQSB 1QW8A 4KC3B 1E8XA 1BJ1J 2MOVA 1MVFA 1GYVA 4U3CA 1HU8A 4PRAB 1IGYB 4XMUA 3C5ZA 3TOPA 1YEWA 3AROA 4C58B 5DVKA 1I82A 3QIBD 3P9MB 2F58L 1IAIH 5DK2A 1IKOP 5IESH 5HDBB 2HG5A 4ELME 3BZEA 1G1YA 3HE7A 2CQVA 3JV4A 1YJDL 4U3HA 3UGEA 2FD6L 4GSXA 3OAZH 4PG2A 3SE8H 1ZJBA 2HT3C 5CR1A 2IH3A 4WI2A 1TT6A 3L3KA 3N1GC 5HPMB 2Z31D 4DFIA 1AZVA 1TIUA 3FB5A 4G8GE 4IOSD 5TFSH 2X1PA 3BSZL 5F7FA 1FORH 3E3QE 3VFNA 3IFLH 4ZODA 5I73C 2NY2C 3GRWL 5LN8A 1ZTXL 3AT0A 3D69B 1BQHA 1QKZH 4YPJA 1FG2A 4XB3A 2DQMA 3ISRA 2K0RA 1NC4B 2R7EB 4Z7QB 7FABL 2FEEI 1FVCA 4MMXB 3C5XA 2DLFH 5B7FA 4WY7L 3TBVA 3WFDL 1S9YA 4PRBA 4A68A 3K72B 3TV3L 4YX2H 1J86A 4LLYB 4S1SH 3WOVA 5EZIH 5HGHA 2AMGA 3E8UH 4XCCH 4U1GB 3ARWA 5FW6A 3AS3A 3PGCB 3UBXA 3S3PA 3PCYA 4IOIB 3P0VH 4OJAA 5FECA 1LK2A 2YSSA 2X5PA 4KV5F 1OT1A 3IJHB 3MJ8B 4XVUC 5GRJL 3GXIA 1AZUA 4GRLB 4Z7WA 2GBVA 3AFLA 1HZKA 3BP5A 2XHNA 2YD9A 5FGCB 2X1QA 2FB4H 3TH2T 2XFXB 1UXMA 2F8VA 1I9JL 1MCOH 3V4VB 3CMOH 3QEQE 3C5JB 4ZTPL 1EDYA 1ZA3A 2XWZA 5EOCL 5D7LB 5GRWA 1K2DA 4GS7B 1AHKA 4R0LA 3HG1A 2A83A 5INDB 3ZKXB 3HUJF 1A65A 4ODUA 2BO0A 4B60A 5HDLA 3K2UL 1WP6A 2XXGA 4A7SA 3MLVL 4N0UE 4IRJD 5DC4B 5AB1A 2JF1A 3MV9E 4N86A 1FGNL 4A6YH 1LNUB 3HHMA 4P2QD 3CDZA 3CFIC 1GRWA 2ICWJ 2F0CA 3R1GL 1S9WA 2RIKA 1MZZA 3MA7A 4H8QA 2PO6A 1U6AL 3DC0A 3DECA 5E2VL 3VFSB 2NSQA 3DETC 4HUCA 4JKWA 2IPUK 3BHBB 4FP8H 3UG4A 1E8ZA 5I30H 1U92B 1PFCA 2ENSA 2P5PA 3ZIMA 4APQA 4HXAL 1I3RA 4L3AA 1QSFE 4AYGA 5EEUA 4WFFE 5F70A 4Y5VC 3QI9A 1RIUL 1LEGA 3N1QC 1I7ZA 4FLHA 4PJXA 2A9AA 4WFEE 5BRZD 1V7MH 1RMFL 5LB1A 5EZLA 5BQ7B 2Q8BL 4KKLD 1FUNA 4IBVA 3ES6B 3UBHA 3QIWC 1JTOA 4JVUA 4UWQB 5ICXB 3D39A 4NQSA 5D7JC 2B9AA 4NQEB 5HDOA 3GSNB 2ZIDA 2OMTB 3VE0B 3BH4A 2DL2A 2XN0A 1A4AA 4LLUB 3BFWA 1EXUA 3O45B 3H9SD 3QXUA 5B3JF 1DJXA 3EFDL 3MOAH 3OHMB 5C0GB 2IWEA 2E4TA 2C9XA 3QS2A 1BGXL 4EN3D 3LH2L 3TA4D 2H2SC 1X5FA 2WC7A 4WEBH 2AABH 2X3BA 5EUOF 4JPWL 3OMIB 3C5ZB 2Z3FA 4N8VA 4N6QA 4LCCC 3V8CA 1T1WA 4FFZA 2R0ZH 4FF9A 1HQRA 5DK2B 1ONQB 2IF7A 4G3YH 4RAUA 2HG5B 5DHXB 1BQKA 1LGVA 4DO6A 4TULH 3HE7B 4EXKA 2E86A 4PJ7A 4BRJA 4P3WA 3JV4B 1TTUA 5FHBL 2FIRT 1IL1A 5GGVL 3V95A 2GY5A 2Y1YA 1FZJA 1Z5HA 5GIRA 3SDAA 2P45B 2O5XH 3L3KB 3MA9L 5A2JH 4HJ0C 4LSQH 3BDBA 1CPUA 3FB5B 2VLKE 4Q6IC 1ZV9A 5H37H 2MOGA 2OW6A 2DW5A 2Z4QA 2NY1D 4GKZA 1MFEH 4AUYA 3TNNA 4FFVD 3QORA 3CBJB 1K6QH 1BQHB 1CU4L 4WWNA 3OAYK 4JR9L 2WXOA 2ZAGA 3FTVA 4L5FH 1FVCB 1CGXA 2AJUL 3BZFA 3Q7JA 3EJTA 3TBVB 1S9YB 2YKLL 4PRBB 3RAJL 2P3YA 2XQ0A 3O6LL 4Y1AA 1CXFA 5T3ZE 4OGAD 3EFOA 4BK5A 3UBXB 3O6KH 2QPDB 5FECB 4UQAA 2BP8A 3ARED 2Y22A 2YSSB 2WCGA 3IRZA 2Y7NA 5KWYC 4ZAKB 1A1MB 1U4EA 4WUUD 4Z7WB 2I7OA 4W9EC 3T1FA 1AXIB 3BP5B 3LOWA 3ZO9A 1F2QA 5L2KE 3DO7A 2EZ0C 2ZSWA 2VGLM 4AVJA 1CZ8L 2OR9L 4UM9D 1ZA3B 4UBDD 1K2DB 5EBLA 3K6IA 5ECJE 1U8LA 5BMFL 4R0LB 2OZNA 1WAAA 1F86A 1I1RA 2A83B 2JCCE 2VSKB 4GKLA 2BNUB 4ODUB 5CP3A 5IHZA 1KFAH 2A38A 3O41A 3S3DB 4QXUH 1XIWC 1PZAA 4FYRA 4Q9QH 3UDWC 2ID5A 1JVOA 4K23L 1BAFL 4Z7VE 3GINA 1BA9A 2MPAL 2XZAL 3GDCA 1I1AA 3CDZB 5J11B 2OK0L 5F72S 1L9OA 4BZ2L 4OQ1A 2XSKA 1AQHA 1S9WB 1G7QA 2PO6B 4KHTH 4MMXC 3FQ4A 1YPZE 3TT3H 4CMHC 5BZZA 1PL3A 3S34H 4K73A 1BM7A 1QFWI 3A67L 1BAWA 4UQ9A 1M7DA 4YSOA 1I3RB 4I9WD 4U1GC 3B9VA 3ARSA 3RWIA 3MRCB 4F80A 1LEGB 4QTIH 3PABB 4GSDH 4PJXB 1WLHA 5EULV 4PN6A 5EZLB 4GRLC 1VEMA 3QJSB 4PW3A 4ZUUB 1VEOA 1VLXA 4MMZA 1JCVA 3NDZE 4X5PA 5E4OA 4NX0A 1K5NA 2F18A 2FHFA 3D39B 4YE4L 5FYKU 3P3RA 4NQSB 3BUQA 4JPVL 4Z78A 3GEFA 4L9DA 2LHAA 1FIEA 5HVFB 4JB9H 1KB5A 4MAYA 3KS0H 3DMMA 5KN5A 1T5XB 2ZX9A 3ZKXC 3SQOH 1EXUB 4WW1A 4YK4B 1KWGA 5IEHA 2J5LC 4PRHD 5SX4I 5MEPA 1N6QH 4RGND 1PCSA 2JWYA 1G7HA 1BVKA 1E7VA 1GAFL 3AXHA 1PF3A 3IFPA 4WHYG 1BQLH 1KLGA 1FH2A 1I3GH 4UV4L 1UZ6F 1WSST 3RPIA 4PSRA 3F58L 1T1WB 1QSEE 5AVYB 2I60L 1HQRB 4RAUB 2R1YA 1MRDL 3LEVL 1E4WH 2BWIA 4OFDA 1WTGT 3N44B 3VXQA 4R96A 2C3XA 4TVPL 1CFNA 1NFAA 1PAMA 1JZ4A 1FZJB 2UZPA 1F97A 3BZDA 5F7AA 3JVFC 1H5BA 4YXHL 1NIAA 1Q1PA 2YN5A 2AK4E 1Q0XL 4OM1H 2GQHA 1NGPH 3LHPH 3BN9D 4EQ3A 1T7ZA 2Z4QB 4HW6A 1J12A 2YQGA 2B2XL 1SHSA 4GKZB 1AD0A 4FJZA 2YFNA 4OIIL 4XXCC 1SN2A 2MTAA 3TNNB 5IBUG 3EJPA 3ESUF 4OZFG 4BHUI 1FDLL 1U8IA 1FSKB 1RY7B 2BH0A 