1ZWIB

Structure of mutant kcsa potassium channel
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
212
structure length
212
Chain Sequence
b'DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords monoclonal antibody, heavy chain
publication title Molecular determinants of gating at the potassium-channel selectivity filter.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/ion transport
total genus 47
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zwiB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zwiB01
5DD1L 2K3TA 4N8VG 2JIXD 5DJXB 1BD2D 3DTXA 3QPXL 1NMBH 5INCA 4IIQC 4OI9A 3SCMB 4OLVH 3CSGA 4MQTB 2A1WL 3NAAL 1I1AC 1R5VB 2CRIA 4LRNH 4N9GA 5I1KH 3MJ7B 4JFQB 5LCVL 5D1ZD 4OCRL 4JZOA 5K59F 1L7IH 4MJIB 4YAQA 4XVTL 1QLRA 3HPJB 3HC0A 3ZDZE 3KYKH 4LSVH 4KVCL 4X6DF 1LVEA 5DJ2A 2W9LA 4F9LC 3ZT6A 1XCQA 4D0DB 2AV1A 1GZQA 4RMQA 4PJBE 4L29B 1EBPA 4LKXA 4ZD3H 4PP1C 1YJDL 4Z7VE 2C4XA 4JREC 3IDIB 2R0LL 2OBGA 3VGBA 2QR0B 4KK5C 4LBEA 2XV6B 4OIAA 3VXME 2H26A 1IC7H 1WCBB 5IHLB 3V5HB 1I7RB 4U1KA 1HHJA 5DJAB 1CE1L 1HKLL 1I1YB 2RAMA 4U6VL 2NY2D 1EO8H 5ISZB 3O3BB 5J1SC 3KPNB 4HMCA 3MOBL 2MWCA 4K3DH 3VFUA 4Q9CA 3F6LA 2EDEA 1Y18B 1HHHA 1FNGB 1N6UA 2E7MA 1BD2E 4JCMA 2DBLL 2X4PB 5I30H 1KEGH 5BV7L 4EQ2A 1J7VR 3ARGC 3FQXA 4LGRB 1A2YB 4XHQA 5E4EC 4EDWL 2EKJA 1VEOA 3ZTJG 2AEIT 4UT9L 1ETZB 4QHKI 3EFFA 2W65B 1CL7H 2IH1A 1HWGB 2IPTL 2VITA 3BAEL 4JVUA 2OI9B 2BVUA 2BY1A 1LE5B 1HOCB 3UTTA 3RVTC 4G7YL 4PREB 4MQXC 1MHHB 4XNMA 4XVSH 5JA8B 3R1GL 3TWCH 4JDZA 2OMNA 4XVJL 2AABL 3H9ZA 1XCTB 2XZZA 3ZTNL 2YRLA 1YY8B 2QSCH 2A83A 3GBLA 2NMSA 4K8RD 5C0FA 4ZTOL 1RZFL 3P4LA 4EDXB 1XGRB 4GBXC 4P2QA 2ED9A 3W11D 3TPKA 4OLWL 4MCYB 5D72L 1YNTA 1Q0YH 1EH9A 1ZA3A 3MLRH 3SDAB 5EBMB 1J0KA 1CDCA 5ETUA 2G75B 4PJHB 2ERJB 3PXJA 1EFXB 1RZJC 4X5XA 3PGFL 5JDSA 2WWKO 3SGEH 4LPTA 3OKLB 3FN9A 4OCSL 4PRDA 5FGSA 2H2PD 1QSFB 4JHAH 3MLYL 4Z7QE 1RZIA 2DQFB 2K9UA 1BBJB 4GRWF 1UYWH 3O6FD 3GSXB 4JB9L 5C6WH 5E6IC 4WI7A 4OFIA 5FDWA 4LNRA 3FQNA 3PWLB 4PJ8A 2R9HD 4G5ZH 4L8CA 3O3DA 4OF0A 3VXSA 3X3FH 1P4LB 3MV9B 4I18C 4GH7B 4I0CC 4MX7B 2UWEA 3VFVA 5GS1A 1ZGLB 3RL1B 2V9TA 4AMKL 3C87A 4LCWD 5EU4A 4FQJH 3FQWA 3MRPB 4BZ2L 1BQHB 1J0YA 4QRPD 3ULVH 5BRZB 3WMSA 1KCVH 4M7KL 5IB1B 1U8OA 4GKOA 4K7PX 5EU6A 