4NCC2

Neutralizing antibody to murine norovirus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
220
Chain Sequence
b'VKLLESGGGLVQPGGSLKLSCAASGFDFSRYWMSWVRQAPGKGLEWIGQINPHSSTINYTPSLRDKFIISRDNAKNTLYLQMTKVRSEDTALYYCARLLRYFYALDYWGQGASVTVSSAKTTPPSVYPLAPGRAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab fragment light
molecule tags Immune system
publication title Flexibility in surface-exposed loops in a virus capsid mediates escape from antibody neutralization.
pubmed doi rcsb
total genus 40
structure length 220
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ncc202
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ncc201
3IJYB 5FCSH 2NMSA 3ULVF 1BIIB 1HQ4B 5I30H 1MHPL 1T6WA 2ZKHL 1A7BA 1T03L 3GZKA 5JW5A 1EGJH 1AP2B 3KYMB 4NHCH 2BNRB 4LLUA 1BFTA 1C12B 1OTTD 3QIWD 4R4NC 5F7LB 3RDTC 2I25N 4K3DH 3WHXA 3MV01 2GJJA 3DI3B 3MRQA 2VR9A 1K4CA 1MWAL 4JHZA 5E1HB 5C2BL 2DKMA 3HI5L 1BQLH 1X5ZA 4CJ1A 2ICWI 4LHUA 4DOHE 3U1SL 4CMHC 2F5AL 1NMCB 1FE8L 1NJ9A 2HVKB 4FQXC 5DQ9A 5KVDL 1Z3GL 5AAMA 3CMOH 2IAMB 5F9OL 5E03A 3WNKA 5DZNA 4HLZH 3PWJB 5E9DE 3BIAX 4Z7WB 3THMH 4FG6D 3Q6FA 2Q7YB 4P3WA 4U6TA 3PP4L 2NY5C 1SY6H 4CJ0A 3ARFC 1L7IH 4K3DL 5C0BD 2DRUA 1TDQA 3C6LA 1J1XL 4PJBF 1XGUB 4FN0A 3O6KH 4OKVB 3K8MA 1ADQL 5KJRH 3QNYA 4OLXH 2P5ED 3CDYA 3NACL 2OCFD 1BBJB 4MNQE 1EMTL 4PFEA 3OF6D 2KH2B 3B6SB 2XG5A 3O6LH 4U1NB 1MCOH 4KMTL 4XNXL 4I2XB 3X3GH 5ID0A 5FOBB 1E4WH 2MQ0A 4P9ML 2J5LB 4PG2A 3HC4L 3QXAA 5KOVC 4KTYA 5EU6B 2GSGB 1EBAA 1RURH 5IGXL 3NZHH 4RWYH 4WO4A 1JGEA 2ARJB 3NTCL 2D3VA 5DMJB 3V95A 3VRIB 4LNRA 3U1SH 2X4UA 4DKEH 1I1AC 2E9WA 4FFZL 1ZE3C 1G7PB 3VWKC 2W0FB 5JR1L 3WJLC 5DA0B 4P3CH 1AGDB 1X5XA 1F8TH 3ARZA 3PWPD 4R4FL 5D2NC 4PRHE 1HYSD 1EO8H 3CAFA 5L2JA 3MV9A 3MACL 3OAZH 4FQPA 4PJFA 4ZXBB 1H15A 3K0WA 1SM3H 2ARWA 3VXUD 4PGBA 4BZYA 3RWGA 2D31B 3TT1L 4M43H 4L3AA 3IDXL 4ZUUA 1E0OB 3C2AL 4Z78A 3RY5A 2AJYL 5D93C 1YN6B 2CLRA 2HAZA 1EAPB 4C83A 5I1HL 1CF8L 1P1ZA 3UJJL 2AKRB 3NBNA 2ZPKH 4ZO6A 5IESH 5EIIA 3D0LB 4FFZH 3U7AA 1Q9KA 4Y4FA 3HMXH 4HBQA 3GRWA 4Y16B 3SQOH 3H9SA 1JNHB 5FUZL 5A2LH 4W4OA 1FNGA 3HG1D 4Z7WA 5CSGA 5JW4N 4YBQD 3WO3B 1KB5L 4M9OA 5KSAA 1AH1A 2PCPA 4NCDA 2DWDA 4WY7H 5DGRA 4H8WH 3V0AC 4NDMB 4EEEA 2ZNXA 5C08D 3SE3A 2BCKB 3JVGC 2JB5L 4AEIH 5MEPA 2GTWA 3JUZA 4HKXA 1WV7T 8FABA 4O51A 1F6AA 3H7LA 4G8GD 4M1CC 1XCQB 3NGBB 1MCDA 2MPAH 3X3FL 1BVKB 1TZGH 1KFAL 4OIBA 5ISZD 5HHMD 3DO7B 5EN2B 1VKXA 2YWYA 3BKJL 3L1OL 4G43A 1NEZB 3HZKA 1T03H 2DLTA 3S4SG 4K9EL 5BS0B 2R0KH 5F1IA 5FEBA 4GQ9L 2Q86B 2VLKD 3BPCA 2QQNH 5INCA 1CBVL 1JHLL 4J3TA 5D70H 5DJ2B 4PRNB 5F7DA 3WSQL 3KS0J 4LLWB 5IVOA 4PJAE 4X98B 5CJBA 4HAGA 4JZJC 4KXZH 4XXDA 5L2KB 4R96A 2XICA 5DJXB 2VXSH 2YMXH 4P57B 4PBVC 4GKSA 4X9HA 4UTBL 3MLRH 2D31A 1EZVX 1I75A 3VFVA 3RL1B 2OL3L 5FXCH 4P4RA 4N8VA 3U4AA 1CLYH 4CDHA 1KPRB 3GMRB 1ZWIB 3V7AE 4FZ8L 4LOUD 5GJTH 1IL1A 2ED8A 4Z78B 3Q3GA 4WRLA 5HHNA 1K6QL 1LDPL 1U91B 4AH2A 5F7MC 4C83B 3ETBF 1ZLWH 4JQVC 1IM9A 2OTUB 5ITFA 2Q76B 2ZUTA 1GGUA 3AFLA 5DFWH 2F58L 1EPFA 1ULVA 4ZS6C 1UM5L 1FVCB 3DGGB 4DN3H 2BOBB 3IFPB 1A64A 4PJ8B 5C9JA 1KENH 3BT2L 2ZZUT 4JQXA 1NKRA 4GG8B 1PVHA 2MJWA 2GUOA 3QRGH 4MCZA 4DJMA 1Z0MA 5LAXA 4ZXBD 5FUOH 5C0FB 3EOBA 3O6ML 2XACC 3RNKB 3PWNB 5DJ6B 3K2UH 4G9FE 5K9JH 2DBJA 1XFPA 1FNSH 4NM4L 4OD3H 2R0ZH 3VI4E 2R56L 3BRGC 5E00A 1OF2B 3EUUA 4YZFE 1H3VA 4APQC 1KV3A 1ZSDA 3IDGA 2C5DC 2VXQL 3GJEB 2R2CA 5GRVL 2GJ6B 4N1EA 1Y0LA 4JFFA 4HLJA 3NPSB 4QHUA 2X5PA 1JJUA 3BP6A 1FFPA 2IFGA 3OKMA 1X44A 1NCWH 5F1OB 1WC7B 5F89B 4JZJB 3UP1A 4NZRH 1ACZA 3SE4C 4Z9KB 2XTJD 3EJYD 3EYSL 4EOWL 4CVXA 1OAKL 3G08B 4OTXL 5DYOA 3DARA 4UDTA 4XCEA 3B43A 1UCTA 4RFOL 2CD0A 1JPSH 1KTLA 2UWEE 3MFFA 4LDEB 2VAAB 2YEZA 3STBA 2HTLD 1I8IB 3CVHA 1R5WA 4YWGH 2EH8L 2IAMD 5IW1B 5IP4A 3OZ9H 3MOAH 1OGAD 3RPKA 1N4XH 1RHHB 4KMLB 3VDBA 1I9IL 1UWEH 5I1CH 1BVZA 4OGXH 1E27A 1UB5A 5CD3A 1PYWA 3LQMA 1WZKA 3BUYA 1QBBA 3QQ4A 3BKML 4ODTL 1UWXH 4P59H 4HS6B 1SEQH 3KYAA 4U1HA 4W6XB 5I8CA 1T2QL 2GEEA 1OP5H 3T0BA 2VDOH 3SBWC 4JZOB 1A6TB 1QSVA 3SCMC 1T2JA 4R26H 1RU9L 5CMAA 1WZ1L 4PUBL 3FONA 4HXBL 5EZIH 3VWKD 3O9WD 1QSEE 1OP9A 3E1F1 3AY4C 5EOQH 1P2CA 4LPTA 4TSAH 3RJDA 3SDAA 3ZZ1A 4NQDE 3OXSB 4LCIL 2A9NH 2DBLL 2WWMC 4OLEA 1SJEB 3K81A 3CD4A 3ZTJH 1MRFH 1DQLL 3IU4L 5EDXA 4MXVF 3L1OH 1JZ4A 1RZGA 1CGTA 2QSCL 3BGFB 1IAOB 5C09B 4NO3B 2XPGB 1FORL 1G7IB 4G8GA 4NWTH 5HGAB 2UV3A 4DZBB 4WENB 3L3IB 4GAFB 1FG2B 4R4ND 2NY0C 2F53E 3JSSA 1JHTA 2BC4A 4J4PC 5SWSB 4U2ZA 1U3HD 3RNQB 1QSFA 4JDZA 1NUNB 2WBJD 4IBLT 5FFLA 2C3GA 5GJSL 5IIEA 1N7MH 3KXFB 2FJHB 2PYFB 5EUOE 3IFOB 1ACYL 3O6FC 5F44A 3TJHC 3KYNA 2V9TA 2VERN 3REVB 3QXAB 1GGCH 3TH3T 1H8SA 4PBXA 1LE5A 4ZSOB 5FDWA 1G6RB 1UH3A 4P49A 3FAWA 5DFVC 3VXQB 4GT7A 3FT2A 4WHCA 3NABL 4L8CB 1A6VL 3OG6B 3VXOB 1B0GB 2H26B 2J8UF 1UWXK 4HCRH 4X4MA 2VL5A 4Z95L 4IEFB 5HHPA 4HJJH 5TGBA 1I8IA 1RIUH 3CVHB 1F3JB 3C60D 3EKCA 2ZOLB 3BZFA 3CXHJ 3MRGA 3LY6A 1AC6A 4MD5B 3VDCA 1QUNA 2PXYC 2JELH 1YNLH 4Q9QH 3U4BH 4HCRA 3S4SB 1JGDB 1MFCH 4Y5XC 2VRAA 2ADJA 5FUZH 1S9WB 3WUWB 3AAZB 4HPYH 2OS7A 4XRCB 1T20A 4LVHB 3VFSA 1ZGLM 