2V9RA 2FJFA 4Y8AA 3BZFB 4HALA 2FWUA 2QHLA 1P4BH 4AG4L 1DCLA 1EIBA 2YFOA 1EHLH 4Y1AB 3H0TA 4JZOA 3VM7A 4MD5A 4OFPA 4R7XA 5DJZB 5C2UB 5CLYA 2AJXH 1ASPA 2CGRL 1OP5K 1EO7A 3PV6A 2BP8B 1MHCB 4M7JH 4XPBH 1JGUL 4QHMB 1COBA 3K7UA 2QTVA 3B9KA 3NP4A 3T1FB 1YY8B 4EDXA 5DSCA 4NUJA 5IK3B 3HE7C 1FNSH 4JJHA 3T04D 1H0DB 1I9RL 3NCYS 1XL6A 4WWOA 1T1YA 5C71A 5EBLB 3TEZA 1U8LB 3IYLW 3DUSA 3N85H 4B9CA 3ZYJA 3NGBB 5IHZB 4XPTH 5KTEH 1U95A 1NGXA 4DUWA 4KK6D 3FO9A 4OCXH 3O41B 3T0BA 4AENB 2IC2A 3QEUA 4MNGA 3GHEH 1M42A 4LCWD 4EKXA 1CC3A 3B2VL 3CVHH 4CC4A 3A22A 2J2ZA 3F7LA 2FGWH 1EO5A 4TKWA 1I1AB 3CZKA 4L23A 4HIQA 4ZX4A 5AW2B 1NC2D 4PRID 5KUMA 3UTSB 4X4ME 1G7QB 4FQQA 4JQXA 5EUOA 5EU6E 5HDBE 3KW7A 3VFMA 2C7UA 1EWHA 2DQTH 1YEHL 4MJ2A 5I8KH 3OLDA 1T03H 3QG7L 1QRKA 4JM4L 4ILDA 4HU8A 1M7DB 3EIFA 4HSQA 4S1QH 1HINH 1TOXA 4XPGH 4D0BA 5SWZD 4XNYL 3BLPX 3RWIB 4C83A 4PP1D 4FE9A 2CUAA 4LL9A 5BO1H 6CGTA 5F0MB 1EMTH 3D48R 3BAKA 4JO2H 4MDJB 4ZAKC 4WNSA 4TNGA 2WB1A 4MMZB 4RETB 2XTSA 4PJ5D 4Q7DA 3KWTA 3OXSA 1IGIH 4PB9L 4X99A 3G5XA 4UT9L 1AAJA 2CKNA 2OM5A 2SEBA 3O6ML 1I85C 4Z7QE 4KXAA 3RA7H 1V7NH 3P3UA 8FABA 1TQTA 5FHAH 4RIRA 3DMMB 3KH3A 4AJ0A 3WKMH 4QRFA 4WW1B 2XETA 1R5IA 5CMAA 2PYED 1OWWA 1OP4A 4TUOB 3RDTC 1HZHL 5ALBL 5C86A 3MMEA 4KPHL 3Q8AA 5E23A 3FFOA 1BVKB 3VI4B 1QFOA 3IFPB 3Q0HA 1KLGB 3F8UB 4ZG1A 1QATA 2NTSP 2GUYA 4PJAF 1IKNA 1YQVL 1DANT 1U8OA 3RPIB 2VLME 3J2PA 4GBXA 3TCXA 2OKMA 3B37A 2MEJB 3DHUA 1EGJA 2IBZY 5FGCE 5B1KA 2R1YB 2PO6C 2XWXA 1X9QA 4WHTB 4M61A 1U3HA 5K9JL 1KF9B 3EOTH 5IBTH 3VXQB 4IRZL 4R96B 3VQ2C 1HKFA 4XMPH 5D7LE 4YHLL 3QQ3A 2A9NH 3QPXL 2HT2D 3QXDA 1DVFA 3UPAA 1H5BB 1OM9A 1HDMA 1L7TL 3MRMA 4UM8A 2FBJH 4J3TA 1NOLA 1CFVH 5GJSL 1AKJA 1N0XH 1WS8A 1WFTA 2ATKA 4R84A 2CR3A 4WKZA 3W0WA 1KV7A 5AL0A 1AD0B 3G7TA 3BXNA 3N1MC 1DLFH 3C09B 3QO1A 1W0VB 3ABKB 1DQQA 5K9KA 4TNVF 4QXVA 4ZFFA 5B4MD 5JORA 3NIDF 1E4XH 4K8RC 3TIDB 1RZ8A 3HKFA 2IDSA 4AL8C 1R5VA 1A6PA 3UMNA 3T2OA 4DQOH 3RLSA 3H0TB 4JZOB 3VFGL 1FPTH 3SYOA 3FW6A 3NDYE 1DBJL 4MD5B 1KJ3L 1FH5L 2GG1A 4GQZA 5GRUH 3RKDC 5IT2H 2ROYA 4AGMA 4N2NA 4Y0GA 4H1LG 3MCYA 3ZL4L 1FRGH 4KKAD 4AVIA 1KXVA 4GB9A 1A6ZA 1HT6A 3QNYA 3OHXA 1NGYA 5IQ7L 3B9KB 5B1JA 3HBZA 4LOVA 3O3EA 2X53A 1MW2A 4UB0H 4WTQA 4X9BA 4YHMH 4ZW8A 1MNNA 2X4QB 4UT7H 3MLPA 3MACL 5DSCB 5A40E 1XV8A 1E5YA 3L1OL 1S7SA 4NQEE 2WVTA 1KB3A 2D7NA 2XXCB 3FUIA 1VESA 3DUSB 4DVRH 3ZHLA 3FAXA 4WWKA 2DQCH 1DVZA 4AK2A 1NGXB 4NENA 3EGXB 2EE6A 3B6SB 3T6XA 3NFSH 3QEUB 4JAMA 4MNGB 2BIPA 2YN3A 3QZBA 4G9FD 3SKUD 2V9UA 5B8CA 2J2ZB 1TEFA 5JA9A 5J56B 5KBNC 3ZKSD 1HXYB 1J1PL 1JFQL 3KBEA 4P06A 4L3FA 4PLJD 3C6LD 4XODA 1BD2D 3GI8L 5GGUA 4FQQB 1IT9H 3WAKA 1BZOA 3Q6GH 5L6YL 3VFMB 1KIRA 2IDUA 4UNIA 2C7UB 4Q58C 2HJKA 5C6PB 2WYTA 3IJYB 3OZLA 4G11A 3ZMRA 5JHMA 2IWGA 1OTTD 4D0BB 2ADFL 4GP5B 1FIGL 3B9EA 4L1BA 4M5TA 4JFDB 4XWOD 3KHQA 1EANA 3MN8A 3F5WA 4XO8A 1IQDA 3QRGH 2GIXA 4W4OA 3WSQH 35C8L 4X99B 3G5XB 3GSUA 1TYJA 1DJYA 2SEBB 1TITA 5HJDA 2FDBP 2IBGA 5J6SA 8FABB 4ANXA 1H19A 1QP1A 5E9DD 2B1OA 4RIRB 2FJUB 4PRPA 4DW2L 1AHWB 3NGBC 1R5IB 3V4UH 5CNHA 5CMAB 4QTHA 1PIFA 1CLYH 2H6PA 2HSIA 2FRGP 2ATPB 1IAOA 1P6AB 2AVGA 2VZVA 1VACA 2G9KA 3QARA 4NERA 3EYUH 3UIYA 1MI5D 1I1AC 4GQQA 1ZV5A 1U8OB 4PJ9D 1RUAL 3QUHA 4Z7WE 2G5BA 1AJ7L 5HI3D 3PLYA 4ZMLA 2BHFA 3TTSA 3AY4C 4PREA 3V0HA 1YY9D 4M61B 1U3HB 3KPRD 1IGJB 4AYFA 1G6RH 4NC1C 4CW1B 5GQBA 1CFBA 4HEPA 5FFGA 1HCYA 2LT9A 1EAJA 1ZA6A 3QQ3B 2FVNA 2AJSL 2G0LA 1DVFB 3QXDB 4LPXA 4A37A 4CMMA 1SXSA 2L04A 3VG0H 4GAAA 3MRMB 4B9PA 3W82A 1CTMA 5I19H 2BVEA 2H6OA 1CK0H 1AKJB 3MUGA 1J18A 1TCMA 2ATKB 4WKZB 3W0WB 2XVGA 3NJVA 3MRIA 1GW6A 3EYSL 3CLEH 3QUYD 2GABA 1JWMA 4MMZC 1MCWM 5DS1A 3RY4A 3BXNB 3UEZA 3A47A 5HI5C 2WQ8A 2VZ3A 1DQQB 1QI5A 5K9KB 3LS4L 4EE2A 3T0EA 4K0OA 4JW3A 1MWAA 1YC7A 1I8UA 3GM8A 4QXGH 3Q5OA 5JORB 1RZ8B 3MJ9L 2ESVA 3GT6A 1JOIA 4DO4A 4OFKA 3DMMC 3MGOA 4URTB 5IHUL 4E5XB 1FP5A 2Q7AA 4OLEA 5EPMB 1CVRA 3RVXD 3TP4A 1NOAA 2FYYA 4GXVL 4V1DD 1KJ2H 3HAEG 2FUQA 4R4ND 3HZKA 1OAQL 4M9PA 4PJXE 3TN0A 1Y6NR 4HKBA 4TSBL 4UQ3A 1A6ZB 4ZX3A 3QNYB 5DTFB 3OHXB 2BSRA 1NGYB 4KRNA 4TTDD 4KUZL 2ARWA 4G9DA 3NCJL 2WK2A 5EU4A 5DC0A 1KEGH 3UTPD 3D39E 5CZVL 4YDJB 