3RJQB

Crystal structure of anti-hiv llama vhh antibody a12 in complex with c186 gp120
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
AVQLQESGGGLVQAGGSLRLSCTASGRISSSYDMGWFRQAPGKEREFVAAISWSGGTTDYADSVKGRFAISKDNAKNAVYLQMNSLKPEDTAVYYCAAKWRPLRYSDYPSNSDYYDWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords C186 gp120
publication title Crystal structure of anti-HIV A12 VHH of llama antibody in complex with C1086 gp120
rcsb
source organism Human immunodeficiency virus type 1
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2011-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rjqB00
4P2RB 2FX7L 3LB6C 1RU9H 4P2OA 5EBWB 4KRPD 3X12A 3VMNA 3C9NB 3TFKD 1O0VA 3GJFA 4XCFH 3VFMA 2ADGB 4WWKA 4PB9L 1QKZL 1LDPH 5LGHL 2B39A 2OR7A 2J1KA 4E41A 2UUDH 4ZUSA 5FYLD 2X40A 12E8H 5IT2H 5JW4M 4HBQA 4UU9B 3DVGB 5BRZA 5TF1L 3CX2A 4UDUA 3L3GB 4WVRA 4EOWL 4MJ5A 4ZTOH 2ZUQC 2FRGP 3D9AL 2W1NA 2Q1EA 4QOKD 2HJKB 2NMSA 3ARGD 3NCYP 3ZE2E 3QAZB 3FQXA 3RWCA 5IOPA 4PRPB 2XN9B 1FVDA 3T0AA 1T1WA 1T1YA 1FO0H 2BJML 4QHMB 4HCRL 4V1DB 4UOW0 1CD1A 4HX1A 4JVUA 4XAWL 1A1OB 1LEKB 3BRFA 3DXAA 4UT6L 3MRRA 1WBZB 4IOIA 2YPVH 2V5TA 2P4AB 4MB5A 3DNKA 3GBML 1SJVA 2GTZB 3VFOA 3AXLB 2AJUL 4WEUD 5MENE 1MJ8H 4L8CA 2VDQH 3CX5K 4BQ6A 4JPIB 3LKOB 4J7RA 3WYRA 5M94B 4UTBH 1CVSC 3H42L 5KVGH 4MA8L 3QXVA 3RUGA 1ZS8B 1YYML 3VFSA 1AIFB 4XRCB 5C9KA 3EUUA 3AB0B 5C0IA 4Y2DB 32C2B 3QNZA 4K7PX 1GIGH 4IRJB 25C8H 2VDRL 4QRUB 1MCSA 4R0LB 1OLZA 5AYUL 5H35B 3FMGH 3IKCA 1MCPH 1A7BA 4WNQA 3BKJH 3UJIH 3WUWG 1IC1A 5MERA 3MV7D 5DLML 1OTTD 5L2JB 3TT1L 1FG2A 4TVPH 1JNLL 2ZSWA 1BWMA 1LO5A 1PQZB 1GZQA 1KTRL 5CMAB 1T5WB 4BSWB 3HE6A 3VGFA 5KSVB 1YMMD 5K9OB 1ONQB 3QDGE 5I75C 1D5IH 4K9EH 2V2XB 3QIBC 2IANB 5F6IC 2L7JA 1P84K 5DD0H 4KRMB 2QSCL 3THMH 1MRDH 5JHLL 3SDXF 1OT1A 1N6QH 1Q1JL 1RK0B 3MODL 5FDWA 3M17A 1CLZL 5IQ9B 3QDMA 4NO0D 1AE6L 4G8FB 3INUH 5E7FA 4L1HA 1EHLH 3TN0B 1ZMYA 2W0LA 1WIPA 3FT4A 5FOBA 2DQJL 1LP9E 3OV6A 1HH9A 4AIZB 1NAMH 3PP4H 4YFLI 2J6EL 4XP1H 4XXCA 5CEZD 1Z9SA 7FABL 1DEEA 5HYJE 2DJ4A 3SDCD 5C71A 3QR2A 1DQDH 3UBXB 5FV2A 3RGVB 1G7JA 5D6DC 3N1MC 3PXHA 3MOAL 1UYWL 5FYJU 1NL0H 1UEYA 1RUAH 3EIFA 2F9BT 4HV8B 3AAZB 1KLGA 1HQRA 2J8HA 4J1UB 1UM5H 3DO7B 1IEAB 2ZUTA 1QFWM 1T7XA 2GY5A 2VITB 5F7DA 4ONFL 3D5OF 5CEXA 3RWGB 4J8RB 5LKNA 4I3GA 1J05B 1SJXA 4OIBA 1TVHB 3DYOA 3SDAC 4EUPA 5E6IB 4YE4L 4JVPA 4P3CH 3ZSSA 2C26A 3C5ZD 4JANB 3KLSA 2VDKH 3MNVB 4WFHD 2CLVA 3FJTA 1L7IH 4LDLB 2ICEB 4O2CA 3GDBA 5T1KD 3SE8H 4TTGA 1KIPB 5GISH 2CLRA 1S7RA 3EYQD 3NABH 3HE7D 5KSAC 1G7LA 2QKIB 3MLXH 1RZIB 1P5UA 4NNYA 4PRPE 3ORJA 2XN9E 1BVLB 1U95A 3AROA 1BBDH 1JWUA 4OF7A 4P2OD 2EEBA 3N1PC 4V1DE 1F4XH 1V3JA 4U0RC 5I1JL 1OTSC 1NMAH 4WWKD 4A6YB 4QT5B 4E41D 3N06B 5CLTA 2FD6L 1W0YT 1LHZA 3MMEB 4YWGH 5BVPH 2DLTA 1C12A 3GHBL 3QQNA 4DCQB 1I9JL 3CNKA 5BRZD 1MHEB 1Q8MA 3PGCB 1W2KT 4JG1H 4N8CL 3NPZB 4B7IA 4LKCA 1BJ1J 2OI9B 3BN9D 5EBGA 3EYUL 2EIBA 1E27B 1FNAA 2F19H 1SM3L 4KTDH 2K9UA 2O5XH 4DN3H 5E7BA 1QR1B 4YDLC 1FFOA 1KXTB 3SOBL 4GS7B 1AI1H 1EPFA 4I0PC 3FB8B 3DXAD 3RWDB 3BKYL 1B6DA 1NMCB 4ZMAT 3VGEA 1AD0A 2UWEA 3IGAB 1X9QA 5IMLB 1KCRH 5FKPA 1IAIM 4JFZH 2F5AL 5HBBA 2A0LD 2DLIA 3WSQL 5DD1H 4LSTH 1KLFA 4PJGF 4F15B 5C0CA 2YWZA 5T33L 1P7QD 5HI5C 3CSYA 3QXWA 5KS9B 4NDMA 3MGOB 3OKOA 1H15B 5KW9H 4NRXB 4R4BA 2X4PA 5HVFB 5FV1L 2RR3A 2IANE 1WAAE 4JO3H 1VFOA 5JZ7D 4J3UA 3IDNA 1UADC 5CP3H 4BFEA 1HHKA 4N0UB 4U6YB 3O81A 4JFOB 2NY5H 3C87A 3VXOA 4KJQD 2D0HA 5C0GB 1ZEAL 2EH7L 1QFUL 5GS1B 5JXEA 1BOGB 5IBLC 3ME0A 4EDXA 3T2PA 4YGVB 1QA9A 2ENSA 1UQSB 3TZVC 3GI9H 4YLQT 1BEYL 1NBVL 3G5YA 4LLWB 4XH2A 3S98A 5J4MA 1MCHA 5HI4C 3BW9B 4ONOA 3M8OH 1HOCA 3NA4A 3MRCB 1EV2E 1RK1B 3QDMD 3V0AC 1C1EL 1ZTXL 2O61A 4JB9L 4OCYL 5J57B 4GG8A 5DR5H 4M6OH 4KROB 2Q8AL 1ED3B 3RU8H 1T1XB 3RZCA 2Z0BA 3FQRB 1ZLSH 1I9RL 2XZQL 4DGIH 5SWSA 1QYGL 1BZ9B 5JR1L 3S36X 3IDXL 1LEGB 3VRJA 2C1PB 3LRHA 2IADB 3P4MA 3MR9A 2R23A 4GKZB 2JB6B 2WWMC 3WKMH 1P69B 4BKLA 3BGMB 3FAWA 3ZE0E 4JRWA 5LGKA 1I8IA 5I1IH 2CRMA 4NC1E 1FVEB 2P8LA 4I48B 3HTLX 1TVDA 3BH8B 1QBML 3PE9A 1NEZB 5JUEH 4IM8A 1QQDB 3UXFA 3QIUA 3P4NA 3LEYH 3PUCA 4YXKL 3VRIA 1Q94A 2GI7A 2ZNWA 4OQTL 1F45A 5IG7B 5DJ6B 1G7QA 4NT6A 2CKBB 2I9LA 2AGJH 2PXYB 1NGZB 4DEPC 1YNLH 2FSEB 2Q6WB 3VCLA 4J3XA 1JMXA 5DGRA 4S1SL 4JO1H 3QEGL 2M1KA 4P49A 4RBPK 3WJJA 4BFBD 3HNVL 2BDNL 4NHUB 4M1DH 4LHUG 5FYLH 4C4KO 4M02A 5D9SA 3KLHD 1MFBL 1CD0A 3WDIA 2HYMA 1F3JB 4Z7UB 3G6JA 2W9LA 4XBEL 1UM6L 5IWLA 1G7MB 2GY7B 4K3GA 2WMPA 1WICA 1QTYT 2N7AA 1IL1B 1R3JB 2ZCLH 5ALCL 3QNXB 4LLDB 2NY2B 2WZPD 1E4WH 4TNVF 5IEHB 4I77H 2JJWA 1A4JB 4XCYB 1PKQA 5CWSA 2CK0L 5HD8C 2WINA 1TZHB 2DN7A 4GKSA 4JFDB 3RVVD 4KKAC 4Z77A 5D7KE 2VDPL 1AO7B 3MJ6A 4JZJB 3ZT6A 5KS9E 2NY4C 2H9GA 3QFJA 2IFGA 3BWUC 5D7JB 2NY7H 4LCYB 4WUUD 1YEFH 1MPAL 1MRFL 5EULV 4MNHA 1IC4H 4EBQL 3MLWH 2R1XA 3P9MB 5ACMA 3UPAA 3S6CA 5B4MD 1I1AA 2ITDA 4N0UE 4HUVB 3GMQB 3OZ9L 4R26L 4DGYH 3BN3B 5F88A 2A9ML 2M26A 2NY3C 4HS8H 2XY1A 4AMKL 1KGCE 2H32A 3QH3B 3T8XA 1J86A 3R0NA 4XVJH 4ORGB 5L88H 4X6DA 2CKBH 3QDAA 5CEYA 1JZ6A 5C0CD 4K3EH 1UACL 2I25N 5I9QC 