1E5CA

Internal xylan binding domain from c. fimi xyn10a, r262g mutant
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
87
structure length
87
Chain Sequence
b'TGCSVTATRAEEWSDGFNVTYSVSGSSAWTVNLALNGSQTIQASWNANVTGSGSTRTVTPNGSGNTFGVTVMKNGSSTTPAATCAGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XYLANASE D
publication title The Structural Basis for the Ligand Specificity of Family 2 Carbohydrate Binding Nodules
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 10
structure length 87
sequence length 87
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1e5cA00
5DHDA 1C7SA 1C7TA 3NDYE 1EXHA 3NDZE 2XBDA 1HEJC 1QBBA 2CZNA 5DHEA 1HEHC 1XBDA 2CWRA 1E5BA 1EXGA 1QBAA 1E5CA 2RTTA
chains in the Genus database with same CATH superfamily
5JXAL 1GZQB 5D2NA 4BK5A 1B6UA 4MJHA 4U6XA 2BVOA 1AR1B 4BINA 4OV5A 2MCAA 4RISL 1BXXA 2ATPA 1CD0A 1EZUA 1L9QA 4R3SA 5LBGA 1WGVA 2GJ6B 2VDNL 4CN6A 4IS6A 1WIPA 4A7TA 4WI8A 1FFPB 2ZKWA 4UTBL 4Y89A 4ISVA 5FYJH 4M6ML 2XU9A 3KPSE 4GMSH 5ICZA 5KTEL 2OJZL 1NCDL 3UZQB 4FULA 3P54A 1LQSR 4Q52A 5FK9A 4E0RA 1YEIH 2GJ6E 2Y7SA 2BJMH 3KGTA 3BHBB 5D7IE 1HXMA 4E36A 4PP1C 1NCAH 1TQCC 3BC9A 1ORSB 4YHKL 2WLIA 3DUSA 4YL4A 5DJ6B 2V7HB 1A7PH 4KVNH 3NIDB 3MLTB 5HDBF 5JYLA 3IDIA 1AOHA 2A4EA 4IOSA 3K6IA 3VFSB 3CFNA 4MNHB 1NBVH 1FO0A 5F21B 3PHQA 1D5BB 3AAZB 3EJRA 1ZWIB 3K3QA 3DETD 3UOAB 4EBQH 5LXVA 5DS1A 1J0IA 4MTMA 3NIDE 2EXTA 1TU2A 4I2XE 4ERSH 4B95C 1Z9SA 4A6YA 1S3KH 2O5YH 1Q72L 5HDRA 4Z3GA 5I28A 2AQTA 4N85A 4YS4A 2B2XH 2JLPA 2D7PA 2FHFA 4DCQB 3LKPB 1G6RL 1AXSB 1AAJA 4NRXB 4K7FB 1UOWA 1A7QL 4Y5VC 5FYKH 4IRZA 9CGTA 2X4NA 2JXMA 4OIIH 2A73A 5ESVB 5JMRA 1ACCA 4MASA 3ESNA 2I27N 1MCRA 2KERA 4CMHC 4DN3H 1IC7H 1TVBB 4JM4H 1R19A 2GK0B 4FQHB 5KSVA 2N7BA 5D7KE 1QHOA 4J3OD 1DJYA 2R0ZL 2CLVA 1R3KA 3GB7B 5EN2B 1HCFX 1S9XA 3BAJA 5ECJE 3S96B 3SOBH 4YSQA 4GAJL 3ESOA 3D48R 4PW3A 5EZLA 3X2QB 1UJ3C 4Z23A 4JRFA 1ZT1A 3B43A 5MEPA 1BMWA 1ACYL 3VXSA 5KS9E 2NYYC 4HX1A 3D85B 4HIHB 4MCYA 1NLBH 2V2WB 4OZGF 2R15A 4Q6IB 3GMMB 3IPEA 1JMXA 1JV2A 1ZOXA 3H9SA 2Z65C 1YN6A 2ZXAA 3QDJD 4L8SA 4M7ZC 4H7VA 2H2PC 3WNPA 3KPLB 4NQCE 4Y1TA 4ZW5A 3K71B 3SDAB 5F1IA 4H8WH 2RALA 2DI9A 1UM5L 2QQLL 4N1EA 4Y7MA 3LN9A 3I6KA 2JTYA 3L16A 2YUXA 1AGFB 1GCYA 1FFOB 4YSPA 1WIOA 2NX5B 4PGZA 5C0DA 4V11A 2EC8A 2BS8A 2N7AA 3P30L 4G5ZH 3VTTA 1I1AA 4NHUA 1QBBA 3QNFA 5IMMA 1MJJA 4PJIF 4PR5A 5DRNA 2DJ4A 2IAAC 4NP9A 3WAKA 5CLXA 1YYML 4U0QB 3KLLA 4X7CC 2NX5E 3UO8B 5EUKB 4HWBL 3CXDL 4YHOL 1PJ9A 5EZOH 2V7NB 5DA4A 3GRWA 1EGJL 2BY2A 2XTJD 3OXRB 4WO0A 3QZNA 5C9JB 2AANA 2QGBA 4HSQA 1T0MA 2C3VA 1CFNA 5K33A 4WTZA 3LZNA 3ZKND 2R0WH 4Y5XB 4GXVH 1ZS2A 3VSQA 2WMPB 1KLGA 4NIYE 4POYA 3SE4A 3H7LA 1DUZB 1HIML 4BSWB 5IZ7A 4KMTL 4I3GA 3QHTC 2ZZUT 4L9LB 4LSDA 5T1DH 5MENB 43C9A 1A1NB 3MJ8A 3Q9PA 1ET7A 5GGTH 2OMTB 1MCQA 2IPUK 3S8GB 4K15A 1BFTA 1LO4H 3FQXB 3QG7L 4M4RA 4TVPL 1CXFA 4AUJA 3C09C 1OQXA 3EOBA 4J3OF 1ZEAH 5FCSH 4YVNA 5C0AE 3TV8A 4FFZH 2OL3A 3A22A 2VTFA 3WFEL 3QXUA 4WW1B 1A3LL 1ICTA 4TNVK 5D7LA 2C34A 5FOJA 3NOIA 3ETSA 4TYUA 3W9DB 1F3DH 3FN9A 1NAML 4KY1L 1CFSA 1NC4A 3DTDA 1YY9C 3DPBB 4X5WA 3PPEA 4FTVB 1CR9H 1HHGB 5EIIA 2FB4H 1SLXA 3HG2A 2VUYA 3FT1A 2UXFA 4PJ9C 1SOXA 2AZUA 1OAUL 1MF2H 1XB6A 2E7CA 3MOAH 5JUEL 2CHNA 1FVDA 3CX5K 3SYCA 3NIFF 1I7RA 4G70B 4G6MH 1X9QA 2JI3A 4POUB 5ICYB 4OCYH 1A6ZA 4LOEA 4LPWA 3MNDA 3PDOA 5EG6C 5LCVA 4WI0A 4JJ5B 2OYPA 4XNYL 4XAWH 3RIAK 3N1FC 4HHWA 3QEGL 4XT1C 4N2NA 1BQKA 2CGRL 5KBDA 5AALA 1T1XA 4JLRA 1RKRA 2KLRA 4P2QB 5C6TL 1MCOH 5MI0C 4Q9QH 4MD4B 5AW0B 1KY6A 3EFFA 1SLWA 3KLKA 4FP8L 4UYQA 4L3FA 4JS7A 1WYJA 2IQ9L 2XWBB 4Y2DC 3MLWH 1IAKB 4FQ1H 4L1SA 4PB0L 4PJIE 3S34L 2EDXA 5C70A 5I71B 3W1ZA 2QPDB 2MQGA 3HC4H 1NM9A 2C1PA 5IROC 4BWUA 5TF0A 1H19A 3I9PA 2HAZA 5C08D 3L1OL 5FO9B 1NIAA 1N3NB 3GMPB 4UT9L 1S9WB 5MEOA 3MUJA 4OQTA 2QVTA 2UY6A 5CFAA 2ID5A 1Q4NX 1JNJA 2L0DA 2Y5TB 3PHOA 4OB5L 4BQBA 1F6FB 1J0HA 1OT2A 1UXSA 2GAZA 3PFQA 5DO2C 3MVSA 3W5NA 5DMIL 5ESAB 5GSRA 1D6EA 1WFTA 1N7MH 1HH9B 25C8H 5G5DA 3AB0C 2A0LD 3MRDB 1IKOP 4I85A 2GY7B 4GT7A 5CLTA 1T5XB 4KROC 2AJSH 1GS6X 4AYBA 4AMWA 1KEGL 5GRVK 5T1KA 3UPRA 4O02A 4GKZA 4LCCB 4WF7A 1CDCA 1W0WA 3QO1A 4FFTA 4IEFB 3SD5A 1U42A 1VFOA 3WTUA 1P5VA 3JUYA 3QDJB 1RUKH 1QSFA 2P8LB 3BUBA 1BVLB 5E6YA 3WTYA 1ZHLB 4JZJB 3WOVA 5CEYA 2VYRE 3QP3A 2B3IA 1NC2B 2DIJA 5FCUH 2Q76A 3MLXH 2YRZA 3REWA 1P5UC 1NANH 1QI3A 3QDJE 3L3HA 1U6AL 3BH8B 2G75B 3B2VL 5DHEA 1WE5A 2DYPB 2DB8A 2RFXB 4C58B 5I1GL 3H3BC 1MFMA 2CU9A 4GBXD 4JMXA 4XWGL 6FABL 4AW4A 3K1DA 3PP3K 1F97A 4PI0A 2VDRB 5EU7C 2W38A 2F53A 3OAYK 3JWNC 3NIFE 3JT2A 3FU3A 3V0WL 2H3NB 4TSAH 1KJ2B 1K8DB 4DFIA 2YAFA 3OKKA 5DC9B 5KVDL 3HBZA 1MNUL 2DM7A 1H0DB 3JTSA 4U2YA 2C9VA 4PHXA 1C08B 5LBVA 3TA4D 1TYJA 1T4KA 1CDBA 3LY6A 3RNQB 1UZ6F 2RA1A 1I85A 4WI3A 1N4XL 2QV4A 3DRQB 2WUCH 2OZ4H 3QNZA 4JFQA 4K5MA 3BGMA 3B6SB 2JB6A 4U6VH 4F8NA 2R9HD 4EAEA 4CC4C 1MCCA 3CCHB 3QNYB 4J3TA 1VFMA 4R7VA 3FTWA 2XTJE 2XQBL 3C6LB 5BUPA 4F7MB 4PSPA 4AIZB 3JYCA 4EN3B 2VAJA 4YHNB 1O9WA 4NZFA 4OW6A 1WAAF 2NY1D 4WY7L 3TZVD 1OT4A 1B0RB 4FG6C 4S1RH 1JZ7A 2JIXA 4U1JB 4U2ZA 