3TO4D 4D9QE 4D0CA 1CR9H 3LN4B 1U8IA 1IM3A 1KELH 3MRHA 4RAUB 4IRJB 1IAMA 1A7NH 1QFUH 5HBBA 5DVKA 3WN5C 3DV4B 4NJAH 4O00A 1GIGH 4GRWE 1R0AH 4JPIB 2F8OA 4QKXB 1H8NA 3QJHB 5KZCB 3EOAA 2OYPA 3MACL 1R3JB 3BP5B 2IPUK 1X5AA 5J3HD 1H3GA 4HWBH 1W0WB 5DRZB 4ENEC 4NKQB 1N5AA 4NQVB 2Q87A 2ZOLB 5IROC 3CFEA 2OTUA 3V5DB 4Y2DC 3VFWA 1EA9C 5T1LB 3HMXA 4I2XE 4JFXA 3RDTC 4W6WB 3WUWA 4F2MB 5JPNB 4KJQD 4WIQA 2HTLC 4DN3H 4PJEA 3CC5B 5I9QB 3O41A 2A6KA 2A6JB 1EERB 3LIZH 4ZNEA 4M5YH 1T7XA 4F7TB 2VDMH 5DJDB 4LCWE 1VGKB 5HI3C 3UAJC 1N3NB 4JDVB 4P2RE 3BKYL 4JHBA 3FOMB 3H0TA 5B21A 4QRPE 1QFWH 2VN4A 5DQJA 3SDXB 4Z0BH 4G6ML 5EO1B 4E42A 4TQEL 4HS8L 1HSBB 1BFSA 1M71A 3MGOB 4F58H 3U9PL 1HQRA 5DUMH 5DZOA 1CDIA 3OAUH 2ATKA 4M43H 2CDGB 4W81A 2AJYH 5K9OB 1MHPL 2FECL 4AZ8A 4WW1B 2Q7YB 1DUZA 1ZWIB 4NZDA 5KSUA 3MREB 3JSSA 5CLTA 3CVIL 3TZVB 4FQHA 5DVMA 3O2DL 5B8CA 3N1GC 2HVJB 5J9PB 2V9RA 3MNZA 4EN3C 3QUXC 3BSZL 4LMQI 3RWFA 4ZUSA 3OZ9H 3C5SB 5JMOC 3B8SA 1DBAH 4PYHA 3GO1H 1FAKT 1S78C 1DBJH 3NFNB 1UENA 1I3VA 1BQHG 1GC1H 1U8HA 5CJXC 2XTLA 3MRBA 4EUPB 4HUUB 4LP5A 4JO3H 2NY4D 4YDLC 5AZEL 2FEDC 1OAYH 2R8SL 3THML 2Z8SA 2XRAH 1B4JL 2OSLA 5TDOA 5IQ9B 2L7JA 4AT6B 5IM7B 4JLRA 1XGYH 3HKFA 2E7CA 3IFPA 1ACYH 4KQ4L 3SGKC 4POYA 3OHXA 4XCNB 2PNDA 1AHWB 4OLYH 1T0NA 1E4KA 3ZYJA 2KKQA 5E2TL 1XF2A 1TVDA 2ITDA 2F5AL 3E6HB 3PHOA 2OL3B 3DO3A 1BGXL 4NN5C 3PGDB 4FXKB 1ZEAL 4WTXA 3RTQD 1WTGT 3BIBX 3BWAA 3TM6A 1UQSB 4Y5YA 4XBEL 4P5TC 1CDHA 2R0WL 1KLUB 4J3WA 4HF5L 4X6CB 7FABL 1WBXA 3O3AA 3L3OB 5IIEB 2MCG1 2ZUUA 4XCEA 1AFVL 1B2WL 1IGFH 4JPVL 4NC0B 1X6LA 1DN0A 4PJIB 3KWWB 3RZCC 3SJVA 2XWJB 1H3XA 3WJJA 1YMMB 4QOKD 1MRFH 2VAAB 3VXRB 3S36X 1EHLH 3S35X 1DLFH 5I76B 3D48R 1KPRB 1KBGH 1M4KA 4YHIA 1A6TA 5EO0A 3UMTA 3BH8B 3FN0H 3FT2B 5CP3H 3VXTB 5KJRH 1EEUA 2X40A 4P5KA 5DJYB 1INDH 4F7PA 3TBYA 4DGVH 2H6PA 3RVXD 3GIZH 1QR4A 1CLZL 3QQ4B 4F8TA 2HYMA 4OZIF 3MRGB 3Q6FA 1Q9OB 3VGFA 1XMWA 5EZIL 3WO3B 2PO6A 4UBDD 3QBTB 4NO0A 3VG0L 1UH4A 5BXFB 3RY6A 3CIQA 2EIDA 3M17B 3S96A 5ID1B 3WEXA 1A7OL 2X4TA 3OXSB 5DQDL 5AAMA 2CLZA 2DI7A 3LEVH 3I6KA 4EUPG 3QO1B 4D9LH 4ZTPL 4MXVF 2Y36H 3QNXB 3B43A 2WUCL 2VLLA 5E2WL 2Q6WB 5DRXB 1CBVL 3CMOH 4O4YH 3ARDA 3E0GA 2XT1B 4WGWB 4QOKE 1NGQL 3BZFB 5IFJB 2CUMA 4NCC2 2KDGA 1DBKH 5T3XH 2HFFA 1KFAL 3JWOH 