4NCC2

Neutralizing antibody to murine norovirus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
220
Chain Sequence
VKLLESGGGLVQPGGSLKLSCAASGFDFSRYWMSWVRQAPGKGLEWIGQINPHSSTINYTPSLRDKFIISRDNAKNTLYLQMTKVRSEDTALYYCARLLRYFYALDYWGQGASVTVSSAKTTPPSVYPLAPGRAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab fragment light
publication title Flexibility in surface-exposed loops in a virus capsid mediates escape from antibody neutralization.
pubmed doi rcsb
total genus 40
structure length 220
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ncc202
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ncc201
4KRPB 4ODTH 5FFLA 3ZDZE 4Z0XA 3BYTA 1QFWL 4X98A 1S7XB 1RHHA 2VLRD 2WLZA 1NC2D 3EW3B 5DHYB 3RUGA 4KPHL 2XPGB 3CFJB 3SGKA 5C6TL 5E8DH 5JR1H 1JNLL 2DJ4A 2YXFA 1YMMD 1KIPA 2KPNA 4WW2A 4PJAE 4P46C 3LOWA 3L3DB 4G6FD 2FO4B 5TDNB 5C0CB 1BQSA 1QSFE 3S98A 1OM3L 1J1PL 5GGSA 2FX9H 3VD7A 2VDLH 3CXDH 3SDCC 2GSIA 5DJ0B 3U46A 3V6FB 1EO8H 2HJLB 2AK1H 3LRSB 3VXSB 2E6QA 4DN3H 4PRNA 5A40E 4J4PC 3OJMB 1YECH 2GAZA 5ETUA 4NOBA 3HI5L 2NXZB 3G5XB 3D39D 2EXWC 2QKIA 4Y2DD 3DWTA 5ENWA 3KS0J 1CZ8H 3FO1B 3P30H 4M43H 4U6TA 3HS0B 1G7IB 5FYKL 3WNKA 5C0DA 5KBNC 3EYSL 3GSXA 3EO1A 1WCBA 4NNXA 1JHTB 1P7QA 5K9KB 3GMOA 5TF0A 4LLWA 3LQAH 1F90L 3KPOB 5JHDB 1NBQA 4N9GA 1VACA 5IVOA 1KTDA 5CGYD 3LMJL 1RZIB 1BPVA 3PWLB 4QTIH 3OAZK 4YDLB 4NQSB 1VFAA 3HNTH 5CWSB 5JXAH 1T20B 2EIZA 4XI5C 1Q9KA 4UTAH 2W0FA 4UBDC 4KQ4L 5FA4A 3FRUA 3DUUA 4M8QA 4NQEA 1ND0B 4OM1L 4KDVA 1A9EB 3RKDD 4XC3L 1UWEH 3MRHB 3S3SA 3BP4B 4G6AC 2EDQA 4L8SA 3VG9B 2GW5A 4HMDA 3FFCD 1Q0XH 4Y1AD 1YC7A 1MHPL 5SWZD 1FPTH 4XB7A 5FECB 5C0NC 4TUOA 4N68A 2E3VA 5FYJL 1UM5L 1HHJA 1JHKH 2ZSVA 1SYVB 3KYNB 5L7XH 2X2YA 1QNZH 4XNZC 3TJHC 3O6ML 1RJLB 5F1IA 1BIIA 4RSVA 5AG9A 2W38A 1CD9B 4ZTPH 1BVLA 3PDDA 4D0BA 2Z8RA 1A7RL 1ZT7B 3DX6B 3FQRA 3MLYL 3QFJD 2R4SL 1SMOA 1UXWB 2EH8H 1LEIB 3BEVA 3D3VD 4KDTA 5L2KE 2FZ3B 3GI9L 4CUCA 1G7JB 3IVKB 3GSNB 5EPMB 5FXCH 1QFWH 2XZAH 4NQDA 5HHPA 5F9AC 1K85A 1E28B 1MRCL 2AVGA 3CJJA 5KW9L 4KPHH 5C6TH 1JNLH 1XF4B 4HUKB 4WI6A 3IDIA 1YEKH 4K9EC 4XAWL 2E9JA 1OM3H 1J1PH 3VFRB 1LILA 2P48B 4JFDB 1FYHB 1QLFA 2AQ2A 3TCXA 3M1BB 3I6GA 4MJIA 5D7LE 3QDHA 4ZOBA 1ZHBB 5DJCA 4Z78B 3HRZA 2R15A 3HI5H 4PV9B 5DK0B 4BZ1L 1SBBA 1NKOA 5CSZB 1UWGH 3WLBB 5HYJE 5JMRA 2B0SL 5FYKH 3LDBB 1KJVA 3EYSH 3I75A 3OKNB 5J0BA 1VEMA 1TVHB 3O9WA 4N8VG 4O2EA 1KPUB 4RMTA 5IFAL 3STLA 4TQEL 3ALXA 1F90H 4U1IA 5ANMB 2M8XA 4GQ9L 4WO4B 5F9JA 3QCVL 1WBXA 4DVBB 3MRCB 43CAA 5J12B 1HK6A 5MEND 3LN4A 3MRFA 2CRMA 4KQ4H 4POYA 3PL6A 1RIVL 5L2JA 1XMWA 4OCMC 1Q38A 4OM1H 5KVGL 5IW6A 4P3WA 2WBJB 3G6JA 4XC3H 2H2SD 3OG4B 2QQLL 4U7KA 4YLQT 2H26B 5C2UB 2I9TA 1DVFD 3SDAD 2ATPB 2V7HA 4LP4A 2MFNA 2FCBA 2C1OB 1J0JA 4JLRA 1MHPH 3W5NA 5H8DA 1MWAL 3EOBA 4UIKL 1NDMB 3OAYK 5JA9A 4U7SA 2VKXA 5FYJH 4XHJD 1UM5H 3QNXA 3O4LA 3MV8B 1T83C 2FECL 3RBGA 3NPSB 3QZWG 4N0UE 5IHUL 1NCCL 1FYTA 3D0LA 2HH0L 3U6RA 3HZMA 5TGBB 5FCUH 2E6JA 2VRAA 1P5VA 1R3LA 3MLYH 3NIFF 1YQ2A 4BQCA 2R4SH 2CRIA 4MZ3A 3W5MA 1JWMA 5FAAA 3KPSA 2EZ0D 3GI9H 1CD0A 1JYXA 4IRSD 4MDIA 1N8ZA 4I1NB 2EDNA 1HEZB 1ZT4B 1MRCH 2KDGA 5KW9H 1X5YA 5L9DL 1AO7E 4JFQB 1QA9B 1KSRA 4OZIA 4X9FA 5DD6B 4HFWB 1RVFL 5FB8B 1U8MB 5E8OB 1PKQE 4X6EA 2PTTB 3KPMB 3RJQB 3PL6D 1RHHB 4XCYA 4XAWH 3N0PB 4AT6A 1PGRB 1S9YA 4PJ5E 1IZKA 4M6OL 1U8NA 5E8EB 1CFQA 4WW2B 3WNLA 2BCKB 4Q9QL 3FB5B 1NUDA 1MCBA 1HH9B 3BUTA 1LO2L 3WKML 4CU6A 5I9QC 1H15B 4BZ1H 2ARJQ 5DS8B 3WN5C 4PFEA 2EDKA 1SYSA 3MNWB 4EOWL 4QXGL 2VDRL 4M9PA 4AZ8A 4MCZA 1T7YA 3MO1B 4WW2F 3EFDL 3WHXA 4PJEE 2B0SH 4LRIA 2A6KB 1JN6B 1LDSA 4UB0L 3VJ6B 2ZG2A 1QVOA 4P3DB 3VXRA 4WRLA 4P59L 4FMFA 3QA3B 4P5TB 1C7TA 1P5UA 4TQEH 5ENWB 1OGAB 5HI4C 5D7JD 5E9DD 35C8L 5D7IA 5DMGC 4F9LC 2DYPD 1T80A 4GQ9H 1WIUA 1B6UA 3QCVH 3EO1B 1JGDA 4JFEE 3HR5B 1E6OL 3MYJB 4WU5A 4PJXA 4L4TA 5D1ZD 5GGQL 3DHJA 5CKGA 2W91A 1A8JH 3SCMD 2FIKB 2IQAB 3RY4A 1KTDB 1RIVH 1NFIA 3MREA 4PJEB 4Y5XA 5C0EB 2QV2A 4JJHA 1VFAB 4XP5L 1VERA 3FN3A 4FQXC 1J11A 1A1NA 3TPKA 1CGVA 2QQLH 4ZXBD 1S5IL 1NEZG 5A2IH 4PJEF 1U3ZA 1EVTC 1MWAH 4UIKH 3C5JB 1FLRL 3WS3A 1NBYA 2IJ0C 1OAUL 3W9EA 4JFXA 3GK8L 5FHBL 1CDJA 1VFBB 4P5MA 4ENED 4B53A 4K23L 4MAYB 1FFOA 3KG5A 1KCRL 3RWCA 5IHUH 1NCCH 4AENB 2VLKA 3MRKA 1OF2A 2GJJA 2HH0H 1T6VN 5GRYA 2VL4A 4YDVB 1HWGB 1R5VA 4C56B 5DJDA 4BSJA 4Q74A 4Q58C 5EB9A 3S8WA 1BIIB 3DGGA 2YPLA 3QEQA 1HINL 4OZ4A 3TZVD 4I3GA 1JZ5A 3L3KA 3FO9B 4QHNB 4APQD 2PN5A 3MUHL 5DK2A 5L9DH 4PP1C 4WHTB 3RWFB 3BEVB 1SHMA 2V2WA 4LCWB 5I1HL 2NLJA 5IT2L 2RHEA 3EOYG 1U91B 3S4SA 1PSKH 2VYRE 1RVFH 2CPCA 4HWUA 4BKLA 1OTSD 2AXGB 1P4LA 2CIKA 1JYVA 1YZZA 2XN9E 3TN0C 3AREA 5GRVK 4OQTH 2AV1B 4NN7C 5E6IA 3A6OA 3QDGD 4J1UA 4ELKB 3O11A 5GS0D 4M6OH 4LKCB 5L8KB 1CXLA 5J06A 4Q9QH 4WNQA 2XI9A 1R5WB 4JAMA 1WC7A 1CT8B 4FP8L 1LO2H 3WKMH 4LBEA 1IGML 2QHLA 4EOWH 5GQBA 4QXGH 2NX5E 2VDRH 1YEHL 5FOJA 2J1KA 1QPXA 3EFDH 1YNTA 4WDIB 7FABL 1YY8A 3HUJA 5KVMC 5LXGL 2EEBA 3QUXB 3UTTD 2K1MA 5GGRA 4UB0H 5JDSA 5EZJA 1MCDA 5HY9A 5LBSL 3NA9L 4P59H 2ZNXA 1CF8L 3PWUB 2YD1A 2GYSA 1UC6A 5E99L 2X89A 35C8H 