1KIPA 3F3HA 4DUXA 3IAQA 1W91A 5JPNB 4OI9A 3RJQB 1OAJA 2O6FA 4X9BA 3NH7L 3H6AA 3D4CA 2CLZA 4OLYH 4FXGB 1UD2A 2IMNA 2X70A 3UJIH 3RA7H 5DD5L 5DHMC 2WBJB 2YRBA 4X4YB 1RZFL 4ODUB 3RI5F 1HKFA 5E9DA 5EUOF 3EJTA 2A9BA 1OQOA 5IVNA 4D0BB 3SE9L 1INEH 4JFED 3O4OC 1XDTT 4M62L 3MO1B 2YXWA 3S3BB 4J3OH 2FO8A 4UQ3A 1PEZA 3PAUA 5J56B 4GMTL 4F7CB 4G1MB 4IU3B 4DF9A 3ZO0A 4WW2A 3BQUC 5L4IA 1QSVA 5DD6A 3CN2A 2GITB 4TLKA 1DJSA 1RZGB 1U8MB 3BPCA 5DWPA 5DLLA 1UFUA 1PZSA 5F0JB 2AMGA 3ZE2B 3BESR 2D3VA 1QFUL 4AC2A 2CBOA 1W16A 2NNAB 2Z3FA 3NA9H 1HAWA 3RZWA 3ZZSA 1S5IH 5MP6H 3L7EB 4JZOB 5F9JB 3RFZA 3DKHA 5KSBA 2DWDB 5FO2A 2J1XA 4J27A 2WB7A 2AXHA 3B7TA 3MODH 5DK3A 1CWVA 1OP3K 5K9QG 3V6ZA 1A9EB 2OMUA 5DQJA 1YLBB 4AENB 3IDXL 2X1QA 3ARFB 5IB4A 3GDBA 4XOBA 4A66A 3QUGA 1ITBB 3CFTA 3ARRA 2X2UA 2EC9T 4XGZB 4NAMA 4KK6D 3DO3A 4JM2B 2W60A 4Z95L 4UNTA 2BRQA 3EF4A 1CI5A 1H6TA 5IVXB 3QJTB 4XXCC 1OF0A 2ZNWA 4JFYA 5C08B 4QHLA 4TULH 5DUPH 3N43B 3Q8FA 5D1QD 4PEEA 1HCZA 5J4MA 4LNRA 3NJLA 3Q1EA 1NGPL 3II3A 4ATTA 1S7UB 5JDSA 4W9EC 2J44A 2B1HL 5A2LH 5C08E 3LIZL 1RK0B 3B9DA 4ODHH 1AZZC 4E42A 2VERN 2ZUTA 2J88H 1MAJA 5J6HA 2AXGB 4LAJH 3BP7B 2YD0A 3EYVA 4H44C 2Y5EA 4X8XA 2XG4A 3CC1A 4KJQC 2A9NL 1O5DT 4JMNA 4GW5B 4HPOH 5DC4B 4AT6A 3D39D 4BE6A 3GKWH 4ZFOL 5KBLA 4XCNB 1WIUA 4DN4L 3WUZA 3FQNA 2XYBA 4KO9A 5EDXA 3BH9B 3CXHK 4FTDA 3VI3F 2AEIT 1F4YL 5DK2B 5ADPL 2HXAA 5SWZB 2JJSC 4J3BA 3TO4A 5EUOE 1JZJA 2B4CC 1ML0A 4KAQL 3RX7A 1UVQA 3DTXB 4QXWA 5BS0A 3GXTA 1MJUL 2YJLA 4B3VA 4LLMA 3TBVB 1LL1A 5F7YC 3JV5A 1BAFH 3QA3A 5JIQA 4FFWC 5SWZE 1ZS8A 4GBXB 3DIFA 3C75A 3IFOA 2X4SA 5BVPH 2BRRL 1GR7A 5EPMB 1OP5K 3T08A 1WF5A 1BBJB 2JQAA 4G7YH 1T66C 3ZW3A 3SDYH 5DZAA 4IKLA 1FN4A 4PWHA 1R3IL 2OMXB 3P0YL 3QB7C 5F6IC 4HH9A 4F7EB 5IW1A 1CGWA 3DMMD 2EVJA 4S11A 2EEBA 3BKYH 4PGBA 2ICCA 1NWPA 2J2ZB 3SE3A 3VXOA 3ABLB 3GHBL 4EVNB 3BT2H 4NSKB 3PWLA 4H4NA 4PRHA 4IKIA 5C6WH 3WBDA 1T1ZB 2ENQA 2MRYA 2VZOA 4NNPL 3LXCA 5C97A 4QRSA 1R5IB 3V4PA 2IWFA 3BMVA 4JPVH 4J3SA 2WV3A 2Z31B 4AQEB 3D50A 1A7OL 2GY5A 1IAMA 4Y88A 3UZVA 1PFCA 2KKQA 1X9RA 1BOGA 1M2OA 3BCDA 3L3GA 4GW1B 3VRJB 2VDQH 3UPCA 3IS0X 1ETZB 4J3OG 3KYMB 2NY1B 4PRBB 5JQ6H 4R4BB 2JJUA 4YDJB 5E08H 2GUYA 4JRYA 5CBAA 4JRXD 3CVIL 1T03H 3C5SB 4MLIA 3BAKA 1FSKB 1UCTA 2V0AA 5E1HB 2EIEA 1WTGT 3TH2T 1NCUA 5F96H 2VZ1A 1YEEH 3CU7A 1XEUA 1BJ8A 4NKOB 4X6FA 1I8KB 4Z7WF 1EERB 3D25A 3SPJA 2V5SA 2EDFA 3I9GL 1NBYA 5KVEE 1KNOB 1ZVYA 3SO3C 2SODB 4PUBL 3G08B 3OQ3B 4ZUTA 3MA7A 4BCZA 5DC2A 1DQIA 4FCAA 2NUPB 5BO1H 1QATA 3UJJH 1IEHA 3W38A 5T1JA 1S7XA 4GEJA 4XPHL 5D4HA 3OKNB 4K9JA 2H0FA 1KB9K 1TNMA 3D0VB 4JFEE 3IXAA 4K2UL 3AY2A 4OGAD 2F0CA 1Z9OA 1ZTMA 5D7JA 5EOTB 4H20L 1KIRA 3F7QA 5AL0A 1DLFL 3AREC 1BX2A 4D7BA 3WIHL 4N5ED 1HX0A 2HSIA 1MCIA 1RZJL 2P5WD 4KKAC 3N55A 5E6ZA 5IR1A 4NWTH 1P2CA 4PY8I 3QRBA 4GRLA 5GGVY 2LLLA 3ILPB 3H9ZA 5IQ9B 1C16A 3FUJA 2DN7A 4QTHA 2BDNL 2R1XB 3DROB 1IIIA 4X4MA 4FNTA 1TG8A 3UBGA 5G2NA 2IWEA 1MFDH 2D0HA 3NZ8A 2OYLA 4DO6A 2WKLA 3V5KA 5F7DA 5HI3C 3HMXL 4DNLA 3ZRCC 3VXQB 1K4CA 1FRGH 1M2VA 3BIAX 2VC2H 4DGYL 5GZOA 4NJAL 4GQ9L 4R2GC 1CDGA 4XBGB 5BXFB 3WTXA 3CFKA 4AV5A 4H2CA 1I3GH 1OZTG 2C9QA 3TVMD 1IGTB 1AJ7L 2Y6SC 1OAXL 4QXVA 3MRBA 4ZK8A 3PWPA 3QZPA 1BJ1J 2AQNA 4N2IA 5DWUH 4J3UA 1QFWI 3CQFA 1UFGA 4WHDA 4AIOA 3EJCA 3T4YA 1U36A 2F74B 3N1QC 3GBDA 1A3RL 1VA9A 2VN7A 4N26A 4LSVL 2CIKA 4U3XA 4PJBB 3BEWB 3LKQA 2LVCA 4G6KL 3IF1A 2IAMA 1JGDB 4QXTA 4BH8B 1QLRB 1G6RA 1SN5A 1JPSL 1AR1C 2ZCZA 2XACC 3GS0A 1RURH 2NY3D 3K46A 1CXEA 1TTAA 4OIAA 4TXVB 4PJBE 2ZAIA 1KJMB 3J07A 3QWRD 2Q7NA 2NNCA 5HPMB 1CLOH 1E8WA 1URZA 5KVEH 3HC0A 1WBYB 2R23B 1WBXB 4OCMC 4EN2A 3I2CH 2J8UF 5GGVL 1R9FA 5HI5C 4Z7WE 1T7VA 2CK0H 3D39E 3W3BA 1I31A 5ABDE 3QHFH 2VXUH 3MJWA 2KYIA 2BM3A 1MI5D 1ORQA 4XNXH 1WS8A 4C56D 1WA1X 2XWDA 2VO5A 2HKFL 5ICXA 5CP3A 2DH2A 4PJGA 4P5KB 1MDTA 4IHOB 1D5IL 2IOIA 3THML 4QOKD 3D33A 2WCPA 3O6LL 4K3HA 2OSXA 2PPFA 1E4KA 4X5RA 3HG4A 3NRQA 3ZR5A 1I7TA 2ZUVA 1EQWA 5ILTL 4NIKB 3DMMB 1TEYA 3V55A 4IMKC 4UTAH 3TF7C 4P5TB 4LSRL 4RMWA 3CFEB 5ERWA 3MRQA 2G2NA 4YXHH 5KJRL 3ULVD 2IPUG 3M45A 2DMCA 5EV7A 3ZZ1A 3B7UX 4CL7A 2A5UA 3L7FA 5D71L 3CSYB 2HX7A 5E8EB 4NQTA 2ENYA 3QPKA 3RIFK 3WLBB 4NKIH 1LM8V 4HIXL 2MTAA 2HFFB 1BVNT 1MLBA 3NP3A 3QUKB 4HCGA 4DPCX 4IU2B 2APWA 3L2NA 2ATKB 2KDGA 4W1TA 1DJZA 4IM8A 1B6DA 2ZICA 4FQXD 4LPVA 4PG2C 1J5OH 3ZMRA 1NEZG 35C8L 3NZHL 2QTVA 4OFYA 4GRMB 4S0SD 1EIBA 4HWBA 3WO4B 4WCYH 4RZCA 4PLKC 1EGJA 3MV7D 4JO5A 1CLYL 1KPVB 3INUH 3ZYIA 4JRXB 4KPHH 3OGOE 2HJLA 3PV6A 3A0OA 5TGBA 3KL5A 1A0QL 1A2YA 2XN9D 3LXAA 4RX4A 5KEZA 4HUWA 5HVWA 2ZJSH 1NMBH 3CVHH 2MHAB 2DBLH 1UYWL 1CFVL 2CPUA 4ZUUB 4EQ3A 2YOCA 4Q6IC 1U92A 1DTUA 3EXJA 1IBHA 4JRXE 2AGJL 4URTB 1OLLA 4OQ1A 1FL6B 4FABH 2ZOWA 3U2SA 1ZHNA 2E0PA 4HS6A 1LILA 2IV8A 3VNYA 5K93A 3SDAC 5DHVB 3EBGA 3KPQA 1OO2A 4MJIA 3EGSB 2BMKA 4QGYA 4TPRL 2BHUA 4FNPA 3QJXA 2CD0A 3FF8A 2V5TA 1LP9F 4ABQA 2HH0H 3D51A 4BIKA 1BLNA 4HG4J 3QR0A 3IJSA 3AROA 3LQAH 4HSAC 1SOSA 1BM3H 3OHXA 4NNXB 1I4FA 3K81A 1NAMA 2IC2A 3MCKB 5HHVH 4YDIH 2FX9L 2P5WB 2G2RB 1NAKL 3QDAA 3W56A 1KN2H 3GT6A 4UB0L 5EEZA 3NN8A 4HAGA 