1ES0B 4PRHB 3ELAT 2YC1A 2LU3A 3C5ZB 1LVEA 4ZPVA 2E6JA 1BQHA 4JFXB 1G7IA 1U8LA 3UCRA 2XQBH 2OBGA 5D6CA 1EGJL 5ERWA 1CGTA 2HTLC 5T1KB 1OF2B 1AGFB 2H8PA 4NJAH 3WNNA 4EIZC 3T0ED 3HE7B 2YPLA 4LVHC 4RGND 2K7QA 5MI0B 5C09A 2YN3A 3I6GB 4JLRA 2CDEA 1OAKL 1F3DH 1GPOL 4WGWB 3QG7L 3MRLA 2EC9T 2GJ6B 4P2OB 5IMMA 3J7HA 3PP3K 1X44A 3X12B 2A9NL 1QRNA 4FG6C 3GJFB 1RZ8B 3VFMB 2X6MA 4MD4A 4NZRH 3ARUA 3T2NH 2CUHA 4ZUSB 2FGZA 4U2YA 1C5DA 5C3LD 3FZUD 3PXJA 1J0HA 2HT3C 4UDUB 4YGAB 5B3JE 1FNLA 1D3CA 5D5MA 5DYOA 3SDDA 2FLBT 5CEZH 1QLFB 1QFWH 1HHGB 3REWA 4ZFGH 4BZ2L 5MEQA 1OWRM 3DARA 4N8VG 5DMGC 1KEMH 3FQXB 3VMOA 1G0YR 1SMOA 3A6CL 5IOPB 1HSAA 4FFVC 3OJMB 4IIQA 5LBSL 1T1WB 1HYRC 1T1YB 1IQWL 3CMOH 3RZCD 3EBAA 4D0DA 2ATKB 5J6GA 1Q9KA 4HX1B 4LLUA 1PW3A 4HMEA 1YUHA 2PF6A 2MMXA 3SKUD 3SE9L 1IKNC 4IOIB 3ETBF 2XG5A 5SWSD 3M45A 4Y8AA 1AHWC 3MXWL 3VD9A 4AEEA 2J4WH 4B50A 3IYLW 1CI5A 3OF6A 3AREC 2WP3T 3ARBA 5ICXA 1UZ6F 3MV11 5I30L 4HKXA 1U3HB 5IMOB 3RUGB 4EJ1C 3D0LA 4NIKB 2BNUB 1FPTL 3QIUD 4IRSC 3QUYA 3KPQB 5HDBF 3C8KA 3HR5A 1RUKH 1CICC 4HG4K 4Z7WF 4MSWB 1CQYA 4M7KH 4LASH 3G5VA 1GOGA 3IKCB 1RAMA 3D2UA 1I3GH 4F7TA 4LSRH 4RISL 1NCUA 3G5XA 4XMLL 1IFHH 3MO1A 1J1OH 5MERB 5IB3B 1Q38A 1TQCC 4L4VA 4U33A 5EIIA 1KFAL 5DJDA 4MCYA 3BPNB 1LO5B 5BO1H 3X13A 1GZQB 1QSEA 1AO7E 1T7WA 2RCSH 3LRGA 1RZGA 2DBLH 3HE6B 3QI9D 4HKJB 2YPKA 4QXUL 1GGBL 5CEZE 4NPYA 3L3KA 2IGFH 3SBWC 1BP3B 4XNMB 4Y1AB 2CO7B 5GGRY 5I1HH 4RGMC 1CXLA 4DUWA 3DX9B 2D9QB 3GMMB 1NCWL 2ICWJ 3KLDA 2B2XL 3C8DA 3D18A 4RA3A 1TPXC 5EC2B 4TPRH 2A6IA 3MC0A 1G6RL 1TJHH 1HHHB 5IGXL 5C6TL 5FOBB 1JZ3A 2XTJB 1CFVH 3MGTA 4HMDA 3LPWA 3HZKA 3BDYL 3BRDA 2YUVA 3FRPG 3CDGB 4CVXB 1VKXA 3QFJD 4LRIA 1CXFA 1KACB 4PRHE 2BOCB 2HT4D 3JVGA 4OGXH 4F8TA 3QUMA 4FXGA 4OZHB 4X98A 4MDJB 1YECL 3IDMA 1U8HA 1S7UA 1UCBL 1I1AD 1BQLL 1TCMA 4OCSH 5GS0D 5ISZA 5EA0H 1CDCA 1WCQA 5FHBL 1HQRB 3ESVF 1B9ZA 1F6LL 5IW3A 4JY5H 1GOFA 2FX8L 5C7XH 3CH1A 3RBGA 5F7DB 1RIHH 3I2CH 5CEXB 4U7KA 4ACPA 3QRGH 3LD8C 3U1SL 3RTQD 1JHKL 2EXWC 5DD3H 5DUPH 1UZ8A 2QLVB 4E41E 2OR9H 4JY6A 2OK0L 4ETYA 1ZHBA 2CLVB 4Q6IC 3SPVB 3GMPB 4JFHD 3C6LB 3WO4B 1K4DB 5FDYA 4U49A 1C5BH 1D5BA 2FZ3B 2CLRB 1D9KA 3O2DL 3RVXC 1S7RB 1DDHA 4AEIL 1G7LB 1WFTA 2YPLD 3VXQA 2EDKA 4NNYB 5C09D 2BVTA 2LAAA 4KDWA 4WWID 3MACH 4I18B 4Z8FL 3V8CA 4FQLH 3O9WA 4OM0L 4GOSA 4JJ5A 3OKEB 3SE3C 1P1ZA 3SKOB 4LHQB 1QRND 5EIQA 5DUBA 3DX8A 2GAZA 3UDWC 5BQ7A 1J12A 5A16A 1MVFA 1FRGH 2WWKO 1LO0H 3T4YA 5SX4H 3ZHKA 1N3NA 4QHUA 1CGSH 4TSCL 5DURB 5E8PB 4ZUUA 5IBTL 4OLXL 4OD3L 2P7TA 5E8OB 4QWWC 1GYAA 1RULL 3VFWA 1ITCA 4LCUA 4S1QL 3WN5C 3O6LH 5I71C 3QO1B 1M71B 2V2TA 3RUGE 1CIUA 5GRZA 1ETZA 4ODWA 1MVUA 1MI5A 3QXAB 5EIVA 3C5SB 3VA6A 3V7MA 1T66D 5FHAH 1LK3L 1FFOB 2R0ZH 2W9DH 1ACYH 3NFNB 2AK4D 1W72L 3O8XA 1KJ2A 4HC1L 2OZ4A 3U7YL 5C92A 1PEZA 3O0RH 2Z8VC 4KTEH 1U8JB 4KRNA 4YDIL 5EZOH 3GMOA 2DJUA 1AD0B 1HKLH 5D2NC 1WTLA 4XPHH 2PKDA 2UWEB 4C83A 3U36A 3I85A 1NLBL 5FKPB 2FIRT 4EUPH 4LFHG 1A3RH 3STZB 4H8WH 1RPQA 4JHWL 4L9LC 4IDJH 3CSYB 5KTEL 4Q6YA 2WSKA 4NDMB 4OJFH 4GLRI 3MLYL 3S34H 4YHKH 2A6DB 1JPSL 5FOJA 3MUGA 3QUYD 2FEEL 2KQMA 4Y1AE 3E2HC 2DDQH 3ROOA 2NTSP 5CJBA 4Z7QF 4WEBH 5BV7B 2VE6A 1Q0XL 5KAQF 3T1FA 3D2UD 3O3UN 4BH8A 3QEHA 3OR6B 3QDME 4LGPB 5DVKA 4ALAH 4ZFOA 1EMTH 2CMRL 4L4VD 1U8PA 4GQ9H 2XTJE 1L4IA 3VGAC 4XX1E 2NXYC 4YK4C 3P30L 2FO4A 4LPXA 5EU7E 4ODSH 2E7LC 2YD6A 1J0JA 2DMCA 3SO5A 1MQKH 3RL2A 2KQNA 5FGBC 4XC1H 2IBBA 5C8JA 5ILTH 1OAUL 5TE4L 3IXTB 1A2YA 4HK0B 1FH5L 1X5LA 3T4AA 5GGVL 1IRAY 4PJCF 3SGJA 1YMHB 1HOCB 4ETQB 5JZ7C 3MJ9L 1BMGA 1U3YA 3L6FA 1Z5LA 4J3SA 2O61B 4JKPH 3X3GL 5CJQL 2LFGA 2DQUL 3TGXA 5CCKH 1QHPA 4XC3L 4GW5B 5KVMC 5D72L 1OAQH 4JN1L 5DJ2B 4HPYL 4ZO9A 1SEQH 4O02L 4LLVA 4FN0A 3HHRB 1NCAL 4DK3A 4DW2L 1P4LA 2D0FA 2FJHB 3P4MB 4FZ8H 3F6LA 1CG9A 4BKLB 1MFNA 1D7FA 1R5VA 3RPKA 1CXIA 1U8KB 4Z0XB 4U1SA 1FIEA 5ISZD 5IJKA 1HILB 3DOSA 3MTRA 4DN4H 5GXBB 4L4TA 2P8LB 4PG9A 1VFBA 2IQAA 2Y1VA 3GMLB 1WF5A 2CRYA 5TDPB 3QXTA 1BQUA 5I8OH 3HAEG 4OUOA 3VRIB 1Q94B 2OXHA 3ARDA 1I9EA 1G7QB 1PVHA 3IS1X 3EYOA 4M5ZH 3RZWA 4X80L 2VLLB 1FNGA 4NT6B 4RX4A 2I9LB 3NACH 4YQXL 4BQ8A 1CGWA 3VCLB 3OGOE 1EUTA 2B1AL 4N9GA 5HPMA 2BNRD 1TZGH 2EE9A 2EEDA 2R2CA 1DBBL 1IC5L 2XOTA 1D9KD 3L5XH 3RWIB 5I1AA 4IS6A 5E2UH 5MEPA 2IG2L 2KPNA 3CVHA 4EDWH 5EWIL 5HYSG 5DDHA 3FONA 3O9WD 1WTGT 4M6NH 1MCKA 3F58L 4K3JL 3WIFB 5IMKA 1NLDH 2DMKA 1IILE 4P23A 5HHOA 1PYWB 4OZIF 3FN0H 1Z9MA 1KN4L 1MAMH 2FL5B 4L3CA 5CWSB 4D9QD 3CVIH 2UWEE 4QEGA 2NY6D 4AZ8A 4Z77B 3MRBA 3LRSA 4PJBA 1MI5D 2H9GB 3O4OC 5JPNB 4JDTL 3ISWA 2FB4H 2R2BA 3HG1A 4Y19B 3KJ4B 3S35X 4L3EB 4MNHB 4PTUA 5E2TH 1IVLA 4Q9RL 5T5FH 3O8XD 3ZZ1A 2FJFA 2Y7QB 3H9HA 4L1DA 2ITDB 1MFEL 3EAKA 4FQ1L 1DQML 4PJ7A 4P5MA 4U1GC 3TVMA 1F6FB 3WIIL 1RJYA 2OL3L 2ILLA 4MJIA 2HTKD 1H8NA 1Z2KA 5BXFA 4X6DB 3RVVC 4PJAA 5DZLA 3KLAA 4WFEE 3EO1A 4M61B 5HXMA 5C3TA 4MYWB 1UH4A 5KVDL 4LNRA 2CIIB 1M05A 2P46B 4ZPVB 4IMLA 1O7SA 4NWTL 3UPRA 1G7IB 4JQVC 1OM3H 4K2UL 1Y18A 1DJSA 1U8LB 2I9TA 3VDCA 5D6CB 3DRTA 3D0VB 4PRBB 4I3RL 1F4YL 2H8PB 3T0BA 5F3HA 1C7TA 4LSUL 3B83A 1VPOL 5CSZA 2W0PA 