1HH6A 4U6XA 1S78D 1JNNH 1S7SB 2A1WH 3K74B 4OV6F 1VCAA 2DYSB 2ZCKL 4W6YB 4LSTH 4WWKB 1H5BC 3ECBA 2YOCA 1IC7H 1KXQA 2EILB 2BZDA 3ETTA 4LDCA 2MWCA 3DX9A 4NM4L 4KROB 3T1WA 1TKWB 3SJVD 4JAMB 1CBVL 2AQ1A 5JQ6L 5B8CB 1B2WH 3U0PA 4UQ2B 5IOPB 1AH1A 3IDXH 1WVZA 2OV0A 3U6XA 5IVNA 2BHYA 4L0PB 4P8QA 3C09C 5FW8A 4WHYH 3P4OA 5GGUB 5C7XL 5TQ2H 2WKOA 2YPVL 4PJHF 1RULL 2HJKB 4YGVA 3ZBMA 4I1RA 4NQDA 5IQMA 2A77H 4FQJH 3C8DA 3L54A 4HULB 4B27A 2R69L 1OAJA 2QQNL 1DL7H 1LO2H 3L5IA 4AM0Q 5MEQA 2FZ3A 5ILTH 3MI6A 25C8L 2ZUSA 2XJKA 2JH2A 3VXPA 2JSFA 2OSYA 2M83A 3F5WB 3S98A 5IMMB 1G7MA 1IQDB 3B9KC 3N41F 2VSCA 4BFJA 4HG4K 4OAWA 3F7KA 2EVJA 3SY6A 3GSUB 4ZYKA 1KYDA 1NUDA 1TZGH 2VLRD 5IMKA 4HLEA 3V6ZA 1VADA 2A0LD 2FLRT 2QEJA 1QNZL 3MLWH 3ARBB 4LVNB 4PRPB 1XFPA 1WBZB 3KL0A 4OUOA 4Y1AE 3RI5K 4QTHB 2H6PB 2VTFA 1DANU 3ABLB 5IB3A 2ZXWB 2QPUA 2BJML 4J28A 1AQDA 4HWNA 4L1LA 3B2XA 4NQVA 4X9HA 2OCCB 2G5BB 3E8VA 4OD1H 3UTTD 3AJ7A 1ZXKA 2X88A 3Q6FA 4PREB 4XCYA 3VVVA 3S37X 3GSOA 2BOCA 4RNRA 4AYFB 2HKFL 2MKWA 3FTGA 4Y9GA 3QJOA 2LAAA 4HUKB 4OCWL 3WNKA 4MB5A 3FTUA 1E6JL 4BWWA 1WAAE 4XPHL 2EC9T 4RISH 1JYWA 3MNZA 4L3CA 1NFDB 5LBGA 4P04A 5JOPD 4XN2A 3FB7A 3MUGB 3GHBL 3QPKA 3B1UA 3ESOA 3MJWA 2P8LA 3MRIB 2DMCA 1JWMB 1WDAA 2FX8H 5FGBC 2QELA 1ADQA 2XN2A 3WJJC 4NUQA 3V9CA 3UTSE 2F1BA 3T0EB 4BGLA 1MWAB 5FYJL 4QHKI 3ELQA 4NC1E 2G9HB 3O9WA 5K1VA 2BDNL 5IFJB 4I13B 3MGOB 5CLZA 3V6BR 4JHWL 1AHWC 3LPOA 4OLZH 3UBXI 3UYPA 2GITA 2YD6A 3KLHD 4O9HH 2L7EA 1REIA 1UZ8A 4TQ8A 3TBCA 4KBPA 3VYNA 4R3SB 5JR1L 2X4SA 3U25A 4DN4L 5I6OA 3HZKB 3VD2A 3TN0B 4ANVA 3C8KA 4HKBB 4UQ3B 2CKBL 4HZAA 4QRRB 5EU3A 2BSRB 4CVUA 1TZOA 4K2UL 2QKSA 2Z35B 4G9DB 1DJGA 1OARL 3S97C 5EU4B 5TE6L 2WZAA 3CFJA 1P4IH 1U3HC 2EE9A 1HH6B 1RP9A 2ZCLH 4U6XB 5B22A 1IVTA 4ES8A 5AD0A 3EW3B 4EUPG 1MFDL 3RTQC 3O3DA 3TEYA 3E9TA 1DVFC 1BQSA 1J1OL 1HKLH 4RAVA 1DBAH 3ECBB 3FRPG 1U58A 1ET8A 4I87A 4K3DL 3DX9B 5EFIA 1TYEB 3CXDH 4J2XA 5FS5A 1S9XA 1F3JA 3MV7A 3Q01A 4MQXC 1OEZW 4NHCH 3KJ4B 4XBGA 3VI4E 4N1CA 4AITA 3SKOA 1NANH 2NLJA 3GTNA 3U0PB 1ASQA 1MG3C 2WUBL 4G1MA 3V6OA 5FPIA 1H8OA 1YN6A 4J3OD 3WIAA 3FSAA 1R9FA 1LK3L 4ELDA 2P5ED 4BJLA 5JPNA 1KBKA 3P4OB 1GL4B 1L7IL 4A6YB 3QHZL 3ZGIA 3I50H 5DURD 3FQUA 2CUIA 5EA0L 3PAYA 1SJHA 1UASA 5MP6L 4ACPA 4YGVB 5EBMA 3W37A 4I3SH 5TK2A 3QFJD 1EEZA 1NBZA 3PP4L 1W91A 2PCFB 4G7VH 4NCC1 1TFPA 3NAAH 3GMMA 4WO4A 2NXZB 3F7RA 3HKZA 4BSJA 3DPBA 1SJXA 4BZ1H 2TRHA 4LKXA 1OAUL 5MEQB 3WY2A 2FZ3B 4DK3A 2K6ZA 5AOKA 3EXJA 3BAYA 3VXPB 1X9RA 2VDRB 1G7MB 3OHXC 4WI9A 1QRNA 3RE0A 3D2UA 4Z3EA 3WY4A 2K1MA 5B1JC 5JXEA 3S96A 4OAWB 1TZAA 1D5IH 3HNSL 3OKKB 5GGTA 1XBDA 1YEGH 2Q3AA 2X6VA 3LXBA 4HPOH 1MIMH 4MVBD 3V6ZB 1VADB 5E8NA 3WE6A 2D7OA 1A6VH 3IU4H 2VLJD 3MLXL 2N0MA 3ULVC 5C2BH 3A6BH 4HCIA 2OL3H 5CINH 3CIAA 1JPSH 3BOVA 4KROC 5FB8A 3N0PB 2F8IA 5IB3B 4ENZA 2E6PA 1DE4A 1AQDB 5T5FL 4NQVB 5D93B 5GS0H 2GBUA 2PXYD 2IAND 5J6GB 3Q6FB 1IC4H 4H1LH 4XCYB 1JWSA 2BK8A 3GSOB 1EO8H 2AJVL 2BOCB 4RNRB 2YA0A 1F90H 2CRYA 4Y4FB 5FA4A 3AXIA 3FTGB 3ABMB 3HZ3A 4KQ4H 4ALAL 4WI8A 2WN3A 2CK0L 4HMCA 4G71B 3ZE0B 4P9HL 2CALA 3MNZB 2YKKA 1ZLWK 4L3CB 1KXTA 3VXUA 4M02A 3PY9A 4IKNA 1T89A 2G5UA 4NLAA 2R2EA 2J71A 4MNGE 3FB7B 3EADA 4G7YL 4ZFQA 2WVSA 3ATFA 5IWLA 1QPKA 1TNNA 3RX9A 2P8LB 2RAMA 4IK7A 5E95B 4H0GA 3CFCH 5B3JE 1G7PA 2ZXQA 1JHLH 3GXUB 3OC5A 3BD5A 1FGVH 1U2HA 4YJZL 4A2LA 1KBWA 2F19L 4ENEC 3RY6C 1WCBA 3NJXA 2ZZUT 4TPRL 2KL6A 5FYLL 4IBSA 3ARBC 4LVNC 3O9WB 2EDNA 2X38A 4M3HA 5EWIH 1JN6A 3S36L 4TQPA 4LSRH 1R3LB 2Y36L 3UYPB 1UFUA 2GITB 3K4ZA 4LB8A 1LMKA 4PGZA 4WI4A 4Y4HB 4HAKA 1UZ8B 3I9IA 3HNVH 3RHWK 1O5DT 4Y88A 3H3PH 1XGQB 4G7QB 3ZDZB 2ED7A 2PN5A 3PWUA 2XWJA 4JFDE 4R97B 4OZIF 3C8KB 2EVHA 3PXLA 1S9VA 4JANA 5EV7A 5EU3B 1GA2A 1AE6H 4PCSA 3REVA 2P48B 1UKSA 5TTRA 2AGJH 5IREA 1O7SA 3CFJB 4WTXA 4N87A 5L88H 2PPFA 3DJSA 2XIBA 1KN4H 3QZWB 4HKXA 2E46A 4Q0XH 3HC4H 3ZKNC 5AD0B 2R29H 1GGBL 3BCFA 1M6OA 3B8YA 3O3DB 4GI6A 1E9PA 4YGAB 3WFHB 4CN4A 5A2KH 4RAVB 4R26H 5F9WB 1BF5A 4FXKA 3RX5A 1U58B 2I9TA 3WKPA 4KRPD 1U36A 2WLZA 5EFIB 2CRMA 3QUZD 2WB7A 1XF2A 4J27A 1RURL 1S9XB 1MHPH 3BPOC 3B56A 3C08H 3MV7B 5DRWA 1M3IA 4XBGB 2X6UA 3HTLX 2ZXEB 3B2DC 2NLJB 4F7PA 4JE4B 