5CZVL 4DVRH 1V3LA 4NPKA 4GG6F 4F8TA 3EO9H 2ZWSA 3DSFL 2P5WE 5KN5A 1DUYB 2JKJA 1RERA 1FLRL 4UM9A 5E7FA 4Y5XC 5GQBA 1TQVA 3TN0D 2G9HA 1EBPA 3VFNB 2WQRA 4JO2L 4KKBD 3VFOA 2WKOF 1RHHB 4W9FC 1IEAA 4L9LC 1NSNL 1VFBB 3KM1A 4WI6A 1N8ZB 1UWFA 3HBQA 3RZCA 5CJXC 2FHCA 2GBVA 4TQEH 1FPTH 3U7YH 4I77L 2HFTA 4X6EB 3MR9A 3TBWB 1NFAA 2YKKA 5F7EH 5HBBA 5KJ4A 2QKSA 1G7LB 2AABL 2AMUA 3T1FB 3T2OA 1AKJA 4L3CA 5DJ0B 4W9ZA 2B9AA 5EU4B 1U4EA 3S35L 5HHOA 2EE0A 2FX7H 2WQ8A 3WD5L 4LLYA 3MBXL 4XCFH 3U0PB 1FG2B 1MDAA 1QR4A 2Z7ZA 5E24E 3P40A 4RQQA 5JHAA 2E3VA 3VH8B 1IBGL 1SOKA 2HLFC 1RHFA 5A1AA 4F3FB 5I8OH 4EKXA 5EU6A 2NT1A 3LS4H 3KYKH 4Z7NF 4G7VH 4KKCC 3EDJA 1IGCL 1VPOL 1A4JB 3IWUA 5LXGH 1OE2A 1TJGH 5TF1L 4CADA 4FQJL 1PSKL 5I82A 2EVFA 1FL3B 2E27H 3OJ2C 3CFIC 1KBGH 2ALWA 3WN6A 4UM8B 2VMFA 3H0TA 4LO9A 5GS2D 3RL2B 1NDMB 1ZK5A 2W91A 2LFGA 2VDKB 1HU8A 2R1WA 3FCUB 5CMAB 2VMEA 5DI8A 3UXFA 4OGZA 2OA9A 4XP5L 3UBHA 1H3PL 4C56B 4X7TB 5ANHA 2HVBA 4OCSH 4XCCL 4DAGH 2IBZY 2P45B 2NW2A 3G5YB 2NY0C 1BPVA 5DHVH 4M56A 2VJXA 5F1NB 1MI5E 3OBAA 5KZCD 4C56E 4H26A 5AYQA 2OMYB 5I6NA 4KK5D 3DJSA 4OBSA 3FRUA 2R0LL 2ZCKH 1XZWA 2ZF9A 3NCBB 3GSOB 1BG9A 4FHKA 4QOKE 1RJZA 3H9HA 4Z0BH 2JELL 5I71C 1MVUB 3CUPB 3EYUL 4IOSD 4QHMA 2N0MA 3MOQA 4OLEA 4U7KA 1E2ZA 2ZONA 5JYMA 4JQXA 1RIUL 1TETL 3ULVE 1TCMA 4LOUD 5I6OA 1FGVL 1YEJH 3ATAA 2VH5L 4XZUB 2HJFB 4OT1L 5JTWA 1XF2B 5F7UA 4FQXB 4YHYB 5CSBA 4C47A 1ZGLM 4NM8H 3LIUA 1Z9PA 5D2LA 4R83A 4UQBA 2W94A 3OKOB 1UGKA 5AUMB 5JW4M 3UMNA 2YQBA 1GAFL 3GFUA 3OAZH 3IGKA 3QJVB 5D72L 4HMCA 4PRNA 3NA4A 4M7KL 4Z7OE 3T6ZA 4J4PA 1DE4B 3TBSB 1IC1A 3QW9A 2XN9B 5KYUB 3F65A 5IQ7L 4LCCC 1JPGB 5T3XD 2IOOA 2Q9OA 2XLLA 3CFCL 2CBQA 3FCGA 3HI5L 3MV7E 1T04B 4AQ8C 1E9QA 4HZLA 1P4IH 3QZMA 4CNIB 1RU9H 4N0RA 3RWCA 4ESKA 4RGOL 4PW9A 2DWSA 5IB1B 2XN9E 4YDVA 2I24N 3S36X 3MA9L 4JZJC 1DBBL 1Y0LB 3STZA 3EFOA 3MROA 4M1DH 3LTVA 1CL7H 5JHDA 3VXSD 1UWGL 3K4ZA 4ZUWB 1Z3RA 1NUGA 1NGYB 1D5XA 2VRKA 5LBSH 5CP7A 1U8PA 3H9SD 3VFMB 3VI4B 1Z5LA 3F6LA 4X7DC 1QSEA 4P5SA 5B3NA 2AXFB 4H8HA 2XG5A 3NEEA 1EO8H 3LH8A 4R96B 5D4IA 4H1LB 1FNLA 1TKWB 5IFJB 1ADWA 3AY4C 5F8RC 3LZFH 2QPEB 2JH2A 2WNXA 1ZVSA 4HV8A 3VI4E 4XNAA 4AV4A 3ZHDA 4OZ4A 3VXMA 4UIMB 1JNNL 3HS0A 5DHXB 3OG4B 1Z3GL 4E9LA 1HVXA 1DBKL 5D9SB 5LAPA 3AMLA 5J6GA 3VFVB 4CMMB 1HEZB 2ZSVA 1AD0B 4NN6B 5DZOA 3LRKA 4LHQB 3VO0A 3ARQA 4ZO7A 3TN0B 1GCFA 2BP0B 2CKBL 3C6LC 1MHCA 1M56B 1ASOA 1JZEA 2MEJB 4U4IA 2Y6TE 3TT1H 4IRSA 4EN3C 5IESH 2XA8L 2XZAH 3ULVH 4XVSL 3QUZA 3BZ5A 1K5NA 4LEBA 3V4VB 5CEXB 2CMRL 3CFJA 5DS2A 5JPNC 4CSPA 1PDKA 2FBJH 5AVWB 2AV7A 4FXGC 2OK0H 2XPGB 1HZLA 4YHMH 4NFCA 6TAAA 2L8AA 1MW2A 3HRPA 1CFMA 4H40A 2WBJC 4KXDA 1UB5B 4ZOEA 3WEXB 1ASQA 3IVKB 5DK0A 3H53A 1HZHL 2ITDA 4U1GC 4PS4L 5TE6H 4M6OL 4HLZH 3K2IA 1WT5A 1E0OB 1VGEH 4K94L 1IE4A 5J57B 2WLMA 4P3DA 1OV8A 2IFFH 1A25A 2VIRA 2VXQH 3GIVA 3NPSB 3NSXA 2DQGL 4IDJL 4PJ8B 3FPXA 5EWIL 4DW2L 3E80A 1DBMH 5JOEA 1DEDA 1GIGH 2AAVA 3QFGA 5CR8A 3LIZA 2K7PA 1XGQB 5D2NB 2A74B 1PGRB 1V05A 4ZS7H 4ONFH 4OV5B 2R2HB 3EBIA 4NDMA 3TO2B 1YQ2A 2NY7L 2ATPB 1NC4D 4R3SB 2CH8A 3LH2L 2GSGA 1TTGA 3QC6X 1NDTA 4IS6B 4XMPH 4OLUL 2B16A 4HZ1A 4G82A 4BZ2H 3ECUA 3BIBX 2BNRA 3KL3A 4XPFH 5D2NE 5IMLB 4WK4B 3OAUL 1QRNA 2W88A 4ZFOA 5ICZB 3RVVD 1PBYA 4JNXA 2XXFA 5FK9B 4QRQB 4E0RB 2ZKMX 4RA3A 4LCIL 4KNUA 5AVRB 1FE8H 5C07D 3MJ9H 3ARFC 4WQOA 3AADB 5GRJH 2Z1KA 3LV3A 3ZIMA 4P3CH 2MPVA 3MLPA 2E4TA 3AG4B 1MHEA 3ESVF 5T5FH 4FLRA 2O26U 3D52A 5DJ2A 1ACXA 4JM2C 1BDYA 4A7GA 1S7QB 4UBDC 3WFHA 1RZ8A 4YDNA 3PHQB 1CMOA 2XBDA 1KSRA 4P4RA 5T3ZD 1EH9A 4Y8AA 2HVJA 4X0NA 5F89A 1WA2X 4KJPD 5J1AA 3MJ7B 1CVSC 1TU2B 5B1CA 1U4FA 3O4LB 3KBFA 4NO3B 3LSOB 1KC5L 1ITCA 3VH8G 4WNQB 2WYZA 1GC1H 2JXMB 3SSGA 2A73B 2E7MA 2WWKT 4CVXB 4NGHL 2HB0A 5IWLA 3O8XA 2JJVA 2UY7A 3SGEH 5E2VL 3I50H 2R0KH 3FOMA 2R8SL 5DQDH 1JOIA 2VLLA 5KSVB 1A3ZA 4ATWA 2CLVB 1R3KB 1W72L 2D7TL 1JZ6A 3KYOA 3VYPA 5T3XE 2IG2L 4R4FL 3T0WA 4L4VA 2YO3A 4JY5L 1T21A 2P5EB 5T1KD 4KOBA 1MJ8L 1ZT1B 1A9BA 3L2MA 2LLGA 3GSNA 3A67L 3VXSB 3V52H 4HX1B 1KB3A 1WD9A 1WJ3A 1I8AA 2WC7A 2PPCA 4G9FA 4Z7VB 5GJSL 3ZE1B 1JV2B 3H9SB 1E3FA 4K9EH 3F7KA 1YN6B 4YQXH 1NL0L 1KCVH 4GBXC 3ZHLA 1QSFD 4PJ7A 4V2BA 3U4KA 2UZIL 3FS9A 3VXSE 3F83A 1UWYA 1AC6A 4HHAA 5A2IH 1GSKA 3GZKA 4PTUA 3ZE1E 5GS2H 2OYKA 4ETQB 2ITFA 3H9SE 1BVZA 1AE6L 3VWKA 1OK0A 3I6KB 1KACB 1SXAA 2D4FA 1WGOA 2DI8A 3N6YA 3RU8L 4HISA 4PJ5B 5C0DB 3LPOA 2V3EA 3PGCA 3WJJC 3S36H 1YNLH 1I1AB 1D5ZA 4NHUB 1IT9H 1VB9A 2F53D 4WKZA 1B0WA 4ZXBA 1F4XL 3S4SA 2BO0A 5IMMB 4J12A 4LZKA 2LT9A 1MRDH 2Z31C 2YMXH 4JRWA 2APBA 2Q3XA 3EO1B 3ULUD 5TDOB 4HLZG 3FTZA 1PX3A 3GYRA 4GIPD 1THAA 1EV2E 3WIHA 5I0DA 1HNYA 5TE7L 1UA6L 3SDCC 4O2CA 5GS1C 5LN8A 1T0MB 3EDKA 1A6TA 1T6BX 2GT9B 2NY1C 2HRPH 1JP5A 2YIHA 3PJLA 1YJDH 1OT1A 1ETJA 3G6JB 5MERA 2XJLA 3MRHA 4B9JA 2AEQL 4J1UA 2A6DB 1KLGB 4K3JL 1FSKC 2EKSA 5DT1H 2WB1A 3M1CA 1FO0H 4H25A 3TCLA 3WN5A 5E8DH 4CN1A 3QIUA 3R0MA 4LBEB 1YNTA 3LXUX 4EZKA 3HMXA 4LLQB 3LKOA 1I9JH 43C9B 2Z7YA 1YC7A 3MJ8B 3MTRA 3KBHE 2FZ3A 3PJNA 4PWIA 3RWHB 1TO4A 1BP3B 3QEHA 1KELH 3WUWG 4A6YH 4LLUA 4DT2A 1G9EA 1F4HA 1OCCB 