3CFEA 1HCVA 3MRLB 5JDSB 5IMMB 5KJRL 4FOMA 2QTEA 2VKXA 3QWOB 2WQ8A 4R4FL 5IVXF 2EYSB 3FFDA 4MD4B 4U0QB 3DRQA 3BIAX 4HIXL 5DQJA 3ULSB 5E2VL 5IVZB 3BKCH 5FA4A 1J1PL 5DJAA 3VG9B 1RUQH 5D5MB 3SDDB 3EKCA 5ESVA 3REWB 1KIQB 5MEQB 4XMPH 4AEFA 4P57A 5DSCA 3DHJA 4Y5XA 3SN6N 3T0EC 4Y4FA 5FYKE 1HSAB 4NC2B 4ONGL 3I02A 4P2QB 3O6ML 3X14B 4PB0L 5GGTH 2WBJA 1UT9A 4D0DB 5GS0H 3L5IA 4WI2A 1JI2A 2D31A 2R0WL 4LLUB 4GXVL 1K85A 3EOAA 3HFML 4JO4L 4NQVA 2H32H 4KVCL 3V6FA 1NC2A 5EOCJ 3ZE1F 1MFCL 4TUOA 4LOUD 4GMSL 2SEBB 3ARXA 4F3FA 2LABA 1JV5A 3ARBB 5ICXB 1T21A 3GSRA 1CL7H 4RQQA 1F13A 3IVKA 2C3GA 4PD4K 3D0LB 4G8GA 4Y5VA 1E6OL 1Z3GH 5C1MB 3V6OA 3BSZH 3C8KB 3HR5B 2JJSC 5TDOB 4Z7NE 3PWJA 3VH8B 3V6ZA 3OKDA 4F7CB 1T0NB 3ARDD 1T04A 3D2UB 2EE6A 2PTUA 4RX4D 3TH3T 4F7TB 4O58H 5I1CL 3E1F1 3MO1B 4OGYH 4N0YH 5LGJB 3GSVB 4R96A 3IETA 5KVEH 4X7SL 4L4VB 1MNUH 5EIIB 5C6PB 1QSEB 5CZKA 1F11B 4UQ3A 1H3WM 2DBJA 5CHNB 3VFRA 3EYVA 4NN6B 4IMKC 2YPKB 1NJ9A 1ROWA 3QFJE 1MRCH 1F6AA 4BFIA 2F54A 4Y19E 5F44A 4S2SA 1T0PB 2HWZH 3SE4A 3U0PA 1KBGH 3FQUA 1KCUH 5JA9A 3GK8H 1RZKH 5D1XA 3FO0H 3TO4C 3W39A 1GL4B 5MHSE 1DANU 1OP3K 4P23D 4BZ1H 1KXVC 1A6WL 4P59H 3T3ME 5E4EB 4Q9CA 2D03L 1J0ZA 5CLWA 3GIZL 1LO2L 4KHTH 3I50H 5HGAA 3MGTB 4XMKH 2DQHL 4UUJB 1JHLH 5GIRA 4X6DE 3HZKB 2X9YA 4JRXA 5DK0B 1LE9A 1CR9H 4N8PA 3QI9C 1VKXB 3MBXH 1KNOA 1WEJH 4GXUM 1A7NL 3JTTB 5EN2A 2I5YH 3QCUH 3TNMA 4CJ0A 2ADIB 4G42A 1AXIB 3BXNA 3HG1D 4DZBA 4JM2B 1CLYL 2ZSVA 5CS7A 3NZ8B 3W5MA 1NGPH 5KSUA 4CMHB 2ESVA 5T5NF 1U8HB 1S7UB 2XA3A 1WT5A 5F7EH 2W65A 5SWZA 4UINH 5ICYB 3WBDA 1MCWM 5DJ0A 2VLRB 4FP8H 3TVMD 3MXVL 1AR2A 4KPHL 5TFSH 4JFQB 1HEZA 4MJID 5IK3A 3TBWA 1E4XH 3MRGB 4PS4L 1WBYB 4ISVB 3FHAA 5CZXD 3IFNH 3FKUS 3BZ4B 4R90H 3KXFB 1UZ8B 2L4OA 3C2AL 3BP5A 2XRAH 3D25A 3R8QA 1I3UA 2EIDA 2EO9A 3F7YA 5E8EA 4F57L 4JY6B 1PD6A 3L3DA 4E42A 1A02N 5EZJB 3GRWA 3WHE1 1RU9L 2FGWH 1QO3B 2E9BA 3GSQA 5DTFB 1S7VB 5JXAH 5D5ME 1BZQK 1D5BB 1LDPL 3EYSH 5TDNA 3LKSA 1D9KB 1DDHB 1DTUA 4JFPA 3WLWD 5IT2L 3RHWK 1RUMH 3BZEA 2EH8H 4NN7C 2YXFA 3GSNA 4JPWH 3IXAA 1V5JA 5DFTA 4JJ5B 4ZTOL 4PIRF 2LU4A 2J88H 4HHAB 2YHGA 1T83C 3PNWB 5DUBB 4KJYA 3PL6B 3DX8B 2GAZB 4RIRB 3RTQC 5A2JH 5IFHL 2JJTA 5A16B 1UJTA 1JTPA 2QQKL 1QNZH 3QQ9D 5DT1H 3T4YB 4Z6AT 2OTUA 4ZXBC 4R8WL 1PJ9A 5FUZH 5FUCE 3HRPA 2P7TB 4MD5B 4UT7L 4WU5A 3VFWB 1QPXA 1BF2A 1ETZB 3QUMH 1MVUB 4ODWB 4QCIB 5ITBH 3G04A 1MJ8L 1NAKH 1EZVX 1L0YA 1ACZA 2VISA 5SV4A 4UTBL 1K5NA 2WBJD 3OAUH 4U1HB 5KVGL 3VGBA 1OGTA 3CFJB 4L29A 1NBQA 3O8XB 1KJ2B 1YNTA 5BZDA 3K4DA 1BPVA 2GIYA 5I0DA 1NC2D 3GMOB 3MRHB 4G7VH 1FNFA 4L4VE 1DZBA 2Y9RT 2MOVA 4C83B 2Z8WC 1JNHB 1BVZA 1QSEE 4QHKI 3ARSA 1MCPL 3EDDA 4U6VH 1XIWB 2FYYB 3L7EB 2ENYA 1T20A 4G8GD 2AKRB 4WV1C 3MQIA 4HUWB 4CBPA 4X9IA 4LCCA 1RZKC 5EU6B 4NKDA 1RZJC 5J89A 3MUGB 4MQXC 3EOTH 4JQXC 1AQKL 3HB3D 1I8LC 3T1FB 4BH8B 2ID5A 2LV4A 4NNXB 3QEHB 2IALB 3EDJA 2D7TH 4I0KA 4K9EL 3CXHK 4ZFOB 1X5JA 4OZ4A 3D1MC 2BRQA 5CP7B 5FF6A 3THML 1MRDL 5IB2B 3UJJH 4BQBA 5A3ID 1G9EA 3BISA 4PRDA 1G84A 1IQDA 4OCXH 1JPST 4OUUB 4L8SB 3F65A 1I7RA 5IHUH 3BWAA 5D7SL 3QAZC 4Z78B 4FTVD 5F89A 1IBGH 2UZYB 2F54D 3LH2L 1RFDH 3BO8A 4KZDH 1NAML 4BUGA 3PP4L 5ESQA 5D1XD 4XP1L 4X6CF 4UAOC 5I18L 1CDIA 5GGUA 5ADOL 2G9HB 3BQUC 2XKSA 4ODVL 3TV3H 5SWQB 2VLRE 4GG6A 4XAKD 1T6VN 1DQDL 1QEWA 4DGVH 5I1DB 2AXGA 4L9DA 1KJ2H 4IDLA 2OZ4H 1KB5A 4FQQB 4EN3A 5I76B 4JRXD 5JLZA 1NL0L 1RUAL 1A64A 3VFVA 3KXFE 1OVZA 4WHCA 2B8OT 3AB0C 1CK0L 2O5YH 1F3DJ 3WEXA 2FJGB 1I7TA 2VDML 3GMRA 1TTUA 5GHWH 4UILH 2ESVD 1H5BB 1LP9F 3DYMA 1A6UH 1TITA 4FNLH 5A2FA 4TRPH 5SWZD 4KK8D 3FOMB 2AJXL 5DMKA 4KKNA 2VDKL 4L4TB 2RBLA 4PJHF 1ZHKB 3B2UD 1DL7H 1PZUB 2PYEA 4GRWH 1FZJA 2NNAB 3L95A 5GGSB 2ORBL 3BAEL 1GCFA 4HIIA 1A22B 3UYOD 2N4IA 3NABL 4KVNL 3GFUA 3MLXL 4BM7A 5CJXC 1UWGH 3MCG1 1FNGB 1L0QA 3KPTA 4LU5H 4LHUA 2VDLL 2OM5A 3HC0A 1BBDL 4N9GB 4NWUL 3DX7A 3KPSA 5E9DA 1MJUH 1F4XL 1ZAGA 3GI8H 1NMAL 1X5XA 1XGRA 5FKAA 4CADB 1QACA 5E8DH 4KK6D 3IF1A 4YWGL 3VI4E 2DMBA 2X89A 3AFLA 3TN0C 5I1EH 1YQ2A 3P73A 4YBQC 3T0DA 5D8JH 2E3VA 3FONB 4PP2A 4JRYB 4HSQA 1KTLA 2Z92A 1R3IH 4MAYA 4I3SH 5HHOB 4KTDL 2O5XL 3TEUA 1ZSDB 5T1LA 3LN9A 1J1XL 4P5KB 5EOTB 5F7NC 4KY1H 4WW2A 1VADB 3KPLA 3QEUA 4NQXA 4LCWA 1R24A 3GSUA 3SGEI 4EQ2A 2V7NA 3MRBB 5IW1A 2X4NA 5ACLA 4HKZA 3FL7A 2EE3A 2E8YA 3ILPB 3LRSB 4PJBB 2DQDH 1OSZA 5JO5B 2MCG1 4U2ZA 5C2UB 4M62H 4HIEA 5EU6E 3BUTA 1OP5H 1KCRL 3TPUA 2R2BB 1BFSA 2Z9TA 4XNZB 1U8MB 2VJXA 4PTUB 2A74B 2XQYK 1CXKA 4NUJB 5D71H 3MCKA 3K8MA 4YHMH 5E6IC 4XPAL 3N85H 1LNUA 1QOKA 4YR6A 2V9TA 1I3VA 4PJ7B 4P5MB 3TVMB 3TJHD 1RJYB 3CFIC 4XT1C 2Z35B 3BESR 3QUZA 5E1AB 4XI5D 3QRFM 4I9WD 4GAJH 1A6VH 5BXFB 4WFFE 2DL2A 2W91A 2XACC 3DIFA 3KLAB 3EO1B 5E8NA 2NY5L 5F9OL 4P5TC 4NC1C 3MRKA 4NGHH 2BVUA 3V0WH 1KPUA 4LNRB 4LCIH 5AWNH 2R39A 4IMLB 4A6YL 5I0ZA 1Y18B 3WL9A 1LILA 1MQ8A 4AYFA 1AQDB 3GI9L 3CVHH 2JELH 5F3HB 4PJ5A 1P9MA 1GAFH 1U36A 4NP4H 2BOBA 4NQCA 5CSZB 4I5BA 2EXYD 4IBLT 1B4RA 3VFNB 3CFEB 2XWBB 2BSSB 1WAAF 3LVEA 4DFHA 4NZTL 1T7YA 1JPTH 9CGTA 3WXVL 1TCRB 2V6HA 2ZG3A 1N5AB 3HMXL 1Z0MA 3V4UH 4LKXA 2V17L 1FE8H 2C4FT 3DMMB 