3MRLA 4KQ3H 2CCLA 5SX5K 3N2JA 5HHNA 2XKNA 3B3BA 4XVSL 4M7LL 2XZCL 3QEQD 1J0IA 2WYHA 4MBOA 4U3SA 3DX8A 3T0EC 2W1NA 1F1DA 1PG7H 3STZB 3GGWB 3MV8A 2IDCA 3FQUB 2ZNXA 3BP4B 4F2MB 1SJHB 4XHJD 5KW9L 3AM8A 2WOBA 5EBMB 4HUUA 2C9PA 2I25N 1EEZB 1NBZB 3T0VA 1MHHA 1T0MB 4LO9A 3GMMB 3KPSA 4ONFL 4WO4B 1GJIA 2YHGA 5KYYA 5GZOA 3DPBB 4F24A 3BC9A 2X9ZA 2X2HA 3MV9D 2XZZA 3G3LA 3UJTL 1ZSHA 3TN0C 5JHDA 5E2UL 2BNRA 3T3MF 4K55A 1B9KA 1URIA 2FNWA 3W0WE 1UT9A 1QRNB 4FMKA 3D2UB 2VN5A 2VKXA 4ZXBD 2FJSA 3S96B 4L18A 1NCAH 1SQMA 2XOTA 2R9HC 3TZVC 5CZXC 1I75A 3NCCB 4G6KH 1SOQA 5E8NB 3WE6B 3VSUA 5LXGH 1PG7W 1IFHH 5L0QC 3D85D 3LMJL 4JO4H 3UG5A 4BQ6A 1ILSA 1QSFD 2YA1A 4WFFD 3H85A 1ZLUH 4YO0A 5CBEB 4WW2C 2X6AA 4WFED 3DOSA 5D1XA 3SDDA 1DCEA 2ADIA 3KJ4C 5F7MC 3U7WH 1DE4B 2YS4A 5KAQF 3ZHNA 2FQEA 4KY1L 3WHE1 4MFHA 4NAMA 4WAFA 2B1AH 5J9PA 3HAEH 1D5XB 1UCTA 3R4RA 1PEWA 4E9QA 2F6AA 1JWSB 2Y06H 1I7TB 1A6WH 3D6GA 3MAWA 2EC9U 1Q1JL 2FWSA 1E2VA 5AYUH 1ITBB 3WN5A 1XMWA 3BE1L 1TZIA 2V7HA 3SGDH 1IGML 2EEDA 3TO4D 5AVRB 2BW5A 1PNDA 4HC1A 3DIDA 4PLKC 3VXUB 1KGYE 2DMGA 3MXVL 3QJTB 2R2EB 3GZQA 1MAJA 3BVTA 3QW9A 5LNEA 5PCYA 5HYJA 3VDBA 4OCRL 4PJBA 1TVBB 4JFPB 4GFTB 3RIFK 3ZDYF 4NBYB 3BVWA 5FYKL 1G7PB 3Q8BA 2J55A 4L29A 3ZMNA 5A6IA 4M6MH 2NY5H 3H4HA 3N40P 4LSPL 2VDMB 4GQ9H 3TBTA 1WCBB 4MA3A 1KC5L 4J3BA 3QYMA 1YYML 3IMTA 4I9XA 1J8SA 3HB3D 3SOBH 1QQDA 1MCRA 1UZ6E 1JN6B 3ILQD 3G9VA 3TIEA 4J4PC 3DHJA 2WBJD 1BM3H 2VLKD 2D9QB 1IIIA 3UO1L 5A7EA 3RGHA 4A67A 4JY5H 2IEPA 3U9PH 3TFKC 4OFIA 1NCCH 2EXSA 1ZT7B 3PWUB 3IWVA 2P42B 2XWJB 4JDVA 5F6IC 2CE6A 1LEKA 3FQ2A 4BFBD 5CLWA 5I1JH 4JANB 3RPKA 4JJOA 3ZR5A 2YGNA 1MIEH 1ZLVK 3REVB 1TTCA 4LPVA 1JXDA 2VQ1A 3WTWA 1VGEH 1WFUA 1F6FB 3MXWL 4QRTB 5J1SC 1O9WA 2MPVA 4Y4FC 1T1ZB 5IJVA 1EFXA 3FZUC 3NJJA 1MCPL 4BUQA 5A7BA 5T3ZD 4E36A 2O93L 2HT3D 1M6OB 1PCXA 3D4ZA 2CLVB 3GBLA 4F7TB 2XUWA 1B0GA 4PRPE 4FXKB 3W38A 3D08A 5BJTA 4H20L 2P24B 3K46A 4ONGH 1XF2B 1NMBH 3MREB 4HWBH 3VG9B 5DRWB 3HI1A 2EJ1A 4FZEL 2GJ6A 4F7PB 1BP3B 3MRLB 2NY2D 2W94A 5L2KD 5HHNB 2XKNB 4NAQA 4XVTL 3TJPA 2J88H 5D2NA 1VFBB 4YZWA 4L4JA 4N0FA 4U3SB 5KBDA 4MJIB 3DX8B 1WT5A 3MV8B 3RU8H 1BFTA 3FB6A 3NCWA 4PP2A 4TRPH 3NA9H 4HUUB 4WLCA 1KCSH 1RUQH 5E7FA 4ZO7A 2GTZA 3O2VH 1MHHB 3U6XS 4Y4HC 2PETA 4AV4A 3PWJB 1ET5A 3SYQA 2UX6A 3CDCA 5KYYB 4I3RL 4B9IA 3RGVA 4K94L 1NFDE 1PQZA 4PY8J 3FRUA 5I6KA 1QABA 1QHQA 1YLBB 5EO0A 5AW9B 5JHDB 4R97C 2GB2A 2BNRB 4XVUD 2VDLL 3DOIA 2QQKH 1UXSA 2WXJA 5I1CL 4YUEL 4DAGH 1Y18A 4N24A 1D7CA 4LDLB 1SJVA 1AMYA 2E6QA 5EO9A 4ZMPA 2X4UA 3EYOA 2HFGH 3T0EE 4KX7A 4I5BA 5DZNA 1WGVA 3PV7A 4M8QA 4X2UA 4QUOA 4JVPA 5KS9B 5JW5B 4LARL 1DVYA 2WZPD 4BH8A 3DRTB 2Z6FA 1AG0A 4YO0B 5LJYH 5EF1A 5IKCB 1NL0H 2N7AA 3VXTA 4P2AA 2ODIA 5D1XB 4P9ML 3SDDB 2ADIB 4ZMQA 1KCKA 3C60A 3HPJA 3L9EA 4PI0A 4AQ1C 1E2ZA 4UT6H 3V6OC 2CU9A 4MSWA 3OC8A 1UEMA 1ED3A 4QRRE 5J9PB 3GYRA 3AU1A 2EE3A 2GFBB 4YHPB 4CVZA 4P07A 4S1RL 4DP8X 3DETD 3TNMB 2UZIH 2D4DA 3WN5B 2X89D 2Y0SA 2NXYB 3LQMA 5DCCA 1DQKA 4NFDA 5LNGA 4BYHA 3O2DA 4G8AC 5IFAL 3C5SA 2YD7A 3SGEI 4ZX6A 2PCXA 4Z7IA 1FNHA 2B3IA 3PHAA 4PJBB 5E8OA 3MUUA 1QSED 2F58H 2IJ0C 3MROA 3QIWD 5JXEC 4QKTA 5B39A 4OV5A 4L29B 1KWKA 1E4KC 1VA9A 2D8KA 3LIZL 5D7JD 2AJ3A 4MA3B 3D30A 1RUML 1YJDH 4JFQB 2FD6H 3Q2CA 1QQDB 4S10A 4WUKL 3KWUA 4JZJA 3TIEB 1NAML 4CBPA 2AK4D 4NQDE 1MCQA 3L3OB 4OQTA 4X6DA 5ISZA 4A2FA 3BSZH 4NFBA 1WWWX 2H2SD 3GXNA 1DZ0A 4RBPK 2CLZA 1F5WA 1ZTXH 1JVKA 3GRWH 3UC2A 3IMUA 5E6IB 4YZFF 1ECZA 5CJOL 3BKYL 5EBGA 3UGXA 1IM9A 7FABH 3DO4A 3TA3A 4HCRH 4M7ZB 1PZ5B 1U91A 3WFDH 5IJVB 1EFXB 1CQKA 4JFVA 3TV3H 3RBGA 3BGMA 2DH3A 2APVA 1EZVX 2QPFA 2WOYA 4AWJC 5CXPA 5AZ2L 4H8UA 1B0GB 4HJ0D 5FEBA 2J1XA 3NIDE 1T89C 1W72L 3VGHA 5J3HD 2B14A 3QUGA 3HI1B 1LL1A 5IWLC 2J56A 5GRJH 3W57A 4JM0A 4URKA 5I0VA 4MDIA 1OTUC 5D2NB 5DK3A 1OOWA 4N0FB 1XF1A 1MFMA 2YGVA 1BBJB 4ZTPH 5CCKL 5EOCH 5KSBF 1PY0A 4J3XA 5AVZB 4B3EA 1ZK5A 1EJFA 5I8CA 1AIFA 4PP2B 4X5RA 3G5YB 3K8KA 4FAAB 2HWZH 4NO3A 2GTZB 1KGCE 3KGTA 2ZUVA 4F8QA 1YNKL 2NY6B 5IHWA 3MLVH 3RGVB 3VD4A 1PQZB 2HLEB 3P4LA 1QBAA 1R0AL 3FRUB 1FGNH 3DX3A 3FDWA 3I75B 1D5BA 5DC2A 4QGTA 4EEEA 1UXSB 1S7VA 4JFFA 3BDXA 3X13A 5I16A 3DGCR 4EIGB 2WHVA 