5DQ9B 1FSKC 5DVKA 2J8UA 3UROR 2YC1A 3IJHB 3I75B 4B5EA 3EZJB 5CJ5A 1E6OH 1JGEB 4NO3B 2P5WB 5GGQH 5CP3A 4LSDA 4WUUA 4NKOB 1CR9L 5ECJE 3BZEB 2Z4QA 3EYQD 2BVYA 5E1AA 3RNKB 4WHCA 3WJLC 5C0JB 5JXED 1D6VL 3H7LA 4MQXC 3UDWA 4CU8A 3MUGB 2IQ9L 3MFFB 3DUHA 4B7IA 4UILL 4PPTA 3MACL 4ETQA 2HMID 2RQ8A 4R3SA 2XRAL 1S5IH 4CW1A 1G0XA 2HJKB 5EORL 4XMPL 5L2JB 3HAEG 4PJCA 1S9KC 2AK4A 3IFPA 4ZO6A 2J6EL 4XBGA 3G6JB 3W39A 2G75B 4F58L 1FLRH 5SX4I 1OAUH 4PV8B 3ULSB 2VITB 2R1WB 3GK8H 5FHBH 5A2LH 1N5AA 5EU3A 5D6DC 3FQXB 4K23H 1I8LC 4YBLC 1KCRH 4JLRB 3QJHA 3MRBA 1JNNL 3L3JA 4YHML 3MLVL 2IBGA 2CLVA 5D7KD 3N06B 5HVFB 1FYTB 3D0LB 4BFGA 1IAII 5HYEA 5B4MC 3AB0B 3UJJL 1FVDA 1L7TL 3MCKA 3QPQD 4CVXA 3U6RB 1UENA 2X89D 4FOMA 3OTTA 5IMMB 4U1GB 5DUPL 4NZUL 2NQCA 1MLCB 5GRXG 3ZHDA 3LKSA 5C6WH 3EJYC 4IRJC 4YR6B 4HH8A 3PV7A 5IT2H 3DGCR 3QNZA 1UWXH 3AS0A 3O6FC 1HI6A 2BC4B 4QXTB 5JZ7C 1M6OB 4HK3N 4M48L 4ORGB 3KVQA 4QRQB 4XP1L 5EFIA 4A6YB 3TWCH 3SGEH 4R2GD 4X6CE 4KGJA 3OV6A 3K46A 1U3HB 4YHKL 2EDRA 2NY4B 1AD0A 4XCYB 1SVZA 1J8HE 3D2UA 4BZYA 5FDWA 3GHBL 3BKML 3MRGA 1CICA 1IGMH 4HSQA 1ZE3C 3VWKA 3ZKND 3ARGC 3R8BB 3HCVB 1YEHH 2BMKA 2X6MA 1A4JA 5HYSA 8CGTA 2XIDA 4WEMB 1K8IB 4NHUA 5LXGH 5CJOL 4S1DD 1N3NB 5FK9B 1UVQA 5LBSH 3NA9H 3CSBA 2C9AA 1CF8H 3JVGA 1O5DT 1WLHA 1DQDL 3P73A 1ZVHA 1BMGA 2Y7QB 3GSVB 3WHXB 2NXYC 2J12B 1QRKA 2VC2L 3H9SE 2BY0A 1TQBC 5EO1A 5GGRY 4EUPG 4LSSH 5HYQA 2PYEB 1HXYA 5L0QB 3AU1A 1BOGA 3B6SB 3KHQA 2JCCE 1OAKH 1CR9H 1KEGL 5CBEB 4P4RA 5J12C 3MFGB 3QBTB 1D6VH 4KH2A 4G42B 4KI1A 5A1AA 2NW3B 1P6FA 4MLSA 1ONQB 2IQ9H 3B8SA 4UILH 4EI5A 3UAJC 4AEHL 5I1EL 3MACH 3HR6A 4JRYE 1X7QB 1FN4A 1MFCL 2XRAH 4P4KB 1KLGA 5EORH 1WTLA 4XMPH 5GZOD 3WXVL 4F58H 4R6UA 1G7MB 1CLOL 1QFOA 1UJ3A 4H1LH 3ARBA 4JM2B 3OF6A 3O45B 4LPWA 5HGAA 5JDJA 4KMLB 5I8CA 3W0WD 2D3VA 3NPSC 1A2YA 1KIQA 1SQ2N 1JNNH 4GRLA 1TLKA 4YHMH 4L4VD 4L8BA 3MLVH 3L7EA 4JM2F 1FFOB 5HGDB 2UWEA 4Y2DC 1VFMA 4O2CB 1I1YA 3E2HB 5C0GA 4Y4KB 5CIPH 3UJJH 1NANH 2GJZA 3VFVA 3ZDXE 1L7TH 1IKFL 1XZ0A 4JREB 5F7MC 5ISZD 4ZUTB 3T65A 4MNQE 4NZUH 1R6VA 4MZ2A 4JJ5A 2P8LA 3P9WB 2DS4A 1N6QL 5IOPA 1QQDA 3VXTB 1CG9A 2H6PA 2NYYD 2O5ZL 5E2UL 3ROLA 5IBLD 4M48H 3TH4T 3HE7A 4XP1H 4FTVB 5JUEH 5DHVH 3ULVL 4HUVB 3BP5A 2BHYA 3SGKC 4G80B 5JW4R 3G6DL 4YHKH 1FFPB 3IU4L 3K2UL 4OV6F 4H26A 3RZWA 2P4AB 1DEDA 1NLBL 4X6FA 1QHPA 3GHBH 2MCPL 3BKMH 1XGTB 4X6BB 3U48A 3UCRA 2YOCA 3O11B 5KVFL 1AGDA 4NQXA 5T1KB 5IEHB 4UUJB 3KPRB 4HGKC 3IDYB 4HJJL 4N0YL 3LQMA 1MHEA 1JYWA 5CJOH 4DKEL 3GDBA 3ZKSD 3PNWB 3FOMA 4HS3A 2Q20A 4GRLD 4Z8FL 2W60B 1DQDH 2JJUA 1FL3A 1YNTB 4MWFB 4RQQA 1YY8B 4AIXA 1P2CA 5IIEA 2VC2H 3J7HA 3ULUD 5L6YH 5EZJB 3UO1L 2OL3L 1A3LL 4L3EB 3U9UA 5J6HA 2DQFA 3KLSA 2FR4B 1VCAA 5IESL 2LU4A 5IMLB 1KEGH 5F9WB 1G7HA 3OPZL 3MV7B 5KSUA 3G9VA 4QRSA 4KUCF 2ATKB 2Z8VC 1CXEA 2VLMD 4J8RB 5FM4A 1PAMA 5BS0E 3GSOB 2E7BA 1OP3K 4AEHH 4GOSA 4HZLA 5I1EH 4ZS6C 5E5RB 3MSPA 1U8KA 5KVEL 4NBYB 5B39A 4EXKA 4HX1B 3TYGH 3UTPD 5C0AD 1I8MB 3WXVH 2IALB 4LPXA 5H2BA 5B38A 4LVOC 4ZOAA 1CLOH 4OUOA 4JZJA 4ETQB 2Z93B 3P11L 4J12A 3DVFA 4ONHB 1O0VA 5FYKD 4HH9A 4WI2A 4XBGB 4L8SC 5HSFA 5T3XD 5IKCA 5CEZE 4PGJA 3CZFA 4OCNC 2VLJA 1N5AB 2GK0A 5H94B 2OSLB 3PHQB 5I1CL 3LAFA 4P3CL 3TVMB 2B7DT 1IKFH 4MVBD 4YIQB 1AIFA 3B2UD 1RZ8A 4G6JL 4MD0B 3T4YB 2VLLB 4E41A 5FUOL 2EH7L 3VD9A 1N6QH 2WINB 3MCKB 1KG0B 2VDML 2H3NB 1BD2B 3QIBD 1ZSDA 4KDTC 2O5ZH 2CKBH 4JKKA 4O02L 1UWXK 5E2UH 1PLGL 3ALPA 5HJ3A 1DFBL 2WUBL 4GUPA 4CL7A 1M05B 1MI5E 3EAKA 1RJYB 4QOKB 3H9HB 2IH3A 3ULVH 2NZ9D 2X4NA 4UIMA 4K94L 3BSZL 3LY6A 3G6DH 4XZUB 3C9NA 3IU4H 3K2UH 3TT1L 5ITBL 3V4PL 2Q3AA 3QUZA 3QZWB 4PB0L 3ARVA 2X4OA 2MCPH 4Y16A 5F6IC 2OTWA 3MCG1 5EFIB 1H3PL 5TE7L 3WE6B 5IB5A 5F7LB 4HJJH 3PUCA 5D1XD 5DD1L 4ZSOE 4N0YH 5HHXL 5DRXA 5FDWB 3U4AA 4DKEH 3STZB 4JPIA 3RVWC 4I2XB 4L9LA 2E7MA 4Z8FH 1DQML 2BMKB 4K7PL 5EU6A 3GSRA 3MCLL 3PE9A 1PDKA 2EE6A 3I50L 3QDJE 2EYSA 1TQCB 4HUWA 5DO2D 1EEUA 3UO1H 2CUMA 4R0LB 1A3LH 5HI5C 4E5XA 4S2SB 4IS6A 2EC9U 4MCYB 5IESH 3O9WC 4U1KB 2HT3D 5DMIL 1HOCA 3OPZH 1QRNE 4G5ZL 2IPKB 5BVPL 4R4BA 2BOCA 4XBPB 1GHFL 3INUL 1MWAA 4PJDE 2FX7L 4PJIE 5J1AA 5EU4A 1VDGA 3EYOA 1T1WB 3W82A 3ILPA 3BPOC 1G1CA 1NLDL 3MOBH 4K8RH 5KZCD 3PL6C 4U6VL 5DMKA 2OMNA 3VRLF 1K4DB 3LD8C 1P53A 3P11H 2V6HA 1LE9A 5E6ZA 2BVOB 1KLGB 2AJZB 2FLRT 3NIDE 1TJGL 4BFEA 2OQJB 2GJ6A 4BSWA 2IAMA 3WDHA 5DVOA 1OTTD 2NY5L 1BFTA 4HWNA 5HGAB 5I1CH 4KK6D 5GGVL 2A0LC 4LHUA 1TZHA 3OHXA 1W0YT 4P3CH 5CBAA 4M1CD 1I9EA 3VFPA 3L3GB 1C12B 4OGXL 2DWDB 1MCKA 4FQJL 4HEPG 4CBPA 3SDDA 4WJ5A 3T1WA 3QUML 4G8IB 4Z7VB 3JTSB 1U36A 4G6JH 5CSGA 4OQTA 3DI2B 4WFGD 3KWWA 5IVXB 4NBZB 1BWWA 5FUOH 3F12A 2EH7H 4YJZL 4MS8D 2HT4C 3LKRA 3VFVB 3O3DB 5F71A 2VDMH 2ZZUT 4F7CB 1MVUB 4XVUC 4WFFD 3O8XB 2K9UA 4O02H 1NEZB 1QYGL 1PLGH 1ORQA 1KTLA 1EV2E 2WUBH 2FRGP 3QQ9C 4OLYH 3TBYB 3VFGL 4JJ5B 3PDGA 1TETL 4Z7VF 2DLIA 3VG0L 3VXUE 5E6YA 1Q1JL 1AJ7L 2XV6B 1BLNB 5IVXF 3BP7A 4F9PA 2BXYA 3CK0H 1HSBB 5JHLL 2C4XA 4K94H 3BSZH 4KI5D 1IGYA 2CO7B 2A73A 5DEZA 1S9WA 3TT1H 2BNQA 5ITBH 3V4PH 4QY8A 4PB0H 1C1EL 3DTXA 4RISL 2YD3A 4JFHE 4LSTL 3SKNA 1H3PH 