1LDSA 3AS1A 5IEKA 5DQJB 4M6OL 2J8UF 3L3IA 4RWHA 5FA4B 1GH7A 3PJSA 4GS7C 2QADB 2R9HD 3T08A 1NCNA 3G9VA 1ZLSL 4ERSH 5E70A 2NY1B 5D1ZB 5ESVB 3RL1B 2XNAA 4DGIL 4LEXH 4Y16A 1XCQA 5MEOA 4WU7B 5DSCB 3GMNA 4ELMB 4Y5XB 3CFCL 4L4TE 3OAYH 4OFVA 4Y4FB 3I02B 2AJZB 1UWXK 3NMEA 3WFCL 2WBJB 4N9OB 4RMTA 3AS0A 3W2DL 5I1IL 4OTXH 2EDOA 5HHXH 5C0RL 1GOHA 3HZVA 1RUPH 2VQTA 3BKML 2FX9L 5JUEL 1MCCA 3V6FB 1NC2B 1NUGA 4TUOB 1DVFA 3MRPA 4NM4H 3L5HA 3GSRB 1CTNA 1E4KC 3QEQA 4YDKH 1S5HA 3EGSB 2VH5L 4RQQB 1T2QH 4HBCH 1TETH 3IVKB 3MBEA 2Z31A 3BZFA 4NQDB 2VXQL 2D7MA 1QP1A 4Y5VB 1A7RL 5E03A 1MELA 4HEPG 3IFOA 4K23L 5HYEA 4M7ZB 3WUWB 3LZFL 5DUML 1MWAA 4XNQB 2PYED 4W4OA 5T3XD 1H3PL 2YA1A 5GS1C 3RY6C 2R4SH 1RIVH 1C5CH 3DBXB 1T04B 5I17B 2ADFH 1KV3A 4PRIB 3ZE0F 4JFEB 5HHOE 5FO7A 3OPZH 4NSKA 1EXUA 1TJIH 2B4CL 3IETB 4K7PY 2W0FA 3WIHL 4X7TA 4AEHL 4LSDA 4BFGA 2EDTA 3KPSD 5E9DD 2B4CC 2LAGB 5CKGA 3RIAK 3RJQB 4LOUC 4ODHL 1GVIA 5JW4N 3VFRB 1RMFH 4G6MH 4PJBE 1D5XA 1E4WL 1HWHB 5B38G 2X89D 3HLAA 2NXZB 1F6AB 5DXWA 4YHZH 1MLBB 1L9MA 2F54B 4GW4A 2AERT 2VL4A 4S2SB 3DETD 4KROC 3U0PB 1XGTB 4HGKC 4EZMA 3KNBA 1UGNA 4DAGL 4MAYD 5FAAA 1CYGA 5T1LD 2NY7L 4DVBB 4PJ7E 3DPBA 4QRRA 4M8QB 3QJFA 4O2EA 2MCPL 4G8EA 3MLWL 1R5IA 1INQB 4LCWD 3WHXA 1A6ZB 4MXWH 3ULVD 3O3BA 3PF2A 3PABA 3MNWA 1LE9B 1DLHB 3H8NA 2ICES 4DGYL 1MY7A 3SY0A 1KNOB 4OZGA 2P5EB 5EN2B 4XVUD 4F9LA 4DZBB 3ZO0A 3L7FA 4MJ4A 4XVJL 5F6HI 1YEEH 4ZG1A 1A7QH 5L88L 3MROB 2CKBL 2KZWA 4K3EL 2ESVB 1UG9A 3T0XA 1FJ1B 5GJTH 2FEDC 2W65B 5SWZB 2FHBA 4PJXB 2J5LC 2PXYC 2QSTA 5C9JA 5KS9F 2Y5TA 4YFEA 1U3JA 2XQBL 3QUZD 1HEZB 5IK3B 3DSFL 4TUKL 2QV2A 4NJAL 4I4WB 3CK0L 2BNQA 3LMJL 3OR7A 4UIMB 3BP5B 4MA3A 3D25B 3I84A 1MIEH 4ODXB 4Z7OF 1H8OA 4RAVB 4ZOCA 3VFPA 3VXUA 1DQQA 2AV7A 3G6AB 5HVHC 1DFBH 5HJ3A 4U6XA 5TDNB 2NY2C 4NZRL 5E56A 1IKFL 4PJ5D 1CFNA 2ICCA 4JFPB 4ELME 1MIMH 4NQCD 3BZEB 1D6VH 4CVUA 1A6AA 2DIAA 2CJUH 3GSNB 4OLVH 3NGBB 3W82A 3IXAB 1PX3A 5BS0A 3ESUF 5CEZL 1WZMA 1QFWL 3QYCA 3S9DB 3JWNC 4ZFGL 2CDGB 3UROR 4JZJC 5C2BH 3LOWA 1UEMA 3EHBD 3X17A 4MLSA 5JHDB 3ULUD 1TVBA 4GBXB 2E9IA 4X8XA 2YMXH 2I60L 5AEAA 2OTUB 1MF2L 1RJZA 3JWDH 1IJ9A 3CMOL 3NCFB 2Q8BH 3O11B 3G08B 3O3EA 1KTDA 4G6FB 4RA0C 4Y16D 5AZEL 1J7VR 5DMIH 4NQDE 1FYTA 3MLUH 3NCYS 3V6OE 2J4WL 4QXWA 1OW0A 2W59A 5DHXB 5E00A 1PY4A 5C08D 1S7QA 3H2WA 3HRZA 4RFEA 2RAMA 1K5NB 3RNKA 1OGTB 5JW5A 1S7SA 1YNTB 4KQ3H 2Q86A 2ZPKH 1KJVA 1YEJL 4PRIE 1MJJB 4OCRL 4JFEE 3QHZH 3I3DA 2HRPH 4LRNL 2Q3AA 1Y0LA 1DVFD 3EDFA 1RUKL 3QQ9C 4NFBA 5DZNA 3QA3B 4UT9H 1DLFL 2DI8A 3PQYA 3O2VH 2EZ0C 3BIBX 3QEQD 5ENWB 4G8IB 4LSRL 1IFHL 1JP5A 3MBED 2NR6D 3GRWH 1J1OL 2UVEA 4LP5A 2QSVA 4JREC 4PBXA 3F7VB 4WUKH 2AVGA 1GC1H 5ECJE 5MI0C 4NKDB 2Q20A 4RAUB 1FL5A 2ZCHH 1KC5L 3VXMA 2F54E 2VXTH 2Q7YA 2EDLA 4HH8A 1S5IL 5FYJD 1XF2A 3S88H 4NHCH 2PN5A 4OGAC 2R4RH 3GB7A 4MQSB 3KPPB 2VDOH 3MRDA 5FF6B 4XAKE 1HDMB 1JVKA 1OQOA 1B2WH 2VABB 5I1HL 2NYYD 4U6TA 3N1FC 1T5XA 4PRDB 3UPCA 4UIKH 5CJ8A 1ND0A 4JRXE 4XHQA 1IAIL 5E0QA 2JK5A 2H1PH 4P46B 2JF1A 1JK8B 3AM8A 3GHEH 2UYLB 2B5IB 5F89B 1TQBB 2VLKA 3TT3L 1JZ4A 5H37G 2F15A 1CBVH 3BO8B 3PIQA 4EUPG 1PFCA 2ESVE 4QRSA 1DBAH 4XP5H 5I66A 1H3XA 4K7PL 2BY2A 5GGUB 5SWZE 1SYVA 4PJXE 3CJJA 4MS8D 2VSCA 3WDJA 4QRRD 5E95B 4GG6B 4EVNB 4NZUL 2BVOB 1KB5B 2GTWA 3H3PH 5T3ZD 1AH1A 2WNGA 1IGYA 4EN3B 3W81A 4KJWD 4OCSL 1U3HC 4X6FB 1W8NA 3S37H 5EA0L 3VFVB 2XZCH 1S9XB 2PR4H 1T4KA 5ETUB 3UO1H 2Y72A 4JY5L 3WEXB 1BIIB 1RIHL 3I2CL 3GMRB 4KMQA 4HPOH 3QRGL 3KVQA 3PWUB 2E9WA 5DUPL 5HHMB 2L0DA 4X8JA 3U0WH 1AC6A 3E8UL 5CBEA 3FN9A 3P0GB 1YEDA 1OGAA 1NKRA 2EICA 4U1MA 4D9RD 3SGKC 4PJFA 4WO4A 1OLLA 1A1MA 3L95B 4RWYH 4NUGH 2BNQD 4UOJA 5JHDE 5C07A 4LHUB 3HC0B 1AY1H 1TJGH 1QLEH 1UB5B 4FQLL 3RWEA 1IAMA 1XF3A 4Z7VA 3DX7B 2X4UA 5HYSA 1A9EB 4R7DA 3MRFA 4LQ1A 5IESL 5I1LA 1E6JH 4TUJA 4ZYKB 3ZTJH 3L3HA 1XGRB 5FKAB 1EK3A 3SGDI 2XQYG 4XP6H 5IHZB 1UXWB 3D48R 3IF1B 5JIPA 4ZAKD 1CGSL 4Y88A 3P73B 2XTJC 1CE1L 4PP2B 4LSPH 3B2UC 5BS0D 3S5LG 5DEFA 5EU7C 4S1DC 1S7XB 4WIQA 4E0RA 3IFLL 2Z92B 3IU4L 3KYOA 3TBVA 3BP6A 3WO3B 3VFGH 1KB5H 5FHAL 4QHLB 4AT6A 3M1BB 2R0ZL 2P48B 2W9DL 4JHAL 4YXHH 1ACYL 4WW2B 4PV9B 1GC1C 4NQXB 3QEUB 3UTQA 4LCWB 3GSUB 3IDJA 3O0RL 4HCRA 2PUQT 1FYTD 4MNQA 1OSZB 4Y7MA 3QDJA 4KK6C 4HIEB 4XPHL 2UVFA 3QPXL 4H8WL 3DYPA 5A40E 2DICA 5CILL 4Y4HB 4IDJL 4LFHD 2MTPA 4OJFL 2XWJA 3TBYB 4KKBD 1LNUB 3S34L 4YR6B 4YHKL 4FQXC 3RUGF 1T7ZA 4K8RC 4OFDA 5T3XH 2DDQL 3LKRA 2PW2A 2JJUA 3JV4A 1PZ5A 4GSDL 1AD9A 4O00A 3C6LC 3WXWH 3PQYD 4K94H 4KI5D 1CTOA 4UMGA 3DIFB 4UBDD 4YHPB 4ALAL 4ONHA 4K71B 4Q97A 3RAJH 4DKFH 3MRKB 1KPUB 4GQ9L 5AAWA 4RSVA 3VXMD 5HVGB 4CVZA 1RD6A 4I18C 5I15H 3MZGB 1K8DA 2NZ9D 3WL9B 5J1AB 2OQJB 4I13B 2Q76B 4MJ6B 5ILTL 1ZLUH 1JCKA 3X3FH 1OAYH 3BE1H 2VL5A 3QIBA 3V2AR 5DRWA 5TQ0H 2FEEI 4NQCB 4GG6E 3MJ8A 4I5BB 2EC8A 4G9FA 5FK9A 5GRJL 3L9RA 4L8BB 4XI5C 1KIRA 4JN2B 1ORQA 1DSFH 4JKPL 2RGSA 2YD5A 2OS7A 2ERJC 3O4LD 2B0SL 2VR9A 5CCKL 5AZ2L 5IEKB 4D3CL 4N8VB 4LF3B 3D3VA 4P3DB 2APXA 3ULVH 3L3IB 3PWNA 1MLCA 2QQNH 3BP4A 1XR8A 4OLZH 1OAQL 5L7XL 3PWLA 5HHME 2DOCA 3JV5A 2XNAB 3BYTA 3HPJA 4FABH 1SEQL 