5IFAL 5CEZH 4QHNA 3VD9A 3FO1B 3ZSSA 5CZXD 4OGXL 3V95A 1CFSB 1E4XL 3C60A 4CJ1A 4UIMA 5ALBL 5FCSH 4YPJA 1S9WA 4RBPK 5I8KH 3GSNB 1WC7A 3U7YL 1CVRA 4ONGH 5IF0A 3BIKA 4PJXE 1FVEB 4LDEB 2CO6B 4Y5VC 3REVA 3BPLB 1ZTXH 1HYSD 3S88H 1T66D 5FO7B 4NUJB 1MI5A 3ZKNC 4MXVE 4L4VD 4XNZC 3F7RA 4Y8AA 1B6UA 1G9EA 1MFCL 1XR9B 4MNQA 2YC1B 5GISL 1A3LL 1YJDC 4ZFFA 5E00A 3HC3L 1JE6A 1OAZL 2FX7L 4LDLB 1YYLL 5D1QB 5DJ6A 4DVBA 2Q3AA 1TQBC 1GC1C 5F9DC 1FCCA 5FYKL 4WFED 3MLPA 4P9HH 2F5BL 2PYED 3U0TB 3BD5A 3RGVA 2G2RB 1N26A 5CILL 1MCOL 3STLA 2BZDA 2WP3O 2IAMC 5E4IA 5GS0L 4PBXA 3IDYC 4Z6AT 5JOPD 4P23B 1NCCL 2DS4A 5DD0L 1BQUA 4DK6A 4OCLC 2FEEL 2D7PA 5BV7C 2P43B 1KTKE 4GT7A 4YC2C 3OAZH 1D9KB 2LU4A 4LVHC 4MD0A 5E8NA 3MLTA 2VZUA 3SQBA 2FD6L 4H0IA 3EDKA 1MVFA 4Y1AD 2O5XL 2VABB 5CSZA 2IFFH 5D2LB 4P2YA 4KQ3L 3V79C 2ZUSA 3QI9A 4RX4D 3DVNA 1PKOA 4Y4KD 3QXWA 1UM4H 2ZPKH 1IKFL 1A4JB 5E0QA 4LHJB 2R2CA 4L4VE 4HEME 4RGOH 3MXWH 4H8WH 5HSFA 2AXGA 4OZGA 4EI6A 3BIAX 3HCVB 3IDXH 2IQ9H 2QQLH 2J2ZA 1CICC 4XZUA 4XNYL 1MCSA 4PJFB 1TTGA 2MHAB 1LK2B 2AJZA 2BSRA 4C56B 1QBML 4AIOA 4IDJH 1EX0A 4FQCH 3HAEA 4WFEE 3ILPB 1G0XA 3C9NA 1GJIA 2L7UA 1XGQB 2PYEE 4DUWA 2NY6C 1S7SA 4K7FA 1D5IL 1TDQA 3SDCC 1SY6H 2FX8H 2HLAA 4AJ0A 3GIVA 4X7TB 5JOPE 2P1YA 1NL0H 3CLFL 2G5RA 1QBLH 1YEFL 4NNPH 3IJSA 2Z35A 4GG6F 4BQ9A 5FO8B 3RY4A 3IDMB 3EOTL 3GSWB 4HS3B 3H3PL 3RY5A 2C1PA 3QUZC 4HKBA 3VFTA 2V7NA 5JMRA 3AXLB 4NBYB 1FL6A 4CNIA 2RFXB 5CIPA 5TDPB 1OARL 2ICEA 1EFQA 5HHOB 25C8H 4S2SB 5D1XA 2P45B 1N0XL 3CUPA 1ACZA 1T04A 4DKFL 2IBBA 2J8HA 1YN6B 2FBOJ 4WHCA 4LCYA 3IDGB 3ZMRA 3VJ6B 2EDYA 3LSOB 5C07A 1EEYA 1EEZA 4U1NB 4YHNB 2P5EB 5FXCH 2Y23A 1NAMB 3JWOC 5JW4R 1KG0A 2QADD 3ZYIA 5DK0A 1CFTA 4E41D 1WBYA 3C08L 3MODH 1JF6A 4JY6B 5T1KA 3BE1H 3BYYA 1MCNA 5FM5M 3X13A 4P99A 3ETBF 4G43B 5HI5D 4F15C 1H8OA 4JZJA 1P2CB 2VDOL 5JQ6L 2X44D 5J6GB 2AV7B 4POZD 5GGTL 4HC1A 2EDJA 4I5BB 3VFRA 4MA8L 3T8XB 1HWHB 1QA9A 4WW2A 3MYJB 1ZVYA 2EIZA 4N0UB 4XVUC 4NQED 2BY0A 3TEUA 1CS6A 3V6ZA 3HPLB 1BECA 4KTDH 1T5WA 4KJPC 2XPGA 1FYTD 4WI2A 1S9YB 5HI4D 1UEMA 1W2KT 1JTOA 3DVGB 1NC2B 4G3YH 4N8PA 4P9HC 5TQ2L 3HFML 4RFOL 2L0DA 1BQSA 2AK1H 4HSQA 1RIUL 4NRYA 3NCCB 4X4ZA 1DVFD 4JDTL 4H20H 4JR9L 3NIDE 3P30H 4Z7WA 2ESVB 1AGDB 3T2OA 5SWSD 3KPRE 5EG6C 1KV3A 3NCMA 1SYSB 