1VEOA 3BXNA 3T8XA 2UY6A 1C08A 2F53B 5GSVA 3HZKA 1NCWL 4YNYA 5DD1H 1KENH 4DKFL 3IGAA 5D6CB 5HHXH 1YYML 3QG6A 2FIRT 3SKUD 3ZDYE 2ZG3A 5HXMA 2C1PA 3JV0A 5FKPA 1QLRA 3JWOL 1I75A 1NUNB 4Y19D 1H8OA 2IAMD 3T0AA 4K7PH 3MCLH 3G04B 2FJGB 3I50H 3LSOA 2EKSA 3RHWF 3SE3A 1BM3L 2CDEA 5CJ8A 3GHEL 5I1GL 3WLWD 4LRIC 5FV2A 3BPCB 4H0GA 1UB5B 3GMQB 1ZLWH 4Y2OA 1SVCP 3MLXL 4LHJB 3MXVL 5I66B 3FB6A 5DMIH 5L0QC 4DGIL 4G5ZH 2EYRA 5BVPH 3IFOA 5IHZB 1AXIB 4UQ3A 4IIQB 4YHOL 4YO0A 5E56A 1GHFH 3INUH 5J6HB 2DQFB 2YD6A 1FE8L 4Z77B 3PF2A 3O3EA 2FX7H 2R29H 3QSKB 4JRXB 2VZOA 2IWGA 1WICA 3EZ8A 1JIBA 1G7HB 4BELD 5EC1A 5KSUB 1NLDH 2Y72A 4R26L 4PYGA 4Z5RA 2VDOH 4XPFL 1FZJA 4U6VH 3VFOA 5EO9B 2DN7A 3BKCL 3QO0B 4Y5XC 3KJ4C 1J05B 3Q3GA 3RP1A 1D9KD 3KYMA 1PY4A 1TJGH 1WQVT 4NCC1 2Q76A 2PYFA 5C08D 1TFHA 1N2RA 1HN1A 2C3WA 2HWZL 1S8DB 2NW2A 1XGUA 2UYLA 4EBQL 4I9WD 3RDTB 3NFNA 1IM3B 2NY5H 3CPLA 1ADQL 3DRTB 4OIBA 2EE9A 4LRNL 4P2OB 5GGVH 3LIZL 2MOVA 2VZSA 1INQA 1OTUC 5JW4Q 4XCEA 3B9KB 4OGXH 4FQJH 2BNRA 3QUMH 4JQVA 1F5WA 3GSUA 3BUYA 1ERNA 1DCLA 3EYVA 4P2QE 2ZCKL 1MFAL 5HHVL 1K5NB 3GKWL 5DEFB 4NGHH 4KVNH 3RL2B 5I16B 1AIFB 4JCLA 4NJ9L 1UKSA 1X5ZA 1S9XA 2K7QA 3P77B 5BRZD 1QYGH 2DI9A 3VRJB 2J2ZA 3VFGH 1G6RL 5D1QD 5FM5M 4I48B 5F21B 4XX1E 4JY5H 1TETH 2XOTA 3VG0H 1Q1JH 1AJ7H 3C6SA 2CSPA 5JHLH 3GI8L 4KKBD 3U2SB 4XWOD 1OAQL 3MNVA 4AH2A 4GKSB 1ZSDB 2P42B 3TIEA 1Z5LA 5C0IA 1C1EH 2V5TA 2YHGA 1LP9A 4HUUB 4X4MA 1VESA 4LSTH 2IMNA 3AREC 5DHXB 5E6IC 4UQ2A 3X14A 5K33A 3ARDA 5CLTA 1EFXA 3BVNA 3FCTA 3MGOB 4GO6B 2XG4A 4DKFH 4MSWA 1YYMH 4XXDA 5JW5A 1AGEB 2ED7A 4LPTA 1KLUB 1T5XB 1AI1L 1H3GA 3JWOH 2PETA 1QSEB 4PG9B 4X7TB 1BM3H 4OLWL 3GHEH 4HLZG 3RGVA 4E0RA 5I1GH 2M1KA 1ZANL 2VIRB 5I18L 1DQQA 4PJ7A 5J13B 3MLXH 5C09A 3MXVH 3VXNA 1S7SB 4DGIH 5JNYA 5D8JL 2WANA 2DM4A 5FA3A 3TBSA 3DXAE 3VFSA 4Q9BA 1KPRB 1FNGB 4YHOH 3QULA 3CX5K 2PW2A 4EIGB 1FE8H 4CJ0A 4G8GD 1TNMA 5E5MA 2R39A 1YPZB 3KYOA 2GSGA 5K9QI 3O4OC 4KK9D 3Q6GL 4HKXA 4P9HC 4R26H 3UTQA 4XPFH 5EUOB 3BKCH 4NO5A 1JK8B 4NQCE 2EYTB 1IAIM 4I0PD 1YPZF 1T66D 3GRWL 4FXLA 1M7DB 4G6KH 3P4MB 3HLAA 4I0KA 3A67L 5CIPA 3ARFB 1NAMA 5EUOF 2HWZH 2CLRB 4EBQH 1OW0A 3RX5A 1EFQA 2BK8A 1Y18B 3AFLA 1LE9B 4Y7MA 3ZKNC 1BWMA 5DURD 4LRNH 3LIZH 3GJFB 4EUPB 4U2YA 1YY9D 4PRHB 5ACMA 2WWMD 1EBAA 1A1OB 4PJ9B 1XAUA 1CVSC 5DA0B 3RTQA 3H3KA 5F1OB 2ZCKH 1MFAH 2X4RB 4LEXL 3GBNL 5HHVH 2ADJA 3EDJA 5IB2B 4PRDA 5DHVA 5FKAB 4QEGA 5DJ8A 5DJZA 4NJ9H 3O3UN 4F7EB 4FQHB 4WJ5B 1MAJA 1G6RH 3SDXE 2P43B 3EYFA 2J5LB 1ZA6A 4JFFB 4EJ1C 3VGFA 3GI8H 1DP0A 4QNPF 3TM6A 1OAQH 5IQ9A 3F58L 1FNEA 4F8QA 2VLRB 5FOBB 1NC2B 4HT1L 4PS4L 1JF1B 1RZKL 2R56L 4JGUA 2VDPL 1YMMB 4XRCA 1NMAL 1RZ7L 1IGYB 3LEXB 2VXQL 2R2CA 1X4XA 1S9WB 4G6FB 3BKYL 5D2LE 4NO0A 3ZKXB 1AI1H 3MUJA 1EUTA 1F2XK 3BT2L 3PABB 1C08B 1CICC 5J7CC 2YKLL 2Y25A 1F4AA 2NNAA 2IF7A 3VWKC 4YNYB 1DLHA 4PGEB 3CDGB 3QT2A 4L1DA 4OLWH 2H32B 3LQAC 1ZANH 3C8KA 3D39B 5I18H 3DYOA 1KEML 4E42B 2IBZY 3RUGE 4FXGB 1HYSD 4OSUL 1GCFA 4LARH 4PTTB 2EKSB 4LPVA 4N8CL 3MLUL 3VFMB 2CRZA 2IADB 1ZLWK 4ZFZA 3ET9F 3RVTD 5MEPA 1Y6KR 5DK3A 4AIZB 2PKDA 4XCCH 2CUHA 5HYSG 3B9EA 1I7UB 1NGXB 1NGWB 2HFFB 3Q6GH 4HUNB 3K3QA 1IE5A 4BH8A 2NYYC 5IBLC 4NUJB 4D0DA 2ICEB 4EI5C 1D5BB 4CN1A 3WEXA 4QHMB 1U8HB 3PP4L 3GRWH 2CIIB 3HC4L 5IJVB 1MCEA 3SGDH 5DVLA 3NPZB 2G5BB 3A67H 4MHHI 1TNNA 2HTLD 4LLMA 3VE0A 1RIHL 3QWOB 3WIFA 3OB0K 3U4BL 1O7VA 2A9ML 1UJ3C 4EVNB 3FFCB 1QFUL 3ARBC 3D3VE 4Y1AB 3S5LA 1N5YL 2JK5B 3KYMB 2A6DA 1WWCA 2IC2A 5SWZB 2BRRL 2Q76B 2PYFB 4DGVL 4GXVL 4Y4FA 3H8NA 2NW2B 2D7NA 5DMYA 5EO0B 5IB3A 5C7XL 4MJ6B 4JFYA 3UZEA 1AC0A 2CKBA 4GRLC 1UH4A 2VZUA 3GBNH 2NTFA 3EDEA 4V1DD 4YHNA 3KLAB 5IBUB 1CL7I 1G9NL 2AEIT 3KPQA 3QFJB 5D70L 1MCRA 1F42A 3CDYA 3D3VB 2DB8A 2V17L 2OK0L 3ZT5A 1NUGA 3A6CL 3DECA 2HN7A 3S6CA 3QYCA 1X5JA 4M02A 3F58H 4AQ1B 4PRID 2X1OA 2V2TA 3MRPA 1JBJA 4NHCL 4PS4H 4OKVB 3RVUC 2DMKA 4RGOL 5IMOA 2HLFD 2R56H 2WQ8A 3WNPA 2VDPH 3HE7C 1NMAH 1RZ7H 4EXPX 3OL2A 3VWJA 4YHIA 2VJXA 3BKYH 4HBQA 4GW5A 3EJJX 3L5HA 3NCEB 5C0IB 5FGCB 3K8KA 2HP4A 2BSSB 4N8PA 3C8HA 5HGBB 4PY8J 3BT2H 2Y6SD 3ALWA 1VSCA 2Q3ZA 2YKLH 3VD4A 5JTWA 3BVNB 3FCTB 4YBHA 3E0GA 3N1QC 2VKWA 4F80A 4MSWB 4PBXA 2NY2D 4NQDE 4Y4FD 2O61B 2WBWB 3IXTA 4GRMB 5KS9A 1KEMH 4OLZL 4OSUH 3P0GB 3QFDB 4G43A 1CU4L 2YRZA 1QSFD 4N8CH 2ZUTA 1TCRB 3MLUH 5I75B 2MHAB 4CADB 3C5SA 5J3HD 1WZMA 3UPRA 1DR9A 3ULVD 3SPVA 4BH7A 2IMMA 2N56A 3LB6D 1TIUA 5IVZB 5IFJA 3V52L 1CXFA 3TBSB 4UV4L 1XR9B 1PW3A 4MJIE 3DX9B 1ACYL 3T4AA 4Z7WA 1S7UA 3MBEA 2DLGA 5DJ2A 1W8NA 5E5MB 5D93B 3K80A 5KG9A 5MENB 1CLYL 4I18A 4PBVC 3PV6B 1VPOH 5GS1A 3D1MC 3PP4H 3HC4H 4HF5L 4NN6B 4HKXB 1B0GB 1FO0B 5BZDA 3R06A 5H35A 2I5YL 4CMMB 1RIHH 2N7AA 3DUSA 3U4BH 2ESVA 1DVFB 2A9MH 3SDAB 3ZSTA 4FG6C 4JZJC 1QFUH 1N5YH 4PLOB 1GXEA 1NFDB 2X4PA 1ZGLA 3L7FA 4GAJL 4LDEB 3MRNB 4DGVH 4GXVH 3IDXL 4ZPVA 3VXOA 5HVGB 5MEOA 4OM0L 5C7XH 1KJ2B 3RPKA 3RWHA 4N0RA 5B39G 4GH7B 2P8MA 3F62A 5JLZB 2PW1A 2GTZA 5B38G 4PJHA 1NFDF 1KJMB 3TO4A 2JIXD 3ZE2E 1FFNB 2UZYB 2X4SA 3LCYA 3IAQA 4W4OA 1G9NH 3HG1A 1M71A 1BVKB 3FN9A 3MRRB 5T5FL 1OOAA 1E6JL 1JPGB 2IGFL 3GSWA 