4HDIA 4ONFH 5F3BA 3K4DA 2H2SD 1H5BB 3KPPA 1EVUA 1YDPB 4ZNEE 4KVCH 1I9JL 3GRWL 2XZCL 3VH8B 1LO3L 3HRZB 3G9AB 3MA7A 2EDHA 5T5FH 1YN6A 4NZJA 5DC9B 1P4BL 5IG7B 4FS0A 3F5WA 1Q9WA 3WLBA 3O3AA 5I71B 3KR3H 1CXKA 2CH8A 2DLEA 4DQOL 2P7TA 2JELL 2DWDB 1A7QL 4NC0B 2EC9T 4NDMA 1VGEH 5TDPB 3AMLA 5J4MA 2MKLC 1QO3A 3T0EC 5H37H 5C0CA 3F12A 4Y5VC 2LQRA 3TO4A 4QOKE 3HB3D 5L8JB 2D9QB 4HUXB 3X12A 1W0YT 1NMAL 2W9LA 2V17L 4TSCH 2H8PA 2AK4A 4XNQB 3QHZL 3RI5K 2CPCA 1A6AB 4EN3A 4F8TA 4U4BA 5D8JH 3U30C 2VDRL 1QBAA 2R2HA 3L3GB 3MCKB 5EZJB 4JRYB 3JTSB 3P4OB 3SE9H 2VLJE 1YUHB 1EUUA 1MHEB 3RZWA 2HN7B 3D25A 4O2FB 4PG9B 5TE4H 4DQOH 3CSYB 4NQCB 4H88H 5IJVA 3MLRL 3V5HB 4DEPC 1SJXA 3VFGL 5DUPH 1F02I 2N7BA 4MGXA 4ZTOL 1AO7B 2R1WA 1BAFL 1BIIA 1HQ4A 1NAKL 2HH0L 3QEGH 1XH3A 3PWPE 3WE6B 1TJHH 4ODTH 1HHKA 2EZ0C 5T5FL 4G6JL 4WU7B 3BFOA 2W91A 3PV6B 3VGEA 1LD9B 1OOAA 2XIDA 4Q74A 2W9EH 3WFBL 4CL7A 3OTTA 1KCRH 5DJXA 1AC0A 4LNVA 3GMMA 4J4PA 1G0YR 2VE6A 1INQA 5CWSB 5BVJB 5DURD 2E6PA 1HN1A 4RMRA 3QXTA 1BJ1H 4TSAL 2D7PA 2WBJA 3L7FA 32C2A 3LKPA 4YLQT 4R0LC 3BWUC 4PJGF 1HHJA 2V7NA 3SKNB 4R2GC 4F3FB 5DD0L 3BN9D 5DFTA 1J1PL 3QUZA 5BV7H 1NMAH 3ULUD 2IEPA 4CN1A 3BW9B 4QGTA 3MUZ1 2Q76A 3DROB 4JN1H 2BSTB 2R29H 3MPCA 3LMJL 1IM9B 1T5XA 1EJOH 3FOMA 4ZFOL 4NJAH 5BJTA 4W4OC 2KQMA 2NTFA 3NCEB 2Z92B 4JFDA 4OM0L 3C6LB 5IEKB 3MJ9H 2NW2A 3NFSH 5HHOA 3VMPA 4EDXB 4U1IB 3C6LD 2YRLA 1W2KT 1Z3GH 4J3SA 1Q8MA 5EU5B 2YUVA 5D1QA 4UAOC 1IAKB 3ZDYF 1ZGLB 5IQ9A 2XT1B 2C3VA 3HHRB 4GXUM 3QA3A 3NIFE 4AYFA 4CMMA 4P4KC 2FO1A 5IFJB 3UTTA 3BEVA 4Z0BL 5JPNA 5D7IA 4HUWA 5CZXC 4JRYA 3BYYA 5DVLA 2B7DT 3MSPA 3ET9F 4E5XA 3TO4D 4K7PL 2WINA 3LN9A 4P5MB 5BVPH 2HJFB 3RTQA 4OFPA 5JUEL 4KUCD 4FQIL 2R0LL 1RZJL 4WU7A 4BH8A 4JQIH 2FBJL 1BEYH 5D7LD 1RUPH 4XHQA 3C5JA 5C07E 3PDGA 3KPSD 1EXUB 3OX8B 4X9GA 5T1KD 3ARFB 1A6PA 5B22A 2GY5A 4FZEL 1VFBA 4NRYB 1MRCH 1HKLL 3PG2A 3L3DB 5HGDB 4EUPA 4U0QB 5CEYA 4J3WA 1WWCA 4X5XB 5F96H 3BPLC 3DV4B 4J6RH 1W0VB 2VN7A 3MJ9L 1EHLL 2XFXB 3EJZC 5HVFB 3LKOB 4F3FA 3O2WL 3R06A 3J7HA 1GCFA 3STZB 4F7CA 4GXVH 1MPAH 2A9ML 4CW1A 1NBVH 3VMNA 4MXVE 3WFEH 5IVXA 2F53B 1JNHA 4HWBA 2MCPH 2YPKA 5C9KA 4O9HL 3UAJD 2N7AA 1I7TA 2AQ2A 3C08L 3H9YA 2A77H 3ME0A 3ZE0E 5GSRA 1VCAA 3KWWA 5T3ZE 4KDTA 2G60H 5C2BH 5EIVA 1KLGB 3UTQA 1FDLL 1NCAL 4D9QE 4X4ZA 1S7VA 3W81A 1HZHL 3MNWA 3P4MA 2YPVH 5JDJA 3MLUL 2YPLD 3QFJD 4Y2DD 3Q3GB 3CXHK 4RBPK 1MFBH 4A2MA 1S7SA 4RQQB 1RQ5A 2A6JA 5D7IE 2X4QA 1F4YH 4ZS7L 3HC3L 1WEJL 2I5YH 5HI5C 2NX5E 2W07A 4P23C 3T4YA 1T2XA 2WUBL 4JFOA 4DZ8A 2R4SH 3DMMC 1TPXB 4OIAA 3VJ6A 3TN0D 5HSFA 1VPOH 5JNYB 4X80L 4PGCB 3ZMRA 2AJ3A 4HHAB 4I13B 1UH4A 2Q3ZA 4HJ0C 5ALCH 3SPVA 3SE4A 3FB8A 3G6JF 3T2NL 5SWSE 3GO1L 4ODXA 1IBGL 3E6HA 1TVBB 4PLKD 5D2LE 5HGHB 4F15B 5D71H 5H8DA 4BFEA 5IM7A 2W0PA 3VXPB 4JLRA 1LO0L 4D9LH 5B38G 2VKWA 2IQAB 5DS8B 2VISA 4XP4H 1U3HC 1JI2A 1RD6A 4M5ZL 4PJ5A 5ELIA 5IHZB 1PG7X 1FAKT 1EIBA 5HGGS 3T3MF 3TO2B 4G8FB 3GSOA 4KK6D 4XCNA 1FG9C 1JZ8A 3ZKNC 4U6VL 1XZ0A 4PJXE 4UNVA 4OM0H 1F4XH 1R3IL 1WAAA 1A6ZB 3NFPB 1OW0C 2DQHL 5FYJL 4HD9A 1IVLA 2UVEA 2FZ3B 3KAAA 1P7KA 4L8BB 1YMMA 1CS6A 3LEYL 4TNVF 2VXUL 4GS7B 1H5BA 4JB9H 3I6GA 4Q0XL 4JG1H 3H9ZA 5GS3A 3KPRE 1I7UA 1P6FA 3VGDA 4RDQG 3DX6B 3DMMD 1QR1A 1GOFA 4XPAH 1D9KB 2VR4A 5SX4I 3ZTNH 2DJUA 5C0ND 4KRPD 1X5YA 4KROB 4NKQB 3L5HA 1KLUB 3GI9L 3HC0B 3HUJF 1ZT1B 4L8DA 1K4DB 4J23A 3TCLB 4WIQA 4P48A 1OF2A 1TZHA 3P4LA 1DBAL 5FYJH 3HMXL 3VFVB 3FT4A 3X13B 1SEBA 4BSWA 2PNDA 3TZVB 2DIBA 4XGZA 2VUYA 3L3JA 2YBRB 4K3GA 4MDJB 4XAWH 5JOFB 5BV7B 2AAVA 1IC5L 4G6ML 2Z0BA 3BE1H 3U46B 4PTTA 2M1KA 3LSOB 5JNYA 3TLRA 3BSZL 1YPZE 3VA2C 5ADOH 1N5YL 3JTSA 1CIDA 1RJZA 5ENWA 1JWMB 4GRWH 5DK0A 5TDNA 4YXHH 2M8XA 4M7KL 5IMLA 5IR1B 2V9RA 1EO7A 1F8TL 3NCMA 4WO4C 2DM3A 4NO3A 3CVHL 5F97E 1JGUH 4OGAC 4M4RA 3NACH 2JF1A 1XF4B 4UU9B 3O9WA 4NO0B 1ZVSB 4QYOA 4NNXA 4ORGA 1GHFH 2ZCKL 1A1NA 2D4FA 1F6LL 3G5XB 1T0NB 5D6DA 3MOBL 4EOWH 3HC4H 3MGTB 3GSWA 3IDNB 4JFEA 4XVTH 3KLAB 5B38B 1MAJA 5I16A 5H35A 1F4AA 4OCYL 3BZEA 4JO3H 3LDBC 3DO3A 2FNBA 3EYOB 1ZT7A 2R8SH 3LCYA 3V6OA 2WP3T 5C0EA 4AM0B 4XBEL 2P42B 1CFTB 3RVTC 2DJ4A 1DBMH 4H1LH 1X7QA 4OB5H 4K2UH 3QDMA 4KPHH 1LNUB 4AQ1B 1HWHB 1S9VB 1QR1B 4P5KA 4X7SL 4QXTB 4S1QH 3IAGC 3MLUH 1B0GA 2XA8L 3BAEL 4M6OH 5CIPH 4H26A 4HUMB 1NGZA 3CCHB 1NCCH 4HIHB 1L9MA 1K8DA 5I66A 2CUIA 3HZMA 4LEXL 4PG2C 1IGYA 3WDHA 3H9SB 1RURL 1H0DA 4YGVB 2LTQB 1LK2B 1S7QA 4U1IA 2H2PD 4KI5C 5CIPB 3MXWH 3SDXE 2AI0H 1KBGH 2HLAB 3EJZD 4W68A 1JBJA 1ZA3A 4P2RB 1WT5C 3ULVL 5ICYB 1LEKB 5LBSH 4X8XA 4Z7OE 1U8LA 2AS5M 5FGBA 1IE5A 2VLJB 2FGWH 4M02A 4ETYA 35C8L 1KYOJ 4D9RD 4HIIA 4XP9H 1MREL 1Z0NA 1LGVA 1UKQA 2XTJB 4QRRD 4APQB 4F9PA 4IDJL 4YHNB 25C8H 2D0HA 5FF6A 1DQDL 2QADD 4KJWC 4LSVL 4JANA 4LAJH 1RUQL 3MCG1 4FNLH 3TT3L 3MLSH 5GS0D 3QP3A 1ITCA 1U2CA 1B6UA 1XCTA 3F12B 3L95A 3O4OB 5BRZA 1G9MC 2DQHH 4KKLD 1AO7E 5BXFB 4EI5A 4PS4L 3T0EA 1RZGB 4U1NA 4KC3B 3UYRH 3MBEC 2ILLA 3MRJA 4MAYA 4HIXH 5KSBE 2A77L 4MNHA 5DRZA 2DLFH 4O2CA 3EDJA 1PLGH 1WUNT 3FMGL 2R9HC 4PJ8D 1E28B 3ESVF 4WI6A 3GSXB 4N8CL 2FJHA 1MFNA 3CH1A 5HYIA 1S7RA 4P2QE 2J88L 4URTB 