3R1GH 4QT5A 3OZKA 4QI3A 1U6AH 1JGVH 1MRCL 2EXTA 3A3YB 5K59F 3LZNA 1KIUB 4CSSA 4YFLF 5D96B 5KVGE 1SDYA 1ITCA 2H47C 4M8QB 5CEXB 1SYVA 4HXAH 4LCVA 3U7YL 3IMSA 4FXKC 4BH8B 4L5FE 4OZFA 1H6UA 1TQCB 5B3NA 4OLXL 1RIUH 1RSFA 4K3JL 1XIWD 3VXTB 4Z3IA 1B0RA 3JBG7 1QD0A 1RMFH 3V0IA 3ZDZE 2Q8BH 3HPJB 2EO9A 4XP5L 3U48A 2B4CL 2IOOA 2YUVA 1G1OA 3ZZSA 3GLZA 1HYSC 1NEZG 2Y7LA 4CKQA 1NC4D 2PPAA 3FK3A 1UD2A 4CVZB 5D7KD 4XP1L 2F1EA 2KDGA 4X7SL 5DJ2A 2ALWA 3SQRA 2ICCA 4FEIA 2DQHL 3CC5B 1QUNA 2J57A 4GRMA 3EFDH 3EUUA 1JK9A 1BGXH 2AAVA 3DJ9A 3OB0H 1C8QA 4L48A 5GZOC 3C5SB 3LH2H 5LBSL 2DL9A 4JPWH 4B7IA 3BWUC 4D8OA 3MV7E 2VLMD 4GRLD 4JFTA 5E8OB 3QIUA 2ZWZA 3F6IA 3DTXA 3MROB 4N2CA 3ELAT 3T6ZA 1GYWA 3V6OE 3VMOA 3ZDXF 4KITB 4OV5B 3LY6A 2LTQC 2O26U 1DHKA 3ZOAA 1OP9A 5DS2A 1WZAA 5F7UA 2J12B 3TBWA 5FHBH 2OSWA 5GGVH 2OMVA 4XMLL 1W16A 4F2ME 3MA9H 2EXYC 5J57B 4JZJB 3FMGL 5D7SL 3TJEL 5BVPL 3TH4T 3VWJB 4X6DB 5ISZB 2GBAA 1XF3A 4KO5A 4WJKB 3OMZA 4F57L 5D1XC 3SDDC 1LJMA 2X4RA 4MZRA 5E6YA 2CLZB 3CSYA 4XX1E 2AEQL 3OKOA 1J5OL 2I5YL 3NRPA 2H9GA 1CU4H 4I0CC 4ELKA 4KUCD 1QRNE 1P9MA 4JR9H 3F2LA 4P5MA 4RFEA 1IM9B 1BFOB 3Q48A 2AJUH 1SY6A 4G42A 3FT0A 1U91B 1DBBL 3BGMB 2XCMC 2H41A 3O6LH 1DFBL 5PAZA 4KI5C 1SFDA 3SPHA 3HZVB 2NXYC 1R46A 2XV3A 2X7LA 2W8CA 4MCZA 5D6DA 2B7DT 5GS2D 3VI3F 3TH3T 4N25A 1MCNA 5A6MA 3QA3A 3BVUA 3I6GA 3H54A 1JMZA 3APDA 3ZE1B 4CN6A 1N70A 4MDIB 1O6SA 3EAKA 4F8PA 1DVQA 1EJ6A 3SKMB 1AGCB 1UZGA 5ANHA 1CZ8H 2OR9H 4YLCA 3C2AL 4C4BA 4E42A 4IOSA 2X1OA 1JFHA 5EOQL 1UD6A 5BMFH 5IJDC 2MQGA 2AI0H 3QISA 4X0NA 1FNGA 1AIFB 2NYYC 3BSGA 3EDFA 5DA0B 4NO3B 3TF4A 4Q9RL 2RTTA 2HYMA 3L3OC 4KJYA 1XEDA 2A9ML 4HDIA 3E80A 4MMYA 4K23H 4PJDF 1BAFH 4YR6A 3VXUE 1IFRA 5FLVA 2MPAH 4MB1A 5CEZL 1T7VA 2XZAH 3C5ZD 5CU9A 1D5BB 5DGRA 2OK0H 4JFFB 1S7VB 2GJRA 5E6IC 3FO1B 3X13B 2I9LA 2PWHA 4L3EB 4BZ2H 3TCTA 3HLAA 4QT5B 1KTDA 1A5FL 1IGTA 2QQQA 4WKXA 5AVWB 5AYQA 1X5KA 3HE7D 5KYWA 3QJFB 3ZDYB 5E4AA 4PJ8A 2MOQA 5IBLC 4Z23A 2XPGA 3A67H 1MCFA 3SDYL 3NEXA 3NZSA 1SLXA 2OYPA 1BF8A 2YIHA 4UDUA 4BQ8A 4Y19A 2IGFL 4OZFB 5H94B 2AC0A 5GZNA 1UXWA 3U36A 2AEPL 1B0RB 3DSFL 4O02L 1Q8MA 5A2AA 4WHCA 1KY6A 3NJNA 4OZHB 1YRKA 3GLAA 3PWLA 5D2NC 1ZGLB 3T77A 4YE4H 3D9AL 4JPVH 3VXNB 1UJ3A 2JQZA 1YEJL 3II3A 5DJ2B 3VXRA 5I0ZA 4MCYA 4MD0A 2EACA 3IS0X 4LP4A 3V5DA 3DYPA 3QC5X 1QWNA 4P2QA 1EAQA 2NUPA 4ZS7L 2DM4A 2ZG2A 2DQ6A 2MSPA 4W1TA 2PF6A 1DQLL 4GRMB 3LDBC 4H8WC 1B0IA 3SBRA 2CHDA 1JK9B 2NY6C 2XWEA 3MODL 1GAFH 4OH2A 2ZWYA 1SM3L 5DZAA 1YEIL 4NI3A 2EYRB 1LYQA 3GIVA 4UV4H 5D71L 3O3BA 4ZAKD 1XO8A 3JUYA 4ATWA 4CADA 3SDCC 1ET7A 3QIUB 3VGAB 4EOWL 2WCPA 4AK1A 2I60H 5F0LB 4HEMA 3PUUA 1MRDH 2LW3A 2ADJA 2ZD0A 2B1HL 3LEVH 4ZUSA 3JWDL 1NFIA 1S7RA 1OGAA 4TVPH 4ABUA 3F7VA 4XAWL 5E03A 5D96C 3TBWB 3MV8E 2OMVB 3KPNA 4OU3A 1IVLA 2YAPA 2DQEL 4YXHH 1T1XA 5KSBA 1Q0XH 3DUUA 1TQCC 4IDJL 3RDTD 3MUY1 1F6AA 2VM4A 1XF3B 3HJEA 3ZO0A 1QMUA 4FXGB 5CF3A 2DQGL 2B2XH 2DICA 2X4RB 2VDPL 1JZ6A 3UERA 4OIIH 3ARGC 1ORSA 3CSYB 4QKXB 5JHDE 1U3NA 5IVOA 2BNRE 3BO8A 2H9GB 4I7ZC 1FDLH 4DZ8A 1A1OA 4ELKB 4Q4EA 5D1ZB 1N12A 3TVMA 3W81A 3N6YA 2PO6D 4P5MB 4RFEB 3RUGF 4NIYE 4A04A 2H1XA 1GC1H 4AG4H 2WXFA 1E67A 1W6WA 6PCYA 5C0AA 5KS9E 4YDIL 2CO6A 2X7LB 5EHFA 3DGGA 4DKFL 2CGRH 3CFKA 2GTWA 3QWOA 2B16A 1OXYA 4N2EA 2P52A 2O61A 3QA3B 1JGUH 3EOYG 3I6GB 3KPLA 4MXWL 2DQUL 1WBXA 4MXVE 5D1XE 4ETYA 3ULUL 3B83A 1IAKB 1O6SB 2DIAA 4FXTA 1QI4A 2N1KA 2Y24A 4KO7A 4UTBL 3D39D 4ZMZA 2GIYA 3AXLA 1ANUA 4X6EA 5CCJA 4E42B 1I9RH 1D9KA 5F0JB 4K8RD 3F85A 2R23A 5C0IB 2VJ0A 1GJWA 4R7NA 1QI3A 4FGMA 2VXVH 3BSHA 1HIML 4ZUTA 3JZ7A 4GJTB 4JZJC 4GAJL 1DBKL 4KI5E 3ECUA 5HY9A 3VWJC 4KJYB 1UGNA 2BVOA 4HDIB 3UH8A 3RKDD 1KNOA 3PP3H 3QB7C 4KXDA 4PWHA 4FL4B 2HLAA 2QPEB 3B2VH 4YSDA 4ZFOL 2XQYA 2BSSA 4NAJA 3IJ9A 5TE4L 1KCLA 3IRCA 4D9LL 3GXMA 5HYJE 4FXLA 5CKAA 2XICA 1BBDH 1MSPA 2P46B 3P1VA 4WU5A 4PJBE 5FAAA 2ZKWA 2GVYA 5ESVA 1KTDB 1IGTB 4MASA 4F2FA 1TJMA 1ZTMA 4LHUG 4YMPA 2BNQA 3ZIYA 3CC1A 3ZTCC 1THCA 3AREA 5SV3A 3VRJB 2V0AA 4PJ8B 1YEHH 1QACA 2AMUA 2J7LA 3APCA 4GW5A 2XPGB 2WLYA 3DARA 3QG7H 1SZNA 4JM4H 5J12B 3EUDA 4NGHL 3RQ3A 1ASOA 3DLQR 3GHPA 4UDUB 4XNYH 4Y19B 4CU8A 3G9AB 2YGPA 3HG0A 4UM9A 