2V17H 2OK0H 3A6CH 2AQ1A 4IRSB 4FQQA 3TH2T 2XZCL 2PNDA 4O9HH 1VFUA 4M7KL 4NHCH 1A6UL 4MDJB 2P7TA 5EWIL 3V5DA 3BPNB 1CGWA 4RGOH 3QIUA 4OJFL 3O4LE 4LLDB 1VGKB 2CJUL 3S36L 3SQOH 2Q7YB 4KJWC 4G9FB 1INDL 1YEGL 1KXTB 1H3XA 1EJOL 1FNEB 2VZTA 4QHLB 4FQCL 3D0VB 3QUZC 1CFSA 3BD3A 4OLUH 5D96C 1J18A 4JANA 4RAUA 3FONA 1IEAA 4Y16C 5L2KD 2Z8SA 4ZUUA 3FOLA 3KPSE 2UZXB 4GKNB 2VISB 3ZE0F 5LKNA 3LQZB 4KKAD 4NQTA 3E6HA 4LSVH 4B0MM 3OXRA 1U8OB 3NOIA 2OJZL 4OLZH 1S78D 4L9LC 1W8OA 2QR0A 1DLHB 4ZO7A 1CU4H 4BSVA 5I76A 4OZIE 4XXCA 4WV1A 3HA0A 2QSTA 4WTWA 5DGQA 5EBLB 5IB1B 4U1MB 3NZHL 4YGVA 1XIWA 4OUUB 3B8YA 3W2DL 5E95B 5D7JB 5E9DB 4ZAKA 3K1DA 5D7LD 4D2NA 2DYPB 3V52H 3JWDL 3T3PE 4V2BA 5GS2H 4UV4H 5C07B 4UAOB 3ZKQD 3IU3A 2ICWA 1Z6JT 5I71C 3SCMB 1K2DB 4TVPL 3N85L 1CLYH 5HYJD 4F33A 4YPJA 2BNUB 2VR9A 1CVRA 3FQUA 5DRZA 4UINL 2OS7A 1AD9B 1CE1L 2EDBA 1J1XL 1I7TA 4LIQL 2I5YH 3PG2A 3PGCB 3RVVD 1WFTA 3FAWA 3D69B 1LNUA 1PD6A 2CLZB 1YEDA 1AFVL 4GAJH 4YBQD 3OGCB 4NNYB 5D7IE 3IDXH 3EO0A 3BE1L 2Y1VA 4OM0H 3ES6B 2ICWJ 5HTSA 2IAMC 2G2RA 2RAMA 1F3DH 2X4UA 4PJXE 4L4TE 2DIBA 1IGJA 2A6DB 3KHOA 5KAQG 3BZ4B 2EC9T 4GAGL 2DI8A 4IHOB 1KNOB 2X44D 1TPXB 1SJXA 3PIQA 4NPYB 4LOUD 1CDBA 2ED8A 1EHLL 3QDGE 3O41A 5CS7A 5T5FH 3SDDC 1E6JH 1XCQB 3QRGL 2IGFH 1TVBA 3BDBA 3MC0A 3QXAA 1PKOA 5JOFB 3P4LA 3TZVB 2HJFA 2AEPL 3H6JA 3KPPB 2XZCH 4APQB 4NQVB 3KPQB 1A6UH 4JFOA 3WS6A 5EWIH 1DE4B 2YS4A 4OJFH 5HHOA 4X4YB 4XB8A 2CJUH 1T7WA 3BYYA 4XVSL 1NGZA 3S36H 2FHCA 3LKNB 5BOPA 1INDH 3QB7C 4F9PC 1YEGH 1EJOH 2VLKE 2W65B 1DN0B 4G8EA 1A21A 4FQCH 1YUHA 3QDGB 5IMOB 2IANA 3AS3A 5E03A 3MUY1 4HW6A 5CD5D 2ZOLA 3G5ZA 1MPAL 2YPLE 2BVQA 3QEQE 5DC0A 1AO7D 1F6AB 2OJZH 4ODWB 4GRWE 4QWWD 1U3YA 4MA1B 4X5WB 3UTTB 1O7SA 3OX8B 3RU8L 1PZUB 1YNKL 5CEXA 3SE3C 1IFHL 3NZHH 4PJ5D 4OI8A 4KJQC 4DEPB 5KS9B 4YZFE 3LPWA 3W2DH 4H8WH 3DRQA 3D85D 1FC2D 3QIWA 4FRWA 3JWDH 3O3AB 4NSKA 3QWRD 1HHKA 4G7YL 4WY7L 2VQTA 5EU7C 5D1QC 1DUZB 2MQ3A 5IWLA 2D7PA 3PWVA 4TVPH 1RJCA 5KS9F 3N85H 4PJGB 3RWGB 1AGCA 1LO5A 2G60L 2EXYC 5C92A 2H1PL 3GMNB 1REIA 4Z7WB 4UINH 4DUVA 2LQRA 1CE1H 1PQZB 3HUJE 3IRPX 4JDZA 1J1XH 3QI9D 4LIQH 4XTRD 1JNHB 5KG9B 2DQIL 4J3TA 15C8L 4KTDL 1T22B 4PJGF 3OR6A 3MV9B 2QTEA 4PGBA 3DROA 5CFHA 1DZBA 3OWEA 4GAYB 1AFVH 3MLSL 4DZBA 3K0WA 4JFED 4WVRA 1IM9A 4Z7WF 5IMKB 1C5BL 1E4KA 2J8UE 3BE1H 5DWUL 5DUML 4ZDHA 5L88L 1MFBL 1YC8A 2JJTA 5I73C 1G6RA 2O93L 4IOIB 4WUUE 1KXVC 3NN8A 4EDXA 1SJHB 3AXLB 1OSZB 5FF6B 3QQ3A 1W72B 4Z9KB 5I1DB 1FNFA 4OZHB 3RWHB 1EHLH 5GIRB 2CDFA 4Z7QE 4IJ3B 1FV1A 2PW1B 3QRGH 1IEBA 4JQVC 1NEUA 4LF3B 4LNRB 1NBZB 4CN6A 3WBDA 2AEPH 1R3HB 2VE6B 2AKRB 4PJCE 3TA3A 2AK4E 1BECA 4OZHF 2ZUQB 1S3KL 1LEKB 5F7FA 4PIRF 4RIRB 4NOFA 3H3BC 3FQNB 2FL5B 4XVSH 4X0KB 2W0LA 5HDQL 4X80L 4XCFL 2QSQA 3QXUA 1NDGA 1I3UA 2R0ZL 3I3DA 4BK4A 4QYOB 2YD7A 3GSNL 1CGUA 5B22A 4R2GB 2FHBA 1G7QB 1CTNA 2HFGL 5M94B 3B5HA 1MPAH 1CI5A 3ARDC 3B9AA 3BH8B 4W70A 1WVZA 5TDOA 2X9YA 4NZJA 5FO7A 5J11C 3OG6B 4NFBA 5D2NB 5DJAB 4LVNB 1DEEB 3FONB 4Z7QF 3MRIA 3HRPA 4QRUB 1DANU 1YY9C 2XN9D 3LV3A 3EO9L 2UUDK 3RU8H 3GSQA 1YNKH 1ZMYA 4NC0B 1F45A 2F9BT 1TZGL 2GUOB 3RGVC 2B5IB 2NY1C 4GLRI 1MCQA 3GMRA 2CDGB 5F3BB 4NCC2 5I76B 1CE6B 5D71L 4O51A 4H88L 4EDWL 1A7BA 2R9HD 1F3JA 3ARZA 3GRWA 1DUYB 3UTSA 1KB9K 4G7YH 4WY7H 5F88A 4BA8A 4YPGA 1F11A 2ADGB 4I77H 5MERA 5DQJA 1F97A 1XF3A 4FFYL 4RDQG 4TSCH 1R24B 4P23A 2PXYD 1FZKA 3KYAA 4MA7L 3FT3A 2J88L 4ZO8A 3DX8B 2H1PH 1JV5A 1HH6A 2GTWA 1KIRB 2YPKB 1BAFL 3MLRL 4PJ8D 3TNMA 4L4VE 5C0BA 3SJVA 4ZFFB 3GMPB 3VFNB 15C8H 4EI6B 4KTDH 3WO3B 4QRRA 4U1SB 3S37L 1TTFA 1V8HA 1LE5B 5E2WL 3FB7B 3MLSH 4TSAL 4OCWL 4U1JA 4JKPL 3TFKC 4EN3B 1C5BH 1B3JA 4OFVA 1U95B 1GGBL 4H1LG 4ELMB 4HKZB 4JHWL 5DWUH 1U8QA 1FCCA 3ARQA 5DUMH 4KHTL 5IB4A 5L88H 1MFBH 1OW0C 4PRPA 5ERWB 5CZVL 3U36B 3SKMA 3W0WB 4MQSB 3MLPA 4DOHE 5I74C 5MI0B 4WTZA 4ELMF 1X4ZA 2CMRL 5I30L 3RVXD 3OXSA 1Z3GL 2XA8L 4I5BB 1HYSC 3QAZB 3RTQC 5K59E 4NKMB 5ISZB 1EX0A 4RX4A 3IAPA 1JRHL 5EN2A 5D7SL 12E8L 5SX4H 1UEYA 3T77A 1ETZB 2NY7L 3O41B 4NM4L 3GMMB 4HS6B 3GZKA 3BW9A 3QXAB 3CVHL 3BIKA 2HJFB 4MNHA 2JB5H 5HDQH 3MLWL 4X80H 4XCFH 2X5PA 3G5VB 3REWA 5AUMA 2VTFA 3A6BL 3MLZL 4N5EC 4P2RA 1AHWA 2R0ZH 4OLXL 5MEQB 1OAZH 2HTKC 1F58L 3FQWA 3RZCD 3C08L 3GSNH 1J88A 2KUTA 3SJVD 4BQBA 1DBBL 3BPLC 4MA3A 1I7RB 5KSAA 2UWEE 4QRRD 3HPLB 1RQ5A 3BN9D 2HFGH 3T0XA 4OCXL 3RI5K 1U8LB 3VFTA 1Q8MA 4IOFD 4BQ9A 2HLAB 3WIIL 4G9DB 4M1GL 1CLZL 2P8PB 3BQUA 5INDA 4Y4HA 3EO9H 4MJ5A 5KVDL 3ZT7A 1K3IA 3DVNB 3IDGB 4PB9L 2JE8A 4R8WL 5A16A 2GFBA 4LLVB 3MRDA 3QEUB 4MD4A 4NCDA 1TZGH 3DVIA 3RL1A 4JO1L 3O3BB 2YSSA 2XWBB 2NY6C 2DQTL 5T1MB 3UTPE 4H88H 1AR2A 4EDWH 3HNVL 3Q1SL 1KIUA 2YMXL 2X4TA 4GJTB 3I2CL 4X4ZA 2OCFD 1F8TL 3BDYL 5ADOH 4FFYH 3UBXB 5GJSL 4MA7H 4HJGA 1OAYL 1BREA 32C2A 4WI7A 5FYKE 2J88H 1W0VA 2OJEB 2PUQT 4DUXA 3ULUF 1WWBX 5LJYH 3V7MA 1VKXA 4CRPA 3MLRH 2DBJA 1BAFH 3WKNA 5EU5B 4W6WB 1BQHA 5D72L 1D6EB 5ITFB 5T1LA 1L4IA 3QUYA 1JZ2A 5AZ2L 4HK3J 4P46D 4RNRB 1ZOXA 4XWGL 1LO4L 2YN5A 1LK3L 2VXTL 3H9SD 3MPCA 5E2WH 5C0AB 1I4FB 4TSAH 3G5YB 3GB7A 4OCWH 1IJ9A 4ETYA 4ACPA 4JKPH 2MKWA 