1KPUB 1EMTH 5IHUH 2YK1H 2GQHA 2VWEC 4MB4A 2XZAL 1TZGL 1GJIA 1F4WH 1IGYB 4A6YA 4S1DD 3C5ZA 3FOLB 5B39B 5JOEA 4E41B 1RZKH 2DL9A 1K8DB 5I66B 1S9KC 3MJ8B 1OGTB 2DTMH 5F1NA 3S3SA 1NGWB 1WBZB 4ZAKB 1Z9OA 4WHDA 1FYTD 3ISWA 4BQ6A 1F90H 2H3NB 2OSLA 1T89C 3IETB 3DVGA 4WWKD 2Y72A 2RAMA 5D4QA 4O2EB 5K59F 3KYMA 3VXUE 1R3HA 4NM8L 3DXAA 4QXUL 4F7MB 4WJ5A 4QLRA 1CVSC 5KW9H 3BW9A 4UT6L 4HKBA 1Q0XL 4WW2F 1BZQK 4K07A 5DI8B 5KSUB 4KKBC 1CLOL 1MRFL 5DJAB 3ZT5A 2FJFA 2FDBP 1N64H 3QH3B 3QUMB 5GRUL 2ORBH 4H25A 4NZUH 5E99H 2FATL 1YPZA 2H9GA 2E7LC 1BFVH 4UV4H 4WFEE 1NFIA 1MY7A 5DR5L 1LEIA 1S5HB 1CE1L 3ARBD 3M07A 4HHAA 1UM4H 4RZCA 4OUOA 2OJEB 2JB6A 2K7PA 3MOAL 1AXIB 1KIUA 4PJXF 3I3EA 4EQ3A 1JZ7A 1A6UH 2FEEI 3GMQA 3MJGX 2EC9U 3S35H 2R56H 2AEQH 3TNMB 4MLSA 3NMEA 4CMMB 4ISVA 5HDQH 3IDMB 2P48B 1MCEA 2CDFA 4YDJA 3UPRA 2AJUL 4LLYA 4I2XA 2WBJB 2F19L 2B5IC 4PP1D 4E0RB 2ZSVB 4NFCA 3VXNA 1GZQA 3BKJH 1NCCL 2WP3O 1BBJA 2ITDA 4QHLB 4I9WD 2YD3A 3ROOB 2W65B 4LLMB 1HIMH 2QEJA 3PP3K 4XMPH 4AG4L 4LSSL 4GW1A 4MQSB 3T0ED 5F71A 4ZUWA 3LQAL 4N9OB 4JZNB 3QFDB 4NM8H 5F7YC 3WHE0 4Q97A 1NFDB 4FA8A 2XKUA 5E1AB 2DS4A 4UBDC 4V2CB 4O02H 2G2RA 4GKOA 1SJHA 2CXKA 3BIBX 2ZOKB 2X10A 3KPRD 2EH7L 3VXUA 3MV7D 3ARXA 2HRLA 3V0WH 4XMKH 1WCQA 1I7UB 4JFDD 2EC8A 1V3KA 2D9CA 3EFFA 4K23H 4CVWA 1LO5B 1B4JL 4R6UA 4WI2A 2VABB 4TNWF 1DDHA 5IW3A 5F7UA 4PB0L 5F8QC 4Z7WF 3IJHA 1ZA6A 2EYSA 4LSUL 1T2QH 4Y5YA 4ONHA 5I1JL 4GQPH 4CU7A 2AJSH 5HPMA 3BH9B 3VI3E 1OAQH 1D6EB 4HZAA 1WQVT 4WJ5B 2EDWA 4LHJB 4LDLB 3WFHB 1QACA 3V6OE 1OPGL 4HAFA 3MRPA 1AR1C 3CFKB 3FB6B 4Y5XA 1MNUL 5J56B 3LD8B 5T3XE 5ESVA 4QRSA 5SWSD 4QHKJ 1FZKB 4M1GH 3RX5A 5AUMB 4IIQB 5F9JA 1CFBA 4PJHF 3VWJB 5IB2A 4Z95H 3O6FA 4M93B 3DIFA 3RIAK 3D6GA 4HGKC 2APBA 5EIQA 1X4XA 3I9GL 3MLTA 2GYSA 5HJ3B 4ISVB 4OZGF 4N68A 5HYSB 2A83B 5DJ6A 4I3SL 2VXVL 2AJSL 5IMLB 1IQWL 5IR1A 5E8DH 1U8QB 5GIRA 4NQXB 3OBAA 4NUJB 4LU5L 3QWOB 1FPTL 2ESVB 3LH2H 5E95B 5JDSA 5MP6H 5JW4R 1X5JA 3MV8D 5HI4D 2XY2A 1MIMH 1KIRA 4I18B 4FQLH 4D94A 4QRQB 4YJZL 1JL8A 2DQDL 2IALA 4YUEL 2Y1VA 1ZLUH 3G5YB 1QSEA 1DEEB 1MNUH 5KANI 4JM4L 4PREA 2C3VB 4YR6B 5C0GB 3MRCB 3I50H 1PKQB 2CRYA 3GI8H 4YDKH 1U3YA 4QT5A 2FJGB 3STLA 1WC7A 2PW1B 5F89A 4FMFA 1MCLA 1D9KD 2OYPA 1U8NB 3K2UL 2HFFB 4CVZB 5KS9B 1U8OB 3S36L 3QIWB 5F8RC 2PR4L 3EDFA 4MNGA 3ZDXE 1Z9MA 5IFHL 3DURB 3HI6L 4P9HC 5EUKB 1EUTA 1CXHA 1A1MB 1MRDH 1B2WH 3ZE0F 1YC7A 1BD2B 3FQRB 4QXGH 4Z7NF 1PZ5B 1U8MA 2DI9A 2NQCA 1FGNL 3ARRA 2IQAA 4PRHD 3MRFA 3LKRA 1AGFB 3EOAB 1Q0XH 1ZA6B 4Y5YB 4XI5C 4W70A 3SCMD 3KYKL 4LVOC 1UJTA 4LLWA 4XNUH 3MRHA 3VFMA 3BP7B 3HTLX 3QHZH 3VGGA 1X9QA 5MENE 1DLHB 3P73A 4JFPB 3LKSA 1C5CH 4U1SB 4IMLB 2GHWB 4TUJA 1S7XB 5IK3A 4P23A 5C7XL 3QIBD 1KIPA 2XZCH 2XFXA 4RIRB 3MCLH 1SMOA 2FYYA 1E4KC 5I73C 5HD8D 2Z8SA 2X4PB 3CUPA 4OZHA 3EOYG 3M1BA 1FDLH 2DQFB 3DHMA 4GUPA 4M8QB 1GH7A 2DQIH 2EDFA 2HTLC 4X6CF 3RIAF 3U4BL 1FH5L 3A6BH 1KNOB 1Z6JT 4ZOBA 5I1LB 4UOW0 4X4XB 3OXSA 1AR2A 2A9NL 2WQRA 5I15L 4HZLB 1SJEA 1KB9J 3OR6B 3UAJC 2GAZA 1CE6B 5HI3C 2CDGB 5AD0B 1EFXA 1FRGL 2QKIB 5EC2B 4RGND 3MYJB 1GAFL 4NQCA 5GZOC 4OCRH 5DUBB 2HJLA 2IAMA 3IB4A 1FORH 1WZ1H 1FGVL 2VISB 4BJLA 5BRZB 1QFWI 3MUHL 5FCUH 4D0CA 5GRYA 3HKFA 5IEHA 4Y16D 4E41D 1H3PL 4PGJA 3EOBB 3GHBH 4QT5B 4PJGA 2CUHA 5I1EL 5T33H 3OKOB 3ALXA 5LGKA 4OI7A 1I1FA 3RVTD 3MJ6A 4QNPF 1HH6B 1T3FB 3N1PC 4GBXD 1P7KB 4QRPE 3C2SA 5J12B 5MHSE 4RAUB 2A6DB 5L0QB 4I0PD 1I3RB 4P99A 1B9ZA 4ZXBC 3AREC 3OF6A 1LO0H 4Y1AA 5C08B 1S7RB 4PYHA 1Y0LB 4JFFB 4U6XA 4H8WL 3V52L 3FQRA 1INEH 4OFKA 1A6VH 4OLYL 5A1AA 3G08A 5LWYH 2H26A 4Y5VB 5CGYC 4X6CA 4OZFG 3MFGB 4IRSB 3GBML 1NGYB 4UINL 1RK0A 1H3PH 2YUZA 3RAJH 2BSTA 4WO4D 3SBWA 4UT6H 3GDBA 3QPQC 2P43B 1AD0A 3LOWA 2YS4A 1SHMA 3LAFA 3LS4L 5DFVD 3TGXA 1U41A 1MCKA 2XZQL 1IFHL 2ADJB 4QXWA 5CD3B 3HS0B 4M8VA 3LB6C 5HDOA 1BAFH 1JPTL 4LOUC 3P0GB 2W0FA 3VWKA 1M6OA 4WUUB 4FTVA 2HWZL 2DQFA 1AD9B 4JFHE 3HPJB 2BVTA 3BQUD 4MMZC 5DHXB 4LHUD 5TF1H 3VFNB 1RJYB 1S9VA 3KPRA 4RDQF 4HIEA 1EEYA 3KPSB 5KOMC 2ZSWA 5H37G 2Y23A 4KK8D 4Z7UB 4XMLL 4PY7A 3FONB 2PF6A 2BMKA 4JRWA 1EJOL 3MRKA 1N26A 3GBMH 4UINH 2DDQL 1IQDB 1PGRB 3QWRD 2K9UA 4XVSL 2I60H 4PGEB 4GG6F 5KSBB 4QEGA 8CGTA 2PN5A 1WFOA 2VDNL 5JHLH 3L5IA 3FCTB 5HXMA 1IKFH 2BHUA 5IBLC 2VDKL 1UWGL 5CEXA 4ZFOA 3NA9L 1PKOA 4LKXA 5DT1H 1XGRB 4L4VB 4OQTH 3P0YL 1T0MA 3H9SD 2A74B 3FRUA 3ARGC 3HC0A 1MHCB 3INUL 1K4DA 1KCSH 4E41E 1MPAL 2A9MH 4PP2B 4JM2B 3D5OF 1JHTB 5SWSA 5D8JL 1B0RA 1MAML 2R2HB 1OTUC 5HGAA 3T77A 1U36A 3OR7B 4J8RB 2RBLA 1ONQA 1B4RA 4XCYB 4RBPH 4JY4B 1TJIH 5FYLL 3T0WA 2NY3C 4LLYB 5DEGA 4W4NA 3FN0H 4NCC1 5DJYA 3GHEH 2G5BB 2HVKA 3D2UB 1MCQA 3NPZB 2DBLH 2UZXB 1OY3B 3C08H 1YC8A 2EDRA 1CDHA 3QZWB 3OKDB 4BZ1L 5C8JA 2ZKHH 4Y8DC 2COQA 1P5VA 2AVGA 4HK3J 4KK5D 2BRRH 1X5LA 4M5ZH 1MIEH 4MQ7B 1LO4H 1P84J 4N0RA 4E42B 4OAWA 4M7LT 5TE7L 4JPKH 4KROC 2I9TB 3G04A 2DYPB 5C3TA 4KWUA 1UENA 3U9PH 2E27H 3QEUB 3W39A 1I3GL 2FGZA 3ILQC 2YUXA 4OLZL 3O9WB 5AZ2H 2DI8A 2YD9A 4PJIA 2E9IA 32C2B 3LKPB 2HH0H 3QEGL 4HWBH 15C8L 2X4TA 4PLOB 4XRCA 1NMBL 4YPJA 1LP9E 2WSKA 4N5EC 2QHRL 3P0VL 3QUXC 5GRJL 5BV7L 