3B9KB 2J6EA 5MEOB 3GMNB 5KSBA 4GLRH 4PJGA 2IPKA 4FZ8L 2X2YA 5D6DA 3KYMA 5C0EA 2MHAB 5KBNC 4GAYA 3OGCB 3WD5H 1Z0NA 3MRQB 1OP5K 4L3AA 4DN4L 5IF0A 4HIJA 3HZVB 1KF9B 4POUB 3DVNA 5BV7L 4H26A 3K0WA 3NVQA 2LTQB 2VLJA 5BV7C 3NIGE 4O2FA 3SDAA 4M5ZL 3NBNA 1BECA 4HWUA 3WUZA 2Z31B 3BZFB 4HKBB 1MHPH 5EUKA 4KK5D 4V2CB 3WFZA 2YA0A 1TZGL 3QCVH 1X3DA 3IFOB 4QXTA 3PHOA 4G3YH 5TQ2H 1UB6A 2VRAA 1OGAD 5KZCD 1FO0A 4WO4D 1U93B 4ZFFA 1S78D 1H3VA 3BFOA 4MA7L 4OQ1A 5KSAA 3T77B 3KPNA 5E2UL 4N90D 4X5WA 5DJXA 3PWPA 2ARWA 4GRMB 5FO7B 1D6EA 2A6KA 5C07D 1EXUB 3LB6D 2AEPH 3O6KL 3QXUA 5DRXB 3BJ91 3D6GA 4HMCA 2FWOA 4N0FB 2F53A 1GGIH 3VXTA 2LQRA 5JQ6L 4LCWE 4NRZA 3TIEB 5IW6A 2P8MA 3ULUH 3S36L 2HMIC 5HPOA 1NDGA 4S11A 5F8RC 1B3JA 4X4XA 3KS0H 1ZVHA 1D5XB 1PGRB 3MUZ1 4M48L 5LAXA 5C0JA 3T0WA 4LPUA 3HLAB 3I9GH 5D2LB 3C08H 2X44D 2M2DA 5IBUG 4Y4KB 4GW4B 1QSFA 4C54A 3PWVA 1YQVL 5HHQA 2ZKHH 2AW2A 4CW1A 3UTZB 3S4SA 2FATH 1I8KA 4M6MH 2C3VB 3KNBB 4PRAA 5B39A 4KWUA 4W6YB 5HHNB 2ZOLB 4OIAA 5GPRA 1MCFA 1BQHG 3B5GA 2R2HB 5ELIA 3ES6A 4QRRB 4RMUA 5E2TL 1J0YA 4I0PA 3WHXB 2ITCA 1KEGL 4JZNA 5DJYA 5E5MA 3PABB 1S9VB 5FYKL 3MNWB 3QJHA 3OAYK 3GSWA 1RZ7H 4MNQD 1S9WB 3NN8A 4XP9H 5F70A 1YY9D 3SY0B 3QDJD 5DHVB 2YA2A 3FO2A 1U91B 3WFEH 35C8H 2EE2A 3G9AB 3L7FB 4WJ5B 4O9HH 3MZTA 4QTIL 2UWEF 3UAJD 1IM9A 4PJ5E 4YHOH 1I3RA 1MWAH 1EAJA 4NQCE 3CUPA 4F7EB 4YDVA 1H0DA 1KPVB 1SBSL 2QQQA 2GK2A 5FYJH 1FNSH 3KJ6L 5D1QB 2CGRL 2QHRH 3TA3B 2ICWI 3QQ3A 3ARRA 2AJVL 3EJZD 1QBLL 3ULVC 4F7PB 2BNQB 1ZA3A 2EDFA 1A9BB 3ALXA 4H25A 4GMTL 2HLAA 2AEQH 4IJ3B 4KFZC 4XVUC 1IGFH 1U58A 3VXUB 4NQSA 1YEGH 1DQQB 3RJDA 2QHLA 1HSBA 3QUKB 2EO1A 3TJEL 3TZVA 2BERA 2EDJA 3Q1SL 2BFVH 1HKFA 1KCLA 1S7TA 1XZ0B 3D69B 3QIBD 1CFNB 3FT2A 3F5WA 5F9WC 4OD1L 1V7NL 1AKJB 3A67L 4G80A 2YD4A 3CXDL 3JV6A 4G9FD 2AABH 4ZUTA 3UTSB 1RUQL 3E6HA 1NBYB 5CIPA 1L7TL 2BZDA 4HUNB 3H3BC 5JOFB 4CMMA 4D0BB 1QLRA 4MXQC 1MCWW 2DYPA 4X5LA 5HGBA 3EFDH 1TVBB 2B7DT 5IP4A 3KPMA 5T3ZH 2YRPA 1RJZB 3KJ4C 3D3VD 4JO2H 3WFHB 4J6RH 3JZ7A 4L8DB 3H0TA 2XFXA 2G75A 4P9HH 4X7FC 4FQ2L 4HUMB 3QEQE 3O3EB 1KTDB 3OX8A 3DWTA 4FFZH 3GSXA 1TLKA 5F9AC 1G9MH 3P4OB 1B0GA 5E00B 1S7QB 5D93B 3HRZB 4JZOA 1A14H 5IVXB 1QVOA 1YC8A 3PDOA 4XWGH 5JW5B 5AD0A 1S7SB 5GZOC 1F02I 4PLKC 1T3FB 5GRYA 2Q86B 1KJVB 2NW3A 4AH2B 3OXSA 3W5NA 1Z3GL 1P53A 4NKQB 4X0KA 3K2UL 4U3CA 3ULUC 2X1QA 3BSZL 1FBIL 1Y0LB 5E94A 2R2EA 4AIXA 2VLJD 2A73B 3IU3A 4LPWA 3V6BR 3SDAD 4IRZH 4WHTA 2IC2A 1CFQB 2G2RA 4OGYL 4HGWB 4N0YL 3ZDZF 3ILQC 1IT9H 4LLMA 1MNUL 1JPFA 1BD2D 5D2LE 1XF4B 4GUPA 4CU8A 3VXMB 3UYRH 3LKPB 2Q7YB 1EFXD 4RZCB 4ZSOB 4MXVF 1IGCL 2V5RA 4PJ9C 4APQC 4Q9QL 1XF2B 1AP2A 5KSAD 3PG2A 4NCC2 4X9HA 3CH8A 1PEWA 3Q6GH 4U1IB 4IEFB 1R3LB 2BXYA 4QRRE 5DVNA 2CR6A 3VMPA 1VFAB 3ZTNH 1KBGL 3A6BH 2F53D 3G6JF 1KCUL 1BFVH 1OTSD 1P6AB 3VG9C 5T3ZE 2DQIL 3FO0L 1CCZA 2DQEH 1ND0B 4Z7NF 1HE7A 3Q5TA 2A77L 1A6TB 2CSPA 4P59L 5JMOC 2Y06H 5ANMA 4OZGE 1ZWIA 2VLKB 3ROLA 5DQ9B 1FP5A 4KHTL 5TE7H 2AI0L 5EOQH 4XMKL 1CZ8L 1UENA 5DRZB 2MFNA 5I8EA 1DUYA 4HFWB 1MFDH 3ARFC 4QRSB 5I66B 4CU7A 1DN0A 2EDYA 1X5ZA 1FG9C 1XGUB 1M7DB 3BVNA 5CP3A 1SYVB 3CPLB 2I5YL 4LVEA 3UBXG 4GJTB 5IIEA 5GRVK 4M9OA 3ZT7A 2GJZA 3DLQR 1AGEA 4C4KT 4I0PD 4XVTL 2P5WB 3FQWA 5I8CA 4JPVL 3WS6C 2R0KH 5EORH 2BNQE 5ACZB 2HKHH 2QL1A 2I07B 4YC2C 1EHNA 1CGVA 1QPPA 5TFSL 1NEUA 3NTCH 2DWEA 3T3MF 5F1IA 1E4XL 4M43H 5F97E 3VXUE 5HI5D 3IFNL 3HAEB 3ARQA 4RRPG 3RPIB 1I7ZB 4X6DF 4X8JB 4EI5B 3IFPB 3L5WB 5CD3B 1IM9D 2X5PA 1J8KA 4MS8C 5CBEB 2EYRA 3DI3B 3LEXA 4K3HA 3UTSE 2VLMD 2FLRT 1OGAB 5BS0E 5FO9A 1J8HA 4PJFB 3B2VL 4HWBL 4RNRA 3WLBA 1W0WA 1NPUA 4BQ9A 4NN6C 2RFXA 1Q9LA 5DD5L 1FIGL 3DGCR 1K8IA 5AG9A 2R69H 5F7MC 3DHMA 4JPWL 1XF3B 4RMRA 4DFIA 1AXTH 4HS6A 5TJWK 3EO9H 43C9B 5HYSB 1W0VA 4OLEA 2J88L 2NY0C 5IBLD 4OI8A 1ZANH 3ZHDA 5I1LB 1UM4H 1CLCA 3RX5A 4PUBH 4ZTPL 2RIKA 3MV9B 5IB5A 2V9QA 2QSQA 2WIIA 5C0DA 1HQ4A 1A5FH 1AC0A 1QNZL 3U30B 5DO2C 5HI4D 5E4EC 4DUXA 4V2BA 4DZ8B 1FZOA 5FUZL 3FFCB 2BY3A 5DRNA 4YJZL 1G7PA 4J12A 2EDQA 1JF5A 4XHJD 3P0VH 5T1MB 3B3IB 5IVXE 2J2ZA 3VFUB 4R2GD 5I19H 3UTPE 5GGSY 5JOPD 4NO5A 2X10A 1KCSH 4MNGA 1JN6A 3VD3A 2BSTA 4KUZH 3QUML 2DYPD 5D5MF 3QNYA 3TBVB 2MPAH 2J8OA 3BP6B 2VXSH 4PGCB 1DUZB 1F58L 4JM2C 1FNEA 2FBOJ 1JNNH 1NSNH 3BX7C 3LS5L 1MUJA 1P7KB 2IPUK 3HA0A 1IKNA 4G5ZH 3RA7H 4PTTA 5E99L 3FB7A 1Q0YL 3VGGA 1AHWA 3QIWB 4HQQL 5LQBH 4G7VL 4LSVL 3VXRB 1EO5A 3AREA 4ZAKC 2WWMD 3VXME 5IJVA 2E7HA 4E5XB 3GNMH 4ZSOE 2UZIH 5GGQL 5KVFH 4QRTA 4U6VL 4D0CA 5ICZA 5CBAA 3NZHL 2Q3ZA 4QOKA 3ZE1E 3O41A 2GHWB 2EDRA 2PO6B 4IRSA 4M93B 4RGOH 3GGWA 1CICA 1S7WA 2AAVA 3LKRB 1DEDA 2PW2B 2AXFB 4Z95H 1PZ5B 1U8IB 4FQJL 5HYQB 5L8LB 4ENEC 4NJ9L 3JUZA 3ZYIA 2OP4H 3HKFA 4KMTH 1AGBB 4LIQH 2EDWA 2HFFB 2Y36H 3HNTH 2VLKE 1NCCL 3DUSA 2FX7H 3A0OA 4BH7A 1PG7H 3F7QA 4CVZB 4I1NB 2YS4A 2XKNA 3BGAA 2W60A 1SJHB 4UNTA 1K8DB 1XH3A 3PL6C 1QKZH 5IHUL 3DROA 5LGHH 5I75B 4HK3N 1IBGL 2HJLA 2C1OA 3SBWA 4HJGA 4JDZB 4WHYG 5IKCA 4IHOA 4JFFA 4JHZA 5CGMA 3MJ8B 5C0NC 1EEQA 3O45A 2XZZA 5TF1H 4G7YL 2VSDA 2IPTL 4EOWH 3FQTA 4ZFZA 2P5WE 2R0LH 4PJ8B 3D9AH 1F42A 5B8CB 3PHQA 