3SDCD 1DTUA 1FC1A 1GGBH 4CDGC 2DQHL 3HHRB 4X9IA 4JHWH 3ROOA 1EIBA 3OR6B 5J6GA 4ZNCD 4J4PD 5CZVH 3HI1B 5DEGA 5ESQA 5HVHB 3IKCA 3PXJA 4Z7OE 4LQFL 2OI9B 2WM0A 3FFDA 4K3JH 1EGJA 2XWJA 2EXWD 1I1RA 4LLUB 4Y4FC 4ZDHB 5I30H 4KKLC 1Z3GH 5BQ7A 2XA8H 2V5YA 5FYJE 1OGTA 3IDMB 3V6ZA 3QQ3B 4G8FA 1DQJB 5TE6L 1R5IB 1JRHH 4OT1H 12E8H 5D7SH 3ULVC 2NY7H 1S7WA 3S5LG 1U8JA 2CDFB 1AP2A 4NM4H 3SE8L 4FQPA 3CVHH 5F89A 5JW4M 3MLWH 4UNUA 5F72S 5FO9A 3QIBB 3MLZH 4XI5D 3H2WA 4OLXH 4LKXB 4UBDD 2WBKA 1F58H 4GKZB 4OD1L 3T0EA 3C08H 4J2XA 3QDMA 2VLJE 1DBBH 3EOAA 1T5WA 3QRFM 1AQDB 1K4CB 3DO3A 3NFPA 4MNQD 4OCXH 3MRLB 4PJBB 3BEWA 3VWJC 4G6AD 3EHBC 4WFED 1VEPA 4R96A 4Y5VB 3OKKA 3ETBF 2NY0B 3LKQA 5C0ND 4M1GH 1CLZH 5D1XB 2MJWA 1X5AA 4UV7L 4E41E 3BIAX 5KVDH 3NGBB 3KS0H 1GGCL 4PJBF 4R8WH 3TJHD 3IDNB 2VUOA 4WU7B 3JSSA 3JTTA 4JO1H 5BVJB 1MLBA 3DO7A 3DVGA 4XCNA 4GW4B 3ZKMC 4YXLH 1K9TA 4J3VA 3PP3H 3Q1SH 2YMXH 5SX5H 4YXKL 3I2CH 3QJFA 5E4EB 3HZVB 1F8TH 5GJSH 3G08B 4K8RC 1OAYH 1K3ZA 4O51B 3ZTNL 1CXIA 4NRZB 3SDYL 1I9RL 1RZGA 4HWZA 3LEVL 3C6LA 2NR6C 1IKNA 4KGLA 5D72H 4P23B 5AZ2H 4CVZB 2PO6A 3MBEC 4XWGH 1LO4H 1LK3H 2QADC 3KXFD 3MX0A 5EU6E 1G7LB 3RKPA 4I18C 4BZ2L 2PCPB 5GS1C 3BGFB 5IROA 2IH1A 5KZCB 4KV5F 3TNMB 1Q9OB 1IAOA 2Z31A 3RWJA 3KNBA 1JWSB 4WI3A 1QD0A 2DQHH 5GJTL 2E7CA 1T1YB 4U6HA 1E4JA 4YAQA 3WHE0 1JWUB 3PQYD 1Q9LB 4H0IA 2EDFA 1MQ8A 3H7BA 2D03L 5AAWA 5TDPB 4CU7A 5BS0D 2F54A 1LD9A 3P4OA 3TO2A 3GO1L 4M5YL 3T0DA 4DN4H 4YHZL 1GZPB 5IB4B 4G7VL 5ID1B 5GS2D 3QNYB 3PGDB 5F9DC 1N59A 1T0NA 4KI5E 1YEJL 4NKDB 3QXWA 4NRYB 3ZO0A 4GBXA 1JYNA 1EHNA 4HIEA 5TE6H 1CGYA 4OCYL 1ORSA 2VERN 3TO4C 4NZRL 5DI8A 4MMZC 3V95A 2AJSL 4K94C 4W4OC 2BRQA 2C7UA 1XEDA 3SE8H 4LPUA 2CR3A 4FQ1L 2FEEI 2NY3C 3QO1A 4QRTA 5CEZD 3MRQB 3O81A 1V05A 3CFBA 2GIYA 4Z7UA 2UZIL 2EDHA 4JZNA 4NDMB 4Y19E 2GJ6E 4OD1H 3VXMA 3ECBA 2GHWB 3BIKB 4GG6A 1F4HA 1L7IL 3QIUC 2LE9A 2PO6D 4ZQKB 4Q2ZB 2CKNA 4U49A 1ZHKB 3H0TA 4HGWA 2VWEC 1V3KA 1HHHA 1A6WL 4OAWB 4U31A 1U8PB 1JGVL 1A9BB 4RFEB 3S9DB 4KI5F 4UV7H 4FFWC 4A6YL 3ORJA 4QTHA 1CFTA 1GGCH 3IXAB 2OX5A 3HPJB 2N4IA 3T0BA 1MI5D 3L95B 1UZ6E 5L8JB 3G6AA 4U6YA 5INDB 3ZE1E 2ERJB 5DJYA 4PJFA 3OAUL 4J6RH 5CINL 1PVHA 3CCHA 3OJDA 1KPVB 2WZPD 5D5MA 3V5KB 2P5EA 1ZVSB 3EDKA 4LPCA 2BNQE 4GBXD 4GXUN 2ZSWA 4XXCC 3VFUB 4CVWA 4WV1C 3ZYZA 2R1YB 4F2MA 2EICA 1XIWC 4HIHB 3ZTNH 4MMXC 5MP6L 4ZAKC 5HHNA 1I9RH 4FXKA 1NC4D 2RGSA 4J3OC 3LEVH 3VFWA 2OTUA 3PWPA 5JIKA 1I3RA 4LQ1A 3QDJD 3RWEA 3W11D 1B9ZA 4BZ2H 1HHGA 1VKXB 5CP7B 2CO6B 1NAKL 2NY5C 4Q6IA 1S9VA 4P99A 4OF8A 3QUYB 3PWNB 5CUSL 5GJTH 1KOAA 4NIKB 1UH3A 1D9KB 1QRND 4GMSL 3MLTA 1WV7T 3WXWL 4DFIA 3IJYA 5C08B 1ZWIB 5DQDL 3GO1H 4M5YH 5IEKB 5EU7E 1FQ9C 4YHZH 4G7VH 1A1MA 1IAKA 3T1FB 1I1AA 2X4QB 2R2HA 5ICYA 3IKCB 1T0MA 1YEJH 2QSCL 1OT1A 2ZPKL 3RFZC 2VL5B 2YUXA 5C0RH 1CGTA 4RBPH 4XNMA 1BX2B 4OCYH 4ZUWA 5SWSA 1Z9LA 4NZRH 1G0YR 1S7TA 2AJSH 5CEYB 5HI4D 3QEHB 5DMGD 2B8OT 4FQ1H 3ARXA 5I8EB 4AG4L 1MF2L 1S7XA 2W92A 1F6LL 5BRZB 3F6LA 2XPGA 3L3OB 4ODXB 4YC2B 1F4YL 3O6KH 4XNUL 1L9MA 3MJGX 3CDFA 4XMKL 5DZLA 3WS6C 3X12B 3PWPD 5F89B 3L3DA 3CFIC 2FO4A 1L7IH 5TDNA 5C0CA 4FQXD 3JWOC 3VDAA 2EDOA 2DQGL 3D25B 3ILQC 1A6WH 1GPOL 3DARA 1B4JL 3CXHJ 4MQ7B 5DJ0A 4I4WB 3V6FA 1JGVH 2BNRE 2HJLA 3LRSA 3VXSA 4WW1B 5I8OL 4PLJD 3SO3C 1QFWI 4A6YH 1UQSB 3MMEB 3PHOB 3K2MC 3OB8A 5C8JB 2DJUA 3G5XA 1T7ZA 2OR7A 2R8SL 3GBMH 3FO1A 1L6ZA 4POZC 1IAMA 3OAUH 3HS0A 1G7IA 3UBXI 5CINH 3U0TB 1JHTA 4JFHD 4OFYA 2OR9L 5K9KA 4WWKA 3KPOA 4HGMA 5JHDA 3PP3K 1LP9E 4OBRA 5SX5K 5IW1B 3DO7B 1QBLL 2AQ3A 4OZGE 2ZP0T 4X4ME 3TYFB 2WAHA 4XPBH 4HPOL 1J0YA 2AP2A 1RZIA 3PWLA 3NVQA 5MP6H 3EGSB 4MAUL 1CTOA 3QIWC 5CWSA 4PP1D 1T20A 3BP6B 5DJXB 1KV3A 4G8GB 1KTKE 5FYLL 4Q97A 2GITB 2DWEB 3CH1B 5IWLC 5C1MB 1JPFA 1A9EA 2YEZB 3TPUB 3TN0D 2XA3A 1MREL 5IR1B 3GUTB 4BQ8A 1NAKH 3MRHA 2X1XR 3ZT6A 3BP4A 2O5YL 5CUSH 4I0PB 4GMSH 5FECA 3VGGA 3LRHA 2KKQA 3WXWH 5C09E 2X7LB 5F7YC 1SYVA 5DQDH 3BRGC 3BISA 5A3IC 1WBZB 2AXFB 1E4KC 4FA8A 1RJLA 4OI9A 2D0HA 4OZGF 5EUKB 4P9ML 4FQ2L 4U33A 2QSCH 2JJTC 2ZPKH 4UDTB 4WFHD 1ZT7A 1QZ1A 4CMHB 1F2QA 3DX6A 5LAXB 3QQNA 1UXWA 1LEIA 4JKMA 2FZ3A 1G7JA 3GSNA 5EPMA 3BIBX 4W68A 2WIIA 1MF2H 4AG4H 4RDQF 5J1TC 1E28A 3AGVA 2D7QA 1F4YH 1XF4A 3X11B 3TA3C 3AVEA 4XMKH 1A6AB 1CGXA 2WWKO 4JDVB 8FABB 4MQXD 2Q8BL 3QO1B 1OWRM 3WDJA 3VFRA 2DTSA 4JFDA 2BOBB 2DQGH 1P7HL 5JR1L 1GPOH 4P2QD 1B4JH 3MROB 3M1BA 4WENB 1H5BB 4U1NB 3RWDB 4M93C 4L3AA 5IGXL 5I8OH 1ZHBA 4HS8L 1BZ7B 1K8DB 3CGTA 4Z78A 3DX7B 4NC2B 4PV9A 5DK0A 3I3BA 1PYWB 3S35L 3QISA 1T1XB 5CSZA 4WHDA 3WLBA 2P47B 4QRPB 5AD0B 1AC6A 1UH2A 2ZUXA 25C8L 2RB8A 1YECL 3V0VB 1PX3A 4QTHB 3OKNA 4OF7A 1TVHA 3Q5YA 1KPUA 2OR9H 1TCMA 2CR6A 1YN6A 1BZ9B 3P30L 5B4MD 5ANMA 1B2WL 2MSPA 4HPYL 1T3FB 3B4NA 4JHBA 5FM5O 4HPOH 3FHQA 3EOTL 2X42A 2A9NL 3T3ME 4MAUH 5D5MB 4DVBA 4ZUVB 2P5EB 3WFDL 1TTGA 4YUEL 4HQQL 1WAAF 3MRCA 4KJYB 3EJYD 4IRJD 5FYLH 3I02B 6CGTA 1WK0A 3F5WB 2Q86B 3B5GA 4OF6A 5JZ7D 5HHNB 2WBJA 1MREH 2XTJB 5D5MF 5JPNB 4FABL 2R69L 3WNMA 2H26A 2O5YH 1E4XI 1JF6A 2ATPA 4JFDD 3X3GL 3RWEB 4HKBA 1FNAA 2C1OA 3DXAD 5EBMB 5HD8C 1NDMA 