1AQDB 4FTVE 1IM3B 4EN3C 2Q87A 4LSTH 1DBJH 3EFDH 4ODHH 3TVMC 1EJ6A 2VQTA 2CLVA 3VA6A 3IT8D 5TQ0H 3L3KB 1CFTA 3MRKB 5F9WC 2IANA 3MTRA 3RGVD 1RZ7H 2ITCB 4LLDA 4FABL 1IBGH 3L3HB 4MAUL 3GHBL 3GIVB 3MREA 5E08H 4GKNB 4HGWB 4RAVA 5DD5H 4H26B 5FECA 1EBPA 1EFQA 4WUKL 1BOGA 3GKWL 4YHPB 2J2ZA 4X6DE 3DIFB 5B8CB 3U7YL 5DRXA 2OJZH 4DEPB 3ARBB 5DMGC 1CDGA 2VB5A 3RZCB 2VZ3A 1KJMA 4LKCA 1GPOH 4LCYB 3HNVL 1F2QA 3NIGF 4H20L 5DUMH 2UWEB 4OZIE 2CIKB 4NPYA 4X6EB 5CIPA 1N5YH 5IQ7L 4O2CB 3IDIB 1RUAH 2APXA 1U8KA 5F72S 3C6SA 5J6GB 3CC5A 3LRHA 4N0FA 4F7PA 3TBWB 3X12B 1R5VA 4Q0XH 1E6OH 1A6WH 4R0LA 5JHDE 2IQ9H 5F3HB 5EU6A 4YR6A 5C0GA 5CZVL 1M05B 1YNKL 4J3UA 3QUYD 4OLWH 4CNIB 2UZIH 5HD8C 5J12C 1CD1B 3DXAD 4MJ5B 3LQAC 4NC1E 1CICA 2OK0L 2NYYC 4LNRB 4D3CH 3W5NA 5L6YL 3AXLA 4NCC2 2LU4A 4NN7B 3RZCC 4JANB 5TQ0L 1SM3L 3VRIA 3WJLA 5E9DA 5EO9A 1BD2A 1GGIL 2VITB 5K33A 1PLGL 3T0AA 3W0WE 1AXTL 3TYFA 2A73A 3U0TA 5FO7A 4XI5D 2ADFH 1MCIA 1HHKB 1RUKL 4WCYL 4X0KA 5LG1A 3VI4F 1BGXL 3C8KB 1FIGL 3GJFB 4UNTA 5CD5D 2J88H 4B41A 4EI6B 3G9VA 43CAB 2QSVA 5BMFL 2F5AH 3ROOA 4JN2A 2V5YA 1H15B 1YEIL 1NEUA 3DUUA 3AM8C 4MLIA 3TV3H 2H41A 2IMMA 4QHNA 1G7HA 3BGFC 5ALBH 5E2UH 5DUPL 3UEZA 1XEDA 3ARYA 1AFVL 4JG0H 3UBXI 1MRCL 4YEFA 4GW4A 3L3HA 2J6EA 4NN5B 5D6DC 3TBTB 4MJ6A 4LSDA 4NN7C 3QDAA 2F8OA 4Q9CA 2WUCL 3MXWL 2OJEA 5I8EB 3UJIL 5SX5K 1PKQE 3QUXA 5L88L 2RB8A 2QQKL 3JXAA 4P4KA 1SYVA 5FYKH 4S1RL 1U95B 1T7WA 4WV1C 3MO1B 5FYKD 5D2NE 2ZCKH 5CP7B 1N0XL 1CE6A 2ICWJ 4JM2F 5AD0A 5I1AB 5E0QA 4AENB 1KJ2H 4R8WH 1RVFL 1T22A 2NW2B 3SDDD 3BI9X 3SJVD 4CMHB 1X4YA 3BVNA 3QO0A 3IGAA 2FWOB 3OKNB 4GRLC 2WANA 4LHUB 2UZYB 4R4BB 2FECI 3BQUB 3WNMA 2BVOB 5JLZB 4HJGB 5I19L 1FV1A 4EVNB 1QHOA 3ZTNL 1UEMA 3NZHL 1C5BH 3PABB 1ORSA 5DHVB 3BN3B 4Y4HA 3QIBC 5MEQB 3LEXB 1MCSA 4RFEA 5AUMA 4XC3L 3VXTB 3SGKA 1UZ6E 1CICB 3VJ6B 3H3BC 5I1IL 4L9LC 1BX2B 3S88H 3TP4A 2VNCA 3AXLB 4KHXL 1DP0A 3V4UH 1HYSC 4HC1L 5FM4A 3P30H 1DVFC 3QULA 4R7NA 2JKXA 4MJ5A 3R8QA 4UQ2B 1IFHH 3E8UH 3T2PA 1IGCH 1T66C 2AK4E 4UB0L 4BH7A 4Q6YA 4HQQL 4QXTA 3B8YA 2BNQD 5GRXG 1B88A 2NY4C 4HUVB 1NCTA 1VFOA 2VLRE 5CD5C 4XP4L 1X5FA 2VZSA 1R3LB 2B1AL 3TBSA 5C07B 5HGDA 2BVEA 4G8FA 2AW2A 4WFHD 2Y5TB 4JRXD 3WFDH 1JZ3A 1ORQB 1A7RH 4NQSA 3RVUD 2GSIB 2OX5A 4DWHA 3BDYH 5T1LD 4G9FD 2YXFA 3KPLA 4XVUD 1DVFA 2ZSVA 4H88L 2EE2A 3BDBA 1ZWIA 2VDNH 5FO9A 5IROC 5JHLL 2RCSL 3BHBB 3PL6C 3I2CL 1BEYL 3NCBB 2ZCLL 3UTPE 5J3HC 1ZA3B 4FOMA 1HINL 2O5ZH 1CL7H 1GC1C 4ALAH 4YHZH 4FQ2H 5ITBH 2Z91B 3DUHA 4Y19E 4FQCH 4Z7UA 1T1YA 3UZEA 1IAIM 3FQWA 1KJ2B 4JGJA 2R2BB 4LSUH 4QRUA 2VLKE 3VXRD 2JCCF 4XC3H 1S7UA 2RIKA 5J3HD 1RZFL 4XBEH 4ZDHA 2AQ1A 3QUKA 4CGTA 3GM8A 1MAMH 2FSEB 4XH2A 5GS2D 3BP7A 4N0YL 1KG0A 2FIKA 1QKZH 1OSZA 2HYMA 4H1LB 2WZPD 5KN5A 5D96B 2PYEE 5FHBL 4EVNA 5LAXB 3SO3B 2EIBA 5E70A 3B2UC 4JREC 3OKNA 4HPOL 5IHBA 4XGZB 3LEXA 2ZUVA 4HWNA 4NNYA 3MNWB 5GGTL 4F33B 3ARBC 1DLFL 2F54E 4OM1L 2XI9A 1RZIA 4NC1C 3HI1A 3SCMA 4FXKB 1NSNH 4G7VH 1O7SA 1JPGA 3D0VA 5SX4H 4DZ8B 3HMWL 5GISH 2G60L 3MV7B 1RUQH 2NXZB 3DOSA 3RWHB 1GGTA 3MQIA 1A7OL 5C8JB 4MA1B 4ZMAT 3OJ2C 4IIQC 5HVWA 4Y4HC 2I07A 1BWWA 2DQDH 4YUEH 4PV8A 1T1XA 2AEIT 1IEHA 5C1MB 3PP3H 1EO5A 3BE1L 1OT1A 5F6HJ 4GRLA 2VLRA 1P7QB 3GMPB 3QPXH 2J8UE 1DLFH 5DVMA 3F6LA 4LLVB 3OWEA 5IT2H 3O2VL 4TN9A 5BO1H 3KGRA 5EB9A 3MV9E 4HH9B 4BFIB 4NUJA 1V3LA 2PXYB 4WGWB 1OP5K 1T1ZB 2BFVH 3G6DL 1F11A 5K9OB 4A2LA 3GSOB 1GRWA 1DQJA 5HVGB 5L88H 3U4EB 1UCBL 1IC1A 4U1GC 5E08L 3MRNB 2EEBA 4X4YA 1MCWM 4OCWL 3MLZH 5FO9B 5K59E 3P9MA 4L4TD 3F8UB 1PKQA 4G80B 5F1KC 4YEEA 3CSPA 4J4PD 4WUUE 5EBMB 2W92A 1G6RA 5I1LA 4WDIB 3VXQA 4PJ8C 1QLEH 1Q94A 2BDNL 2F5BH 3RL2A 3WIIL 1YEGL 3L3KA 1RV6X 4Z7UE 5E7FA 1G7JB 1HHJB 1YEKH 5I1JH 1KOAA 2X6MA 1V7NH 4H1LA 5DZLA 3O2VH 1MJ7L 4LIQE 5D2NB 3ZO0A 4HG4K 4U2YA 3K4ZA 5F96L 3VXMD 3QUZD 1XR8B 2DM7A 2YSSB 5FKPB 5KG9A 4JREB 3HLAB 3B9EA 5CJXC 2WIIA 4IMKA 1KCUH 1WVZA 4PRPD 4LMQE 3UC0H 1AD9A 4I77H 1ACYH 4LDOB 3VFPB 2PETA 3MLZL 4P2QA 3A6BL 1KB5B 12E8L 2UWEA 4FHBD 5KW9L 1D5MB 3ARGA 5D7LE 5MEND 3MRHB 3GMNA 3VFMB 3WDIA 1QBMH 1I4FB 5I2IB 4EN3D 4HIIB 1L7TL 1FRGH 5CGTA 2EDJA 3K1DA 4KQ3L 3QUXD 4TUKL 3FT4B 3QI9C 1NDGA 3OMZA 1CYGA 1A3RH 4N5ED 1CI5A 1NLBH 2BFVL 2Y07L 8FABB 4JHAL 1BFVL 1QEWA 2VXVH 3T8XB 4HFUH 2GTWB 3OKKB 3MRRA 4Y5VA 4PIRF 3LDBB 4JFFE 2O5XH 1JZ6A 3BPOB 4ZUVB 3S5LB 5I30L 5JPNB 1JUFA 3GMPA 3CXDH 3MLVH 2XWJA 3Q6FB 1B4JH 5F7EL 1CL7I 1G9NC 2ZUQB 2CJUL 1QP1A 4KROD 1ZMYA 2VLRB 1JVKA 3KPSE 1BD2E 1JYWA 2C4FT 2B2XL 5I71C 2XG4A 2X42A 3VWJC 4MNQD 1UM4L 3QEHA 3TYGL 3HZYA 1CFSA 3V0VB 1A7NH 5CEZH 4LF3B 3KLAA 3HG1A 3P11L 3SOBL 3GGWB 2BNRA 4LLUB 1B2WL 1ZLUK 1JE6A 1G7HB 2VL4A 3DUUB 3TBYB 3JWOL 4LQFL 4DCQB 3TH4T 2NXZC 1RULH 1YDPA 3QAZC 5C0IA 3WN5A 4OD1L 2B8OT 3FTGB 2EYRB 5JZ7C 4CUCA 1CLYL 4MNQB 3B5HA 4HSQA 4I4WA 3FB6A 1ZT4A 4NRZA 5FGCB 2YHGA 2R23A 5IOPB 2ZJSH 1ZANL 2IBBA 3FMGH 4WFGE 1G7PA 3B83A 3LQAH 1OAUL 5J11C 5KG9B 2OI9B 5DHYB 3OJVC 2YRPA 4POUB 2H45A 1EEZA 1FO0H 5E2WH 2FD6L 1FNHA 5I2IA 2NY1B 1U8HA 2VIRB 1IEBA 1H3GA 4F80A 1BZ9A 1AQDA 1CN4A 1GGCL 4GRWF 1LO2L 2AGJH 1MAKA 3P30L 4RGNC 1HXMA 3FRPG 4X7SH 