3QG7L 3TV3L 1DFBH 1AD0A 3MCKB 2VZVA 4X0KB 5KVFL 1U3JA 4E41E 5EPMA 3MGTB 1FFNA 4Z7OE 3QQ9C 5HHNA 2NY3B 3VW3H 2FB4L 2Z91B 2VKXA 4PUBL 5IP4A 1ORSA 4YXLH 3G08B 3L1OH 2E27L 2UYLB 1HE7A 3NPSC 1A6ZB 2NNAA 3CJJA 2JF1A 3OAZK 5M94B 3P73A 4G6FB 4JKMA 4QXTA 5F96L 4G6AD 3T0EB 1RJCA 3G5ZA 2XZCL 2NY5H 4F7EA 3JTTA 2XQYK 4PLJC 1PEWA 3K1KC 4NQEE 2A9MH 4HPOH 4G9FD 5I1EH 4Q9RH 1U8LA 2X70B 1FC2D 3IU4H 1SJHB 3MV11 3HI6L 5EH1A 1CFNB 1I1FA 3VXQB 5JZ7D 5HHMB 2HLFC 3LQAH 1L9NA 4XPBH 4K7PL 1A9BA 1C5CL 4B50A 1R6VA 3W0WE 3HI5L 4M7LH 4TUOA 1ZVSB 3S8WA 5LQBH 3O2WL 4M5ZL 1HILB 1LDPL 4OD2A 1MLBA 4JKKA 5SWSE 5GRWA 4MD4A 2AGJH 4RAHA 5FKPB 1CGXA 3D6GA 3HZYA 3CFJB 3FFCD 5E2UH 1IQWH 1P1ZB 1S7QB 1K4CB 3C5ZC 4OJFH 4AG4H 3HZMA 3PWVA 5HD8D 2EH7H 4FXGA 4JFFA 4ZO6A 4NKMA 1CFQA 4PS4L 4XB7A 5IVXB 5MEQA 3NZ8B 4LSPL 2BVOB 4M4RA 3I3DA 1QSEB 4LIQL 4LLUA 4CU6A 4Z0XB 4OKVA 4V1DD 2DTML 4J3VA 2NTFA 4P2OB 2B1HL 1C12A 4DGYL 4WWKB 1KIRA 1CLOL 5IW6B 3ARBA 3QIWD 4FQLL 3BP7A 4G8GD 4OCWH 3QUML 2JE8A 3GFUA 1YY9D 3W82A 2FATH 2FX9H 4IS6A 1UM5H 1LO5B 5D6CB 3TT1L 1P6AB 3D0VB 4RDQF 1QQDA 3Q3GA 1V7NH 3I50L 3MBED 3NTCL 1T5XB 4RMUA 4JM2A 3Q1SL 4UUJA 1ZLSH 4NCDA 4J4PC 2OTWB 3UEZA 2J88H 4XXCA 3MCLH 2E7LA 1R5IB 4MQ7B 1LILA 1PGRB 1K9TA 4IRSC 4ORGB 1MHEB 4OLXH 5I1DB 1P7QD 4G6JL 1D5ZB 1ADQA 3UROR 2GFBA 4NQSB 4LLQB 3KGRA 2WBJC 4LPUA 4HUVB 5DC0A 2VXQH 2YS4A 4IRZH 2W0FA 1GGCL 5DD6B 2D7NA 4LSRL 3SY0A 3BKJL 3PL6D 3FFCE 5E9DA 5HHVL 1B9ZA 1MJUL 3GSQB 1IEBB 4Y2OA 5GXBB 1FJ1A 1HNFA 4U0RB 3IGAB 1J8HD 3E8UL 4IHOA 2HRLA 4NQDB 2D7MA 5KS9F 4RMWA 3IVKA 1KJ3L 3QDMD 1DQJA 1T7ZA 3CPLA 3QFDA 4U3CA 5I1GH 4V1DE 2DD8H 1AGBA 4MAYB 3FTGA 2R0ZL 3SKNA 1JTPA 1FVDA 4OZHA 3UO1L 3CX2A 1LO3H 3UTQB 4FXLA 5ICYB 3VRJB 1FG2A 3T0WA 3DMMB 3L3DB 5EDXA 2W59A 4YGAB 2G60L 4WU5B 3B5GA 3MNVB 1GGBH 4BFGA 4QLRA 5C0ND 3BP4A 2F54D 3D9AL 1M7IA 1BOYA 1B0WA 4GXVL 1EAPA 3L6FA 1KPUB 4M6ML 3JVGA 2NX5D 5JHLL 1N8ZB 3K4DA 1SM3H 4ESKA 5AZ2H 4E5XB 4M8VA 5KS9E 1CFBA 3O4LB 5EIIB 3WKNA 5FHBH 2Y6SD 4H25A 4TVPE 1MF2L 2V5YA 5T3ZH 4OCNC 1F4AA 2AJXH 3QRGL 4U1JA 3OGCA 5IMLB 2GJ6A 2VH5L 4WEUD 3DXAD 2YK1L 4HFUH 5A2IH 3V4VL 3G6AB 2IH3B 3IXTA 3QUYA 1RZ8B 4KKAD 3IFNL 5JIIA 1NDMB 2P5WB 5HJ3B 4FZEH 2R1XB 3QDME 3F5WB 3NVQA 1IC4H 3EYOB 4X7DC 2F58L 4PBVC 1ZLWK 4R2GC 3O4OC 1UCBL 3JBG7 