2JIXD 2Z6FA 3RHWF 4W4OC 4ZNCD 2A9MH 3EOBB 1ZLDA 3QI9B 2XWCA 2BC4B 3T65A 1WCQA 1B4TA 1NPUA 5SX4I 2OL3B 4OCWL 5I1LA 3BEVA 1HAUA 2OP4L 2HT4C 1U3ZA 1AZBA 5HYJB 5JORB 1BIIA 2D03L 1M05A 5E9DD 5T3XH 5D7LB 3ROOB 5IW6B 1CF8L 3O9WA 4D8PA 4QD2E 5E2JA 1AQMA 4JDVA 1P4UA 5FYJU 3DJRA 2E9WA 3HZVA 4A63A 4EOWL 1CFSB 3OJDA 3VGHA 1EHLL 2DQUH 2HRHA 3RB5A 4TUJB 4U1KB 3J2PA 4X5WB 3SZ6A 4AGQA 1KEMH 5D7LE 3WTWA 2FATH 4X50A 2X4OB 4G6FD 1A5FH 1D6VH 4AJWA 2NCMA 2E47A 3F7YA 2CUAA 1DDTA 4KVPA 3QEQD 3RLSA 2RJMA 2Z35B 3IDYB 1FV1A 2F1AA 4LSTH 4FXLA 2ESVA 3QSKB 2VQ4A 1A6ZB 3A6OA 3NCMA 4FNSA 5DJDB 5AOZA 1DN0A 3OKYA 1XSIA 3PDOB 2H2SD 4P07A 1RZKH 1VDGA 2VW4A 1RULH 2ARJA 5BW7C 2E6JA 1FP5A 2UYLB 3PDGA 4LXFA 1P6AB 5HDQH 2X7LA 4QT5A 1YEHL 2YEZB 3TXAA 2XWTA 1T1XB 4JLRB 1FNEA 4ZAKA 1EXUA 4NQQA 3VAEA 4O58H 4BFKA 1OPOA 3UTZB 2IPTH 3QARA 4D8OA 2O61B 2XKUA 2VUKA 3QQNA 4CSTA 4WFED 4B97A 4GI6A 4PH8A 5D7SL 4LKXB 4OJFH 2MTPA 2E74C 2XV3A 4F8LA 5T3ZE 2R4RH 3V4LA 5DR5H 2CJTA 4DIXA 4YBLB 1AXTH 1OK8A 3X1EA 3RFRA 4LLWB 2XTSA 3BN9D 5MEOB 1KCRL 4GW4B 1CDHA 4IK6A 4X6DF 4BQ8A 1QNZL 3H42H 1CU4L 2B39A 5DD0L 2GAZB 2OJEB 1OCWL 1QNIA 2K70A 3F04A 5GSRB 1FBIL 2J8OA 2AKRA 4EIGB 5G5DB 4DETA 3TYFB 1LNUA 4ZSOB 1IJ9A 2BIIA 3CMOH 3D69A 1GTNA 1ZANH 3HKZA 5A16A 2AXWA 1F41A 1V5JA 1YY8A 2FIKA 4U49A 1CGTA 3DX9A 4MJ5A 4O02B 4GKZB 3UPRB 1A02N 1EO7A 1RSYA 3W39A 2WCGA 3LZQA 3BWAA 5C0BA 3C8KA 5FLVA 1XH3A 3QWOB 4NAQA 1P5VB 4ALAL 5L6YH 3FH7A 1FFTB 1QSFB 4UT7H 5D6DC 5I1DA 4M1GH 4S1QH 2GCYB 2OL3H 1G0XA 1SNRA 3TO4D 3WELA 4XO9A 1KXVC 1U8LB 3LKNB 3QFJA 3QXVA 4WW2F 5BS0D 1YECL 4H8PA 3REWB 1DVFB 3AM8A 4B0MM 3S3CB 1B2WL 3DMMC 4ZW6A 1QSFE 2WTOA 4P5TC 2H6PA 2H6OA 1M71A 5KW9H 1HEJC 3PNRB 1MWOA 4W81A 3DV4A 4DP1X 2VJ8A 4ZD3H 3C2SA 1N5YH 2F53B 4LF3B 4AMKH 1YYLH 2EIZB 5EZIL 3VMNA 4IRJC 1PLBA 4MA3B 1RMFL 4JFDA 2F61A 3ULSA 1BBDL 1FVEB 1IILE 1LJMA 2WKGA 2XXCB 1LWJA 3OKKB 2QELA 2F5AH 2X9YA 3QPXH 4LSQH 1MVFA 3RNKA 5L0QB 2HWZH 3JTSB 2GTZB 4G3YH 1F90L 4PRHD 2F53E 4YDLC 4LFHG 5LCVH 1T4KB 2X4UB 4LP8A 3WO4C 3RE0A 5L2KA 5L7XL 1OEZW 4JFQB 3BGMB 5B8CA 2JB6B 1H3TA 3ULUE 4NC1C 3SB3A 4D9LL 5J7CC 5D70L 1I3UA 1I3RB 5T3ZH 4H8QA 4LRIC 1P7KA 5LVEA 4E9QA 4HUVA 4TM9A 3NAAL 2Y2YA 3TPUB 1VGKB 4M5ZH 4JRYD 2ZP9A 3DSNA 2JIXB 1KF9B 3E3QC 5C0CB 3FCSA 3L3OA 3CBJB 2W9EH 1CIUA 5FHAH 2ZF8A 1MRFH 2UWEA 2YA1A 5HDLA 2X70B 5I0ZA 3NJFA 2DD8L 5C0IB 3TF4A 5CLZA 5IUSA 2MQ0A 5HDWA 4U33A 5C0CE 1AY1L 3RWIA 2QKIA 2FEDC 5DLMH 4BUGA 3B5HA 2XNAB 3TJEL 3DO4A 3IGUA 4W9LC 5E8PA 4F2FA 5EBWA 3HZYB 3KH4A 4O9HL 3BD4A 1T20B 2LU7A 4UQ3B 3MV8A 1WG3A 2F8OA 5E9DE 5ISZB 3QQXA 3UG3A 4G6FB 2LV4A 4HKXB 1U2HA 5BOJA 2AJUH 1BVNP 4QO1B 4O02H 3T8XB 5I18H 3TFKD 1LO2H 1OP9A 4MD5A 4EPSA 1U2CA 1QBLL 2WVUA 1JUFA 5D7JD 1UC6A 4RFNB 4BQ9A 4XNBA 5DVLA 4TUUA 4XBEL 5ISZE 5K9KA 1DVZA 2VXVH 3VM7A 2MNJB 3HEIB 5EZJB 3HC3L 4HMEA 5JNYA 3RUGA 2EXYC 3SQRA 3EJSA 2XBZA 3QDGA 4YSEA 2KQMA 4NFDA 5KSBB 5DHDA 4GRLD 3QR1A 1JZGA 1R46A 3JT0A 4WENB 3C08L 2QZQA 4KVCL 3WIFA 4L2YA 3V6ZB 2JI1A 3UZEC 3AQDA 4WTZG 1JN6A 2AJYL 4Z3EA 2FLRT 5IB4B 2ED9A 5CUSH 15C8L 4JW3A 4Y9EA 5KSBE 3QCTH 1AQKH 2HUEA 2VKWA 1KGCD 2Z7WA 2YAOA 5GZOD 4JFYB 5GHWH 3ULUH 3IDUA 2KC0A 3X3GH 4K4KA 4Y16A 4WFEE 4FKHA 4YHLL 5GGSA 4BFIA 1AGEA 3RKPA 2OM5A 3S88L 1M7XA 1Q0EA 4NAJA 3DX6B 4N2BA 2NNRA 3SDXA 1RUAH 4AH2A 5CILH 3ZHKA 4HWNA 3G5WA 4ES8A 3PIQA 5JDSB 4P0DA 4JE0A 1TJIL 3OXSB 4WI4A 5I73C 5I8CA 4O51A 2LLNA 3MI6A 2X1OA 2EEAA 4JHAL 2I5YL 1G7PB 2FX8H 2IAMD 3C2AH 4YHZH 4ADIA 1JZ2A 1MRCL 2V33A 4WV1C 4MDIA 3H3PH 3EYVB 4ZODA 5GRXG 2XG4B 2YMOA 3FONB 3PLYA 4L1DA 1X7TA 3KLHC 1TNNA 1X6LA 2C9AA 5EIIG 1HILA 5F0PB 4C83B 5F7HA 2J43A 5IQLA 3L3DA 3FQNB 1MW3A 1XT5A 5FOBB 3OKDA 1KBBA 3HNVL 3MBWA 1P4BL 1PTZA 3V9EA 3S9DB 4L1HA 4ZS6C 3WEMA 1NCWH 2WLYA 5BV7L 2QZ5A 4QKTA 4JFZH 1MFCL 4LLVA 1MY5A 1WWBX 2NTSP 4ODWB 1UVQB 5BS0B 1BZ9A 2VN6A 4DUVA 1BYPA 2VN4A 4NZRL 4YGVA 4LLMB 3LHPL 1K4DA 3BAEL 3U0WH 4PQXA 4XTRC 4HCRH 3ATDA 3FU9A 3IT8D 4NT6A 1ZS8B 1BSIA 3DIFB 4PWKA 4OZFA 1YDPB 5AVYB 3BKML 5BS0E 3GC3A 1T89C 2Y7QA 3DDFA 3HNSL 3VD1A 4AL8C 1RZIA 4JDTL 2YWZA 5GZNA 3PABB 1QD0A 1F4WH 4YEEA 4RMTA 4HH9B 2YUWA 4JB9H 4P23A 3MXWL 5IW1B 1NGXB 3QQ4A 2L7UA 5JIIA 2ZYRA 4FQXC 4YHYC 1GKOA 5GS3A 3VE0A 2FGWL 2QLYA 2VDMH 3U82B 2BWIA 1KN4L 1V8HA 4I87A 1DFBH 2NT0A 1CLZH 2XN1A 3V4PB 2DTMH 1MOEA 1WZMA 3G5XB 3VU1A 1G7IA 5K1JA 3BE1H 4F7PA 3QS3A 4FG0A 1NEPA 5L4MA 2WWOA 3FHAA 3UZVB 2X28A 5H37A 3GNML 1SJHA 1BOGB 3L3GB 2YK1H 5AZEH 1UD8A 4JDZA 1BFOB 3ZSTA 4HXBH 4YZWA 4XMKH 1QPXA 4PGCA 3WG7B 4OFYD 2CKBA 1INDL 4BGDA 5C0GA 4ADJA 4HEPA 2DQJL 1L7IL 5LUMA 5AB1A 2DLEA 2M1KA 1MLCA 4G5AA 1A6UL 1Z9NA 4NQVA 2OMZB 1INQA 1CXIA 4YSTA 4RX4D 3UP1A 2EEDA 2IFGA 3LMJL 3NACH 5ESQB 4X83A 2L7JA 4EIUA 4FLSA 2WSPA 2IVFC 4Q0XH 5DD1L 4KKRA 2BSTA 3UJTH 1A3QA 2JKIS 3NJHA 3X12B 4ZW8A 1E4HA 2K4AA 2CHXA 3MUZ1 1KCUL 3ZTNH 3MA7B 2BOBA 3GM8A 3NTCL 5AEAA 4FI6A 3D3VB 5ID1A 2X89A 4TVPD 1OM3H 3BW9A 3DK0A 4MJID 3I74A 4RGNB 3GMLA 3UBFA 2R4SH 1IGIH 2UXTA 4AG4L 3IXAB 5DUML 1JHTB 2AK1H 3RWDA 2O1AA 2XWXA 2AV1B 4HJTA 3BPNC 3W2DL 4NN6C 4PJGF 1O7VA 4CVWA 4RGNE 3NDYE 3AW5A 4OZIF 2WANA 3ARZA 