1U8LB 1MCPL 1KB5H 4ETQA 3IFPA 4PJ8A 5ESAB 5C9JB 3V6FA 5KBNC 3T3PE 4AT6B 1U8PA 5HDBF 5F9WB 1BJ8A 1GAFH 4OBSA 1JUFB 4GKNA 3D0LA 4DN4H 4L4TB 2B1AH 3BPNB 3HZVB 3P4OA 4ZUSB 4CAGA 1MFAH 1U6AL 4M48H 4RRPG 3LPFA 2ICWA 3MRBA 5F1SA 3ARBA 4KQ4H 1J1XH 5DD6B 4WHYH 3H6JA 3RZCA 2Y06L 4PY8J 5I73B 3T0EE 4HV8B 4BH7B 1PEZA 3EHBD 3RBSA 1AO7A 1LWRA 2CKBA 5CGYD 3P9LB 3PWLB 5ANME 3RGVA 1JGLL 3D18B 1XGYL 3C60B 1I1AA 4OZFA 1IMHC 1JNLH 3MLWL 4E0RA 3KJ6L 3BOVA 4HF5H 3AMKA 5A16A 5DJCA 3GMOB 5DD3L 3EOAA 1R3LA 3QFJE 5E2VH 3QEHB 3ARGD 5EBLB 4TTDD 2Q8AL 3QI9A 5IFJA 4QRTA 2VE6B 3C5ZD 2HTKD 5D7IB 4GLRI 3ILQD 2HMIC 5GS1B 3BPNC 4FFYL 5LQBH 4U1SA 4OQTA 4AEFA 2HT4C 3O3DB 4ELKB 5BS0A 5LJYH 5C0IB 2W1NA 3P9WB 1NEZA 3UBXG 5TJWK 1C5DA 4ELMF 1I9IH 5ICZB 5GRZA 5C70A 4HWUA 1YQVH 4YFDB 3MZGB 2AXFB 4OI9A 1JTOA 4YHKH 4R97B 1U42A 3IKCA 4OFVA 3WV0A 4EI5C 1VENA 2I9TA 2EICA 3GSNH 2FIKB 4ZDHB 2EYSB 4WTZG 4JHWH 2L7JA 3PHQA 3BH9A 2PTUA 4PLKC 2FECL 4JEGB 3UX9B 2I60L 1A22B 1WAAE 4WEMB 3DUSB 3EW3B 1NGXA 1I7RA 3QUML 4HKZA 1WLHA 1A3LH 1CIUA 1VFAA 3SKJL 1HDMB 6FABH 3TIDA 2BZDA 1I85C 3OKOA 2EDKA 5EU4A 3D9AL 5B3JF 5A43C 5I17B 3PHSA 1RJLA 3ZT7A 1TJHL 3HNSH 5CKAA 5DF0A 2B2XH 4XPTH 3HZVA 2QADC 4KJWD 3WO4C 1SYSB 1OAQL 3CU7A 2DMBA 4QO1A 3A6CH 1I9EA 2D0FA 3GJFH 2D7QA 2D0GA 4KDTC 1U8IA 4NSKA 3BRFA 3OX8A 1K5NB 1OSPH 4YDVB 3FQTB 2MOVA 2J1KA 5MI0C 4DTGH 1YEDB 1IC7H 2FGWL 1CR9L 3OG4B 4KTEH 1DQQA 3D69B 4JO4H 1FLRH 5L2KA 3WEXB 4N0UE 3TNMA 1F11B 3GBNH 3RUGA 5K9OA 1II4E 4YDKL 3I9GH 3IDMA 2F5BL 3WIIH 1ZLVK 5T1DL 2VQ1A 1ERNA 3I3DA 4O58H 4BUGA 1SBSL 2IG2H 3PE9A 5J1AB 1M6OB 1F3JA 1X5IA 3MLXH 5KS9E 1NCAH 3OJDA 5HI4C 3VGFA 3U9UB 4Q6IB 3ECBA 3RWJB 4I77L 2X89A 5T5NF 1LDSA 3ULUE 3T08A 3G5ZB 1GIGL 1AGFA 3LKRB 2VXSL 3KPPB 1XGTA 4RFNC 4JVPA 5FIEA 3SDXF 5F3BB 3ULSA 5ILTL 1LMKA 3VXPA 1OP3K 4U3XA 4KQ3H 1I9JH 2IPKB 3MV7E 3GSUB 1JPTH 3S37L 4GRMA 3MA7B 3TA3C 4FZ8H 3SDDA 3SJVA 3JTTA 5GGQL 1VGKB 3TPKA 4MB3A 3VE0A 5J11B 4KJQD 1D7FA 1Y6KR 3H0TB 4NQCD 2XTJE 1H0DB 3ULVC 3QQ4B 5BVPL 4RQQA 5EU4B 4KQ4L 5LKNA 4HS6A 5I8CB 4IRZL 3UO1L 3S36X 3OHXA 4G7YL 3LKQB 3TIDB 2BNUB 4Y16A 1HK6A 1GIGH 1FNGB 3U7YH 3I6GB 2KPNA 1KELL 1NPUA 4MWFA 1CXIA 4F57H 3EYUH 1UC6A 3PV7A 3JWDL 2GJ6A 1ZK9A 3MRDA 1NH6A 1T04B 4HKJA 5D72L 1DVFD 3T8XA 5DA4A 3MRRB 4KGJA 5DUBA 4I0PA 4AEIL 3TEUA 4ZFZA 2YWZA 3UTSD 4MB5A 5DSCA 2R69H 2DQIL 3FFCD 5IVZA 4MQ7A 4OSUH 3WXVH 4E42A 5I1IH 3QR2A 5KZCB 1Z5LA 2F8VA 1BPVA 1U0QA 4PJCF 4UTAL 1BECA 3MGOB 3T2QA 1MCJA 5C0AB 5C09A 3IFNH 4PJGE 3WS6C 4U33A 3FN0L 2VSDA 4JFEE 3X17A 4M3JA 4X8JA 4HPYL 4OCRL 4Z7QE 2ORBL 4HMCA 4XTRD 5BXFA 4X6FA 2X4UB 4HMDA 3SGDI 3RNQA 1RK1B 5J1TC 4BA8A 5EC1B 1NQBA 3ABZA 5EZLB 4E9LA 1KIQA 2PW2B 3INUH 1AXTH 4K3EL 1TTUA 4NQCE 4WFGD 1KC5L 3MXVL 3CZFA 5EO1A 6CGTA 1IGML 5CWSA 5BVJA 2YPLB 3GMMB 2J5LC 4PJCB 3QDJA 5EZOL 1CWVA 4QCIB 2BHYA 2WAHA 3O41A 3WN5B 2IPKA 2PO6B 4OV5B 5D7JA 3U7WH 1SQ2N 3ULSB 4F57L 2AV7A 3IFNL 1I1CA 4F9LA 3ARTA 4OF7A 4P4RB 1F97A 1FZMA 2GY7B 4RAVB 1JZ2A 1DQJB 3HI5H 3CLEL 3TCLA 1YJDC 2NW3A 2BVQA 5LWYL 3VFTB 1ZT1A 4L8DB 3MGAA 2Y5TA 4G6FD 4KJYB 1MFAL 5CZXD 3ZKXC 1ORQA 4X99B 2AXHA 2R4SL 5I8KL 5K9KB 4LKCB 2FYYB 5BJTB 4IHOA 3I85A 1TCRB 4GG6B 1BBDL 2F9BT 3I6LD 4Y8AA 5HYJD 2YPKB 1TXKA 1T20B 3VFSB 1I7TB 1KIPB 4ZFGH 2I9LA 3L5WB 4NKOA 1J5OH 4FRWA 4UDUA 5KVGL 1KPVB 5D1QB 3RTQD 4PV8B 5D9SA 1BM3H 3C6LC 3BD4A 1OD7A 4S2SA 5I1DA 1ZGLA 2BY0A 2I27N 4XP1L 1ZTXH 3HE6A 3QUYC 2FO4B 1YYLL 1LP9F 5JTWA 4OM1H 1Q72H 3WJJC 4DVBA 3W11D 1RFDH 4NRXB 1Q9WB 5JQ6H 5FGBC 3MUGA 4MZ3A 4ODBD 1N6QH 2NX5D 3ROLB 5IVZB 2JIXB 3EYQD 1KJVA 4YPGB 4WTXA 5DRNB 3MCLL 1MFCL 1KN4H 1RIVL 2HJFA 5D1QD 3RTQB 3KHQA 4YX2L 3DLQR 3HZKB 4MAUH 1P4LA 1IJ9A 4TULH 4BK4A 2R0LH 3E3QE 2NCMA 2AXJA 2FX9H 5C0AA 3TWCL 1EAJA 1IKFL 5CZKA 5GS0H 3LD8C 4U3HA 4CU6A 4PTUB 2VDKH 3P3YA 5FO8A 4LVNC 4UIKL 1H3TA 1YQVL 5A16B 3T4AA 1D6VH 1ZVYA 1HH9A 4P46B 1NLDL 4RAUA 2A6DA 3QJFB 3REWB 1AGEB 3S4SA 2YPLA 5GS1A 2WUBH 5FM5O 4JKPL 2VLLB 3CFDA 2HVJA 4XXDB 5JPMA 4HEME 1W0VA 3QDGE 1RFDL 2H2SC 2NY6C 1UT9A 4XVJH 5EO0B 4CVUA 5TE7H 4J6RL 5D2LA 1BIHA 1J18A 3RWHA 3DV6A 2K1MA 4OF8A 3GSNA 4RA3A 1Z9LA 4XBPB 1MFEL 2O5YH 4L3EA 5KSVB 4YQXL 4FTVD 1J5OL 4ZAKC 4K94H 3B9KC 1E6JH 4L9LA 2R1WB 2DYPD 3PQYA 2BVQB 1NDMB 5HHOE 4JFXA 4NN5C 1P53A 4P2OB 6FABL 1NAMH 1DEDA 1DSFH 4J2XA 2P24A 2BRRL 1UKTA 5JQHC 4I5BB 1CL7L 3CZJA 4IHOB 4WW2B 1YY8A 4XPGH 5E6ZA 4GFTB 2QHRH 1U3JA 5E4EB 3RX8A 2FX8H 3O4OC 3VFWA 1KLGA 4UQ3B 3KPNB 3TC9A 2CDEB 5DO2C 4LSPH 3HPJA 1MJ8H 4R90L 5IBTH 3OGCB 5F7NC 3BZ4B 2CLZA 4XNQA 4HIEB 3NCYP 1FGNH 3PWNA 4JCMA 1TVDA 1M71B 4H5SB 4WFFD 5D5ME 1MI5E 1WZLA 1YECH 2FBJH 2G75B 3BYTA 1J0ZA 5TDOA 4YDLB 1RVFH 4K94C 5IEKA 1WTGT 5HHVH 3KPMA 4WW2C 5D7SL 3VRJA 4DZBA 3I6KA 4JDVB 4NPYB 4JHAH 5DJ0B 4Z7OF 2FL5B 3BXNA 1CG9A 4G6KH 4ZNCD 1JYNA 1HH9B 4P46A 4HWZB 2RCSH 3V8OA 5EG6C 5MEPB 1A7OH 5F88B 1KT2B 5C0BA 5F7FA 3HRPA 4JQIL 4Y19A 3MRJB 4MAYB 2GT9B 2X4RA 5JIIA 4QOKB 3HCVB 5IHLB 4ODXB 5TE4L 1NBVL 3E6HB 4MNGE 2F15A 1JK8B 1BFSA 1VESA 1PBYA 1SMAA 4XBPA 3OV6A 1SY6A 5F9AC 4P2CG 1KCVH 3S37H 5CJ5A 5L6YH 3QDGA 4HS3B 4HUUB 3LHPL 1GC1H 4L4VE 4L1DA 1JMXA 