1HEJC 4LKCB 4PG9A 5DO8A 2OL3B 5F7BA 1N26A 1BLIA 4QWWC 2PKDA 1QBBA 4QNPF 4YSEA 3PWLB 1HWHB 4EMZA 5GSRA 4PB9H 5AB0A 3T77B 3ZTDC 2ALAA 3EG9A 3LVEA 3RFZC 4UT9H 3QC6X 4I89A 5DT1L 1IZKA 1OLLA 2JTYA 3UXFA 2QR0A 3O6MH 3ARXA 1UJ3B 3LXCA 1YA5A 3VXRB 5B1BB 1VHPA 4F8LA 4MCYB 4MD0B 2DV6A 12E8L 4GAGL 2NUPB 4H1LB 2HZHA 1FVDA 4LRNL 4NXSA 5DMYA 5J6HB 5AUMA 1HZHH 5ALBH 1ZV2A 4KPHH 1MH5B 1KTLA 3L08A 4S11A 1TFHA 5DYOA 1R3JA 3E6HA 3X12A 4P2RD 1YQVH 4HP5A 2GJ6E 2WPGA 4CADB 2WZ5A 4F15B 3D3VA 1LP9F 5D2NE 4KOCA 3I6KA 2AZAA 2ADJB 3UZEA 3RVUC 5GGQL 4PLNC 5K9JH 4ZUSB 5LUMA 1NFIB 2KUTA 1S7RB 2E8ZA 1NGQL 1OGAB 4IRZH 3HFMH 4YHLH 3T65A 3CLFL 1FORL 3QPXH 4XN4A 5D1QC 2EDWA 3KPNB 1PZUB 4TXVB 4D7PA 1INQA 3ATBA 4WFGE 4LSSL 4NO2B 2KZKA 4QRBA 3DUUB 4P4KC 3MYJA 1GOGA 3TBYA 1SOXA 5GJSH 3M1BB 4AEFA 5CSBA 3UAJC 5DZOA 5DJXB 1PDKA 4K07A 2ATAA 1T7YA 1W0WA 1WPCA 2GSIA 1ORSB 1HHKA 4GW1A 1I1AD 1T2JA 1CDCA 5E8PA 2Q6WA 4DZ8B 1A1OB 2Z93A 2FX7H 1VFUA 3B1TA 3QRFM 3TVMB 2J4WH 4MZ2A 5DD6A 4MAZA 3UTSD 5D8JL 4WVRA 4LLQB 2R1WA 4J5VA 2JB6A 3GRBA 4HBCL 4QYOB 4M3KB 1A0QH 4KK9C 3UCQA 1XGRA 3B34A 3VFGH 3W9DA 2LOEA 2OMZA 4YSSA 1DBJH 1KJ3H 1FH5H 5C0AB 1XH1A 2Q7YA 3LPWA 3MCKB 4JQVA 4N6RB 2FB4L 3DGGB 3CFKB 3QWOB 2GTWB 4G6AC 3NN8B 1XVSA 3LZFH 2O61B 3ZL4H 4ZUVA 3MGAA 4HH9A 2WLLA 3CBKB 3KPLB 1G9MH 1WBXB 2QGDA 5ABAA 5HI5D 1AD9A 3JSSA 3L1FA 1UWGL 2UX7A 1I31A 1RZKL 5F71A 1A25A 3MACH 3AXLB 1HL9A 1X5HA 3FTWA 3L1OH 4X6EB 1D9KB 5A3IC 2R23B 1ZLEA 1TYRA 4AZ8A 1T4WA 3DMMD 2JCWA 1OCOB 4ZUTB 4KVNL 2CDEA 4DGYL 5DUML 4FFYL 4OD2B 5E1QA 2BVOB 2QPSA 3H42L 4N90E 4AEIH 1SXCA 2COQA 4FXGC 3MBXL 2HLAB 2JJTA 4NDMB 1OVZA 1UG9A 4Y2NA 4AZUA 3W11C 4NJ9L 4ZMXA 2K6WA 1J1PH 1JFQH 1Y1DA 3I9GL 4F93B 4WU5B 3WYRA 3ILDA 1HSBA 5D1ZC 3ARRA 2R83A 3GI8H 5AVSB 2WYIA 4W9KC 1YMMB 2H45A 4NKQB 4RMUA 5L6YH 2BNQB 3A6CL 2O5ZL 2LLLA 2HTKC 2ZKYA 4GUPA 4U6TA 5AVQB 2BW4A 3ZDXB 3HG3A 3RJDA 3GBEA 1ZDQA 3L8QA 3BEVA 1KCUL 1T0OA 4CUCA 3VGDA 5TE7L 3GSWA 2ADFH 3ZRSA 2FUTA 3FU5A 4X6DE 3OGOE 5CFHA 5ISZE 4KNUA 4A2HA 4HUVA 5EIIG 4B97A 4C4KO 4OGYL 4ZO6A 35C8H 4U31A 1K3ZA 5DLLA 4WJG3 3EG9B 2VC2L 4JFEA 5C0EA 2CIIA 3RG1C 3P77A 4ZSOA 2QR0B 3KNBA 2QV2A 3L5HA 4L05A 1B3JA 1RZQA 4LCWA 5KOVC 4ZFZA 3HAEB 5F1OB 4WEBL 1X7QA 2H8PB 2AV1A 4Z3TA 2EO7A 1YAZA 2JKRM 3RUGA 5AUMB 1U8CA 4PRIA 4F9PA 3MPCA 1U8PA 4XB8A 3V55A 1KTLB 4FL4C 2BWDA 5I82A 4MRBA 4PGDA 1DLHA 2PPCA 3CX5J 3X12B 1HJCA 3GS4A 5T5NG 1RUAH 3ZE1E 4EUPA 3B9KD 1AJ7H 2FWLB 3D3VB 3F65A 3I6KB 5J1TC 2R15A 4FI8A 4JVWA 4G2AA 1FZKA 4QYAA 2ED6A 3FU9A 4PJ8C 3EOAA 2K6YA 5HDRA 2AJSH 4UINL 2NW3A 4EKJA 4KRLB 3ZT7A 1QHPA 1IB5A 1VFMA 4PJ5A 4UQDA 3DXAB 3RX7A 4B0MB 2WXQA 4N0YL 3M88A 5GZNC 3TBYB 2VUYA 3HS8A 4DKAA 4Z77A 5CBAA 2HMIC 4JCLA 3EYSH 4IBYA 1W0WB 2GSIB 4GW1B 3T71A 1M53A 5E8PB 5JTWA 3BSZA 4JFFE 1GZQB 2Z93B 4TNWK 3SY0A 4L3EE 3LS4H 1K3IA 1SHXA 4RGNB 3I3EA 4X9IA 2XYBA 2R1WB 3ASWA 5E4EB 1DQVA 3O6KL 5H4YA 5HJBA 3ZU8A 3MJ9H 5GS0C 2IGLA 1XGRB 1FA4A 1YEEL 3ZDYE 5IHUH 3W9DB 5AB9A 1GZPA 2OMZB 4DKTA 1RHFA 1NCDL 2Q7YB 4GXVH 3BP7A 3L6FA 2BC4A 3QJUB 4PHXA 3SIKA 1EFQA 2V7NA 2FATL 4E9TA 4JFDD 1OAQH 4ZUVB 5CCGE 4HH9B 3SB3A 3L4VA 4TSBH 5CJ8A 4OZHE 4F15C 2JV6A 4KUZH 1AD9B 2KYIA 5K9OA 4M3JA 3IJ7A 1FYHB 1U8MA 2G0KA 3KYMA 1GZHA 4M62L 3MVSA 1F4WL 1AQKL 4H8HA 5CZVH 5IVZB 3ZXAC 4DP4X 4E0RB 4LPCA 1X6NA 2F7RA 2ZCKH 4H7VA 2CDEB 4CJ1A 1K8DA 3ERXA 2VMCA 3UOAB 1CGUA 3S3SA 1FNAA 4NM4H 3GM0A 1JD7A 5IY5B 4NZ8A 3K4DA 5HYSG 4DTGL 1CBVH 1LO3H 1HXKA 5JQ6H 1ZANL 3O2WL 1SMOA 3ETSA 5DMKA 3BD4A 4AEEA 3PHQA 2XX0A 1KSRA 4WRLA 2VN6A 2FH8A 1T66C 4Q6YA 2AHIA 2X3AA 3RVTC 4GLRH 1HSBB 4A38A 4FNPA 3TVMC 5HDQH 4U1NA 1KTKE 3G5VA 1U33A 5E9NA 5C7XH 3MRKA 5DUJA 2JLLA 3P2DA 1U3HD 3TPKA 1AIZA 2YPVH 4GUPB 1P5VA 1RULH 4PJGB 2JKNA 1A3LL 3U1PA 1LP9A 3IMWA 5TD4A 2L7JA 2ZICA 1DVFD 3A4AA 2HFEA 3BEVB 3FS9A 2R69H 5E56A 1PZCA 3STBA 1UD8A 2QQNH 5HVWA 1HQ4A 1E9OA 1DBML 4XVOA 4ECNA 25C8H 4MQXD 1R4XA 3W0WD 4X7TA 4HUVB 1TLKA 2ZOLA 1HE7A 1UOVA 1FFNA 4HUMB 4JN1L 4JQIH 4YIQA 2F54D 2V6HA 4JFEB 3ILPA 5CIPH 5B38A 2CIIB 5CGYC 1Z1WA 1FV1A 4ZSOB 5KZCB 1FYTB 3KNBB 5ACZA 4Y1TA 3V5KB 4LCWB 3G5ZA 1QNZH 4G9FA 5F7EL 4ZFZB 4G5AA 5LGHH 4NYLA 4XN9A 2A74A 1UC6A 1I3GL 5IUSA 2E75C 3P2BA 