3TN0C 1Q9KB 1MWAL 7TAAA 4K3DH 3F84A 4KKBC 1P2CB 4FCHA 2ED8A 3HB3B 1X5GA 4PRPA 3RVUD 2WWNA 5BJTA 3TIDA 4ZTPH 4AIEA 1KGIA 1TZGL 5A43C 2VXTL 5EEVA 1PKQB 1UXWA 3ZDYB 1N8OE 4AUYA 1HYSD 3NZ8B 1S9VA 3N44F 1C9SA 4M3JA 2K8MA 2NY2D 4TMPA 4UM9D 3WIIH 1U8OA 2NXYB 2PR9A 5CJOH 5F7DB 3T2NL 5TE4H 1YMHA 4F7KA 3WFZA 2BSEA 1K4CB 1M2VB 1PKQE 4JJHA 1F13A 5C0EA 4X4ME 4QRUB 4UIKH 4JCLA 1O0VA 3R1GL 3UH8A 3RDTA 3LB6D 2BIOA 3PWPB 1J9SA 2ZWKA 4QLRA 4F7TB 2C4FU 2JKTM 1X5KA 1ROCA 4HDIA 3ARSA 3UTTB 3A6CL 3Q06A 2VW6A 4K73A 4PJ8C 4MQXD 3NPSC 3SGJA 2KQNA 3FT9A 4YAQA 4TVSa 4ZO9A 1OE3A 5HHOD 3T4YB 2ZOLA 3ZDWA 4C57C 5AOKA 3IJEB 3LKQB 1THCA 3PWPE 2VZSA 3IF1B 5MHSD 3FQWA 3FU8A 4APXB 2YQGA 2A74C 5D2NC 2GSMB 3EAKA 2Y24A 4AKOA 1HK6A 3NZUA 3C5XA 2QPFA 3EJZD 1E8ZA 5EU6D 2Q8AL 2CJUL 1E4XL 4MA1C 5JOPE 4BDVA 2G5RA 2B1AL 2NY5L 3HVDA 4KRPD 4XC1L 3WNLA 3GUTA 1CBVL 2IOMA 4JK0D 2X09A 4ANKA 3B2PA 4O5LL 2YD1A 5C9KA 2H8PA 3GK8H 3KEHA 4WJG3 1J88A 5GJTH 1A4KA 1M3JA 1AXIB 2QR0A 4JE4B 3Q6GL 1H6UA 1EZVY 1ORQB 4W9JC 1B88A 1L6ZA 5I1HL 4JFVA 5INDA 2JMRA 2OXHB 3OC5A 3ETBJ 5E8OB 4X4XA 5CBEA 4NWUH 4MXQD 5FA4A 4G6JH 3CAFA 3JWDL 3OTTA 2BVPB 5D7EA 5FEBA 4BYHA 3ARBB 3BFQG 4K3EL 5I1IH 1QX1A 2IPKA 3TV3L 4PJGE 1EHAA 3CX5J 5JXAH 4X5XB 2PWFA 3BVVA 3L5IA 1ZLSL 1PF3A 3BVXA 1H5BA 3L7FB 1DBAL 1UOVA 4U6HB 2NY4D 4KZCA 4TUKL 4QXGL 4RISH 3Q5OA 2VDNH 4MYWB 5BUAA 3TNMA 3V5HB 1E8XA 4R7DA 4ZMPA 1MLBB 3MRFB 5ALBL 4M6MH 3U6XA 2HG5A 3TWYA 5KTEH 2FO4B 2OJZH 1NCDH 3CSBA 2HJKA 1PZ5B 3UDWA 4NUPA 5DEFA 4A2LA 1BVOA 5IKCA 4L3EB 1AHWA 3BVNA 5H35A 1ZD6A 3PNWB 1OGAD 1E65A 1NM4A 4PJEA 1RP9A 1E7VA 1X5FA 4YHKH 2HJLB 4QRTB 4J4PD 2FEEL 4KOCA 2X0WA 2BIMA 5I76B 3R8QA 1HE7A 3L4ZA 4P46A 3SGKC 1U92B 4YE0A 1BXUA 2D2OA 4KDWA 1R0AL 2CR0A 3SPVA 1JD9A 3IFLL 3U2SB 2J57A 5E6IB 2ZKXA 1Q72H 5DJXA 4F20A 2DMGA 4Y9BA 3T0AA 3LYRA 4F5CA 2XN2A 4ETYA 4TTGA 1KCSL 4MS8D 5JHDD 1T1YA 2EYTA 1UM6L 1S6NA 1G6RH 3POHA 4MJIB 4P99A 5C3IA 2BZDA 1A7QH 3CDZB 4GIOA 4DERA 2TSBA 4M43L 3DUUA 4KK8C 1TOXA 3F62A 1F02I 4Y9FA 5KUMA 1QSED 3DVNA 3JV0A 3T8MA 3IJSB 3FU6A 4TOYL 1I1AC 4TVPE 3ZX1A 3N1PC 4FMKA 3OWEA 4MJIE 1NAMB 2UVEA 1L0QA 4QGTA 2QQQA 5E94A 4JG0L 3BOVA 4KJYA 5IG7A 1PZDA 2R0ZH 5TDPB 2BNQB 2CK2A 3SY0A 2ICWI 12E8L 2VDPL 4GAJH 3VXMD 5CAYB 2HPOA 1FNHA 4M29A 1WICA 1ACYH 1MFAL 3FZUD 1NJ9A 2X42A 4FXKA 5D1XB 2VR8A 4HWUA 4N8VB 2EO9A 2NY2B 4AGPA 1KB5A 2HVKA 4UM9B 2XZZA 2Z8SA 3L48A 3O3BA 1SQ2N 2NQ3A 3HG3A 2QDWA 3VFOB 4RIRA 3SE4C 1EEZB 1G9NC 3D4ZA 1P7QA 2EACA 1IEAB 3LZLA 4IRSD 3AQZA 1CDIA 2PW2A 4UU9A 3RZCB 1UM5H 2QQLH 2QDVA 3K2UL 3QUZD 5BZWA 4AE0A 4KDTA 3MR9B 4M1CD 4CBZA 1D9KC 3FQRA 3GS7A 1LDPL 4HUUA 1AKJB 3QI9C 3P30H 3WKQA 3BIKA 5IBTL 1WSST 2YWYA 2CDFB 2X4PA 1K2DB 2PYEA 1JNLL 2H7WA 4IIQA 4RQQB 3HZMA 1YYMH 4LCUA 2OAAA 3B37A 2IV9A 1KDJA 3CXDH 3H2QA 4HWBH 4YHOH 1ZA3A 3D2UA 2VLJD 2VOTA 3EBHA 5EU6B 1IEBB 1EGJH 5HHOE 3ULAB 2VT0A 2F1BA 2BVUA 2CRIA 5IW3A 4QHNA 1P4LA 4FQIL 5MHSE 2BCMA 2YZ1A 3KYNB 2BY0A 4K07A 4FZEL 3B7SA 3RVVC 4P5MB 4RCAA 3H0TB 5EU6E 4CKVX 2OCCB 4NN7B 1HT6A 4A7SA 2EDYA 3CLEL 4A1RA 1HIMH 3IDYC 4KMTH 5G55A 4M8VA 4HK3J 5DI8B 2W0PA 4OLZL 2Y3AA 1QUPA 3VDCA 1OTTC 8PAZA 4N0UB 3EO0A 1Q1JL 2ENPA 2BNRD 2E9GA 4HHGA 1J7VR 1UACL 1GY1A 1ZE3C 4U31A 1QRND 2NW2B 2E9BA 4RAUA 1LE9A 1VFAA 3QG7H 4TVPH 3UAJD 4RLDA 3ZY7A 3PWNB 2X4QA 1E4WL 1IAOA 4EEEA 1JPST 4LMQI 1IM9A 1IARB 1XBRA 4ZQTA 3O45A 3FRUB 1S5HA 3WFEH 4Z77B 1A3LH 1O9VA 3ASWA 3MCLL 2XI9A 4QYOA 1OHZA 4ZZKA 4HOMA 2PTUA 1RJZB 1OTUD 3F00A 1NAMH 3H9HB 3PU7A 4KY1H 4AMXA 2WWMC 3L4XA 2YSSB 4YBLC 4K3GA 1UWXK 3NCYP 3SBWA 3SDDA 2ZD0A 2GHWB 2C7FA 4PJAA 2LHAA 4B5EA 1OAUH 3CX2A 1JGLL 5JUEH 1FYTA 3BAYA 3BCFA 1GGBL 5D2LB 4XCYA 1JGVL 3LEXA 4GO6B 3FTGB 4LDCA 1BREA 4E5XA 3N42B 3BAIA 1WLHA 3F2LA 2F68X 5EEXA 1SHSA 4XNYH 1XIWD 3D5OF 2KZKA 2ZYIA 3N40F 3SKNA 1MG3C 3MOBL 3QEGH 1S2EA 4XB7A 2NUTA 4AYDC 4U05A 5D2LE 2CGRH 3FQYA 1KG0A 2YPKA 1YA5A 5KVDE 3O8XD 3L4YA 5SV4A 5BCAA 1E9QB 4HZLB 1QLEL 3C6EA 4AM0A 4FP8H 1N5AB 5DZ9A 5KSUA 3ARGA 3S8WA 2IQ9H 3N1MC 4U6YB 2ZOTA 4PB0H 4H0HB 4YDVB 3C9NA 3S34H 1UH3A 4L4VD 3NEOA 3BD3A 2ETWA 5I2IB 5JLZB 4XMXA 3MROB 3HAEB 3QISA 3QUXB 5DTFA 5JHDB 2VUOA 1DVFC 4HKBA 4FADA 3L1OH 1M42A 2QPUA 4G9FD 1D5XB 3TS8A 1GYAA 3HHSA 4F2MB 4UT9H 1XF3A 1Z5LB 3UROR 3C87A 3X1FA 2APFA 4OB5H 5H94B 5JHDE 3HA0A 1LK2B 5EDSA 2OLDA 1R33A 5DMIH 5AW8B 3GLZA 3OR6A 1NOAA 5EORL 3S7GA 4UMSA 1TZOA 3CXHJ 4OY9A 3VWKD 4HKZB 4HV8B 4JG5A 3LQZA 4JM0A 5L0QC 1QSEE 3CLFL 4QHUB 4X7FC 1KEGH 3L5XL 1B9ZA 2FEEI 1K6QL 3R8BB 3VM5A 5J6GB 2PO6B 3T3PB 2Z9TA 4E41B 2ZSVB 3TEYA 4G8IA 1NIEA 1JVOA 4ZXBD 1JGUL 4O2EA 4DGVL 3VXME 1JAEA 1X5HA 4L8CA 1MHCB 4YHIA 2YGPA 4IRSB 1JWMA 3T3PE 3VA2C 4E41E 2MOQA 5BZXA 1IVTA 4LCWB 2MCG1 5TH2A 5BMFL 3CPLB 3NT0A 2H9GB 4XODA 1U6AH 3WTSA 3B2VH 5KAQG 1P7HL 1OGTB 2RD0A 2JJTA 1URIA 1D2OA 3QJRB 4HJ0C 5ETUA 5I1GH 6FABH 1JK9A 4XWGH 1PDKB 1HESA 3X11A 2E6PA 2AV7B 3QIUD 3GUFA 4Z7UA 2XFXA 1J8SA 2YAMA 3WENA 3KBEA 3QH3A 2IJ0C 3D12B 5DK0B 3S2CA 2X2JA 2KZBA 4ES9A 3V0WH 2ZUQC 3D6GA 2K9FB 1YCSA 2Z0UA 1SDAB 2P8PA 4X9HA 5KVDH 1MNUH 1AD9A 4P3DB 1J5CA 3D07A 2ZUSA 1JWUA 2GUOA 2VIRB 3BVWA 3K80A 5AB0A 