5LWYL 1FHGA 3SE9H 4JGMA 1G1CA 1O0VA 4OIIL 2FJFA 3J7HA 2WBKA 3UJJH 1SEQL 1CT8B 4PGCB 5HYJB 3HA0A 3KR3L 3QNYA 5D7SL 5HXMA 2F54E 5DSCB 1O7VA 4PJGB 2NYYC 2ADFL 5EN2A 2CJUL 2OJZH 2YPLD 1KF9B 1ZS8B 4ODTL 3T2QA 2NX5E 1JPGA 4Z7UA 4OLZL 2EDKA 3FHAA 4LPWA 1IBGH 4O2EB 2HMID 2GK0A 5A2JH 3SO5A 2YWYA 4Q9QL 1QR1A 1ZSDA 1J0HA 4ELMB 1TJHH 1I3UA 4X4YB 2ADGB 2WV3A 1HXYA 3MLWH 5C0JA 4FFZH 4I3RH 4BSVB 5EU7C 5IB3B 3IETB 3DXAE 5HHQA 1PAMA 2HFTA 3WXVL 1O5DT 3K46A 4HUMB 3HMXH 1MEXH 1TQCC 1BFVH 2P46B 4W4NA 5L2KB 4LHUB 1T0PB 1HH9A 1T4KB 3GJFB 5KSBE 4QXUH 4I4WA 3T3ME 2V2TA 1BZ9B 2CSPA 4ZO7A 3KJ6L 3MBXH 5A3ID 5GGVL 5CEXB 5DGQA 5JW4N 2ATPB 1ES0A 3QUKA 4U1HB 1E4JA 1KJ2L 3ZHKA 3QRFM 3HRZB 3MRQB 4XP1L 5DO2C 4EVNB 3LB6D 2W60B 1DQML 1IGCL 3GI9L 3BDYH 3IS1X 2H8PB 4XCFH 1L7TH 3MGAA 1E27B 4KRMB 1JHKL 4XGZB 3MRNB 4ZXBD 2YPLE 1KB9K 3WFEL 3HI1A 1NC4D 1NGXB 5DR5H 2BDNH 4G9DA 4KUCD 3VFOB 3VD7A 1BP3B 4OAWB 1I8IB 3EO0A 4HHAA 3SN6N 4HIIA 1DBBL 1T22A 4L8BB 4QWWD 5CAYB 4GW4B 1I7TB 2GJJA 5ESQA 4PJBA 1KPVB 2Q86A 4JHWL 3NCYS 3NA9H 4PTUB 4YH6A 4Z7VA 2E5EA 3G5VA 4NN6C 4TTDD 3PDOA 2MQCA 4DOHE 3QT2A 3VXMA 5JO5B 2PXYD 2BOBB 3ZO0A 4HXAL 4NM8L 2FGWL 4JFDE 3HE7B 4X7SH 3LMJH 3TBWB 1WSST 1I7ZB 5MEOB 5LAXA 3DO7A 2I9TA 2WWKT 2BHUA 3QIBD 1U92A 1A14L 5E99L 1DUYA 2E6PA 3UZQA 2JIXA 1BD2A 2F53B 5C6TH 1HI6B 3U0WL 2Y06L 3FT4A 3PV7A 2R2EA 2HWZH 4KVNL 4FQIH 3BN9C 2XKNA 1OAUL 1U3ZA 4MAUH 5IHZB 1JMZA 3QEGL 4R96A 5D1ZA 5FKAB 2GW5A 5HGHA 1FPTL 5HGBA 3BKML 4ZUVB 4DEPC 1FE8H 4LHUG 5BVJA 1NCDH 1NGPL 5I74B 1IC5L 1WCQA 4L1HA 1KOAA 3GSRA 1DQTA 1NKRA 5GS1C 1RUKH 1M6OB 1YDPB 1MH5A 1XF1A 4S1QL 3VWKD 1A6WL 3MJGX 4MNGB 3MA7B 3SGJC 3VXUE 2HH0H 4JREB 5I6XC 5FV2A 3OG4B 4APQD 3WFHB 4NHUA 1QFPA 1KXQE 3X11B 4LSQL 5F7UA 4Y4FD 2Z92B 2ZSWB 4X6BA 2VSCA 1LGVA 3GBNH 4JPWH 1W72B 5EIVA 2IBGA 3LAFA 4EKXA 2R69H 4LEOB 4OFDA 3N9GH 1IGIL 1DJSA 3Q5TA 3WL9B 5CZKA 3VDCA 1CG9B 1EJOH 1WQVT 1NLDL 2A6IA 1EFXD 1TITA 5DK3A 4N0RA 1I3RA 3DSFH 3ARGB 2W92A 3B9EA 5E4EB 3AU1B 1U91B 1NSNL 3QDHA 4FG6C 1U2CA 1XF5A 4JJ5B 3BZEA 3FOLB 1FZOA 3ZL4H 4KJYB 3D5OF 3VD5A 1RJZB 1NBZB 1UKQA 4LASH 3RX8A 2NY7L 4OQTL 1OOAA 1L9MA 2E9IA 4PJHF 1J8KA 1X5ZA 2O5YH 1S5IL 3GMNB 3L3HB 4XPAH 4LARL 5JHDD 3PV6A 3QHZH 5KSVB 5JW3H 1EUTA 3PWJB 3QIUA 3AS1A 2KUTA 2XQBL 5J4MA 3P9LA 1JZ3A 