3IDIA 4F7MA 3VGHA 5HD8D 3N1GC 1JHTB 2FIKA 2NTFA 4DGVL 4Q74A 1FSKB 15C8H 4HLJA 3LV3A 1FGNH 1KJ2L 3I6KB 4KKAD 5ALBH 4PGBA 1CDGA 3D3VB 4HCRH 1U3ZA 1MLCB 5F93C 1KELL 1TENA 1YEKL 2NY4D 4XAWH 3T04D 3PP3H 1SYSA 3PWLB 4UT6H 1YMMA 3GBMH 1LGVA 3C5JA 1IEHA 2APWA 3NFPA 5EPMB 2CK2A 1JMZA 1WITA 3VD4A 2AJ3A 1LK2A 5JPMA 1E4JA 1Q9OB 2H26A 1FHGA 3FO1B 4NQEA 1V7ML 4X99A 3STBA 1VGEH 4YH6A 1I7UA 1BHGA 1OGAE 4CNIA 2OMBA 4JM2F 1DBKH 3PV6B 3H42H 3ZL4L 4PJFE 4EI6A 4TRPL 1XIWC 4EQ3A 4WHDA 3V5KB 1HK6A 4N90E 3ZKNC 2WLZA 2A2QT 5IF0B 3FTGA 4HIJB 1DL7L 2VDRH 4NBYB 1U8OA 2H2SD 3B9VA 4KDVA 4TQEH 2EIEA 4U1JA 4X6CB 2ARJB 5ITFB 1K6QH 5AYUH 4ZFOL 3MRNB 1NFDA 5BZWA 1UWGL 3MV9E 4NO2A 3RI5K 5J7CC 5EUKB 3K4ZA 2R1YA 2BC4B 3OB0K 5DLMH 4Q6IA 4F2MA 2ADJA 3TT1H 3FFCE 2ATPB 1JNLH 5E6YA 4PG2C 2C4XA 4GO6B 2E8ZA 1T80A 3GI8L 3DX6A 2HTLD 1FO0B 1JZ5A 2LVCA 5E8DL 5KSAB 5I16A 4L8SC 3KPNB 1JF1A 4X5WB 3MFGB 1K4CA 4PLJC 5I1EL 3PWPB 3O2DA 3RIFF 1D6EB 2C3WA 4NKOB 5D8JL 3BPLC 2HAZA 3SE3A 2QSCH 3OJ2C 5JHLH 4PV8A 1Q1JH 4FG6D 4FFWD 4U0RB 3BUYB 3VXTB 3UDWA 1GGCH 5IW6B 2P8MB 1CLZH 2JLLA 4PJHB 3IRPX 5C0JB 4R7NA 3QDJE 5FYKU 1NFIA 3VXRE 2HT3D 2DQJH 4ZQKA 2DD8L 3U6RB 1QSFB 3WN5A 3PWVB 2APFA 5HHQB 4CW1B 2BHZA 2J6EH 3OKLA 2BCKA 2KBGA 1S78C 4PRAB 1CE6A 2HH0H 5DMGD 5IR1A 2DWDA 4BJLA 3DUUA 1S9KC 2APVA 3ES6B 4YDLB 3VI4F 1A4KB 3V5DA 4TSBH 3ZYJA 4I0PB 1H5BC 1IZKA 4PY7A 3MOAH 4YHML 5BOPA 3UBXI 5DJCA 3GSWB 3DSNA 1YDPA 2X70A 5D2NA 1I85C 4UV4L 3ARED 1LO4H 1T7VA 5ID1B 1T6WA 3QWQB 2XKUA 4L9LA 4PBVC 5CUSH 1K3IA 3KPOA 1XFPA 4J3OC 3GKWL 4N1EA 4YE4H 4Z76A 1V3LA 4NGHL 4M6AA 4R9HA 3MV8D 4IRSD 4FRWA 1CICD 1LQSR 4YO0A 2H6PA 1CLOH 4YDVB 1H0DB 3D39A 4U1KB 1NGXB 2GITB 1VACA 1EHXA 5EU4A 3MNZA 1UXSA 4LPCA 4CN1A 4LARH 5E2WH 3CVHL 1NAMB 2AXJA 3WJLC 1JE6A 1GAFL 1UJ3C 4NP4L 4X5XA 1YY9C 4TULH 5J9PA 2VQ1A 4ELKA 1S3KL 1HI6A 4YPJA 3W9DB 1KB9K 3Q6FA 3D3VE 2E7LA 1U58B 4JDVA 4ODUB 1JPTL 3DO3A 4JPKL 5FGBA 1HSBB 5ID0A 3SCMB 3TZVB 1P7QA 3SGEH 2YXMA 1HINH 2C7UA 4LLYA 5J8OA 1HZHL 2BMKA 1FE8L 2YSSB 3S35L 4LSSH 3FT2B 3F5WB 1ZHLA 3UAJC 4J2XA 4JFFD 3GHBH 1I9JH 4G80B 4M7JL 1FZMA 1ULVA 2ZUXA 5EO0B 4N8CH 3RWHA 4PGEA 1LMKA 5FCUH 5CIPB 4ERSL 3K8KA 3SQOH 5FXCH 3CZFB 4MWFB 4LEXL 3EJZC 2BY1A 3C60C 2DYPB 2X7LA 1Y6MR 4XP4H 1SM3H 4GH7B 3J8F7 5FEBA 4GRLB 1MH5A 1NANI 2IFFL 4X6CE 3EDEA 2R56L 3H0TB 2XFXB 4GXUN 2G75B 4HUUB 4UQ2A 4OTXL 1RZFL 4YEFA 1GJIA 1D5MA 3OX8B 4YHIA 5IROC 1RUPL 1OOAA 3GSXB 2HLFC 5CJOL 8FABB 1GHFL 5GGRA 4NQED 3LS4L 1EX0A 2F5AH 4NM4L 3S3PA 5GJSL 4JZOB 4NZJA 3WSQH 4YDKL 3U2SA 2BSED 1QVOB 5KANG 1TETL 4XTRC 3KGRA 2NW3B 3VXPA 3OXSB 2D9CA 3PWPE 2J8UB 3LN4B 5C0AB 1X6LA 1EZVY 3JWOL 1KULA 2R2EB 2QQLH 1C16A 1OB1A 2GSGA 2DQGH 1RIVL 2VUOA 2EXWD 3UZQA 5IVNA 1I1FB 5FIEA 3BGFB 2X4QA 2ADFL 2WQRA 3JSSA 5HDLA 4P4RA 3VXSA 4WHTB 1LO3L 1JFQL 3OPZL 4DEPB 4PJHE 2OJEA 4OLUH 1TJIL 4NN5C 4JFYB 4LLMB 3TIDA 1L9NA 3CC5A 3R06A 4XPFH 4GUPB 4MAUL 1ZEAH 2EH7H 1HH6A 1QFUH 1QSFE 3RVXD 2H3NA 1RMFL 2VN4A 1AP2B 3UJTH 1ZXQA 1A0QL 1XGQA 5DS8A 1NBVH 4X7CC 3OHXB 1FGVL 3TCLA 3DMMC 1AGDB 2EDDA 5CIPH 4MHHI 2QADC 4TVPE 3JV0A 4HFUL 2IAMC 5D1ZC 1C1EH 1ZTXH 4JB9H 3MFFA 3H3KA 4JJHA 3MRIA 3W0WA 2CDFB 4QWWD 5CGTA 1DQLL 3SJVD 4JQIH 4I2XA 1N26A 4YHLH 1JGDA 1M6OA 2EKSA 1DUYB 1DN0B 4NBXB 1I9RH 5E2JA 3BVNB 3WE6A 5JR1H 1DCLA 2JIXA 3IDXH 3HS0B 4PJBF 5IIEB 2HN7A 1WC7A 2GJZB 5EC1B 1A3LL 1AGEB 1MY5A 2YUWA 4TNWF 5I8CB 5JORA 4FQHA 1FDLH 1EBPA 4DKEL 4BELD 1NQBA 5DK2B 2NY3B 2ICWA 4M3JA 1WCBA 1QBMH 3CLEH 1CFTB 3CIQA 3QUXB 4PRNA 4PJ7F 4HXBL 3S96A 2V9RA 1JF6A 1TNMA 2E7CA 2F8VA 4YXKH 1R3KB 5I9QB 3D85B 5BCAA 2VAAA 2FHCA 2YKLL 3BEWB 4PJAF 3FB6A 1MIEL 4JQVA 4WUUA 3D39D 4S1SH 2EYRB 3QEGH 4HDIA 2IBZX 5HDQL 2OTWB 1KN2L 1WISA 3IAGC 3HNVH 5FO9B 1J8HB 1II4E 2OJZH 4YXLL 2YRLA 5EZIH 4FFYL 1W0WB 3BD4A 4QHNB 3RNQB 4I8DA 3P9WB 4XNUH 1MIML 1I4FA 1GZPB 1MFBH 1Q9LB 1XR9B 2IPUG 4DTGL 4ZD3L 2NXZC 4QRPB 4Z0BH 2NXYD 5IM7A 4LVNC 4WTXA 4XBEH 2CJUL 3E6FA 5DJZB 5CKAA 1UM6H 4LLQA 1WZLA 3FT3A 2PTTB 4QTHA 1FZKB 1W0VB 3NFSL 3V5HA 5GSVB 3H6JA 3L3OB 3S5LA 5ALCH 3IT8D 5C2BL 1S9YA 3BHBA 2WIIB 1HQ4B 5AAMA 4U1LA 1TTGA 1P2CB 3QWRA 1MHHA 3EZ8A 1E28A 2DKMA 5DRNB 2GK0A 3MA7A 4WGVB 1WGOA 1I75A 1G1CA 5DMIL 5LXGL 2BSTB 3NA9H 3T0EA 3MLUL 4QGYA 1WBXA 2J8UE 5FM5O 4K3DH 3EO0B 5C0AE 3TO2A 4ELMF 3MV01 3LSOA 4FZEL 1YJDL 5ABDE 4QYOA 4KRPB 2AEIT 4KQ3L 2AV1B 3QULB 1YJDC 4H20L 3FB7B 4CUCA 4R26H 2BVQA 1UVQB 1VEOA 1INEL 3QHZL 4R97B 4WI8A 4BUHA 1CGUA 1FV1A 4J3WA 3OXRA 3I6LD 4AMKH 1J88A 5IV2B 5DZOA 3KYKL 2X9WA 1BJ8A 2XXMB 4LDEB 4XHJC 1UACH 3FHQA 3ZTJG 1VHPA 2VR5A 4R2GC 2WUCH 3LQZB 1J5OL 4QOKB 3GRWL 4YDJA 3ARGB 3O41B 3CDYA 3H7BA 4IRSB 4M7LH 2JJSA 3GGWB 5KG9A 1S7WB 2XT1B 1ZOXA 4LPTA 2EDXA 4MQ7A 2DM2A 5F7LB 3Q48A 5EBMA 4NM8H 3S88L 4ODTL 2A83A 5IFJB 4NHCL 3VXSD 4JAMA 3NIDE 2R4RL 5L6YH 1C8PA 4X4YA 1EAPB 2DS4A 3GSNL 2Y07H 1KSRA 4U1NB 3MYJA 2B1HH 1B0RA 1OAKH 4D8PA 4DKDC 1B2WL 3DUSB 4BH7B 2OMNA 1GPOH 4GKNA 2XKNB 3NGBC 3VG0H 4UIKL 2A9NH 2H1PL 4IMKA 1XH3B 2BSRA 1G9NL 3DTXB 1CT8A 4BYHA 4GBXC 1EEYA 2HJLB 3CGTA 3VWKC 4OSUH 4YNYA 4IHOB 4XCNA 1CBVL 1F4WH 3FQTB 4ZFZB 3MLVL 1DBAL 3TO4A 4J4PD 