4W6XB 1N4XH 5EEWA 5DJZB 2ZOKA 1XCWA 3QORC 4AQAA 4KX8A 3ZJAA 1ZLVH 1QYGL 3C6SA 2CCLA 1U8NA 4YUEL 3L5WB 3O9WD 1IBYA 5PCYA 3MNMA 2XQBH 5JMOC 1L0PA 4NDMB 4QYAA 2D0FA 2J5LB 5F6HJ 4XI5D 4DQOL 5C0FA 2GSGB 1NDGA 1CTNA 2YRLA 1C8PA 4HEMA 5EBLB 3ZE0F 2XWRA 4WY7H 4PGJA 4GQZA 3MU3A 1IGJA 1K85A 2XQYA 4H5SA 2QADD 5FO7A 3EYQC 4P05A 1SYSB 1G7QA 4ZO6A 3WGVB 4J6IA 3SE8L 3NH7H 4Q9RL 1QKZL 4DPBX 5DD5H 2ESVD 1U8HB 4N8VG 2BNRE 4XNQA 1RZFH 3DPDA 1QRNE 5I19L 3BT0A 1Y18A 4V33A 3MLUH 4PJCB 4UZSA 2EC9U 3SE9H 2ISDA 1YEFL 2PTTA 5DZJA 5DJ2B 4OTXL 1JI2A 4M62H 4PIRF 3U9WA 5DMKA 4P9ML 4KRMB 4ZAKD 3P4NA 3WFHB 1RZ8B 3FCTA 4GMTH 3VD7A 2AS5M 1SFHA 2DMKA 4EO5A 3LJ3A 5F89B 3APNA 3G5ZA 3UAEA 5J1AB 4CSSA 2I32A 5JIMA 4GS7B 3FQ2A 5DQ9B 4B7LA 3MUY1 5A2FA 4UINL 5T1LA 1J1XL 2IH1A 4RDBA 1H3VA 3SGDI 4L8BB 4M00A 2OTUB 4K8RC 1KT2A 3SBPA 1A8JH 1QFUH 2CR6A 1YNTF 4PFEA 2XT1B 5HYEA 3PJSA 1ADQL 1K8IA 3B3IB 4GKLA 1YHPA 4R5TA 3ARPA 3BUYA 3GSVA 5CD3A 3CXFA 4TSCL 4X99A 1UHVA 2VLLB 4FN0A 2YD4A 3CIQA 3IDXH 3E6HA 2FLMA 4UZGA 2C3GA 3FOLB 4WUUA 1VZGA 3FAWA 1WPCA 1T21B 2A6IA 3X14A 4TUOB 2FT8A 4Z95H 4B27A 3FQ4A 2R29L 3GSNB 3MJGX 4WDIA 1JSYA 3VVVA 4DO5A 4W6YB 5C0BD 4IHBA 3N2JA 1JVLA 5D8JL 3V0JA 4GSXA 3FC8A 2HZHA 4L4VE 2VDOB 4TV3A 2RACA 1RZQA 1NGPH 5KVFL 4KQ0A 4JKNA 1F11A 2B1HH 2CLRA 2OCFD 3QFJD 3LIZH 4G9FE 1S7TB 3GIZL 2XKNA 2RIKA 4PTUB 4S1DD 5IY5B 3IGLA 3VWKB 3L2LA 1QHPA 4PJ7E 3FSVA 3EDEA 4GQPH 4JX0A 2CO6A 5DUBA 4XP9L 3SE3C 3TH3T 4C8XA 5B3JF 4MNGB 4UV7L 1W15A 3FB7A 5I66A 1JCVA 1KBKA 3MZTA 1D5ZB 2A9NH 3L5HA 3VXRA 1T6WA 3S4SB 5TK2A 4RH4A 4DN4H 2W0FA 3M1BB 4JFDD 1MXDA 4DO4A 4I4WA 1HL8A 2W65B 2ZX8A 1F00I 3GSQA 1F4YH 4XVJL 1N2RA 3EBAA 1CGSL 5ADPH 1A6AB 4GO9A 1NGQL 3E8VA 3EHBC 2XIBA 4NJ9L 4KAQH 2BIQA 5BVJB 3BUPA 1O6VA 4WHTA 5IUCA 4O2CB 2PW1A 4Y1SA 1MJUH 4M4RB 1A6TB 5L2KD 2J21A 1AYOA 5AKRA 3L9BA 5MERB 3MRHB 2ZXQA 1EUTA 3P4OB 1NMAL 1IC4L 2EKSB 5LGHL 3OLGA 1MJ7L 4H25B 2X1PA 1MCSA 4R4NC 2HTKD 2J1YA 4XPTL 2BRRH 4WKXA 3L4CA 1P7BA 4ZFZB 3LN5B 3NCWA 4L8DA 2DL9A 3GBLA 3LKOB 1MHPL 5FUCE 2EXWD 2X6UA 1V54B 1ED3B 1OW0A 2CA3A 1R3IH 3P0YH 4G59C 4S2SA 3IDJA 4L0YA 5CNHA 1ZLWK 3ENEA 3HNTL 3GHBH 3MFFB 4OZGA 1R24A 1WVZA 3IU3B 1I7UA 3EADA 1R3JA 3T65B 2J1ZA 3QPQC 4NCC1 3BP6B 1BZEA 4HBQA 1FNFA 1CS6A 2F7PA 3BEVB 5I1LB 1TTUA 3HN5A 3VFRB 4CC1A 5SX5K 4MDJA 5DZLA 2OS7A 1BIIB 4RGNC 1M05B 4YWGL 4YSSA 1A7OH 4OJDH 1YEDA 4JGMA 3S3SA 3TONA 4UNIA 2VN5A 4EMZA 3OJDB 2KDYA 3DI2B 4NB7A 2E4FA 1IJNA 3BO8B 5FW6A 1Q94A 3MGOA 3CVIH 3BZEB 3CVBA 1GGTA 3HB3C 3CZUB 3K7UA 1N9PA 3QDHA 4AGNA 2ESVB 3MMEA 2ZUXA 4ZZFA 1KJVB 5I5MA 1P84K 1DN0B 4PB9L 2H3XC 1YUKB 3EGDB 2W0KA 2ARJB 3O81A 4ECNA 2NXYC 1E6OL 4Y5YA 3QDGD 2Y9RT 3FL7A 3I9GH 3KPPB 4QT5B 5E5UB 3RL1A 4OI8A 2F8VA 4TNGA 2ESVE 1HHHA 2N3JA 3HE6B 3IE4A 4LIQL 4NBXB 2HRLA 3QC5X 4PUBH 1EXUB 4ZAKB 5GZOC 4NN5B 4UQAA 1B90A 3AACA 5E2UL 4WO4A 1LE5A 1P0SE 4ILDA 2PCFA 4XPHH 1UGNA 4ZPTA 4L29A 1SVBA 2P9RA 4G9DB 1FFNB 4K2UH 1ZGLA 1HJBC 1ZT7A 1MEXL 1AQDB 3O6KL 4H20H 4PS8A 4RFOL 1DLFH 2VDLL 1GSMA 3KNBA 4Y16D 5L8KB 3TBYA 3WIHH 1AHMA 1RZJH 1RIHL 4Y4HB 3AJ7A 4OUUA 1GJWA 4YSAA 4MMYA 1U8KA 2VR3A 4RBPK 1UENA 3I6LD 1DQQB 3WXWL 1AKPA 3S35X 3M86A 3GSRA 1WQVT 4KKLC 2LU5A 2YQ2A 2BDNH 1BEXA 1YC8A 2UWEF 3MYJA 3AU1A 4ZW7A 1F2XK 1LNUB 1WUZA 3D69B 3STLA 3HMXH 3U2IA 2QL1A 4DTGL 3K2KA 4NZTL 4MAYB 4MJ5B 4HAKA 2ADIB 2Z34A 4A67A 3DBXA 4HA1A 1AC0A 4JR9L 1FZOA 4NJAH 4GQ9H 4J8QA 1IC5L 4DGYH 4XPGL 3BWAB 1SDDA 3C8KB 4MAUL 2IANA 5C0BB 4WNJA 4ZUVA 3K6SA 1N6UA 4N2GA 1AJ7H 1SEBB 1OAXH 5D1ZI 3IDNA 5I1DB 5L8LB 4OFVA 3OD3A 5J9PA 5ACZB 4HZAA 5C0BE 1URLA 3U4AA 5EULV 2AEPL 1A3RH 3ARBC 5I6LA 5ITBL 3I75A 4LSVH 1SN2A 4LVOC 4G6KH 3A4FA 1M71B 1IZKA 3T3MF 4HUKB 1RJLA 5IHLB 2GABA 1U0QA 3C60B 3KL0A 2YC1A 5E4EB 4BHUA 5DYFA 5E1IA 4MA7L 1N12A 4OJYA 3U0TA 3I6GB 5GZND 1JFHA 5EZPA 2Y0SA 2H1LM 1CF1A 5EBMA 3ULSB 4P23D 4YBHA 2EXSA 4OD2A 1LWRA 2GC4C 1Y6NR 5GGVH 3S5ZA 3DGDA 2CSPA 1AFVL 3MRCA 3N40P 1IAIM 4XN9A 4JFDE 2NW3B 2ZE0A 2APTA 2P48B 4PREA 1A65A 4QRPA 3TH4T 3JVGA 4FJZA 2B59B 2EEFA 4PRIB 2HKFH 3ES6A 4D9QD 3FQUB 5K59F 4L18A 1S78D 3SODB 5IHWA 2DM3A 1D5IH 3THMH 1NMCC 4MB5A 3RY6A 5L2KE 1VF5C 3O6LH 1B4JL 1Q9OA 1XB8A 3SDXF 4HUVB 4Y2NA 3UTQA 3EJYD 2WTRB 5ILTH 1D3CA 1PLGL 3UBXI 1IGYA 1GRWA 4YJZL 2YD2A 3DSNB 4LSRH 1TZAA 2QMKA 2QGDA 4PJHF 1F3RB 1YPZF 2P46B 4XCEA 5KJRH 5E6IC 2F08A 3GTVA 2NZ9C 4KH9A 3ZDZB 1CGUA 3EH2A 3MXVL 4O00A 5D71H 1JIBA 2CO2A 1KCKA 2WIIA 5EF2A 3ZQ9A 3HG0A 1KY7A 4EI5B 3FFCD 2D7OA 4NLAA 4BSVA 3HRZB 2IBZX 3FT2B 1L9PA 4WHYH 4HIXH 5SWQB 3RWIB 2APXA 4D0DA 1G0DA 5DFVC 2UWEE 3TCTA 4YR6A 4MGXA 3ZDZE 3MLYL 3QIWC 3IKCB 4NRZA 4IGBB 4Z7QE 4JRLA 2ADGA 4N5UA 2B3RA 1NOLA 35C8H 3NZHH 4NHCL 3MV8B 4OVVA 5DCCA 2HTLC 4MQ7A 4PTTB 2X89D 5FV1L 2H41A 4ICWA 3VX0A 4FC3E 1CLYH 1QW8A 1D2PA 2EO7A 5FC9A 5C7XL 1GTFA 2UZYA 4JUTA 2LAAA 4MD5B 4UOW0 3RVUC 1D7FA 3IDGA 3HG5A 5GRZA 4CW1A 5I6KA 4FFVC 2GIXA 1JUFB 1A0QH 4GFXA 1GZHA 3RWJB 3MV8E 2BVQA 3H56A 3S4SG 3US0A 5D1XC 1JTPA 1CFVH 1UYWH 2Y4SA 4NZUL 2NTFA 5JNYB 3O6FA 1PNCA 2NY2C 4N2OA 4NQEA 4XOCA 2VZ3A 5D5MF 3RUGB 3TX4A 5E1AA 2YN5A 3WTVA 3QDGB 1DANU 1QPPA 1MFNA 4PRPD 