4N0CD 5IK3A 3WIHA 4U2YA 2YZ8A 3H2WA 3WLBA 3TBSB 4GBXB 1I4FA 3RA7H 3TIEB 5GGRB 2G5BB 2BJMH 4IRJD 5E24E 5HHXL 4RGND 1YA5A 4NRZA 4KI5C 2SEBA 1K8IA 3MLUL 1AR2A 1AXSB 4R90L 3U0PA 1GSMA 1S3KL 4M8QB 3QEUA 4N5EC 5C0AB 5FYJH 4PJHE 2JK5B 1FO0L 4GLRI 4I2XA 5C0GA 5SWQB 5B8CC 3UJTH 5LGHH 5E6IB 2Q7NA 5E5RB 1XR8A 5FFLA 2O5ZL 4H1LB 1IJ9A 3BWUC 4M1CD 5CGTA 5TE6L 4KK6D 1SYVA 1YEEH 5BS0B 4HK3J 4XCCH 5DLMH 2VXUH 5FF6A 4LCWA 2YD8A 2V5RA 2OK0L 2A9NL 4P2RA 1IKNA 4F37K 1U93B 3G6JE 3MRRB 3VA2C 2IALA 4QRPA 4GRMB 2JCCB 3A0OA 5JHDE 1OSPL 3TO4A 4OFPA 2CKBB 4HWZB 2XG4A 3EO9H 3RKDC 2VISB 3HG1D 1II4E 3REWA 5JR1L 3WN5B 4X9HA 5LGJB 1OAQL 1Z0NA 1XF3B 4IM8A 5J7CC 1AGCB 4RGNE 3CDCA 3VFSA 5AD0A 2AEPL 3KJ4C 4U6HA 5J56B 3CNKA 1I1CA 2VZTA 1ZLUK 5DGRA 3JTSB 3LH2L 4HIEB 2B7DT 3BZ4B 3ABZA 1T1XA 2IANB 1EHXA 4LVEA 3SDXF 4L1DA 5ID0B 1SEBB 3B4NA 1DQQB 4Y5YC 4QTIH 5HDQH 1T03L 2EIEA 3OWEA 4EI5D 3RDTB 3O9WA 4RRPG 1S8DB 1R3KA 1FFQA 2CK0L 1JNLH 5EOQL 2C9AA 2Y4SA 3QXVA 1X4XA 4RQQB 3OKNA 1FN4A 4Y4HD 2NR6C 1KYOJ 3H9HA 3R0MA 1T1ZA 3WJJC 2X4QA 3CD4A 3HAEH 2ADJA 5I66B 1KC5L 1FLRL 2OR7A 4X80L 4ZUWA 1MCBA 5IB4A 2BRRH 5ICZA 1MAJA 3RWEA 4DCQB 4JKLA 1MFAH 1Z2KA 3W2DL 4QY8B 2GCYA 3HG1E 1N5YH 4QRRD 4FA8A 2VYRE 3CXDL 4PRAA 4JFHD 3MRDB 4XP4H 3OKOB 5GRJL 4HXBL 5IESL 5BJTA 2QQKL 2B39A 1P9MA 5EC2B 2OZ4L 1AKJB 4JEGB 1A1NA 5FYLL 5I19H 5DMGC 1VPOL 1HHGB 3SEPA 4H1LG 1CTOA 1VFMA 2JJSA 4P3DA 1PKQB 3SDDB 3RY6C 4ONFH 2QHRL 1RFDL 4EN3B 1G9ML 1RUMH 2YEZB 3KYNB 5I1JH 5CIPH 2IGFL 2QQNH 3DI2B 4GXUN 5T33H 4ZSOE 1CK0L 3UBXI 5BZDB 1ED3B 2BOCA 5I8OH 2BNQB 5F89A 5HDBF 2IPUG 3V7AE 1P7KA 4CVXB 2Z8RA 2C7UB 2EO1A 1RV6X 1VEPA 2WLYA 5FHAL 3EZ8A 3IF1A 2CQVA 2F74B 4MNHB 4HJ0C 5DYOA 4O58L 4X6CF 2YRPA 1R3HB 4XNUH 3ARFD 5FV1L 3CVHB 3C60C 1CN4A 2GITA 3QCTH 1TMCB 4R4FH 4QRRE 3BP6B 1C5DB 4PJIF 1RI8A 3BXNB 3QCVH 1JGEA 2CIKA 2YKLL 4JFHE 4LCUA 2DBJA 3ALPA 3IXAB 3PIQB 4NN5B 3S37L 1NBQA 2WUBH 5GHWH 2WIMA 3P4MB 2OQJB 5DMIH 4QRQB 4LEXL 1FFOA 1TJIH 2GY7B 5DJCA 5IT2L 4AEHH 2M1KA 4HC1H 1DL7H 5DXWA 3DUUB 5KVEL 3FCTB 3E3QC 3MJ9L 4PV8A 2WP3T 2GSGA 5EA0L 1A22B 1UT9A 2DQDL 4XNQA 4QOKA 4ODVL 3V6BR 3NCFB 1Q9LA 1F2QA 4BUGA 3N85L 1CQKA 2BVYA 1QBBA 5HYSB 2R0KH 3PWNA 5DHYA 2H9GB 5GIRB 3NABL 4XPFH 4KZEH 4UTAH 3EJJX 1D5XA 1EGJA 4PJXA 2GJZA 2N56A 5IEKB 4PRPD 