1VIWA 3H9ZA 4QRPA 2F5BL 1U8CB 2LU5A 2YD1A 1U8PB 1XH2A 3QQDA 5I9QC 2BJMH 1SJMA 3BUIA 4PGDB 1DLHB 5JUEL 2EP6A 5IB4A 1OSEA 4PV8A 4XXDB 4EUPB 2YQ3A 3V5HA 3B5GA 4PS7A 4XOEA 5DJAA 1V55B 5DRNB 4KTGA 3GBDA 3RIAF 4JRFA 2HKFH 2IH9A 1CLCA 4OCWH 4OKVA 4KZCA 4IHBA 3EOAB 4BWTA 5IJKC 1E6JH 2OA9A 3ULVD 2NW3B 4WWKD 3OMAB 4XPHH 2OR7A 4PJ5B 4RRPG 4BH7A 4KROD 3MZGB 2IDQA 3IB4A 1T6WA 1F2XK 4KTDH 4AE0A 4Z77B 1UD4A 5CBAB 3GHBH 4XOBA 2NQCA 3U2IA 5E9DA 4ODVL 1SDAB 3IDJB 4HCFA 3WELA 3SY0B 3NQIA 2OTUA 4J3OF 3SDXF 2AJXL 5LCVA 3IBEA 5FYJH 3CSBA 2LVEA 3PFUA 1MELA 3PU7A 3D25A 1X5JA 2BDNH 5CILL 2V3EA 1H8LA 1MI5A 1GZPB 3IVKA 3PGFH 1OO2A 1CE6B 1U8KA 2R1XA 3LXAA 1FN4B 1J7VR 1L3WA 2BC4B 4MBRA 1WA2X 4Y19E 3GS7A 2K3HA 4HSAC 3CCHA 2V7NB 4DN4H 3MRRA 1E8YA 1FNSL 3DJTA 4G6ML 1UATA 4NM8L 1TTRA 2CKBH 4KNSA 1HCVA 4WIQA 1VRSA 4K2UH 2YSTA 2WQVA 5IV2A 5K9OB 1OARH 5TE6H 4X9FA 1EQWA 3KYMB 4AQOA 3BRFA 1JI1A 4ENED 4GXUM 4U4BA 3U6RA 2DWXA 2MJWA 4HETA 1TCRA 3W5MA 2VERN 3VXRE 1MFDH 2WSKA 3ARBD 3NCMA 2NY5C 1P5UA 1I9EA 4KGLA 5C0DA 2FGWL 3V4LA 1J1OH 3EZJB 4PRPD 5ABZA 1Q9LA 3QUYA 5CCHE 5KSAB 5DRZA 3EGSA 4K3DH 4AGQA 5HXMA 4PWGA 4BFOA 4HK0A 4HA1A 2PCPA 5K1JA 5E5RB 4EBQH 5JPMB 2WUBH 5DMKB 3N42B 4L1HA 1RUKL 2KPNA 1LK3H 1WS7A 1CG9A 3DROA 1Q38A 2WSPA 2Z7WA 2ZKMX 1L7IH 4U1NB 5DEGB 1HINL 3Q8EA 4HEME 3MRKB 5EORL 1OQOA 1XDTT 3WTYA 4BZ2A 1XH0A 3ZKND 5EA0H 1P5VB 5CD5C 2VUKA 5MP6H 2OZ4A 5BO1L 5KSUA 1OGAE 2C3VB 4AYEC 4A63A 1LP9B 3PP4H 4AE1A 4RA0C 4LESA 2HFEB 4GMSH 4AV0A 1NIFA 4LNRA 1X7TA 4N2IA 1OAUH 1HQ4B 1E9OB 3ZW3A 5IFHL 4S0HA 1ZT4A 4X7TB 4R7LA 1V7NL 4J7RA 2ZOLB 1NCOA 3CZFA 4N8PA 5FHAL 1FFNB 2N59A 1WITA 5GS3A 3WKML 3HNSH 4YIQB 1XAUA 2AEOA 4LCUA 2DH2A 1NMCB 5B38B 5K1NA 1JZ8A 3T0ED 1DN2A 1I4FA 3T0AA 4ELMF 5ACZB 5ICYA 1WJ3A 3G5ZB 4G9FB 3HZYA 5DJCB 4NYLB 4N3TA 5D7IF 3MLXH 1N2RA 2WWNA 2YEQA 2A74B 3GXFA 3HEIB 4QRPB 5C0AE 2W0PA 2QVTA 1EDHA 4H26A 4HPHA 3QQDB 2YQBA 5IOKA 2P44B 5T5FH 3FOLB 3TN0D 3AAZB 2FQGA 3ULSA 4QRRD 3LNEA 3KLLA 3PIQA 4PV8B 4HJJL 1C9SA 5L4MA 3V5HB 1PYWA 4GIPD 5DJAB 2AJVH 2V3FA 2R9HD 5CZXD 3JYBA 2E7DA 1QNIA 3HN3A 3EXLA 1EXHA 2YWYA 4ALAH 1OV8A 2CK0H 4G8FA 3E7JA 3LKRA 4P9HH 4NOFA 3NPSC 5HJ3A 1CYWA 4Q97A 4BH7B 3MKKA 3VQ1C 3QXAA 4POZC 2VLRA 2XX1A 1AXSA 4GUCA 1N8ZA 1FL5A 2OMBA 3RL1A 3ARUA 2QL1A 4IHOB 3VFTA 5D1ZI 2YOAA 4N85A 3IAPA 4MJ6A 3MBWB 5JIQA 1CXLA 2AZUA 2XYCA 3M7OA 2OTUB 1HSAA 2C3GA 2WLNA 2F19H 3B7SA 4TPRH 1YMME 3VD7A 3VB9A 2VE6B 1T20A 2BNQE 3DVGA 5FYLH 3LNHA 6TAAA 5KSVA 3J27A 3S36H 5I74C 2Y36H 1MI5B 3ZDXE 1Q9OA 1TETL 1PG7X 1U8KB 2V5TA 3WY3A 2R1XB 4UB0L 1SXZA 3OWRA 1QG3A 1M2OA 3EFFB 4PLKD 3OKNA 4YHML 1L4IA 5LNDA 3CCHB 3ZKQD 4W9GC 4HOXA 3MRRB 1UENA 3DSNA 4HZ1A 3DA0A 1X3DA 4HXBH 1Z32X 4ODHH 2QT6A 3NCXA 4BQ9A 3ABZA 1S3KH 2KLTA 3U6RB 2XV2A 5DGQA 3LB6C 5J1AB 1TCRB 5C0DB 1P5UB 4HKZA 3PL6A 4KKBC 1Q9LB 4J4PD 1JS4A 5CSGA 5DRZB 3EGSB 3I6LE 2VM3A 1YJDC 4UANA 2AQRA 4HK0B 4YEEA 3BP6A 1BG9A 5DHVH 5G5DA 5KVMC 2ZOUA 5FCUL 4PW4A 4JRLA 4XNZC 1SOSA 2HRGA 3DIFA 2A6KA 4PJEB 2DQFA 4M7LH 4XVSH 5AOJA 1HAWA 2E9WA 3TCLA 3DROB 1CDYA 3D3VE 3IU3B 4XH2A 1TMQA 2FT6A 4Y4FD 5C92A 2JKXA 3FZUD 4OLVL 3WHXA 4Z7AA 2X1WL 1GGTA 5AOZA 5FO8A 4WFHE 3H7LA 1NCIA 4ONFH 4LNRB 3HVDA 1KDIA 4GEJA 1S46A 2O6FA 1SDDA 3DXAE 4TLKA 5E5UB 3BKCL 3UJTH 5HYQA 1ZT4B 4DF9A 2FYVA 2J43A 3CZFB 4X98A 2HLFD 3QXVA 1AGBA 4NNPH 4LCUB 3V4PA 4Y5XB 2BS71 3Q2WA 1GZHC 4JHUA 1PD1A 2NZ1A 4RGNE 3ZHFA 4MJJA 3HZYB 4MJ4A 3UAFA 1DFXA 4UT9A 1N2RB 3FN0L 5LDSA 5KSAC 3MRNA 3QUMA 3MX0A 3RWHB 3SN6N 3RY5A 1OHZA 2WGXA 3WEBA 4CA4A 4Y4HD 3T0WA 2P5EA 4XE5B 1HHGB 3WUZA 2QKIA 4H26B 1QA9B 1BVNP 4GO6B 3VYPA 2VIRB 1CI5A 5C3IA 3BW9B 4KZ0A 1E9QB 4OKDA 3WNJA 3QZNA 5JPMC 4KY1H 1IZJA 3ULSB 2GJPA 2UVEA 3QFJA 1TG8A 2QHRL 4X7FC 3V9EA 4QPEA 3LRSA 1J0ZA 1W15A 1Q1JH 3TYFA 2CWRA 3BE1H 3H1ZA 1PSKL 1EBAA 1IGMH 1L9QA 3LKRB 4IDLA 1BWMA 4IRZA 4ZMVA 5HJ3B 3M1CA 4HIPA 2QMKA 3MXVH 3QXAB 5ECGA 3MV7D 1FL5B 4OCRH 5HHXL 1SXAA 3DI2B 3VH8G 3W3BA 5CJ5A 1JJUA 2OMXA 2Z9TA 3VFTB 4LCIL 1TSHA 4PU2A 2VLJA 4WTZG 4X83A 5FYKH 5DQJA 2WQWA 1G0XA 1VJSA 4MJ6B 3IAQA 2V4LA 4LSPH 3NACL 1NMCC 2APFA 1HSAB 4HKJA 1A22B 5KVEE 2D7TH 5JXAL 1KC5H 1JPEA 1PMYA 2X10A 1YYMH 4KWUA 5AL8A 5FWRA 3DVGB 