4JKLA 2JKXA 3WIFB 3T3ME 2QSTA 2ZCHL 3WNNA 1S7VA 4ODTL 3RZCC 1EDQA 3W57A 3RUGE 4NUJA 1HYRC 5FA3A 1N59A 3QDGE 2YEVB 3ARDA 4TPRH 4W9KC 6PAZA 3UO1L 3SBQA 4QJ3B 5EO9B 3BLPX 1IMHC 4JKWA 4QY8A 4Z78B 1SUHA 4KKPA 4MQXC 2WJ5A 5LO7A 2BSED 1WAAA 3DURA 5IF0B 3KS0J 4BA8A 2X40A 3C8HA 1UG9A 5GGSB 3KLDA 1JG9A 1IVLA 1AGEB 2FX9H 4NERA 3RDTD 1NAKH 4I1NB 4JEGB 5IJKA 1KTDA 43CAA 4Y2OA 2CM6A 4UB0H 3CE1A 5E51A 4AH2B 3EJZC 5HI4C 2Z8VC 5F44A 5FGBA 5CZVH 4AYSA 3PIQB 3WAJA 1KXTB 5K59E 2VITA 3CZFB 1IL1B 3JVFC 4O51B 3ROLB 5I8CB 3DSFH 3OLIA 3UIYA 1FLRH 1WP6A 3SDXE 1BAGA 2Q20A 5ACLA 3HOGA 2OTWA 2OW7A 4N1CA 4JO2H 4NN7C 3WCYA 2Y72A 1NSNH 1E5CA 2UUDK 1KPUB 2WZ5A 2WSDA 4X6BA 3L3DB 4A2HA 4F93B 1TXKA 4D9RD 5IP4A 4X9IA 4I77H 3MBWB 1K72A 3DOHA 2CPCA 2EE2A 4MXQC 5E5MA 2K6ZA 4PLOB 4OGXL 1UADC 2AABH 5I1JL 4K5OA 1BD2B 4XP6L 4P04A 5GRUL 3SCMA 4LLVB 1T2XA 3WS6A 4AGLA 2XWJA 1ZJAA 3S35H 1ANUA 2V5MA 3IJHA 5L9DH 3A23A 3FN3A 2IH8A 4KK9C 4J6RL 3WD5H 3GXNA 4YGVB 3MBXH 2DWTA 1K4DB 1ZJBA 4HXAL 3BH4A 2F7IA 2WGXA 4HIJA 3QRGL 1BZ7A 1I7ZA 2WVTA 4NT6B 1IBGH 2K7QA 1NFIA 1BD2E 2YSTA 3LVEA 4PI2A 3RTQC 4OZFB 5LLIC 3FB8B 1BFSA 1YMMA 3D0LA 1IGCH 1VPOH 1RZIB 4CJ1A 1NGZA 5TF1H 4FQJH 1JHLL 4JQXC 1PSKH 1T0NA 3QUYB 3QQ4B 5GS0L 5ADOH 3VRIA 3EG9A 2H45A 5AOJA 4KV5F 4OZHB 4HFWA 4XXWA 1I8UA 1TZHA 3Q05A 4XAKE 2WZPA 4WUKL 4XP5H 4Y4KA 1J9CT 1H3PH 4GMSL 4JUSA 4QDGA 5DEGB 4XCCH 4F7PB 1DJHA 3WHXA 1DDHA 2BJML 4WHYG 4Y8DC 2IXQA 3GZOA 3UYRH 2D31A 4UDTA 4PGCB 2X1WL 4UMGA 5T5NF 4RAVA 1EXHA 5C0GB 4WGVB 2X2IA 1MFBL 1V7NL 1RPUA 4WSKA 4QRRA 4HOXA 1MLCB 3CDYA 2TSAA 1XMEB 3VD9A 4CN4A 5C0NC 4NNYA 1W6WA 1INQB 2EAEA 2JELH 5CGYC 3EYUH 1U3HC 3QUXC 2CO7A 3VI3A 4P46D 1SF5A 5F93C 1EK3A 2BSTB 1RIUH 1SJEA 5SX5H 1TETH 2G0KA 2NCEA 4ZOCA 1FGVH 2LABA 2VSCA 5IGXL 4OT1H 2VL4A 1PD1A 2HA1A 1QHQA 6PCYA 3WDHA 2O6CA 2BOBB 4HUNB 5FWRA 5ID1B 1MQKL 1MH5B 3BWUC 3MRKA 4RWYL 4OLWL 2I9TA 1GAFH 3VD2A 3AT9A 3DO7A 1BJMA 3BW9B 4JQIL 1G9HA 5D72H 2BCKA 2BX5A 1WWAX 4M7KH 2BFGA 4DN3L 4YO0A 3RWDB 4TRPL 1TTBA 5IBUB 3GHPA 5IQ7H 4U3HA 2PO6C 2H1PL 5FFGA 3CFCH 3HI5H 3OKLA 1SJVA 3N41B 4N0FA 4GSDL 4S1SL 2N01B 5E8NB 2ZYSA 1KMGA 4K23L 3UACA 4RGOH 2APSA 5BJTB 3PDDA 1JGIA 3CH1A 3CQQA 1DBBH 3MA9H 4IRSC 5EC2A 3TIDB 7FABL 1I8IA 4HT1L 2IQAA 4IMLA 4PCYA 1UWGH 2AQ1A 1B2YA 5D1QA 3Q3GB 5F7FA 1TCRB 3GMNB 4OZFH 4JG9A 4ENEC 3TBTB 1IBFA 2H3KA 3A47A 3CVHA 3NRPA 5IV2B 4NCC2 4PRPE 4MJ2A 4YFLF 1YMHB 1BF5A 5DJAA 2K0RA 4PCKA 2CM5A 5CSZA 1P7QD 1WFIA 3WEAA 2UXVA 1DVYA 2WVVA 3KBPA 4BM7A 1LD9A 3EOTL 2NMSA 4W70A 4BZ1L 2NYKA 3FO9A 3MUGA 5B1KA 2EH8L 3T4AC 2IGLA 2WXNA 2YLKA 2C4XA 3OQRA 4I1RA 2CZNA 4YK4C 4BCXA 1LXMA 1T22A 2ZG1A 2WYIA 5D1ZA 1JNNH 3NFPA 4U1MA 4PJEF 1KWGA 1Z3GH 3QT2A 3EGXA 1DBKH 5E23A 5AG9A 4P2CG 1GS8A 2FECI 3OX8A 4WSJA 5FX3A 2X6BA 1XGRB 5H37H 5KJ7E 4HKJB 3V4UL 5I0WA 2PYED 1CFQA 1WC7A 3MRLB 4R7LA 2L4OA 1KYAA 4J5VA 1UJ3A 1P69B 2V9QA 1DEEA 3GO1L 2CKBH 3Q44A 1JV5A 1M1XA 1E4JA 3OZ9L 3HN3A 3D2UD 2J5LC 4NKDA 1U8CA 4KU1A 1ADQA 3VG0L 4BDVB 2LAGB 1I1FB 3KWXA 5AW2B 4JG1L 4XVSH 2HX8A 3WEOA 3GUTB 1DQML 1BZOA 4UTCA 2A6JB 4MX7B 2CMRH 4BE5A 5F9OL 2G2PA 1LDSA 4PBXA 1WFOA 2QR0B 1FVCA 4D9RE 2FDBP 4OIBA 2NY6B 3O3AA 1FLTX 1HZHH 4GI9A 4PS4H 4HIEA 4M6OH 2R29A 2EEXA 2ZUYA 4YE4L 1KZQA 1OTUC 4K94H 5CIPA 5FA4B 4N0CC 1JDDA 3D1MC 4HUXA 5E5RB 1GZPB 4AX3A 1H8SA 4IDJH 2DQGH 3RWFA 4DW2H 2W1NA 5EWIH 4IKNA 1IM9D 2QQNL 4OFPA 3PWUA 3PE9A 2W9DL 5BPPA 4G83A 4JHZA 5BZDA 2IPKB 1X9LA 1F86A 2XUWA 1G43A 1ID2A 3UBXA 4XHJC 1LGVA 4OM1L 2FB4L 3N0PB 1H5BB 5B39A 4M6AA 4MNQA 2NY7H 4ZX4A 4EI0A 1X5IA 3GQFA 3QK0A 1G9ML 3HIZA 4OLUH 2VCOA 2VLKB 3SDDD 4NENB 5HYQA 1UUNA 1U2YA 3I84A 3OAUH 5I0VA 2GYSA 1FYTD 3LNEA 5IWLC 5DEFB 5FGRA 3V0FA 5H4YA 2PWDA 4LCIH 3SJVA 2YD7A 2B15A 2EQDA 1T3FB 3OB0H 4KMQA 1G7MA 3KHOA 1EFQA 5H35B 2Z93A 1WO2A 3HCVB 3IJYB 4BD4A 1ESOA 3P3SA 2EYRB 3KLQA 3MX0A 1D7BA 3DV6A 4QIRA 2CUMA 4P46B 1VCAA 2A4CA 2J8UA 4L1LA 2PWGA 3ARGD 3CWGA 1W80A 1UUSA 5HGDA 4AK1A 5LAXB 5LG1A 2IBBA 3T04D 3VFPA 2C3HA 3VWJC 3GBEA 3VTAA 5EFIA 4PJ9A 4CKQA 1CYGA 3IJ9A 2EYTB 4PBVC 3VWKC 1R5VA 1KC5H 1RK7A 1A4BA 2YUZA 2YMTA 1JPEA 2BSCA 3CK0L 4OZFG 4YBQD 3KPMA 5CCKL 3TFBA 3VQLA 4NGHH 1ZHBB 1KTLB 1W0VB 3UTPE 3E9UA 4F5CE 5E2VH 2KT6A 1G7JA 1PL3A 2R8SH 1R3LA 3WLWD 32C2B 3DIVA 5E94B 3MV11 4KJYB 2FK9A 2O30A 2C26A 2NXZD 1GS7A 1XCQB 3CHRA 3BP5A 1W72H 2D7TH 5E6SB 3SY0B 1WZKA 2YN3A 3WJMB 5IB5A 2IG2H 4R4FH 5ITFA 4G8EB 3GMQA 5FYKD 1MJ8H 1NKOA 4P59L 2XQYK 1HHJA 3A67H 1A47A 3CZEA 4FXKB 3UEQA 4F2EA 2BXYA 1MCPL 3ATEA 3JV6A 4Y2DA 1O5PA 1KB5B 2HVKB 4NQDA 5FUCC 1L5GA 5GJSH 1UOKA 2YD9A 2BVTA 2FWOB 3P9LA 3IGAB 1NL0H 5H37G 4WNSA 4HGWA 3ERXA 3HI6L 4G7SB 4U1NB 5EU3B 2UZIH 5CM1A 4NO0A 4C55A 4LHUB 2PW2B 5HHQA 2YAEA 1IKNA 1P6WA 2V5RA 4HEPG 4KUCD 3DX2A 3LPWA 2BSRA 4WU5A 3UAFA 1M6OA 1YYCA 1TVHB 1AE6H 5BZWB 4FNQA 4N22A 4Q89A 3U6RB 3RU8H 3FQRB 3TNNB 4HUUB 3K6NA 5LBSA 3BIKB 3QJFA 1X3DA 1PY9A 4L9DA 2X4PB 1F4XH 2Q2LA 3VXNB 4P2OC 5IOKA 2PYEB 4IIQB 3AS0A 3HZMB 3BKCH 3MYZA 2WXIA 4MKTA 1ZXQA 4RESB 4ELMA 3TTYA 4JGJA 2XJKA 5TE7H 3VXTA 1UA6H 3BAXA 4CVZA 3FTVA 2PYEE 3WTTA 1LP9A 1AMXA 3VACA 1MCWM 2VM9A 1B0GA 3GTNA 2DIBA 