3TNMB 5F71A 4XTRD 3EDDA 2VLKB 3LRHA 1LO4L 3UBXA 3CH1B 2B4CH 1CZ8H 4YWGH 3IFOB 3LKPB 4WVRA 4D0BA 2B0SL 2C4FT 3WDHA 3U6RA 2ZSVB 3QI9C 3RU8L 4XPHH 2P47B 3GGWA 1DANT 4RMSA 1I85A 4HUXA 4Z7NE 4J6RL 1TVHA 2JB5H 4NNXA 3GM8A 1JZ4A 1A5FL 5I2IA 2IMMA 3BAEH 4RFNC 5E08L 1H8SA 4ZDHA 3VWJB 4BK5A 3ULUL 1RK1A 4H5SB 4D9RD 1LO0L 2FL5A 3GJEA 1A6UH 1V7MH 1CVSC 1UA6L 4HUWA 5E2VH 1CLYH 1JPSH 4KKBD 4NP4L 1J5OH 3LPFA 2HG5B 2XXCB 1CWVA 2R1WB 4HH9B 5F21B 2R29L 3QYCA 1NMAH 1JI1A 3GDBA 4M48L 4PRPE 1MELA 2C4FU 3D69A 2X1QA 3OJDA 3GMQB 4RWHA 1DANU 3EDFA 1CGVA 2XI9A 3IDJA 5JXAL 4L4VA 3DETD 1V5JA 1MAML 4L4TA 4KTYA 5HY9A 1UCTA 1A1MB 4S1RL 3BPCA 2EKSA 4XNZB 1RVFL 5SWZB 3GB7A 3UXFA 2LU3A 7CGTA 4J3UA 1DQDH 4PRIB 1UWGL 5IMKB 4HIXH 3MYZA 1PJ9A 1AXTL 1R5WA 3RWDA 1YN7A 5GRYA 3OB0K 5F9WC 5TF1L 5D1XC 4U6TA 3NBNA 1TQBB 3M8OH 2DL9A 2PYEA 3PWPB 1A7BA 1J86A 1MFDL 4PTTB 5D2LF 3E2HC 1EHNA 1JGLL 1S7WA 1FVCB 4DKEL 3V7AG 3EJYD 5HYSG 1TCRA 4R9HA 4D9RE 2ED8A 4X5WB 5SV4A 4CVZB 3DX8A 3OKKB 4P59L 1KT2A 1WIOA 3IDYB 4PJ5E 3OF6D 1OPGH 2ZCLL 3MLVH 5DURB 5DRWA 1ADQH 4ZAKB 4LVHB 3P0GB 4PJFF 2DLFL 3CX5J 3L7FA 4PGBB 2D0HA 5L9DH 1X5HA 4OB5H 1WZLA 4RX4A 4Y4KA 1H15A 1OAKL 5TH2A 2BY2A 3TBVA 3VE0B 3EFDL 4K94H 4UT7H 4JZJC 4A2MA 5F9OH 3CSYA 5I1HL 3B9KA 5C09A 1TXKA 4HPYL 4FQ1H 3UC0H 1BAFL 3GMOA 4BH8A 5CD3B 1A0QL 1CICB 3UCRA 4GRLD 1UB6B 4HZLA 8FABB 3LS5H 1IT9H 5ITFA 3TVMD 2NQCA 5T1MB 1X5KA 3A6BL 1QNZH 3MLXH 3JWDH 1Q72H 2WINB 2NY6B 1C5BH 4DZBB 3T0BA 5GRUL 3SDCB 2X4SA 2BSSB 4DFIA 1T3FA 2P5ED 4KGLA 3D3VB 5JDJA 2VERN 4KTEH 3LN5A 5MENB 3W39B 1YEHH 3X14A 2ZUQC 4WNQA 1FNSH 4TUKL 5DD3H 4N0FB 4PJ9D 1MIEH 2XWBB 1U8QA 1VADA 2Z4QA 4PJ7B 5SX5H 4PV9B 5CUSH 5E1AA 5JW5B 1B0RB 5IGXL 1QO3B 1OWWA 4OGZA 1JZ7A 3ULSA 5A16A 5KVMC 1EV2E 4P4RB 4DQOH 3U30B 1NCAH 3U7WL 4FTVB 4UU9B 1KTDB 3H8NA 3ET9F 1KCRL 1XZ0A 4QCIB 1IVLA 2CD0A 3KPOA 2IADB 3D2UA 4L8SA 2EDDA 4MVBD 3QCUH 3KPRA 1U3YA 1RIVH 5L2JA 1HHIA 1OY3B 5C0CB 4PGDA 1HDMA 3QEHB 1RUQH 2CRYA 2EYRB 4E41A 2GAZA 4Y19E 2VL5A 3N50A 3FFDB 3OMZA 1GOFA 3NFSH 3U4EB 4NM4H 1DE4B 4JO4H 4Q97A 1FGVL 2P8PB 3WNKA 5IVZA 1MJJB 3ZKXB 5KSAD 4YDIL 1KGCE 5E8DL 1QKZH 4DW2L 2JB6B 3H9YA 4N5UA 4F15B 3O11A 2PN5A 3L5HA 4Q2ZB 1ZEAH 4ODUB 4XBGA 3VI3E 1N59B 1D6VH 4I0PB 1INQA 3D18B 4NQCB 4NQEA 1JV5A 4Y16C 3ARBC 2PR4H 