1FGVH 1O5DT 2EEAA 1KPUA 1MEXH 4R7DB 1XZ0B 5D7JD 4WVRA 4N8PA 2ZOLA 1I1AB 1E6OL 3FL7A 1WBZA 4WCYH 1KEML 2IQ9L 1F4XL 2Z31C 2NY5L 3N1MC 5CZVH 5D1ZA 3Q5TA 1UZ8A 1KLFA 2J6EH 1LK3L 1GOHA 2JK5A 4Q9QL 3MGTA 4KUCF 2C4FU 1L0XA 2BERA 5HYQB 1W8OA 3IDYB 3WYRA 3W39B 2BJML 3ZLQC 2XN9B 1RIHL 4JRXE 2BY1A 3EJYC 5T3ZH 2FR4B 4YHOH 5EA0L 4HS8H 1HINH 2WBJC 5EFIB 4LMQI 1NANH 3BIKA 4MQTB 2H32H 1CXLA 4G5ZL 5IB4B 1CE1H 4M4PA 3U6RA 1OAUH 3ZDXF 4KPHL 3O3EA 4JY5H 3BP4A 3BMWA 1AXSA 1RZIB 2LAAA 1J8HE 2NY2D 3I75A 4K71B 4TVPE 1T66D 4YHLH 5I8EA 1KN2L 3GK8H 1TVHB 2AK4D 4NKDB 4CKVX 4RIRA 4P9HH 2BSRB 1LEGB 1CGUA 4MSWB 2DLGA 4K8RH 4PJXB 3IJYA 3DNKA 4LK4A 1FFRA 5JW3H 4XB7A 3QQ3B 4XAWL 5E7BA 1W8NA 3C60A 4Y4FB 4FXLA 4POZD 4PPTA 3MJ7B 4YAQA 1NCBH 1Y6NR 3P0VH 4YC2B 3VXSB 4ODWA 3E6FA 3HAEB 3GUTB 3P4MB 3CSBA 5DK0B 2P5WD 2IH1B 1RJZB 4YNYB 4Y4HB 1VFBB 4JY5L 4NRYA 1UADC 3O81A 4M61A 5AAWA 2ZG1A 3NIGE 3GM0A 4NHUA 3V5KB 3MUY1 4ZOCA 4QHLA 1NFKA 4XXCA 2QR0B 3ZKND 1QLEL 4RMTA 3V5DB 3VXNB 1PSKL 3U0WH 4TRPL 4KK6C 1J0KA 4XP6L 3F65A 2GK0B 3V5HA 4LSRL 1S9YA 2KZWA 1A4JA 3QDMD 1ZHLB 3U4EA 3M17A 3RRQA 3RWFB 3BH8B 1QSFE 4X9BA 4HF5L 2APTA 3ARVA 7CGTA 1MFDL 4JZNA 4GBXA 3RKDC 4PGCA 4ZUSA 3LKNB 1XGQA 3IXAA 3GIZL 3RI5F 4G7VL 4ZUTB 5HYSA 1TQBC 5DO2D 4Z7VB 3O8XB 5GIRB 4P2RD 3QNZA 4ZQKB 5CSZA 1K2DB 2HMID 4F9PC 4OFIA 5INCB 3ARDA 3CVIL 5E56A 3RGVB 5EH1A 1JNNH 4IOFD 2OP4H 1NGZB 3TF7C 2DQUH 3QRFM 4UB0H 4P23D 4BZ2L 2A38A 1KACB 1UJ3C 1FBIL 1MUJA 2VZUA 4XCNB 1AY1H 4U6YB 3BP4B 5BZWB 3VGAB 3O3AB 3N9GL 1YYMH 3DSNA 4HXBH 5EZIL 5E2JA 3OJDB 1PYWB 5HYEA 4NKDA 5JHDA 1QYGH 4X7FC 1ODAA 3EYSH 3B9VA 1D3CA 1T5XB 4EXKA 1DTUA 3DBXA 3QDGD 3QQ3A 3S5LG 4AH2B 1RZKL 4BQ8A 5E94A 4HFWB 4PJXA 5A40E 4WY7L 4P4KB 5KTEH 3SKMB 3MRLB 3F7VB 4EI5D 2DWEA 4HPOH 3E0GA 2VC2L 4X6DA 5E8OA 3HNTH 1R5IB 4QTIL 5H2BB 2SEBA 2YR3A 3FZUC 1YYML 4G42B 3L9RA 3ZHDA 4F7TB 4WTZA 1REIA 2P5EE 2F74A 4NO2A 3ZTJG 3E3QC 3GB7B 3AY4A 1S7TB 1JWSB 2BOCA 4LQFH 3X3FH 3JWOC 3QO1B 1FC2D 1WICA 2A74A 1FFOB 1YMME 3LEYH 3B5GA 4L1HA 1LVEA 3CVIH 1EFXD 4MDJA 3M17B 1XH3B 3TO2A 1QTYT 5GS2H 1MH5B 3TZVA 2HKHL 2PW1A 5T1MA 2C26A 3BJ91 3AREB 3WXWH 4JY6B 5IMKA 5GRUH 3TJEL 1A4JB 1MHHB 2UUDK 2D7TL 3ESUF 4NYLB 5E5MA 2GK2A 4X4ME 3G5ZA 2YRZA 2Y4SA 2BVYA 5C2UB 1IGIH 4OBRA 4U1KB 1NKOA 4NJ9H 1CDIA 4RWHA 4ZSOA 4EUPG 3VD9A 2JJVA 3K2MC 5JOPE 3QULB 4U1LA 3O6MH 3GSRB 3SKOA 5T3ZL 1JHLH 4G9FA 1AHWB 5SV3A 2LU3A 1YEFL 1NBZA 4CADB 1D5IL 4NO0D 1UACL 4XP5H 1D5XB 2RJMA 3HAEG 4JFXB 1EHLH 3FFCB 2NY1D 5I1HH 4HIJB 1KEGL 4LFHG 1YMHA 1DUYB 1QLFA 4LRIA 4U6HA 1Q0YH 1QFOA 3QYCA 4Y2DC 2EZ0D 2HFGH 1DQQB 3PDOA 5ESQB 2DAVA 4WO4B 4WW1A 3ULVH 5HHQB 1XF2A 3WEXA 2N1KA 1I9RH 4FQJL 4IRJA 4I5BA 1QRND 2F53A 1VKXB 3PGFL 1ZEAH 1OGAA 4N9GB 4WDIA 4ZFFB 3QXDB 4M6AA 3KLHC 2NXYC 4F37K 1EH9A 5KSBF 2CDEA 4O4YL 5FA3B 3ARDD 4F7EA 4AM0A 1OAYL 4P2OC 2OLDA 4V1DB 2YC1A 3LEVL 1U3ZA 5LGHL 4PJFE 3BKYL 1OLZA 5DEFA 4AZ8A 4C56D 3SDYL 2IGFH 3CGTA 3X14B 4JHWL 2PO6C 4GSDH 4ERSH 3O0RL 5I1GH 4HJ0D 1CZ8L 1DN2A 1JV5A 4D0DA 4JZOA 1L9NA 4KJPD 4YHIB 1BMGA 5CILL 5L2KD 2R2EA 3SGKC 5LVEA 1C08B 2VABA 5JMOC 1V7MH 1MIML 3WBDA 4ONOA 5KSUA 1XIWA 4J3VA 3FRPA 2ZCHH 5ABDE 1UWEL 3VXSE 2FSEA 1MREH 1UXWB 1FVEB 2HT4D 4OCSL 1A0QH 4QTHB 3TA3B 3HS0A 4P5TB 1P1ZB 5FGRA 2X40A 1ZANH 4OF5A 5J06A 1CTOA 5C09D 2R1YA 1OARL 5E8EB 3LHPH 1I1YA 1EERB 1H3UA 1BHGA 3RGHA 4G6AC 4GQ9H 5L8KB 2DLFL 3T4YB 3CDGA 3D85B 4WV1B 4LASH 3WD5H 5DJCB 3VD7A 5KVDH 1KPVA 2KDGA 3R0NA 1JPGB 2N56A 5DRWB 3D0VB 3KDMB 1J1OL 1KCUL 3O6FB 1G9ML 1JK8A 5T1KA 4X80H 2OR8A 1U58B 1T83C 4YO0B 1I9RL 2LE9A 3MLVL 1CT8A 2Q6WB 4OV5A 5ADPH 4YE4H 1FLRL 2EE3A 1KJ2L 4ZYKA 2AK1H 3REVA 3FT3B 4ODVL 1FAIH 5FUCC 1ZVHA 3DRQB 3AGVA 3O4LD 3G5VB 4MJIA 4KV5E 2VO5A 2EDQA 1T1WB 2EIZB 2X9YA 1MCCA 5F6IC 1QLFB 1TENA 5D1ZB 1OARH 1D5XA 1G9EA 3EDEA 5LCVL 3EYQC 4YHYB 3HZYB 4LL9A 1IGJB 2JB5H 5A3ID 1IGMH 3M8OH 4PP2A 5K9KA 4N90E 3GKZA 3VFOA 3CXDL 4WWKC 5GISL 2EDEA 5FK9B 5HHQA 2DDQH 4FTVB 3RVVD 4V1DE 2XN9E 2VR5A 5IB1B 2XWTB 3WDJA 2APFA 2CKBL 2AXGB 4LARL 3PHOA 3S34H 2NNAA 5F9DC 2QSQA 3MBEB 4UDUB 4YE4L 1GL4B 5ICYA 1SBBA 2WBKA 5CGMA 3N50A 1N6UA 3O2DL 2ENYA 3P9MB 1R0AH 1XR9A 5KVEL 5IV2B 3ULUL 2DMKA 3O3EB 4WEBH 5FYLE 3BGMB 4P2QD 4FFWC 2ADGB 4EQ2A 4GMSH 1YNTB 5CEZE 2GFBA 4PRDA 3ARED 1T21A 2CMRL 4P2OA 2Y9RT 1R6VA 1KPRA 5GSVB 1BD2D 4PRIE 1DN0A 2P24B 4NZTH 1KENL 3BT2H 2EEDA 4WW2A 3VCLB 2YA2A 3S3PA 4MJIE 5TF0A 4OCWH 2NXZD 4PJAF 4TNVK 5I1KH 3EO9H 2Z35A 1KELH 5CP3A 3CDGB 2DKSA 3D85A 4WV1A 3MO1A 4OUUB 4JO1H 4ZOAA 3SKJH 2O5ZL 1NCDL 2AEPL 1I1YB 5TDPA 4I0KA 1UYWL 5C0JB 1F58H 2IH1A 1Z9SA 1T6VN 3PWPA 1FZJB 2Z9TA 1IM3A 1MVUB 1MWAA 4YFLI 4JJ5B 3QIWC 1HEZB 1OB1B 1FH5H 3UTTB 5DRZB 2QKIA 3TFKC 3RWCA 3QH3A 4N0YH 1IARB 4TULL 5D1QC 5DJAA 4WFFE 3EO0A 4PJ5B 2PTTA 5IHZA 2FX9L 5IWLA 2XRAL 3QUMA 4YHMH 2XWJB 2ZG3A 2ATKB 4DKFH 4QHMA 5B4MD 2OTPA 5AWNH 4J3XA 3FT3A 4JPVH 4M5YL 3ZHLA 5I1CL 3U36B 3VXTA 1NCUA 1UJ3B 4ODUA 1CG9B 15C8H 1HI6B 5F93C 2DYPA 4K23L 1ZSDB 3W0WA 4YZFF 1DCLA 2XYCA 3S36H 3FO2B 5JA8B 2RFXB 1YN7A 3BP5B 3A6CL 3Q6GH 2EIEA 3DURA 4NQVA 3RPIB 2AABH 3O8XC 3CFBB 4GSDL 2A0LC 1U93B 4LF3A 