3KMDA 3FBKA 2AEQH 2UVFA 4IDLA 2WZ0A 1XCTA 4X6CA 2EICA 4K3JH 3QHZL 2OSWA 5IBUG 5A40E 3NK4A 4GAGL 3N85L 5FO8A 3JBG7 1P5UA 1OCZB 2OFQA 4UQ2A 3BUQA 3BGAA 2F5BL 2YA2A 3PXHA 2XSKA 3Q1SL 3QYCA 3CH8A 3V0IA 1X5JA 2HT3D 3KR3L 3EO0B 4ELDA 2A83B 3QJUB 5LGJB 3ZYZA 1RUQL 4LL4A 4NOBA 4GG6A 3DX1A 3HE6C 1C1EL 2JB5L 1KGWA 2J25A 1KIUA 4OCWH 3HPJA 2OP4H 5FV2A 1KGXA 2WKOA 3QXWA 1S5HB 1DSFL 2D03H 2OMVB 4MFHA 1CF8H 3EJQA 3MV9B 4N2CA 4DK6A 4YH6A 5L4JA 4EOWH 1FYHB 1EO5A 1EHLH 2E9JA 4Z1PA 1NFDA 3CU1A 1SLVA 3IRZA 3UC2A 5IJBC 4BELD 2Y23A 5KYYA 2VXQA 4P2RA 3SDDB 4AI7A 4Y4HC 4LEXL 2QV2A 4PJAB 3UTSA 4KUCF 3ZIYA 1G1OA 1ETA1 2YGQA 1E9PA 2H26A 4H0LC 5T1LD 1CI3M 1WZLA 3MAWA 4XCYB 1EHXA 2VKXA 3O6ML 1LHZA 1CT8B 3NSJA 4LDOB 4OLVL 2EVHA 5ID0B 3JV4B 4HGMA 2XRAH 4PJAE 3DX0A 4YDMA 3VFTB 4EKJA 1FYTE 5ANMB 2B8OT 3AS3A 3GBNL 1H15A 1BZ8A 4G11A 4MAYC 1GPOL 4U1LA 1IQWL 1QI4A 1YEHH 2FSEA 2HKHH 4R7NA 4HJGA 2FO1A 3D06A 4U1SA 2VDRL 1RP8A 2J12B 4AM0B 2OULB 2Y7NA 4JAMA 4GO8A 3U46A 3SKOB 5BRPA 4N86A 1KJ2L 4RSYA 5D7SH 2JLLA 4WUUD 3QUML 4XBPA 1DL7L 1LEKB 4JANA 5HY9B 4J2XA 3FRPB 2X1XR 5DTFB 3C5JB 4BK8A 1K9TA 4HKBB 2J4WL 3BQUA 1RY7B 4LB8A 3HHSB 3L45A 4PLJD 3S37L 2AVGA 4BKSC 1ONQB 1XF3B 3C60C 3VRLE 1KCRH 1CFTB 5E4EC 3SKJL 4JGNA 1QNZH 1CU4H 1EBAA 3BP4B 5DD0H 1AH1A 4L5FL 1I75A 1OCWH 5BRZA 3TT3L 2BP5M 5KYNA 3OR6B 1FBIH 1AO7B 7PAZA 5MEQB 3G5VA 2NXZB 3IN0A 2G3MA 1JPTL 4RGMC 2PXYA 1D5MB 1F1AA 3BSHA 1UB6A 2IF7A 4LP4A 4YPGA 1J87A 4ZUSA 4YXKH 4NUGL 1GYWA 1M9SA 1QACA 2C7UB 4BFBD 2Z4QB 2GSIA 2QVMA 4G8IB 4DQAA 1BECA 1QA9A 1G7HA 4I5BA 5DURB 3TA3A 4ALAH 2HMID 1GVIA 4UQCA 2HTKC 4GKOA 4YHIB 5FYKE 3E2HB 3ZKXC 2KPNA 1JWMB 1XGUA 3PQYB 2P5PA 5HP5A 3MRMA 4KDVA 1YECH 3ML8A 4GG8A 3CTTA 2DTSA 4HOWA 4IOIA 1B2WH 5FUZL 5FPIA 1HXYB 5I30L 1DJIA 1JK9B 3HUJF 3X11B 3QYNA 4HALA 4Z7UB 1QOKA 2XFXB 2A6KA 3QH3B 3IGFA 3VU2A 1MQ8A 5IK3A 5EZIH 4EI5C 2W95A 1RMFH 3HRZC 3NIGF 5ADOL 1ZV2A 1BBDH 2OMWA 2PWEA 4MCMA 2FD6L 1AD9B 4GAYB 4IGBC 2CJSA 3KPSB 1F90H 4Z7UE 1JJUA 4JREB 5CCGE 1JWUB 2GUOB 4OVUA 1DZ0A 2WLKA 3TEZA 3JWOC 4G6AC 5I17A 5HYSA 1G0YR 3MN8A 5B38B 5L7XH 1FAIH 2ZOKB 4HD5A 4P48A 5D7IB 4JJOA 4AQAB 4LSPL 1JYVA 3C6SB 4EI6B 1U8NB 4U4BA 1KLFA 4AYEC 1E40A 2YR3A 1F4AA 3NZSA 4D9LH 1CO1A 2HCZX 5D70H 1UOLA 5FLUA 5F88B 4AYMC 4G43A 4WI9A 1MSPA 4UT6L 5DJCA 5HSFA 5E08L 5C0FB 4LLAA 1NDGB 4E9YA 2YBRB 1T03L 3BWUF 3NAAH 4KKZA 5L2JB 1IGJB 3AT0A 2Z64C 4F92B 4H5SB 5FO7B 2MWCA 4HUCA 1G7QB 2CXKA 1SHWA 4I2XB 4F15B 1I8MA 1A6VL 2NZ1A 2W80C 4NRYA 4FQLL 3AGWA 4HEME 5A3ID 5BV7B 2DD8H 2BOCA 4P4KB 4XNQB 5DRXB 3DJTA 4M6NL 1HOCB 4FEIA 1TENA 1Y18B 1AY1H 1EEQA 4R0LB 1IQDA 3GF8A 2PTTB 4WWOA 2A9AA 3AZUA 3TJEH 4L23A 3KCPA 3RX8A 4LHUG 5DMKB 4JVWA 4O9HH 4AKPA 3DVFA 1Q90A 1N0LB 3G9VA 4AZ8A 4HLEA 2Y07L 3FCTB 2IDSA 4WO4D 1RK1A 2XBTA 2VE6A 4MHHI 3TU6A 2WM0A 1TJXA 1VENA 3DX7A 3QJHA 3EYFB 1U21A 4BUHA 4WWKC 1QBLH 4GUPA 1FH5L 1SM3L 3MBEA 1I1YB 2OSLA 2ZQKA 4P9HC 5EO1B 4XBEH 5C7ZA 1DQJA 1OL0A 1HI6B 3B9VA 2I26N 1KT2B 5CEZL 5J0BA 1PFOA 3T6QC 3HC3H 5KS9B 2HRGA 1GXEA 4WWNA 1HTYA 1OSZA 3VXUD 4OSUL 5K39A 4QRBA 2EVGA 2ZT9C 2MNUA 1N70A 3VD3A 1J05A 3ME0A 4ODVL 3GSVB 3BUYB 3C08H 4KVCH 5I0XA 2OMNA 1GGCL 1VKXA 3H1ZA 1T0OA 4HU2A 5CFHA 4NQCB 2XXGA 5CD5D 2DQHH 2AJYH 1XAKA 3T77B 1YRKA 3GPEA 4AE1A 3L9EA 2JK5A 3E6HB 15C8H 4PGDA 1KCBA 3KWVA 2A6IB 3X14B 4N6QA 1XWVA 2PWHA 2ICWB 1W8OA 1J1PL 5CGBA 4AQOA 2VL5B 4WDIB 4FE9A 1B3IA 1PAZA 4OD3L 4HCFA 2IAND 4YHLH 3FCBA 3QFDA 3FQTA 1MZYA 3P9MB 4HETA 3WL9B 5F3BA 1MCLA 4WUUE 1V10A 3LEYL 4N9GA 1E9OB 2I25N 4DEWA 2F54A 4DZBB 1XH1A 3CDGA 3K4AA 4EQ2A 1TJIH 1F11B 2CLRB 1P6FA 3RWGB 1CICB 1L9NA 2XKNB 5GSVA 1B4LA 5CGTA 4JHAH 4K0OA 5D6CA 5HDBB 3QUYC 3GJFA 4PPTA 4X9GA 1IAIL 5GRVL 2I69A 1MRCH 2FNBA 1AIFB 1VIWA 3W81A 4JQIA 3RWEB 5JXEC 3FB7B 5I66B 3UYPB 5I1KL 3HHRB 3VXRB 5HDBE 4XX5A 2HFEA 3T5WA 1RQ5A 2W0FB 4PY8J 2CR3A 3BPOB 4I4WB 1P4BH 1KIQA 3B2DC 2WQSA 4PV9A 2P4AB 1MCJA 4OUOA 3NJGA 5BV7H 3QAQA 4OI7A 1MFCH 2ZP0T 5D93B 4EIBA 1SMDA 1J5HA 5FB8B 4TNWF 3VXRE 4WHTB 4BSJA 5BQDA 2PW1B 5TK4A 1O6SA 2EO1A 3EJYC 4LQFL 3OKEA 5C0AB 2P24B 4NZRH 2CKNA 3MRRB 4HULB 1O7DE 1B3JA 3BAEH 3LHPH 1A14L 3KPOA 3PAYA 1J0KA 4N6RA 4QRPD 2J1KA 3HR6A 3U1PA 4J8RA 5GRYA 3WNMA 1E5ZA 4PW4A 3S2AA 1Q0YL 5F3HA 3VSUA 3BKMH 5B1BB 4L8DB 3HNSH 4X5PA 3ATFA 1MFEL 1HFUA 4JDTH 3FMGL 1V3KA 3BKJL 5JHLL 4YXHL 3IFPA 2IDUA 2EINB 3LKRB 3WFDL 3VGBA 3MXWH 2IWKA 2JWYA 3E9TA 3T0BA 5GGRB 1RH8A 1JS4A 1VRSA 4BZ1A 2VWEC 2OKMA 1R24B 1ZT4B 2FGWH 1I7UB 2JI2A 3FRPG 5E4AA 3CZGA 1AGDB 1KN4H 1EZVX 2V5YA 4W68A 4MDJB 3RI5K 5IJVB 4XB3A 3P4LA 3UZQA 1J5OL 1SJMA 4OZGE 1R1CA 1YN7B 2ICEB 3CN3A 3GNMH 3BHBA 3GM0A 1EHNA 3OSKA 4LBAA 2GVYA 5AD0B 5I0YA 4E68A 5C07A 4U7SA 4GRWF 4Z0XA 4LMQE 4Z6AT 1INDH 3PXLA 4P3WA 2DQJH 1L7IH 3LRGA 4XOAA 2VR7A 2V7HA 1Q94B 2V9UA 1NH6A 1XCXA 1XXFC 3TOPA 1PG7L 4PJIB 2F2HA 4MRCA 1NUNB 1OTSD 1D5BA 3QNXA 4XVUC 2UX6A 1NBCA 1ZWIA 3LMJH 3DBSA 3W11D 1F2QA 2DH3A 2WLJA 3O6FD 1HL5A 4NQED 5DD1H 5F7NC 1OARL 1UXLA 3N1GC 1E7UA 3UTOA 4AJ0A 2J8HA 2G60H 3SKMA 5LGYA 1A9VA 1HHHB 1KCUH 3OVUB 4NRXA 3NTCH 3KWTA 4A2MA 2VR5A 1KJ3L 3A6BL 4WO4B 4LU5H 1LE5B 5ESVA 2PCFB