1A6VL 3AS2A 4X7EC 1S7QB 5TPWL 3MV8A 3ARGD 4S1SL 2X41A 4GW1B 2IFGA 4U0RB 5KN5B 4YHLL 5HGGS 1AKJD 1FPTL 4P9MH 4FQ2H 2H9GB 7CGTA 2Z8WC 5TGBA 5L7XL 3I84A 3TP4A 1JCKA 4RFNB 2E7LA 1X5XA 2RIKA 1MELA 4NQCD 4KKCC 1QFHA 5KSBB 5I1KL 2VZ3A 1I1AB 2NXYD 4RBPK 2R2EB 3D9AL 3QXTA 2R2HB 4V1DB 1WZLA 5MHSD 2X09A 4RGNB 3KPLB 3U7WL 4WO4D 4UT7L 1ZT4A 2X70B 5KSVB 5SWSB 4OTXL 4X6DB 4XVJL 3RRQA 4MXVE 3N1MC 4OCSL 2ITCB 4JFQA 1QA9A 5I1LA 1FL5B 5KSBF 2UY7A 4YK4C 1F4WL 3LN5B 4HFWA 5DD6A 5FB8A 1U8MA 5E8OA 2XZAL 2Q8BH 2PTTA 3I6KB 3KPMA 3QWQB 5FO8B 4WTZG 4PRIB 3UAJD 4X6DF 5J9PA 5GRVL 5E8EA 1AHWC 1YEKL 2BCKA 5M7QA 4PG2A 4NP4L 3P0YL 5IGXH 3FB5A 4HS8H 4H25B 1HH9A 4W6XB 4L8DB 5KSAC 2CK2A 1H15A 5DS8A 3L5IA 2EDTA 2DBLL 3ULVE 3S35H 4Y88A 1C16A 3MNWA 4NKIL 3MXWL 2AEWA 1UZ8B 3MO1A 4XNQB 2FJHA 3U9PL 5JPMB 2A77L 2GCYB 25C8H 2A6KA 5FCSH 1JN6A 3FZUC 3EKCA 3VJ6A 4P3DA 3ZTJG 3BQUC 4XPAL 2NY2B 3QA3A 4P5TA 5T3ZL 4CJ1A 1T4KA 3FT4B 4Y4HC 3VMNA 1UWGL 1KACB 3C09C 4KKNA 1OGAA 4PJAB 2GK2A 4WHYG 1B2WH 4HPYH 3ZDZF 2XKNA 3EOTH 4NBXB 1QSFB 4C59B 3T08A 2A9NH 3V79C 5F8QC 2DQCL 1VFOA 3HR5A 3WFDH 3MYJA 4YUEH 1X5HA 1FJ1B 4HQQH 4UOJA 2J3SA 4WWKB 9CGTA 4XBEL 2C3VB 1A5FL 1NMBL 4PJAF 2FIKA 2IQAA 3Q6FB 4PJEA 4Z7NE 3OR7B 2AJVL 2ZUWA 2YWYA 5C0EA 2X1PA 2MQCA 4HUXB 3CSYB 3V9FA 1X5KA 1V7NH 4FABH 3AAZB 2QBWA 1U41A 2R69H 2VAJA 4GT7A 4LLYB 1LGVA 4N9OB 1WJ3A 3X3GH 3BN3B 4LEOB 1SBSL 1JPFB 1P7KA 4YDJB 3C5JA 1A6VH 2VN4A 1KBGL 5KANG 2ITDB 4RRPA 4OZFB 5TPWH 4HMCA 1AXSB 1VFBA 4S1SH 4MAYA 2C3HA 2AJYL 4YHLH 4AENA 1CXKA 2OL3B 4H20L 2QEJA 3DHMA 4JKLA 2WK2A 3RGHA 1G9NC 4RCAA 1BQHG 3RY6A 4YDVA 3B9VA 1J0IA 3P3YA 4C56A 5F9OL 1GZQB 5IJKA 4HWBL 5IVNA 2XICA 4P5TD 5E08L 5I1KH 1EZVX 3D9AH 3BKJL 3I9GL 4AEEA 4HHAB 4Z7NF 1CBVL 2JIXB 5FCUL 1FZMB 5DFVD 3U7WH 4UT7H 3FO9A 3MUZ1 4QHNA 3RIAF 4OTXH 3CFEB 3RWFA 1WEJL 4WHTA 2BX5A 4XVJH 1U8IB 3HFML 4OCSH 1QEWB 1J0KA 1P7QD 3U4EB 4LCWA 1QBML 1U91A 1F4WH 2BERA 3SO5A 2AXGA 3U30B 4NYLB 2ESVE 3DNKA 3MV01 2WIIB 1MCIA 5FHAL 2SEBB 2AV1A 4ZS6D 2B2XL 3V6OA 4GQPH 4ELKA 3P9LB 4LKCA 3VCLB 3U0PB 3UYRL 2YD4A 3P0YH 4NP4H 2OXGA 3T0EC 3ZHKA 5C6PB 4NQED 1R5WA 1CT8A 1ED3B 2KZ1B 4XMLL 4P2CG 1T6WA 2HFEB 1RSFA 4PJHE 5E24E 2DBLH 4NKIH 5ESAB 3MXWH 4D9RE 5L2KB 4I8DA 3HG1E 3U9PH 4WDIA 2A77H 5I2IB 3BOVA 3QUXA 4JRWA 1EPFA 4IBLT 2GT9B 3MZGB 4XPAH 1I1FB 3S88L 5T3ZH 3PWUA 4BJLA 3C5ZA 3DMMB 4DZ8B 5T5NG 5DQ9A 2G9HB 3NIGE 5TH2B 5BW7A 3IJHA 1FZOB 2DQCH 2VWEE 3LRGA 1JGEA 4NO3A 1D5XB 2P5WA 5I17B 4XBEH 2NX5A 4NKOA 1YN6B 1A5FH 3C60B 3BZEA 1NMBH 3RNKA 4L3CB 5C0JA 5D7LB 1GOHA 4IDLA 2AJVH 4XPTL 2VXSL 2OLDA 3OSKA 3UPCA 2KBGA 3MUGA 4NQDD 3MFFA 3H9YA 1JF5A 1X5IA 1D5MB 4DTGL 4R97C 3SHSA 4I0CC 2D9QB 1A7NL 3C6LC 4Y5YA 2A6IB 5HYJB 2HJKA 1SBSH 4OFIA 2EE3A 2EDXA 4QGYA 4LLQB 2AXHA 5DD5L 2G75A 2PO6C 4J23A 1KBGH 4WGVB 5LVEA 4PV8A 1FVEB 2VITA 2R1WA 3ULSA 4TYUA 5DR5L 5IROC 3FQXA 4X9HA 4CGTA 2VMFA 2Z31C 2YZ8A 2AJYH 4HKBB 4KZEH 3NIGF 4H20H 4MJID 3KPTA 2IPUG 3RVWD 4X9BA 5F9OH 4CKVX 1BFOB 4HWBH 2Q87A 1IBGL 3CFCL 4F15C 5E08H 1P9MC 3EJZC 3BKJH 3I9GH 3VGBA 2VAAB 5I6XB 4KROC 4YHPB 1CBVH 5DXWA 5HI5D 5IMMA 2YBRA 3HE6B 4J3UA 2D2OA 3WO4C 2DQUL 3K8LA 1MLCA 5JORB 1EEZA 1WEJH 4GBXC 3UEZA 3HFMH 3O9WD 4L29B 1QBMH 4YR6A 3V0WL 4WCYL 4D9LL 2BC4A 4QXTA 1M6OA 5FHAH 1AGFB 4ORGA 3HTLX 4QRQA 5TFSL 2B2XH 4A6YA 4OF0A 5I1LB 4N0UB 5EH1A 4PGDB 1PSKL 2Y07L 3UYRH 4ZUSB 1U3HA 3W11C 1W0WA 4RAVB 1NANI 1A7OL 4OI7A 4OQTL 1WZKA 4HKJA 3FN0L 4XMLH 2FEDD 2VZ1A 2DMCA 5C86A 2CK0L 1MAML 5F7DB 5J9PB 4PREB 3HCVA 4C54A 4WI4A 3I85A 4K2UL 3K1KC 1K8IA 1OB1B 5DYOB 5F7WC 3QUMB 1CDGA 4XC1L 4PP2B 5FK9A 1N3NA 4MX7B 4KU1A 4YHYC 3S88H 3SKOB 1AO7B 1C16B 1MCNA 4H8WC 3O4LD 3VGAB 2A0LD 1UFUA 3JWDC 2FJHB 2Y7QA 3GSVA 1PKQB 4Z95H 1XT5A 4QXUL 1FYTD 5HHOE 1J8HA 1JVKA 4M03A 4LGRB 1T4KB 2PYEA 3FB8B 3B6SA 4PJ5B 1MFEL 4NC1C 4LVHC 2HT4D 3D85B 5CBEA 2XKNB 2IANE 4NWUL 4XVUD 3KPSD 4XPTH 2VXSH 4G42A 2NW3A 3QQ9D 1ONQA 4M7ZB 2MTPA 4DTGH 3IYLW 1N0LA 5EOCJ 1X7QA 1A7NH 4K71C 4P4KA 4NN5B 3ARWA 5DD5H 3S96B 1G7MA 4D8PB 5J1SC 5ACZB 3QI9B 5DR5H 3QXVA 4JM2A 3O45A 4DFHA 2VOTA 5LQBL 4Q6IC 3VW3L 1I9JL 1P7KB 2A1WL 2DTML 4PLJC 3UTZA 4JFEB 4KY1L 4F3FB 2EKJA 1IBGH 4JRYA 5HGDA 3CFCH 3TCLB 1MY7A 1RJZB 2VH5L 4O2CA 4Y4KA 2WQRA 3QH3A 1DBAL 4JO2L 1NBVL 4Q0XL 4RMUA 1CD1B 1EO7A 2YN3A 1I1AC 3MRJB 4ZUTA 2DQUH 3VXRD 5TJWK 3GJFH 5LGKA 1U2CA 4KWUA 1RUPL 4EUPH 1BJMA 3QCUL 4K7FB 3V0WH 1VGEL 3DBXB 2BSRB 1RK1B 4WCYH 4D9LH 1QFWM 2V7NB 3VXTA 4KRPC 4LDOB 4DKDC 4N1HB 3HNSL 2BDNL 4FTVA 4WEUD 5TFSH 4R90L 4L4TD 4HUVA 4W4NA 1U92B 3B83A 2Y07H 4G80A 2ZUYA 4HK0B 1FFPA 4MA8H 4NNPL 3WD5L 5I0DA 1VENA 1A7OH 1S7VB 4F7PB 3VXPB 3FN0H 1XGTA 4TN9A 4X6BA 5C0FB 2HG5B 1RZJL 3TWCL 2XWTB 2CK0H 1MAMH 2FWOB 5T1KA 5IEHA 4C4KO 4TTDD 4GG8B 4UUJA 3KPRA 3TBVB 1CD8A 5EBWB 4N90D 4K2UH 3VH8G 3SQBA 2A83B 5E7BA 5B8CB 3BAEL 4XC1H 5E1HB 1CFVL 1MEXL 1GYAA 3PNWA 3KPNB 3W81A 3ESUF 2W60A 3WUWG 2XNAB 2NXZC 4O58L 1AGBB 4MWFA 4HV8B 1OTUD 2LTQB 4QXUH 2XN9B 2VLKD 1R3KA 3RHWK 4N0FB 5HDOA 1NQBA 4QF1A 4HAGA 4L3EA 1MH5B 1MFEH 3C5ZB 4NRXB 4ZS7L 4FHBD 2FR4A 3BGAA 2Z92B 5IMLA 1IQDB 4OFKA 4R4FL 2H32H 1NCUA 4NWUH 