4C58B 4ERSL 2P47B 5BS0E 5EOTB 2BCKA 3V79C 2X44D 5B3JE 1N3NA 3W9DB 1DBML 2OR9L 1VGKA 5EOQL 4NQTA 5C08E 2XTJC 4MA1C 5IW6A 5GGSB 4R0LB 1FL6A 3QDGB 4MA7H 5AYUH 1L6ZA 1Q9OA 3QJFA 4JO1L 3WLWC 3CMGA 4I3GA 5INDA 2NX5A 2AEPH 1TJGH 4Y4FD 4OCSH 1NAKH 5SWQB 3QPXL 1T89A 3BHBA 5JIHA 3CJJA 2G2RB 3UZQA 4PRDB 2X2YA 3L6FA 1PY4A 3O4LA 3TYFB 3H9SE 5KAQG 4LCIH 3B9KB 5FYJD 4DUXA 4DVRH 1FNAA 1UCBH 3FOMB 4XNZC 4ELMA 2DM4A 5TH2A 3DYMA 5E8OB 2EH8H 4LCUB 4ENED 3WFCH 4PV9B 1EEQA 2P5WB 4X4XA 1TTGA 1HXMB 1A3LL 3F7YA 2IADB 3VXSD 4JR9L 1U8HB 3NGBC 1G7QB 1OSZB 4U49A 4XX1E 4NZRL 4GW5A 4GKSB 3S97C 2CDFB 1AE6H 3IVKA 3DRTA 5DLML 1TVHA 3T09A 2RR3A 3GB7A 3UMTA 4F58H 4C54A 3QEQD 3H7BA 4JFQB 4RSVA 3U82B 5JQ6L 4N0FB 2NYYD 4NKIL 1R5VB 1FJ1A 4Z77A 2HT3C 3ELAT 3LN5A 4DK3A 5IFHH 4YWGL 3EZJB 1CD1A 2L4OA 3ZKQD 1BGXH 2WMPA 3RU8L 2XPGA 2EDNA 3JZ7A 3TWCH 1T0MB 5E24E 1KJ3L 4L3CA 1HQRB 4NQEE 3U36A 3VWJA 4OFDA 1F45A 5IB2B 1C16A 4FQXD 3WFCL 5I1AA 3T3ME 4Y4HD 2BXZA 1ZEAL 2ZG2A 5MI0B 1PQZB 2D7NA 1YJDH 1MCPH 4P5TD 5K9JL 1FCGA 4X0KB 1OAXH 5HGHA 1JP5A 4U6VH 4M93C 5E4EC 2IH3B 1A3RL 2C4XA 1KIRB 5JLZA 1HIML 1DANT 2LABA 4F58L 4Y89A 4KK9C 5JDSB 1WEJH 2I5YL 4QRTB 1N59A 2FBOJ 2X4OA 4PRNA 1QA9B 5C0FA 2BSSB 4XAKE 4DFHA 5K93A 5BW7C 3IU3B 5CILH 3H42H 5FKAB 4LPUA 3OQ3B 3G6AB 2E7HA 4BZ1H 1KJ3H 2R0WH 4A6YB 5DMYA 4JPIA 5L9DL 5DD1H 5JO5A 4R7NB 3T2NH 4J3OC 1OAKH 4J1UB 5CBEA 3QIBB 1A2YA 2A6IB 4Z0XA 4Z7VA 3IJSB 1J0IA 1YMMB 4LGSB 3TVMD 1TQCB 1FPTH 2MTPA 3GSUA 4OLUH 1NANI 2VLRD 4GRMB 3SDDB 3SJVB 3MRQB 1N4XL 2FEDC 3VE0B 3QWQB 4D8PA 1A3QA 3ALPA 4ZG1A 3B4NA 4UMGA 5FCUL 4UT9L 2P8MA 3MV9B 3UTSB 4NT6B 3D85D 2VDPH 3OXRA 3V5KA 4LFHD 2YKLH 1WK0A 3V6OC 5DI8A 4PRPE 1QOKA 4XZUB 4QRPD 4M03A 4XVJL 4ZODA 1ETZA 4OZHB 1LILA 4R3SB 4P2OD 4IJ3C 5I9QB 1FQ9C 5E99L 5IVXF 4HQQH 2DQJL 1FL5A 5E00B 4MA3B 2WWMD 1T1YB 1B0RB 1TCMA 3H42L 1F42A 2NY4D 4DGYL 1CCZA 5C92A 2I26N 2FD6H 4OJFH 1D5BA 4QWWC 5D70L 3L7EB 5KSAB 1LHZA 2H32A 3AB0B 5KVMC 1F4HA 1Z5LB 1MJJA 4JE4B 3B2VH 1C5CL 1X3DA 3MGOA 3BO8A 1B0WA 1YEDA 3QCTL 3B6SA 1J9CT 3HG1E 4Q2ZB 2N4IA 5T3XL 2YZ1A 1XCQA 4GW1B 3NN8A 2W60B 4U7KA 5BQ7A 4HUWB 1J8HA 2BRQA 1JNJA 1KN4L 2FLBT 3QFDA 3WIHA 4IRSC 5E5MB 4P5MA 4MD0A 3QSKB 1S7XA 5CBEB 2AV1A 1FSKC 3W9EA 5B4MC 2JJSC 2LV4A 3PHOB 3SDDC 4S11A 4OLZH 5F1IB 4W6YB 4QGYA 1J1PH 1ADQA 1ZS8B 3K8KA 1J05B 4OT1H 2I07B 2PO6A 1IEAA 1E27B 1UB5B 2Z8WC 4XMKL 1T1XB 1QSZA 4N1HB 4HK0A 1KF9B 4G9DB 5I76B 1FP5A 2DB8A 5GGRA 4TQEH 1HILB 1AIFA 1AY1L 1GHFL 2VDML 4NJAL 4DFIA 1J0YA 1YMHB 3BQUC 5H2BA 1WBYA 3CLEH 4LSTL 3EO1A 4WI8A 5C0CE 4MYWB 5T1DH 1NC4A 5DMIH 5CS7A 4OJFL 1NSNL 1N2RB 1QFUL 5DWUH 1CVRA 1OGAB 4N9GA 3QPQD 4H25B 3RWDB 5D1XA 1E4JA 2C1OB 4YHML 4FP8L 5E8PA 4KKLC 4S10A 3RA7L 4F33A 3RIFK 2Z8VC 5JHDD 4U6YA 5BZWA 3VDAA 3WNOA 5T3XH 25C8L 4UZGA 1DSFL 4NNPL 3I6LE 3NCYS 4AMKH 1MY5A 1SYVB 3P0YH 5JHDB 1RZ8A 4NQEA 3WUWA 4JVWA 3N85H 5DUML 2BC4B 3MV8E 1FZOA 5GSRB 1CFQA 3AM8A 1X5AA 4TVPD 3GSRA 1IAIL 1B3JA 4HKXB 4Y1AB 3EHBC 4JN1L 5FB8A 4LBEA 2XQYK 4QWWD 1WT5A 4QRRE 5ICXB 2M2DA 1QFUH 4YHNA 3QIUB 4Y4KB 5D93B 3BX7C 1S8DB 1XGRA 4L4JA 4P5TA 1A9EA 2B0SH 5JMRA 1T0PB 3HAEH 5CBAB 3GHEL 5I1EH 4U6HB 1EX0A 4POYA 4LKXB 1BQHG 4KUZH 3WXWL 3NCJH 1HHGA 3SKMA 4OLWL 3I2CH 4DUWA 4TQEL 2EXYC 4M6NL 3I50L 4G43B 2HLFD 5I6XC 4XXCC 4DGIH 1ZGLP 5E1AA 1XF4A 2V6HA 1G6RH 1LO4L 3ORJA 4XC1L 4U0RB 3KPOA 2A6KA 3DX8A 3MNZA 3SE9L 3VXOA 1S7TA 2YK1L 1XGUA 1VHPA 3LPGA 4M62L 2VITA 4FMKA 1FFOA 4F9LC 4KDWA 5HI3D 3FZUD 2CIIA 1CD8A 4XPFH 4MNHB 2VUOA 1I3GH 2DD8H 4RNRB 1F13A 3QI9D 1H8OA 1HSAB 1G7LA 3BZDA 3LZFL 4X5LA 4BM7A 1P7HL 5KSVA 2OP4L 1ND0B 4X7TB 4P57A 3MBXH 4IRSD 4IS6A 1FNLA 1CGWA 2GSGA 5E2TL 3AS1A 4ENEC 4MS8C 4NBXB 3JV0A 3PL6D 4HMEA 5A2FA 2D03H 2DQTL 4MX7B 4MAYC 2JLLA 4MSWA 1OVZA 4OIIL 2E9BA 1EHXA 3STZA 1PW3A 4Z7QF 3RWDA 4GBXC 5FKPA 3KPQB 3WFDL 1J12A 4QRPB 5KSAD 3BKYH 3SDCC 3RVUC 4UV7L 1T5WA 5C0AD 2IGFL 1BQHB 5C0RH 4KJYA 5ERWB 1U91A 1N5AA 5DC0A 2X4TB 4BFBD 1LK2A 1S7QB 4RISH 4FQIH 3ZHKA 4PJIB 5E8PB 3GMNB 5GRVK 3Q1SL 3RBGA 2FATH 4Y4FC 3ARPA 3ZL4H 4HT1H 4K7FA 1T22B 1WFNA 3F58L 3DECA 4JGUA 3W5MA 2Q6WA 1A02N 2ADIB 5F9OH 1FJ1B 4CRPA 4NFBA 3TVMB 1RHFA 4OZGB 2JJTC 3QIUA 4Y4KA 5H94B 2IANB 3GIVA 2FO4A 3VFRB 4L3ED 3EGSB 2ITCA 3KPMB 4LLDB 1GZPA 1E4XL 4NRXA 5GGQH 2W0KA 2AKRA 3WUZA 3U48A 1QFWM 1BZ7B 3RNKA 3CFEB 4QRRA 4K7PX 4IRJD 3PGDB 3TBVA 3WKMH 3IDJB 5EBWB 3UCRA 3IYLW 4OUUA 2X4QB 4G6KL 1YNKH 1BFOA 2D7MA 5D7IF 5T33L 2LVEA 4DOHB 5D7KD 4QKXB 4K3HA 3T2OA 3T1WA 2C1PA 3O8XA 3SJVE 1I85A 1OAZH 4UQ2A 3RX7A 2NY1C 4Z0BH 4MDIB 1FFPB 5I0DA 1QNZH 2CIIB 2BSSA 2NLJA 1Z2KA 1YEGH 2ZJSL 4L8SB 4CVXB 5IIEB 4PRIA 4HX1A 4I0PC 1MIEL 4P0DA 5JOPD 3M45A 1R3KA 4PRPB 3SHSA 4L29B 1JWMA 3RHWK 1I1AD 2GTZB 3WS3B 3MUJA 3JVGA 3JV4A 2NY6B 5GZND 4PJFB 5ANMA 1DLHA 3P73B 1EA9C 4WU5B 1LE9B 3QRGL 2HA1A 1PG7H 2V7NB 5DGQA 1GPOL 3FAXA 3L7FB 1LO2H 2Y7QB 3B3IA 3J8F7 1N0XH 4FFVD 5ID1A 3C87A 3D18A 1ZV5A 3ECBB 4UIKH 1BQHA 1ED3A 1GXEA 2X4PA 3VXUB 2GW5A 3HR5A 3KPQA 2JJSA 2UWEF 5EIIB 5DHYA 4QRUB 5CCKH 1IGJA 3QDJE 2HFEB 1FZJA 4MD4A 3BIKB 3UJIH 4UQ3A 3ARWA 1O7VA 3C60C 1K3ZA 4EUPB 2VDLH 1HXYB 4XZUA 1MJUL 