3QG6A 1TPXB 1WUNT 4BZ2H 4BZYA 2G5BA 1C08A 1ZA6A 2FR4A 3TBSA 4TN9A 3IDIB 3U4EA 4F7MB 1U42A 3A6CH 3W0WD 2HJFA 1ZVSA 4KKCD 3MV7B 5LBSH 3LV3B 5B22A 3IRZA 3H3PL 4PGBB 1IQWH 1IAII 2PCPA 3O6FD 4RDQG 3BP7B 4KAQL 1JZ8A 3QI9A 4YX2H 1SYSB 1FAIL 1YMMB 3UO1L 3C5JB 1RVFL 3HR6A 2JIXD 5IHLB 3MXWH 2AJ3B 1LK2B 5JPMB 4WFGE 4NQEB 1FC2D 4HPOL 4X99B 1TZIB 5EBLA 4CN4A 1I7UB 3OJDA 5I30H 1J8HE 3VRLF 4EI6B 1PBYA 1BJ1H 4NO0B 5MENA 4MZ2A 4QRPE 4KKLD 3FTGB 3EFFB 2GUOA 4RMVA 4PJXF 2DB8A 3HUJA 5KANI 3LD8B 4NUGL 4TTDC 5DWUL 5BJTA 1CDBA 4NNPH 1NFDB 1NGQH 1TMCB 4HWZA 4NO2B 3F12A 4RISH 1X5FA 2GJJA 4XMLH 5EZLB 6FABL 5DC0A 1AY1L 1JGEA 1T22B 2R1YB 4P4KC 4X6EB 3SDCB 4Q6IB 2ADJB 1KFAH 2EC9U 3QZWG 1BBJA 3CFBA 2E27H 1YEHL 5EUOA 1BGXL 5GGTA 2Q87A 2WANA 1JZ2A 3RDTD 1JF1B 4P46C 1H9VA 4QXUH 4AG4H 3L3JB 4Z7OE 3BMVA 1X7QA 2DL9A 1TQBC 3BPOC 3V8OA 2BX5A 5B38B 5JNYA 4TSAL 4UDTA 3OTTA 3TBTA 2X1PA 2H2SC 2P24A 4LEOA 2VDNH 3T3PF 1T83A 1MCBA 1REIA 4N5UA 1NCWH 1JWMA 2B2XH 3WFDL 1CS6A 3RTQA 1T0MB 1R5WA 1SY6L 5INCA 1YNKL 1G6RH 3VFGL 4ZXBA 5FYLE 1KB5L 4N5ED 2GT9A 3QWRD 5GRWA 5C6TH 5IGXH 4X6BA 4YXHL 1WFNA 3JUYA 2ZP0T 2CLZA 3T1WA 3WN5B 4J3TA 3QB7C 3MLTA 3SKJH 5FECB 1YN7B 1BFTA 1CE6B 4QOKE 5IR1B 5F9JA 1J9CT 1CDUA 4OB5H 4MVBC 4TOYL 1LP9A 3NCJH 3MJ7B 3TYFA 3CFDA 3O3AA 3V5DB 1UA6L 1WZ1H 3FB5A 4NYLA 1UCBH 3BZDA 4FFWC 4FS0A 4X4ZA 3I3EA 4WWKB 5DFVC 5DJCB 1Q72L 4Q9BA 4RFOL 2EIZA 4E41B 4WEMB 1OP3H 5K9KA 3VWJC 5EO9A 2FX8H 3W9EA 2ED7A 5BRZB 3WXWL 5D7IA 1MFAH 3SKNA 4K94L 4MJ5B 4QRQA 1QFPA 1FORH 1ORSA 4AENA 3U1SH 4YHYC 1JHKH 1NH6A 4WV1A 1ZHNA 3RAJL 4DKFL 1ZKAA 1T1ZA 3RWCB 3SGDH 2OK0H 4P2RA 5GRXG 3K1DA 5HHVH 1FVDB 5I6XC 4H88H 4D2NA 5EBWA 4YO0B 3WS3A 2H6PB 4JQXA 4KUCD 3D39B 4KZEL 1I8LA 4S1RL 2AK4A 2ADGA 5EU4B 1CD1B 1UXSB 1PG7W 1XF5A 2YD3A 2KDGA 3O2DH 3BE1L 3DXAB 4AEIH 3R4DA 3MRRB 2IH1A 4YBLC 1MOEA 3VFOB 3PHSA 3QQ4A 3MV7E 4L8CB 4TYUA 3L3GA 4ELKB 4YK4B 4X9GA 3SKMA 4JDVB 1IAOA 1VENA 2HJKA 1DSFL 1P7QB 1XGYL 2AXHA 5LCVL 3VFSB 1YMME 4LLYB 2BMKB 2XN9A 5C0IB 3QNZB 5FFLA 8CGTA 1ZHLB 4TSCH 4OLXH 4QHMA 5BOZG 4V1DA 4OD3H 5J13C 4NQEE 1RULH 3RWHB 3TO4D 4UNVA 4OLZL 4O4YH 4S1QH 4WCYH 4P48A 3BQUA 2GTZA 4WNQB 2D7QA 5GGVY 2HRLA 2X7LB 2HFGH 4JGMA 4JPIA 3LKOA 1FG2B 3ECBA 3HI1A 1MH5B 2ZSWB 3V7AG 4GG6F 2D0GA 1EIBA 3U7YH 1ZS8A 4Y4HC 4UQ2B 1NFDE 1AIFA 1KTKE 4XRCA 1HWGB 32C2A 1NFKA 1I9IL 3TYGL 4YDIH 4F37F 4XPBL 4PJEA 4QRUA 3ZKXB 5GGRB 1NLBH 4JM4H 2I26N 2EDNA 2IJ0C 5FDWB 4JHWH 3M17B 5KTEH 3QDMB 1MHPL 4K71C 5MEND 1SBBA 3MLYH 1LD9A 5L2JA 3QCVL 3RVWC 3FT4B 1IGTA 4LGRB 1PQZA 4OT1H 1T5WA 4X4MA 1HH9B 1RHHA 2Y5EA 4BSWA 1OB1B 3RKPA 5KSVA 4H0GA 5CJXA 2X4QB 1ONQA 2R29H 5E24E 3VXSB 1OD7A 3P77A 2HFTA 2D7NA 2V2XA 3F7PC 1BWWA 1DEEB 1F90L 1IARB 1WAAA 4PJDA 4YAQA 2XYCA 4RDQF 3TIDB 1FC1A 3BIKA 4WFHE 2VR4A 4WI7A 1G7JB 4PPTA 4WTZG 5IQ9A 2H3NB 4D9LL 2DIBA 3NIGF 5GS3A 3TN0A 1XGQB 1DBJH 2JJVA 1KLGB 1KPRA 2VXVH 3I9GL 3VDAA 1OAUH 3GBLA 5TE4H 1OWWA 2ZCKL 1FH5H 5SX5K 2ZKHL 5KN5A 2FATL 1UKTA 4HIHA 4EUPB 3CDFA 3B9KC 2W38A 4ZXBD 3MFFB 1MREH 3MRIB 3UBXA 2BNRA 1ZVYA 4XPTL 5BRZE 1FLTX 1WWWX 4CRPA 4I2XB 1JGDB 3F8UB 1N4XL 2EKSB 3BOVA 4O2CB 1HHIA 5D72H 4WW2F 4HV8A 4G43A 2QR0A 3O4OB 4HPYH 1GGUA 2MKLC 1IC7L 4J1UA 4MMXC 4O02H 4FQCL 3WE6B 1IEAA 5EFIA 3DO7A 3WFEL 3TLRA 3NH7L 3RRQA 1U95B 2HN7B 1WC7B 4OF3A 3RWGA 3D39E 1ADQA 1JWUB 4F9PC 2Z93A 4O9HL 2LTQC 1J05A 1TVHA 4KK9D 4Y5YC 5E6IA 1NBZA 2VAJA 4YPGA 4XB7A 3DXAE 1INDL 4MB3A 4JANA 5L8KB 4RRPA 3WNOA 4U1GB 1XT5A 3MNVA 2O5ZL 5F21B 1C12B 1FNSL 2ICEA 2QHRL 1HXYA 4LKCB 3P11L 2QKIA 4I0CC 4AL8L 1EVTC 4P5TA 1RZIA 4X80H 4HXAL 4OZFG 2FH8A 1JUFA 4YQXH 1JL8A 2AEQL 4P2RD 3FB6B 4MQXD 4KDTA 4HWNA 5I1GH 4MCZA 4WUUB 3NCEB 4JKLA 4JHBA 4YUEH 5AG8A 4A6YA 1IC5H 4PYHA 2BFVL 2F58L 2Y23A 3GBNH 3N9GH 1I4FB 2IG2H 4TNVK 4WY7L 5EG6C 2AABL 3PGCA 5H37H 4Y4KC 4XXDA 3K4AA 2YZ1A 4LLQB 5J06A 2ZUWA 3VDBA 2P44B 5C0CB 3B5TA 1E27A 1S9YB 5I73C 2XTLA 3BHBB 2XN9D 1OCWH 2ZUVA 3HC4L 3OKOB 4R4BB 2X4PB 5T3ZL 1QR1A 1MHHB 3I6LE 4J6RL 4V1DD 2GK0B 2HKFH 3IDNB 3RWDA 3BQUD 1HHKB 3RKDC 4FFZL 3MGAA 3KYAA 3T0EB 1WLHA 1G9ML 2FDBP 1WBXB 3B8SA 3DVIA 4NCDA 4NKIH 4RGNB 5INDA 3VXOB 3ARVA 4JDTH 5IMLA 3TO2B 4LL9A 1A14L 3LSOB 1N5YH 1N64H 3T09A 2JE8A 1E0OB 4EDXB 4P9ML 3VXSE 1QA9B 1H15A 1MFEH 3KPRA 4NRXA 3G5YB 1DQMH 4XH2B 1FV1B 3OXRB 2UY7A 3CLFL 4HG4J 1OSPL 5D1QC 1E4KA 4IRZL 3TA3C 4L4JA 4N0UA 4JFOA 2F5BH 3DI2B 1YZZA 1IT9L 5GSRA 4P99A 5IHBA 1JTOA 3ZDYE 5C0GA 1NCBH 4GG8B 3UYRL 3H7BB 3HC3L 5GS1A 3RY6A 5KG9B 1EJOL 4WI5A 4K2UH 5FGCB 1BOGA 1OAZL 5IFAL 5EBMB 3RZCB 5L9DH 4YGVA 1UQSA 2A83B 3AY4C 4JVWA 1MCEA 1AXSA 4LLWA 2A38A 5HGHA 5SWSB 2BHYA 3NOIA 2CH8A 3VRJB 3MR9B 2R23B 4I2XE 3MRCA 3WIHA 1HIMH 2DQEL 4RAHA 3MLRL 4IOFD 5ESAA 1I8IB 3TN0D 4N0RA 3MLSH 5LWYL 3V4VL 1CT8B 3BYYA 4YBQD 4HIXH 2XI9A 3ABZA 1J1PH 3QIUB 3P4NB 1T1XA 5D2LF 1N2RA 5J12C 1MFDL 3OG4B 3FQRA 3QG6B 1SVZA 5DA4A 3E3QC 2GFBA 2YK1H 1BZ9A 3TF7C 1CQKA 1C08B 1U92A 2ZG2A 3FCTA 1TFHA 2C1PA 3U4EB 1KJ3H 2IADA 2AJYL 2HJFB 4ONGH 2G60L 2VZ3A 3RGVD 1IMHC 5K33A 3O6MH 5A2KH 4PB0H 5D93C 1UFUA 5TE6L 4ZS7L 1VDGA 4C55A 5EORL 4R3SA 3QI9B 2HKHL 2AJSL 1FVEA 3HFMH 