3MV7A 2YPLD 3QEQD 4LAQL 2ATKA 3IDUA 4LSSL 1KCSL 4J8RA 43C9B 3GSOA 2H41A 5F6HI 2NX5B 2V9QA 1OAKL 2DKMA 4ODUB 4YDLC 4EZMA 4L9DA 4Z76B 1N7ML 2EEDA 3PJSB 2PXYB 1MHHB 1RURL 2YD5A 2VO5A 1A6ZB 3TLRA 2WUCL 4HX1A 4NFDA 1OP3H 1JP5A 3KJ6L 5CGMA 1I8MA 4JZOB 2IALA 2WP3O 1T89A 4PJ8B 3ARED 4H5SB 2Z93A 3SE4A 5E6ID 4ONHA 4Y5YB 3WFCL 5LQBH 1I8KB 2Q1EA 1KULA 1LO0L 3VW3H 1I9JH 4N8VA 3BD4A 1NMCB 3RPIB 3VG9C 2A1WH 2XG5A 2DTMH 3L1OL 4KY1H 2HVKB 2XFXB 1FNHA 5H94A 2OSLA 5GRJL 3FHAA 3PHQA 3UTSE 1R3IH 1ZA3B 4KDWA 2VH5H 1FO0L 2A74B 2XQYG 3TVMA 1DBAH 3ARYA 2V5SA 1QR1B 4JO2H 1NBVH 3K4DA 4Q0XH 3BH9B 4KTEL 1YMHB 3MYZA 4YIQA 2VQ1B 1EZVY 4KUCD 1GGYA 1DL7L 1RUPH 1HQ4B 4MD0A 3T4YA 2VLLA 3QCUH 5SV4A 3QQ4B 5C0BE 3SJVE 1NAML 4XX1G 2WINA 1VGEH 1KG0A 4JG0L 4QRRE 3ARTA 1WF5A 2H3NA 1KJ2L 1BD2A 1P69B 2YBRB 1FIEA 3HNSH 3U30C 1J87A 1EEZB 2BDNH 4KK8C 5B3NA 1M05A 4R90H 2L7JA 1PZ5B 1RJYA 3NA4A 3H9HA 4QOKA 2D4DA 4WUUD 1RUKL 4XZUA 1CQYA 4NNPH 1B90A 3WD5H 4JKWA 1KT2B 4PRPE 4LASL 3QZWA 4NO2B 2KQNA 3GEWB 4RMVA 4LGPB 1RZJH 5B3JE 3WE6A 5JUEL 2GY5A 2O5XL 3BMWA 2VUYA 2ICES 3RZCB 3L6FB 2VSDA 1RK0B 1W0WB 4AQOA 4S0TD 3MA7B 1J5OL 2MWCA 4HKJB 2BVPB 3BAEH 2AK4D 3UXFA 5BV7B 2L0DA 1CFVH 1MEXH 3STZA 3WL9A 4I2XA 3QHZL 1FG2B 4BQ6A 3VA2C 2NMSA 4O58H 1TVDA 2OZ4L 1FFQA 1T7VA 1ZEAH 1OD9A 1YN7A 4R0LA 2DLHA 3CFKB 4GFTB 4S2SA 1P1ZB 4MCYA 3LDBC 2Y5TB 1FBIL 3K8MA 4ZS7H 4P2RE 4X6CB 4U1KA 3HN3A 5ID0B 5HYFA 3VRIA 4R4FH 1J8HB 2IPKA 5L6YL 3JV6B 4LAQH 4XBPA 5EZLB 2E9BA 3K74B 2M2DA 1KCSH 4WO4C 4PLKC 3WUZA 3DI3B 5EZIL 1C5DB 1M1SA 1N7MH 3L5WB 1I3GL 4X6CF 1RURH 4N1EA 1T1WA 1EMTL 2WUCH 3RIFF 3EDDA 3KJ6H 4XGZB 1EAPA 4LGSB 3DURB 1K4DA 4PRBB 1VHPA 2WBJC 2FHFA 3CSPA 3B3IB 3WFCH 2BVOA 4O4YL 3NACL 1GL4B 1LO0H 3TESA 3TYGL 2AJZA 4OGAC 5AZEL 3H9SB 1IGTB 1TJHL 3IS0X 2OQJA 5CMAB 4X99B 3L1OH 1XR8B 4LSRH 3SDCB 3D2UD 2JCCB 2CRYA 2FSEB 3LKPB 5F7UA 1CICD 5GRJH 3VWKD 1IGFL 1FO0H 2VNCA 3CUPB 3N50A 3UTZB 3L3GA 4KTEH 1C12A 2P24B 4AIOA 3MJ8B 2DWDA 1X4YA 4JY4B 4JFPB 3BMVA 3MTRA 2JCCF 4G8IA 4JRYB 4Z7VA 3JTSA 3WYRA 1DL7H 1NPUA 5IVXA 3QH3B 1NAMH 2BVTA 5C70A 3GJFK 1XGQB 3FT2B 3O2DH 3O3DA 2JB6A 4JG0H 4F7CA 1MVUA 3O8XA 1KJ2H 3GMLA 4BFIB 1NEZA 4HIJB 1U42A 2V5RA 3OKMA 1JZ6A 3TBYA 2YZ1A 4WFEE 1B6DA 1GGTA 2VXVL 1BLNA 1HSBA 1IRAY 5DFWH 1VADB 1RUKH 4JHAH 3S37X 1UXSB 3RY5A 1GOFA 2CKBL 4LASH 1CYGA 5F3HB 3IETA 5AG8A 1G9ML 2BY2A 4EI5D 2O5XH 1YYLL 4ZPTA 2F53A 1BFVH 4QO1A 1J5OH 5D6CA 4WW2C 5E8PB 5TQ2L 5GZNC 4RWHA 4MNQB 2YWZA 4C83B 4DAGH 3QHZH 5LWYL 4ODHL 5DSCB 3VXUA 1XCTB 2XXCB 3ARBD 3OF6D 3G04A 5CZKA 3FQTA 2OZ4H 3ZDXF 2FJGA 1XH3B 3DYPA 2VABB 2JJVA 3NCCB 1WFOA 3BPCA 4XNZB 3FRPA 5IM7B 2WLYA 1X6LA 1FBIH 1UB5A 3GMQA 2Q6WA 4P5TC 3NCMA 5I66A 1LWRA 3BHBB 1CCZA 3KXFE 3T0EE 3QDME 1R3KB 2OP4L 5IHZA 2H45A 4QF1B 4IIQA 4DCQA 4F7MB 5DFVC 4P49A 5EZIH 4Z77A 4JRXA 1I3GH 4TNVF 4ZFOB 3S97C 3PQYE 1EMTH 5K9OA 1EK3A 2DIAA 1H8SA 1DSFL 1Y0LB 4RMQA 3SN6N 2EIDA 5EO9A 3I6LD 3QO0A 3IKKA 1OP5H 1J05A 3RVUD 2P49B 1OVZA 3HE7D 4OV5B 1NH6A 4HWBA 3NACH 4O4YH 3KXFB 5AZEH 3MOBL 4K8RL 1TJHH 5BJTB 4OQ1A 5E00B 1UKQA 1QP1A 1S8DA 3RDTA 3AMKA 1L6XA 1IM3A 4OKDA 3DRTA 2Q7NA 4P2OA 1IGFH 1MCCA 3PQYB 2BJML 4MQTB 4N8VB 4MAYC 3M17B 5CSBA 1OARL 3B9KA 5BS0B 3RY6C 2Z35B 1DQLL 1WISA 4ERSL 5HHME 4QT5B 5IJKC 5FGSA 1TJIL 1K5NA 1BP3B 5I1AB 2FD6H 2XTLA 5DEFA 3RL2A 4MNGE 4UNTA 5I16A 5GSRB 4Q9RL 3P77A 4HC1L 3VRJA 4I48A 2R2BB 3HAEA 3QG7L 2VXVH 4EIZC 3P4NB 1GJIA 3U2SA 4GKSA 1JE6A 2VZVA 3IF1B 4OLYL 3DPBA 4PRAA 2FATH 4HUUA 3E1F1 4DQOL 1NCDL 1G9MH 1U0QA 1CGSL 1YYLH 3CK0L 5CJXA 5FYJD 3OKOB 3V6OC 1R0AL 5I8KL 3MGOA 5TQ2H 1F13A 1AGEA 4HUMB 5GGUB 1KLUA 1T5XA 1YJDL 4ODHH 5LWYH 3DV4B 1KB5B 4O2FB 3TBTA 4FG6D 1QSEA 2X40A 2E8ZA 5DRNB 1KENL 2QQNL 4PG9A 4X7TA 2D0FA 5FYKU 2DLTA 2FEEL 5E4IA 3WL9B 1FORL 3QUXC 4JVUA 4XP4L 1MI5B 2VIRA 2VLJD 4U1LB 4Z7UE 4OD2B 3IAGC 1S7SA 1X5FA 3VXME 3C5ZC 1EBPA 5DLML 1YN7B 2OP4H 1KPRA 1FNGA 4KFZC 1B4RA 1AR1C 4GG6E 4YDIL 5BW7C 3U82B 1YPZA 4FQLH 4WI9A 4ZSOB 1KCUL 3FTGA 3VRIB 4M4RA 5ADPL 2DICA 2GI7A 4E41D 3VI3E 5LGHL 1DSFH 1FVCB 3AMLA 1TZIA 4HG4K 5EUOA 4F7TB 1NC4B 3T2NH 1MCWM 5C3TA 1JK8A 2R29L 3DSNA 4RFOL 2EYTA 3L3HB 2MMXA 3WFHB 3QDJB 4KJWD 2QLVB 4AK1A 1EAJA 1M7DA 4ISVA 1EAPB 2VDOL 3P4MA 1ROWA 3ARFA 4P57B 4TVPE 1HDMB 1MIEL 1UCBL 2CLRA 4PJFE 5ICZB 3QUZD 4LPYA 2FEDC 3OKEB 1Y18A 4NC1E 4Y16D 3GJFA 4HIIB 4EUPA 1QRNB 2BJMH 3WJJA 3VXQB 3GKZA 4POUB 4PRHA 4LIQE 4BUHA 5I9QB 3ZMRA 3PWJA 1OARH 3WN5B 4CNIB 2IEPA 4PJDB 1ZHNB 1A1OA 4PJ9A 5F7NC 5AYUL 4PJIB 4HLZH 4KQ3H 4YFLF 1DQLH 5E2TL 4ERSH 1BBJB 2HVJB 5EU6D 2X4RA 3FL7A 1TJIH 3PWPE 5IB2A 4QHUB 5FKAA 4OGYL 1PG7X 3OKLB 1EXUB 1N26A 3AB0C 2R0LH 3JWNC 5E2VL 4FQHA 4HC1H 1A6TB 4F7EA 4PJDF 4Q9RH 1M7IB 3OZ9H 3SGJA 5EOTB 4PJIF 4U1GC 5ESVB 4XAKE 3QG7H 4DGYL 4HDIB 4JFFA 3LKOB 2F74B 1W72H 2JB6B 4NGHL 4KVNL 1YDPB 3GMLB 1TDQA 4U6XB 1JTPA 2VLRA 5FOBA 1NC2A 3OKMB 1LEGB 5CKAA 4JY5L 4DQOH 1NCDH 1JF1A 1CGSH 1OQXA 1YMMA 3BZFB 1R0AH 3LEXA 3NIDF 5I8KH 3VI4E 4UDUB 1MJ8L 1ITCA 4M5ZL 4FQXB 1U3HC 1OPGH 2NY4C 3IETB 3RNQB 1YJDH 1ZHLB 3PABA 1QSZA 2KL6A 3N1GC 4N0CD 1P4BL 5E94B 3U0WL 2QQNH 4PGEA 3OQ3B 1D5ZB 