3MYJA 2EXWD 1LK3H 4KI5E 4PJHE 4X5WA 5JA9A 4Y1AD 3ZE1E 3BZ4A 3SGEI 1OAZL 4N8VB 2KKQA 2CO7B 3OB0H 4KTDH 3AS3A 5EOCL 3HR6A 1PX3A 5E8NB 5L7XH 4HIHA 3PXJA 3AU1B 4KHTH 5I18L 3IDJA 3MRBB 1MCFA 2G9HA 3I02A 4OV6F 3ZE2E 5E6YA 1U95A 5DJZA 1WSST 1BZ7A 4IJ3B 3LRSB 4ODWB 3RVWC 4XNYH 3RFZC 3GUTA 1S3KL 4OCYH 1MCOL 2W0LA 4KMTH 5KVFH 2B39A 3D48R 5IF0B 3B9KD 4RGNE 4HWEH 1AGBA 1IKNA 2EKSB 3MV8B 3UTZB 2GCYB 1NBQA 3KYOB 2JB6B 3LQZB 3UJTH 4QXUH 4WWID 3IVKB 2Z31B 2Z35B 3IXTB 3TO4B 1CGSH 2MQ3A 2HKHH 3GMLA 3UYRL 3E8UL 2YD6A 4L8SC 4TRPH 1JYVA 5DXWA 3NOIA 2HRPL 4D9QD 4I18C 4LCWB 2GTZA 4LCCC 4ZUVA 5ISZE 2NPLX 3FQNB 4FXGB 3ZDYE 5BQ7B 3GSVA 2BY3A 3S96A 1LP9A 1VPOL 3T3PF 4KKAD 5SWZD 3MR9B 1WWBX 3EJJX 1HEZA 1OB1A 4KZEH 5D7SH 3HE7B 4F8QA 4UV7H 4X7DC 3QIUD 4Y4KD 2IPUG 5CHNB 2EDBA 5ICZA 5I76A 3D39D 4AL8H 4QHMB 5F6HI 1T7ZA 3B3IB 2RHEA 3BWAA 4G9DA 5D6CB 5DK3A 5GGRB 1IGFL 4NWTL 3QDJB 1E4WL 4M00A 3QFJA 4X9IA 2ERJC 2HRPH 3AAZA 5EUOB 1A7NL 5ITBL 4UT7L 2P5WE 3QDMB 4XHJD 1MELA 3GIZH 3MFFB 3DRTB 3P4NB 4PD4K 1V7NL 5CLTA 5EFIA 4JFQA 1NAMA 2P4AB 4IRJC 3UTSE 4B7LA 3GSXA 3DX7B 4JKMA 4R4BA 1F6FB 1NCNA 2Q8BL 5DQDL 1T7YA 4JO3L 2W38A 4S0SD 4U05A 4M3KB 4X7EC 3VFTA 2JIXD 1N0LA 4L4VA 4O02L 1VEOA 3KLHD 5IMMA 3BUYB 3DX9B 4AIXA 1JGLH 2EDOA 5K9QG 3GKWH 4S1QL 1MLCB 3MROB 4HCRL 1XGTB 2VTFA 4KTEL 4KKCD 4Y5XB 1KNOA 4LBEB 5CMAB 3VRLF 3QBTB 2ERJB 4HIXL 1OWRM 4PB0H 1KG0B 3TPUA 1VEMA 1S8DA 3AVEA 5EA0H 3MBED 1MQKH 3F7RA 1DBAH 4HLZG 2F74B 4PRBA 4BQBA 1DANU 3OAYH 5GGRY 4DW2L 1DFBH 2EIZA 5DQDH 1U8PB 3VXSA 5E9DD 4OZ4A 4GO6B 2AJUH 5JIPA 3F7YB 3CSGA 5KVEH 4PJ7B 1C7TA 5KTEL 1LO3H 3WFEL 2DL2A 3FJTA 4NYLA 3KJ4B 1WIPA 5HY9A 2EDLA 4KI5F 1R24A 2QLVB 1CXFA 4YXHL 4RNRA 4IMKC 1NFIB 2VDQH 4UIMA 2RQ8A 4XT1C 1BWMA 4TVPH 3V7AG 1JN6B 4G9FB 3V0VA 1T7XA 4I3SH 3HG1B 2QSTA 5BOPA 3T65A 2XZZA 3MMEB 3JWNC 3UTPD 1C16B 4ZPTA 1TITA 3SE3C 3EOTH 2AJVL 5DMGD 1TZIA 5ESQA 5DEZA 5E2VL 3WS6A 4L3EB 1PEWA 3FQUB 4P9MH 4R96B 5I74B 5CSZB 1U3HA 3DETC 4MA8H 1RZJC 4I2XE 2NXYD 3FO9A 3ILPB 2E5EA 4K8RC 5DJDB 2O93L 1OHQA 2VJXA 3RVXD 2B20A 1HOCA 4UV4L 4YHZL 1EEZB 1Q1JH 4QY8B 5HHPB 2F58H 1UG9A 4ZSOE 4O5LH 2CQVA 3TBTA 4TVPL 1EK3A 3X14A 3NCFB 3QUYA 5A2KH 3GSWB 1MLCA 2XA8H 2YZ8A 3BAEH 4M6OL 3LKQA 4LQ1A 5D1ZC 5H35B 5DVOA 3X13A 4BSWB 4Z7NE 3BZEB 2IPTL 4KZDL 1IT9H 1XF1A 4IOIB 3LV3B 1QKZL 1SEBB 3THML 2H32B 2YPLE 4BYHA 4XPHL 5D7JB 4PJBE 2UY7A 4LEOA 4M7ZB 1DQTA 5TQ2L 3X11B 4EDXA 3TA3D 2AV7B 3KYKH 4O4YH 3BO8B 5IMOA 1QNZL 3RDTB 3DXAB 2P5EA 1ZOXA 3OAZK 4RGNB 3IKKA 1L4IA 3D87B 4HG4J 3QXWA 3MLPA 3WLBB 4G42A 1YA5A 1G7MB 4XBGB 5FYLH 3C8DA 4TOYH 4N8VG 5TDNB 2YUWA 1WFTA 3QJHB 2YD4A 1A5FH 1I4FA 4WNQA 4PJ9A 5HY9B 2X09A 5DD0H 4LCWE 4PJ7A 3DJ9A 3AUVA 2IPTH 4KZDH 2C9AA 1VACB 3P9LA 1WISA 1QO3B 1XGYH 4D0BA 1A47A 4LIQH 5HPOA 2VXUH 3OL2A 5CKGA 1N8ZA 3EYFA 5FM5M 3HE6C 1C1EL 4G80A 1KIQB 2YD1A 5ACZB 3MC0A 4PRIB 3TH2T 3R1GH 3S5LA 1ZHNB 4EIGB 4PB9H 5FYJE 1ZHBA 4MHHI 1G1CA 1RUMH 4L29A 3SKOB 5FHAH 3EO1B 5D96C 1JRHH 3VXME 3L3GA 3MCKA 3FN9A 4PJEE 5EZJA 4QF1B 3RL2B 5SX5H 1BLNA 4MCYB 1HSBA 5T3ZD 3H2WA 1UM5H 4DN3L 2DQEH 3RWIB 2XY1A 2VXTH 2W65A 4JR9H 4POZC 4RX4D 3OKEA 3GJFK 4JLRB 1CDYA 1WIUA 4ELKA 3HR5B 5TQ2H 1JYXA 5GQBA 1F3RB 1RU9H 4PREB 3BUTA 4M1GL 2JJUA 4LCWD 5IVXB 3ZSSA 1P4IH 2XQBL 2R0KL 4Q6IA 1HYRC 4X99A 2NY2C 1A8JH 2HVJB 3KJ4C 3RQ3A 3VW3H 4PJHB 5JUEH 4K3JL 1CFQB 1NUGA 4Q9RH 2VXQH 3ARUA 1NL0H 1I7RB 4HKZB 1ZS8A 4HUXA 4M1DH 1OM3H 2E27L 5I9QC 1HHHB 2EYRA 4C55A 3WHXB 1IM9D 2EE9A 1CD9B 3LB6D 4FZEH 3X11A 2ICES 1CGXA 4U1JB 4JM4H 4GMTH 3LS4H 3VFUA 3VU2A 4GJTB 3NIDF 1EAPA 5SWZB 1MF2L 3B9AA 3WFHA 2OXGA 2VH5H 1S78D 1NC4B 2JIXA 1P4LB 9CGTA 5DRNA 3LH2L 2FEEL 5IFAH 3S37X 4P23B 4K3EH 4PJFF 3D39B 2ICEB 2OL3A 3CX5K 4RGOL 3SDAC 4XNXH 3X3GL 4YAQB 4HFUL 1QZ1A 2VXTL 3L3IA 1CICC 4KU1A 4OGXL 4FFYH 5TE6H 4PTTB 3K4AA 1TQCC 4PJAA 2L0DA 4HEPG 1VACA 4XVSH 1LD9A 3D69A 3FB8B 3H8NA 2X7LA 3CPLA 3SPVB 2VLKA 1G1YA 1I1RA 4YK4B 1GGYA 1IAKA 4XCYA 2CJUH 4M9PA 4AK1A 1YEJH 4PJEB 5IKCB 3K80A 4P46D 4JPWL 4S1SL 4QTIH 4DGIL 3UXFA 4NQSB 3V4VH 2WIMA 4OQTL 1FNEB 5ENWB 5J0BA 3RWIA 3MJ9A 4Y16C 1T1WA 3RWFA 5CEZD 1FO0A 4L8CA 1BLNB 4MCYA 2MHAB 1P9MC 2D7OA 5IJKC 3UBXB 5CEZL 2RGSA 3R8BB 4OGAD 4PR5B 2CKBB 4Z8FH 5MERA 3C5JB 2WV3A 2VSCA 4YDLC 1QFPA 2HFFA 3JV5A 4CVZA 2V9QA 4KVCL 3PWVA 4KRPB 3G5XA 4DGVL 2GT9A 4JFYA 3WL9B 4MQXC 5D2LF 5FA4A 3LRGA 3HC3H 2AXGA 3TT1H 4GKZA 1IEBB 2XN9D 4OCLC 2HT2D 3DX7A 4RX4A 1K9TA 4JRYE 4XX1G 2P44B 3MNVB 1W0WA 2CXGA 5ANMB 4S0TD 1NUFA 1KTDA 4D3CL 3GSNL 4L3EE 4Z7VF 5LXGL 3JTTB 4N0CC 3LMJH 5IJKA 4KGLA 4HBCL 4LVEA 5DQJB 1XR8A 3D1MC 1FYHB 3QB7C 1RZKC 4IRSA 1ED3B 4LP5A 1PFCA 2HFTA 4JFPA 1DBKL 2VOTA 4Z8FL 3LKSB 4IS6B 5BOZG 1OSPL 1CFVH 1FCCA 1FVDB 3PJSB 1G0DA 3S34L 5E94B 2L7UA 3V4VL 2FL5A 3M1BB 4P46C 1NFDE 5AG9A 3H3KA 4XPTL 1WITA 4I0PB 3HUJE 4TPRL 1U9KA 4IOFC 2NLJB 3C5ZC 3FFCE 2OZ4L 3ES6B 3DUSA 3HPLA 4I0CC 3PWPB 2QHLA 1E4XH 2XA3A 3QXUA 3B8SA 3MRIA 2VLME 2Q20A 1MRDL 2NY2B 4N8CH 3GBLA 4H0IA 4BSVB 2R39A 2GJZA 2PCPB 3DPBA 4DGYH 2B0SL 5JW4Q 1D9KC 4JKWA 2A1WL 4LLVA 2G9HB 3I02B 4KY1L 1WFUA 1MLBB 1JPFA 1CR9H 3RKDD 1ZLSH 2ENSA 1CFVL 4MD0B