3BH8A 5D9SB 3KR3H 1NEZA 4KVCH 1QQDA 3G6JB 4L5FH 4WUUE 4M43L 3WNLA 4OZGF 4GMSH 5EBLB 3WFBH 2BRRL 2YUXA 3RFZC 5DJ6A 5E6ID 3UMTA 4J4PC 2PXYA 1NGZA 1V05A 4F58L 2Q6WA 2P43B 2Q7NA 1HNGA 1PKQB 5D96B 4GW1A 1NGWA 2WINB 4KKCC 3CFKA 4UV7H 4GKSB 3HUJB 3QHFH 4NHUA 1UWXH 5BJTB 5C0CE 3AUVA 4XVSL 3O6FC 4P5TD 5I1CH 2FHFA 4HWZB 1F3JA 3F12B 4W6XB 4Z7UA 3QFJB 4ZS6D 4X7SH 1G7MA 1AXTL 2ZJSL 1IL1A 1BBJB 1R3JA 2R1XB 3CFBB 1UM4L 3HCVA 3QNXA 4PJIA 3MCLH 1I1AB 2FCBA 4B7LA 5F7WC 1MJ7L 1PSKL 4XB8A 3T0EE 4CVWA 1X7QB 4RGNE 2R1WA 5F88B 1TZHA 4JFDA 4KKLC 3TBTB 2H32B 2E6QA 2K3TA 3T8XB 1AO7A 2GQHA 2P24B 4LEOB 5IBUB 5I19L 4JZJA 2RB8A 5CEYB 1EJ6A 1JWMB 3LQAL 3RTQB 3REVA 4G6JH 2MQ0A 1JNJA 2MPAL 1EHAA 1AJ7L 4LCYA 4BSVA 2VXSL 2YC1B 2D03H 2VZ1A 2H45A 1BQHB 4X6BB 3OMZA 2X05A 2DQHH 2X4TA 4UZGA 1JNNL 1NSNL 2QEJA 3RA7L 5ERWB 4HUVA 3GMQA 3ZMRA 1MCOL 1A7NH 2MWCA 2HFEA 2YPLB 3RDTC 5F9JB 5C09B 2IQ9H 4JLRB 2CDEB 3TYFB 4ORGA 5D7KD 5FGCE 5KVFL 2YUZA 1QRNB 4O5LH 5HYIA 1ES0A 4HUKB 3KPRD 4PRHA 4EI5C 5SWSE 1FFQA 1C5DB 3MXVH 4N5EC 5EO9B 3W9EB 1IGIL 4Z95L 4P3WA 5D7IB 1QD0A 2VWEE 4OLWL 4PS4H 5DYOB 1AGFA 3ZKQD 4AENB 2OP4L 1ZHNB 4KI5F 4S10A 3HNTL 3I6GA 1KGCD 1T1ZB 3U4BL 2X1OA 1PG7L 2DQCH 4IIQB 4HWEH 2GJ6A 3WS3B 4HAFA 3OAZK 1PX4A 3ZDXE 1GSMA 2H2PD 1RZ8A 2AK4B 5J6GB 3CDCA 3ZDZE 1Q9KB 1KIUA 1XF5B 1YUHB 2IH1B 3U30C 3QQ4B 5ADPL 4UB0L 4MXVE 3R0MA 1P4IL 2EDEA 2R0LL 4H1LH 3SKMB 1QLFA 2DI9A 1HHGA 1IAOB 4HKXB 3FQNA 2VOTA 2ZOKA 1F2QA 5IFHH 4DOHE 2QQKH 1UH2A 1EEZA 15C8L 1FGNL 3G6JE 5ALBL 4KROD 5GRUH 4ZNCD 4R8WH 3RVUD 3QUYB 4G6AC 4F8QA 2N56A 4IOSD 2ATKA 4UT7H 2O26U 4UAOB 4C57C 3G5VB 3HI5L 3Q2CA 1X5KA 4PREA 3BQUB 3G5XB 3QIWC 3DGGA 2PYFA 3HNSL 3RVTC 1PKQE 1VGEL 3Q0HA 4JKKA 3H9ZA 5DJDB 4MCYB 3ECBB 3HI1B 1DBKL 3HUJE 1U3HA 4FQIH 5IMOA 3X13B 4LPYA 1RZGB 4CDHA 2BNUA 3B6SA 2P1YA 3ARZA 1FFNA 4KH2A 2WLYA 4KXZI 4FTVA 2PO6C 1NCDH 4NPYB 3L3KB 1AR1C 2Z8SA 4PJEB 3KPQA 4M93C 4TQEL 4MSWA 1OHQA 5BVJA 5C0BA 3SDYL 1K6QL 3LQMA 2FEDD 5EUOE 4S0SD 1GXEA 1RZJH 3D18B 1QSZA 2PXYD 2A6IB 2OLDA 5IB3A 1U6AL 1LD9B 4BA8A 3N1QC 2YZ8A 1IGTB 5F6HJ 3S97C 3S4SG 3SGKA 1AQKH 4POZC 4KC3B 1RHHB 5B39G 4HKJA 1VA9A 3V4PH 3EW3B 3P77B 4PJFF 1EO8H 1CDYA 3FOLA 4PJDB 4XNMA 4YAQB 4Y1AA 3WMSA 5CINH 3QUMB 4FXGB 3BIKB 3K2MC 5K93A 4X98B 3DX9A 3GMMA 3IDMB 4JFHE 4PJ8C 3IDYB 1GGCL 2NY2D 4Z7VF 5EC2A 4MA1B 5B8CC 4P0DA 5ISZB 5D7SH 1BX2A 1HHHA 1KPRB 2YPLE 1JRHL 5C09E 2HP4A 1FSKC 4KJPC 1BJMA 4JFDD 3LH2H 4NFDA 3CH1B 3FRUA 1AO7D 1F3RB 4OBSA 5KN5B 1QRNE 3CDGA 4CVXA 5I18H 2HH0L 4LVOC 4HIHB 1A47A 2BK8A 2BOCA 5ADOH 5D7JD 4ODVH 2IWGA 4OZHA 5GZND 3EJYC 1ZHBB 4MDJA 4GAGH 2BNRB 1QUNA 2ZZUT 4TSBL 5D7IE 3WNKA 4U7MA 4XCFL 1HHIB 1BQSA 2KZ1B 4G43B 2QR0B 3VXQB 1CK0H 12E8L 5EFIB 4P2RE 4RFNC 1LO4L 2VDMH 2VYRE 3O9WB 1P1ZB 2Z93B 1CU4H 5CUSL 2AK4E 4M1GH 1NBZB 4YPGB 3K80A 4PRHD 2YD2A 5BQ7B 4FQXA 2AJXH 3UZVB 1YYLH 1CLOL 2CQVA 1N3NB 3H9YA 4QHUB 1FO0L 5DK3A 4ZUUB 3SPVA 3GMPA 3C6LA 2NY6B 2EZ0D 4XZUA 1K4DA 1ZT1A 1HXYB 3V95A 1U8QA 2FZ3A 2ORBH 3BAEH 4LCUB 4LARL 5E2WL 4KVNH 2V7HA 2YPVL 1R6VA 1D5ZA 2V2TB 4P5TB 1MI5B 3OG6B 1JUFB 2VDLH 4TULL 2VDQL 1EBAA 4I18A 4NWUH 2GJ6D 3OKEA 4MCZB 3SKOA 5EOCH 3TM6A 3T2OA 1M4KA 5I2IA 4MGXA 4OGAD 1HINL 4KK9C 4Q58C 2W92A 4LSSL 1GIGL 4MB4A 25C8L 5E8PA 3RGHA 5E8OA 3U36B 2WBWB 4XXDB 5FCUL 5E1HB 3SQOL 3FMGL 4LMQE 3QO1A 1M71A 3ZKSD 3VI3F 3BKJL 3QXAA 1G0DA 5FM4A 1G7HA 3UJIL 3C5SA 3L5JA 4XP4L 3S37X 4YBHA 5FUOH 4PJEE 1M7IA 1J1XH 4TVPL 4QY8A 1VEMA 5L8JB 3NFNA 3ROOB 5BW7C 3GM0A 3U9PH 4LDOB 1B88A 1B0WA 2VE6B 1U8JA 1TNNA 4GRWB 5IQ7H 1D5IL 2XA8H 4LQFH 4M1CC 4A2MA 5INDB 1ADQH 1U8PB 5DD0L 5D7LA 2BXZA 4K9EC 1PDKA 3EYFA 5KSBF 1N6QL 3STZA 1U3HD 2FO4B 1KUMA 4X4ME 1OPGH 2GEEA 3RL2B 3EOBA 3INUL 3ZSTA 4XPAH 1EHLL 4PD4J 3KPRB 5C8JB 1MAKA 2A6DA 4H5SA 4PJDE 4YFDB 3TWCH 2DKSA 1A2YB 3V52H 2QQLL 1AGCA 2WAHA 1FFPA 5C0BD 3T4AB 2DQGL 1A3QA 3OR6A 5HDOA 3HN3A 4OLUL 3L6FB 5ISZE 1Z5LB 2VC2H 3NPSB 5F9OH 5E4IA 1MCDA 1O7VA 4XPFL 5GSRB 1FCCA 4DQOH 4MMZC 4A6YH 1DQTA 3HE6D 4LSQH 3UJTL 3SCMC 3SHSA 1AXSB 4LLAA 4Y2DC 5HGHB 3IJSA 1UM5L 1MCQA 3IXTA 4LLVB 4Y1AD 4IRJC 4HK0A 2ZNXA 2BNRE 1P4LB 4R0LC 1YMHA 4ETQA 3U83A 4EEEA 4NZTH 1CG9B 1NANH 2MKWA 3BPCA 3WXVH 1R5VB 4P3CL 5ESAB 3HMXH 4U1SB 2XPGA 2V17H 1JYXA 2XTJD 4PG9B 1VFBB 2IQAB 4QXGH 4PY8J 1BLNA 1L7IL 4JQIL 2DLGA 3LY6A 4GRLC 4YHLL 4GW5A 4S1DD 3K7UA 1QFOA 1N2RB 3SE8L 5GISL 1CWVA 2LU7A 2CXGA 5DJ2A 3ARDB 4JY4A 4PGJA 3EYOB 4BSJA 2GFBB 1U92B 3FO9A 3FCTB 3CFCH 4ZNEA 1DE4A 2FJHA 5HPMB 4D9QE 4PLOB 3WFCH 1AFVH 5CGYC 4HZLA 3W2DH 1FNHA 1U8KA 1FDLL 4Z0XA 4ESKA 1HILA 3AS3A 3NAAH 5I1AB 1N8ZA 4R3SB 4IS6B 3EJJX 5MEPB 5BVPL 4HS3A 5C0RH 1MI5E 4IOFC 3GMLA 3LKQA 3CLEL 3BKMH 3CVHB 5TDPA 2FX9H 4OKVA 1MCJA 5DDHB 3UC0H 4JG1L 3X11A 4HAGA 4PR5A 4WDIA 4NQTA 5F7UA 3BGFC 2VLLA 2VH5H 2OSLA 5DF0A 2J5LB 5IMKB 4FQXD 4YIQA 2VXQH 4P23B 2F19L 4K8RD 1A7RH 5DEGA 4DN3L 4K23H 4L3CB 3LZFH 1NDMA 5DUMH 3C6LD 1AI1L 4GW1B 1NGWB 3RGVC 1H3PH 3CFKB 2OJZL 3RWIA 4CGTA 3QZWA 1KLUA 5DVMA 5EZIL 1YPZA 4XNUL 4Z0BL 4WHYH 2B4CH 4QNPE 3WIHH 1PLGH 4JFZL 3HG1B 4AEHH 1J0IA 2HT2C 5HVHB 5DD1L 4JG0H 4LSTL 4ODHH 2FJFB 1JGLH 3HCVB 4PJIB