1T20B 4KK8C 5KSVB 3QJVB 4JMXA 4R5TA 5F6HI 1JNHB 2A74C 4PJGE 5T1KA 3D0LB 1Q9OB 2JCCF 2RFXA 3MR9A 4WO4D 4CDHA 3UO1H 4EZJA 3FT3A 3LZLA 3VA2C 5DLML 4KNQA 3D8MA 3DSNB 5E2TL 1EUUA 1UA6L 1TPXC 1QAWA 4XCEA 1BLNA 1QRND 4X6CB 2TAAA 2Y7SA 3D2UD 5JXED 3BMWA 4B9YA 2BY1A 1L9NA 2VN3A 3MXWH 4HK3N 4ZW3A 2PLTA 4OF7A 4JFEE 2R2CA 4Y16C 5I2IA 4ZSOE 1SVZA 3PXJA 1FYTE 1MCPH 4FFZL 2WO2B 2WN2A 4KTEL 1YPZF 4LCWE 4TOYL 5EDXA 2IQAA 4RGOL 1FL6A 3PL6B 1JCKA 3HC3L 3IDXL 2I32A 4KI1A 3US1A 4H20H 1DDTA 3BP6B 3NIFB 4PRIE 5G5DB 5D7IA 5F3HB 4JPIA 1QLEB 4FZEH 4RSYA 3HIZA 1WA0X 1ZSDA 4XVTH 2WO4A 3FT2B 3U0WL 3QNZA 3TCLB 3QDJD 2H1LM 5I5IA 3NVQA 4OW6A 4BKTC 4LVOB 5FFOA 1DL7L 1LO2L 3QQ9C 1CFQA 4F9LC 1WCQA 4JDEB 5TGBA 1Z2KA 8CGTA 1KUMA 3ORJA 3MZTA 3WHXB 4YHIA 1C5CL 3K5SA 2DPKA 4KKZA 5FO8B 5GSVB 1RK7A 4EI0A 1WK0A 2WNWA 1SNRA 4I3RH 4NZTL 4PJ5E 4K94H 3L13A 1PNCA 1TJIL 1FQ9C 5HYQB 2VDLH 5I1CH 4HJUA 1L9MA 1OTUD 4YSPA 4YUEH 5I0DA 2WMPB 5JLZB 1AHMA 3FSVA 4PIBA 1LO5A 3U9UA 5J89A 1RH8A 5T3XE 4PS8A 3O11B 3UTZA 1P5UC 2YMOA 3LHAA 4X5XA 3MRNB 4LARH 2OLDA 4TS6A 3PQYD 1HESA 4Y9EA 2OULB 3SGDI 4QF1A 2QKIB 4UOZA 4P9MH 1SHMA 2VKWA 5JO5A 4AM0A 2V2TA 4FG2A 2XQYK 4YHZL 5INCB 3K91A 1RZ7L 3LZOA 4K7FA 1WIUA 5FFLA 5LGJA 3FBQA 3EZ8A 4A7VA 3E1ZA 1UA7A 4ZI8A 2WQAA 5DK0A 4RISL 2CGYA 3LRSB 2L7UA 4S1RH 2X4NB 4OZGB 4JKPL 3G6JA 1DP0A 4EI5A 3MV9A 2PTVA 2YBRA 4ANKA 1HEHC 4M6NL 4JKKA 2XIDA 3TYFB 4POYA 3V0DA 1X5MA 1SHWA 3FXIC 2XBDA 3AC0A 1PPIA 5LAPA 2WXRA 1RZGA 2R0KL 4HS3A 1FBIL 5KYUA 4K7PL 4RA3A 3C87A 4IMLB 4AOFA 1ZT1A 2H32H 5TQ0L 3MV01 2B08A 1ZLUK 2GTQA 3EH5B 1NINA 5E7BA 5DQJB 1QSFA 1HYSD 3LIZH 2WWMC 4Y5XC 2HVJA 4MJID 1Q9WA 4HKJB 1WZKA 2WTRA 1L6XA 4QEGA 4M48L 5IHLB 5JHAA 4WUKH 4RZCA 4LVHB 5T1KB 4TL4A 1NAMH 1GPOL 4BCXA 1LP9E 2APWA 2X28A 3MJ9A 3L4YA 2RFXB 2EEBA 4IRSA 3MR9B 3WNLA 5GZOD 4UTAA 3Q9PA 1KB5L 3FT3B 4XNQA 3RWCA 3W2DL 2UVFA 3DBSA 1T3FA 2B9BA 4QGYA 5EZOL 5JHDD 1J5HA 2RB8A 4IJTA 4KJPC 4XCEB 1NFKA 4I0KA 3VD9A 5IW1A 4WI3A 3T2LA 5IW6A 1B90A 5CJOH 2IOMA 1ZHKB 2WO3B 3BKYH 2K45A 4HJ1A 3LNIA 3ZTNL 3ARPA 1ZIAA 4YDLB 4XP6L 5I2IB 2L8AA 2PPDA 3GMNB 5HDBF 2DBJA 4F37F 3SE3A 3L2MA 3IDNB 1CD1A 2ENJA 4G9FE 4LL1A 2IQAB 5E2JA 5AZ2H 3K2MC 2EXYD 2V8LA 1WIOA 2OAAA 5DU7A 1SN0A 4ZD3L 4ZZKA 1WF5A 1OQXA 1W72H 4QRPE 2FL5A 4JPIB 5D1XD 3IPBA 3SDDD 7CGTA 5KVDL 3LX9A 2N4IA 5IVXA 5FM4A 2J8HA 1ZSDB 1P1VA 4LU5L 4CDGC 1OLZA 3O0RL 4FTVA 4M7KL 4OB5L 4YHNA 3QNZB 2Z1PA 5HHMB 1BSIA 2R51A 3D0AA 5CCKH 2DY2A 4LEEA 4LGPB 5L8LB 3QDMA 2H6UA 1CFQB 4H88L 5TGBB 1WTLA 5DRXA 4U1JA 4Z7QF 4JL2A 2CPCA 3ZMEA 32C2A 2N01B 2AJYL 4KI5D 2P8PA 2TSBA 2NXYD 2C1PA 2YPVA 3CMGA 5AAWC 1YNKH 1GC1C 5JMRA 1I7RA 2DKUA 1S4IA 3LZQA 1R0AH 4WI6A 4XI5C 4XVJL 4NKDB 2Y6SC 1M05A 5B3SB 4LT7A 2WIIA 2BXZA 4HJEA 3AQYA 4X50A 2E9JA 5C2BL 1K72A 3NOIA 2XA8L 1JPSL 1MRCH 1OAYL 3VNZA 2PR4L 4LSVL 4EO5A 1LO5B 3U9UB 3QAZC 2YRBA 4WO0A 4XO3A 3PUCA 2EDXA 4XWGL 3UTZB 5CIPA 2NYYD 3PL6C 4X5XB 3U7YH 1XB6A 1MI5E 2VITA 1C12B 2EDTA 4K3JH 4K71B 4QF1B 3BWZA 3RI5F 5L4IA 3KPPA 3EJRA 1EO8L 4UMGA 4AM0B 4BFFA 1JYNA 4K5NA 3X3GL 2V2TB 2D3NA 3U0TA 3P69A 3NBNA 4XP5H 2B4CH 1I1YB 3DO3A 4AGPA 3HPLB 5LGJB 5E6ID 2DMBA 3G04A 4XC3L 4GG6A 4NWTL 2Y1AA 1CGYA 4XP1H 4LVOC 4KUCF 3G6JB 4ACTA 4EI5B 1JZGA 1EFXD 4GPVA 4UAOB 2DQIL 3KPMB 4U6YA 1HCFX 2KZWA 3C6EA 2DQHH 5IBLD 4E68A 4N2HA 4M8VA 1ZPLA 3TTYA 2ARJQ 2YD3A 1RZGB 4YBHA 5KYUB 4GUOA 3OF6A 4R7VA 1DUYA 5LBSH 1YPZA 2IV9A 4C4UA 1ACYL 4EI6B 4FEMA 5JYLA 5D4IA 4N2MA 2VNCA 5D4JA 1ZVSA 4S0SD 5FCSH 2DWEA 4UNTA 1Q9WB 3CPUA 1T21A 4KKNA 4XT1C 1GR7A 2WTRB 5AVUB 2R4RL 1OB0A 4I77L 3TJEH 1JXGA 3BH9A 3FMGH 4NJAL 5D7SH 5BVPH 1OGTA 5FKPA 1KYAA 4IRSB 1CDHA 1BMWA 3EH3B 2FWOB 2NY6D 3VGGA 4XNDA 1A3ZA 2CCVA 4XNQB 4F57H 3RGVD 2XBZA 5AW7B 3A4EA 2PTTA 1T3FB 4LHUA 4ZNCD 2AEQH 1J5OH 2YPLA 2R29L 2I5YH 4YBQC 2L7QA 3M7FB 2YEVB 2WZ6A 5C08B 5IW1B 1M1SA 3BYTA 3II1A 4HG4J 5IW6B 1MUJB 1OPGL 3VTMA 3JTTA 2CKBA 1U93A 3L3GA 1DBBH 3CDGA 4NQQA 2VWEE 3FC8A 1MW3A 3QYNA 4XB7A 1DFBH 1XQ4A 4HIIA 1CD1B 2ZOWA 5I0WA 4GIOA 3D09A 3HNTL 2VO5A 4U0RB 4X4YA 4HLJA 4G8EA 1NCJA 5EIQA 4ZDHA 1S2EA 2VMFA 3BT2L 3FCSB 1E65A 2VR8A 3I2CH 4GRWF 1CJYA 3B8SA 4DP0X 5IVXB 2OX5A 3HB3B 1BPVA 4WEEA 4FTVB 5DC9B 1NBCA