1KXQE 3S3JA 3CDGA 1AXTL 4PR5B 5TE4L 2H32A 3MR9B 4GKOA 5E70A 4JDTL 5AYQA 1FORH 2GJ6D 4XP4H 3VXUB 3D39A 4WEBL 4Y2DA 2IG2L 4E42A 4D3CL 1I85A 1LHZA 4FXGA 3FQTB 5HDBE 4PTTA 4LHUD 4ORZC 3VFMA 5DLMH 2IADA 1CDYA 4AIZA 1WUNT 4YDIH 5C0CE 3I3EA 3SDDD 2Q6WB 1DDHB 3QHFL 1I7UA 1NGXA 2AV7B 5DDHA 5IG7A 1KCUH 5J56B 5ADPH 1NGWA 2HFFA 4P48A 4JPKL 1AE6L 4JFFD 5LGHH 4KMQA 2ZOKB 4DCQB 1JPTL 2V2XB 3VXSE 4XH2B 3NABL 4G6ML 2R1XB 1FL6B 4KVCL 3X13B 4NUJA 3V8CA 3VH8B 2ICEA 4RFOH 2BSED 2C4FU 5JQ6L 1D5BA 3ULUL 4QHMA 4EEEA 1XGRB 1U8HA 5K9OB 1OP5K 1KCKA 2CIIA 3FO2B 1IGIL 5IJVA 3TN0B 4P4KC 3PDOB 3WUWB 1OSPL 2G5BA 4NN7B 4WFHE 3CC5B 3F7VB 2OYPA 3ZDYF 2BNQD 1MIEH 1UCBH 2EIEA 2AJ3B 3LPGA 3R4DA 3QWOA 1WGOA 4LSPL 5GRWA 4EVNA 3FFCA 5HDBF 3E6FB 4TTDC 4G6KL 4JM2C 4Y1AA 2JK5A 5JHDE 5SWZA 1MFDL 3OB0H 1T04B 3QXDB 1IC7L 5EO0A 4NZDA 4MJ6A 5AYUH 4OF5A 2AS5M 3IDJB 5E2TH 4UNVA 4X8JB 3RWIB 3REVB 5E8NB 1SJEA 4OGYH 3E2HC 4Y4KC 3KLAA 5E2VH 1CFNB 5KANI 4KJQD 4P0DA 4JREC 2A38A 2E6PA 1E27B 1IQWL 3QFJA 1IZJA 4DGYH 2Z91B 3D3VA 5T3XL 3KGRA 1FSKB 1JI1A 2AJUH 3LVEA 3ZYIA 1ZS8B 3CFDB 4B7LA 1Q9WB 3HAEB 4OKVA 3GJEB 3NTCL 2H8PB 4D0CA 1IT9L 2EXYD 2X05A 4DK6A 1MJ8H 2R23B 4ALAL 4M5ZH 4PRAB 1HSAB 5EC2B 4NT6A 2BSSA 3QCTL 5HGBA 4AM0B 1MHCB 3OKYA 4P2QB 4ZG1A 4QCIB 4X7CC 3OJ2C 1P4BH 4LCIL 3BGMB 3U0WH 1JMXA 3VMOA 1AXTH 2FYYB 4ODBD 3IDYC 5TE4H 2J8HA 1ACZA 1LK2B 4JDTH 4O00A 2V9RA 3B2VL 1XF5A 3S4SG 3TBTB 2O61A 4YBLB 4GRMA 4WEBH 2IG2H 2HA1A 4D3CH 4JN2B 2X9WA 1IL1B 3F8UB 1MOEA 3QFDA 3TGXA 2I9LB 1R3JB 1YA5A 1TCRA 4GS7B 2MHAA 4CADA 3VGEA 5JMOC 3NZ8B 1EUUA 1U93B 4FFVC 2ORBL 3OKDB 2DQJH 2BNRD 1HZHL 2LAAA 3QHFH 4LCYA 1T2JA 4LARL 5DJ6B 5IVZA 4JFDE 3ZLQC 1SEBB 1T0PB 2B1AL 5DD3L 2GQHA 1TITA 4JPKH 1XR9A 1AE6H 1JPTH 3QUKB 5F9WC 3DX9A 4XCCL 3NABH 4G6MH 4EQ2A 4KVCH 3F7YB 5MENA 1JZ3A 4IRJB 1FGVL 5JQ6H 3PV6A 3ULUH 5C9JB 3FTGB 3O6FB 1IGIH 1J9CT 4JPVL 1B0GA 1TZIB 1FO0A 4LVEA 3ZZ1A 5IV2A 1OSPH 2PR4L 4HG4J 3CNKA 3BWAB 3UDWC 4CMMA 1T89C 4LCUA 1DVFA 4QHKI 4LSPH 3SDAA 2DIJA 4ISVB 3SE4C 3DXAB 3CU1A 1U6AL 1NFDA 3TH3T 3ARDD 5ALBL 1MFDH 3C2AL 1EFXD 5DTFB 5MHSE 3MRNA 5ANME 4PUBL 1SMAA 5AEAA 3O2DA 1EEYB 1IC7H 5BO1L 4G3YL 3ARGB 1KJ2A 3NH7L 2D0GA 4TUJB 4X4XB 1X6NA 1G1YA 5GGSY 5JLZA 1NJ9B 1AKJB 2IPTL 4X83A 4U1HB 1Z9SA 4RZCB 5K9QG 1KJMA 5FGBA 3DV6A 1YEEL 3PWJB 1FFNA 5DRWB 2W0KA 3TVMC 3NCJL 2OMBA 3TEUA 4KXZI 4R4NC 2F5BL 3RGVD 1BVKA 3MRRA 4MXQC 4NQCB 1IQWH 2NY1D 3L3IA 3V7AE 1JPGA 1ZGLM 2NXYB 1E4XL 5D9SB 1JPSL 5T3XH 5C09D 1TQBB 4IRSA 5A43C 3TIDA 2BSTB 3LMJH 1HXMB 2YUWA 3W9DB 4MDJA 3NTCH 4DVRL 1IT9H 4JY6B 3MV8E 4LLDA 1VGKA 3NIFE 4QKXB 1ZT1B 2Q7YA 1KN2L 4G9FA 4OCLC 1HE7A 4ALAH 4R9HA 2OZ4A 1CWVA 2QQQA 5ICXB 2ZUSA 4QHLA 1SY6L 3TBWB 3QCTH 4L8CB 3D0VA 4ZMAT 3MQIA 3AROA 3JV4B 5HPMB 4DUWA 1G0DA 4LCIH 1KGCD 2FJFB 4GKNA 3TFKD 2VISA 3LQZA 3SDXB 3TF7C 3SOBL 3B2VH 1MCLA 1A4KB 1U8OA 3WNNA 1UA6L 4KC3B 1Q94B 3O6MH 3MRMB 4Q9CA 5BXFB 5EBLA 1ZLUH 2ORBH 1MJ7L 1HKLL 4LSUL 1TQCC 5IB1A 3SDXF 4U1MA 2YD8A 4Y2DB 3CVHB 4OUUA 4KJPC 1HZHH 4R0LC 1A7RH 3JVGC 3RTQD 5D7JA 5E9DA 3KLHC 1WBYB 2B1AH 2FBOJ 1MJJB 2DYPA 5DD3H 4UOW0 5C07A 5IQ7L 5D2LB 4Z6AT 5D1ZA 3SCMA 1K2DA 4IMLB 1FGVH 5DDHB 5IG7B 4PY7B 3BO8B 2L4OA 4YFLI 4ZPTB 2P1YA 2BNUA 4JPVH 4N5ED 4Z0XB 5D2LF 4G9FD 1AD9A 2PR4H 4X98B 3AC0A 2HTKD 3NCYS 2RJMA 1H3VA 3PGCA 3RUGB 4ZXBA 1VPOL 3S35X 3D69A 3JZ7A 2FGZA 2CLZA 3Q5OA 1U6AH 3T0VA 1KIPB 1OGAE 5ALBH 3C2AH 3OGCA 4NNYA 4PUBH 3MGAA 5BO1H 1BIHA 4G3YH 3ARPA 3OBAA 3NH7H 3ES6A 4NO0D 3BDXA 5GGSB 1AH1A 3Q5TA 3RUGF 4H0HB 2GSIB 1FLTX 4NKQB 1QSVA 2IPTH 3U46B 3BZ4A 4IHOA 1KNOA 1LVEA 4LU5L 1YEEH 4PRNB 4WUKL 4IDJL 3NCJH 1ODAA 2GAZB 1HKFA 4NPYA 5ETUB 2F5BH 2I27N 1XCQA 5I1JL 1E4XH 2NY6D 2QKIB 1JPSH 5IFAH 1D5IL 1Q72L 5JOFA 1SJEB 5DD0L 3TZVA 4M6NL 4PBWD 4NQEE 2K3TA 2NPLX 2OM5A 3KPPA 5DZOA 4APQA 4NQVA 5C07D 5C0DB 3O8XC 3GSXB 1WCBB 4NNXB 1DE4A 4MHHG 1P7QB 4DVRH 3GMOB 4X4YA 2ICCA 4LLWB 2XKSA 1EGJL 4N9GB 1KN2H 3LKNA 4R7NA 1VACB 1GVIA 2QSVA 2W65A 4O9HL 1DN0A 5KVGH 1SY6H 2B4CL 3ZSSA 4JEGB 3AM8A 1XGPA 3QDGA 1UM4L 1RUAL 4D0CB 3F6IA 1ULVA 2EIZB 1IC5L 1Q9KB 3G9AB 4C56E 4TNWF 1KJ3L 3SQOL 2W0FB 2ARWA 5FA4B 3FRUB 1NFKA 3DUUB 4M8QB 4NQEB 4C55A 4LVOB 4NT6B 1F6AA 4F37F 3SOBH 4OLUL 4I13B 3V5HA 4ODWA 1UA6H 2EDJA 4L8SB 5DA4A 4LCWE 4X5WA 3UTTA 4JGMA 3OX8A 4TUOB 3HMWL 3WMSA 1ES0A 1KN4L 4LSVL 1HKLH 1MJ7H 1XF5B 2FLBT 4LSUH 2XY1A 4KKLD 4CN4A 1HHJB 4JCMA 2ZSVB 4UOW1 1RHFA 2DF3A 3V6OE 5F1IB 3O3AA 3ZYJA 3HB3C 5IQ7H 1QBBA 1BVLB 4D0BB 3JUZA 1WZ1L 1DUZA 2E7HA 2YA2A 2DJSA 3IJSA 4IIQC 4LCYB 2XZQL 4ONGL 3FQRB 4PJGA 3RWGA 1A3RL 5E0QA 3DETC 5JXEA 2RFXA 2JJSA 3GMNA 3OMZA 2XACC 4YGAB 2LAGB 3FRPG 4LFHD 4NQDB 1PQZA 5HHPB 1JNHA 1T22A 5C2BL 5F7HA 3MV9A 3IDIB 1X3DA 2C5DC 3OJVC 4GAYA 1Y6NR 5GISL 5IV2B 1KLFA 3VWJD 5JOPE 5F6IB 5IMKA 2LV4A 3EHBD 5HYIA 4LCUB 2I07A 4OFPA 3RJDA 4HC1A 3BZDA 2P5WE 3RDTC 1BQUA 1QLFB 1UYWL 4IOIA 1MRDL 3I6GB 1SJHA 1IVLA 2EE2A 1EH9A 3AXLA 4P2OC 4MJIB 4LU5H 1OSZA 1LO3L 5ABDE 4NFCA 5FF6A 4WUKH 1W72A 4IDJH 5I1DA 3AY4A 3HZYA 4S10A 5DJCB 4OZHA 2QHRL 4YDKL 3HRZB 3B9KC 5GIRA 4FFZL 5T33L 5I1JH 3ZKMD 4LF3A 4LNRA 4XVTL 1D5IH 1NBZA <