7FABH 1BVKA 2AJ3A 3T0ED 4YHOL 1J12A 5FA4B 4OI7A 3W0WA 4N0UE 4LGSB 1DVFA 1HYRC 4PIRF 4XB8A 5HHMD 4JM2C 2MSPA 3CLEL 1X44A 1PG7H 2LTQC 3B6SB 1DQLL 4JCLA 5SWSA 4UV7H 4KMTH 4XXCC 2E7LC 5HHPB 5F6HI 3FMGH 5TE4L 1MQKH 3QDAA 4MDIB 4YHLH 4P9MH 2OL3L 2QQQA 1DDHA 3MX0A 3RWHB 1RURL 1G1YA 3LKSA 5GRVL 5BQ7B 1YEIL 5EB9A 4O5LL 4S0SD 3G6DL 5FM5O 2APXA 2Z93A 1T21B 2HT2C 4K94C 3NPSB 1IE5A 5FB8B 3HNSL 3U2SA 3NIFF 4HIHB 4YPGB 3UYRH 2DDQH 5DZLA 4CL7A 4JVPA 4P2OD 1TJGL 1TZHA 3VFNA 5L88H 1S9KC 5A43C 1LK3L 3PP4H 4HJJL 4OZ4A 1QLFB 2E7BA 5FGCB 4HQQL 1GZPA 2FSEB 3KYAA 3JWDC 2B2XH 3I3BA 3BQUA 1EK3A 4H88L 1XT5A 2QKIB 1YUHA 5HHME 4HWEH 2Q8AL 1PQZB 1ONQA 3BFOA 3JVGC 1BMGA 1MNUL 5F6IB 2MOVA 1QEWA 4ZOAA 3FFCA 3T4AB 3MRFB 2VXSL 5EUKA 4TULL 3VRIA 4YHZL 3NIFE 5DJZB 1IQDA 1LD9A 4YXHL 3C5ZB 2VDPH 5F7YC 1FZMB 4TSAL 3RWIA 4A2LA 3BN3B 3SHSA 1AIFA 4A6YA 1OTUC 1A1OB 1JWUB 2EE3A 4RNRA 3P0YL 4V1DA 1OGTB 3QUYC 1JWMB 4M1DL 2XY1A 1A6VH 1P84J 4NQDD 4WGVB 4KWUA 2I26N 4PP2B 3DVFA 2H1PH 1CD1A 2XKUA 2NXYC 3IJYA 4PG9A 5EC1A 5SX5K 3BUYB 4MAYD 1AQDA 1A3LH 2QSTA 2OR9H 4HIJB 4UMGA 5IR1A 2V2XA 1LDSA 4MSWB 5C08D 4AEEA 1AQKL 3SCMC 5CMAA 2D9QB 5GZNC 4WV1A 5KS9A 1Y6MR 3GSNL 1P7QA 3WHXB 5LJYH 4IRSB 4YGVA 3HLAA 2PTTB 4MA7L 1OGAB 2WBJB 3PL6A 4OT1L 1NFIA 4HGWA 5GSRB 4HEPG 2VAJA 3SBWA 5I8EA 1I9RL 1Q9KB 4NQTA 15C8L 3FB8B 5LG1A 3TJEH 1MCCA 5F7DB 1LEKA 1DSFL 1VDGA 4OTXL 5GZOD 3EIFA 4HBCH 3QNZB 1MY7A 1IGJB 3QDMA 4PBWD 4XC3H 3MFGB 4ACPA 4QHMB 4XRCA 3LQMA 1LHZA 2XTJD 4NQDE 4WDIA 4WUUB 5ALCH 3QEQB 43C9B 3ULUC 3KLHC 1Q94B 2HJLA 4RMVA 4NN7C 2A73A 3B5TA 2HFGL 1XH3A 4YHMH 1P53A 4Z5RB 1KIQB 2BNUB 2IG2L 4G42A 4N0YH 3FQTB 5C86A 3OX8B 3MR9A 2F54A 5GGQL 5ILTL 4ETQA 2IFGA 4NDMB 4K8RH 4JQXC 3RJQB 3M1BB 1WAAF 3MZTA 3WIHH 4GRWH 5C08E 2J6EL 1A6AA 1JVKA 5JA9A 3GHEL 4OLUH 1PY9A 2AK4D 2NX5A 1V8HA 1WIPA 1WZ1H 4PD4J 3PNWA 4NYLA 3MROB 5IJVB 2X4NB 3ISWA 1NGZB 1J1XL 2FNBA 1K8DB 2NY0C 2QTEA 4NKDA 3S34L 2FBJH 3I6GA 4KV5E 6FABL 4G8FB 3FB6B 4NO5A 2BHZA 3DXAA 5IVOA 4JO2L 3P2TA 1TVBB 3EO1A 4OSUL 5MERB 1IGYB 4F33A 1YEFH 2WQ8A 4MWFB 2ARJA 2D7QA 4CN1A 1B4RA 3WE6B 4JQIH 2DN7A 3MRKB 5D7LD 1WFTA 3LKRA 5KSBA 3QFJB 4L5FL 1D5MA 4R4NC 5CEYB 1KLGB 1WAAE 4HFWA 3KYOA 4HG4J 1ND0B 3R0NA 1OHQA 4GW5A 2XTJE 3IAPA 4B5EA 3O4OB 1AE6H 1W0VA 4WY7H 3LD8B 2DTSA 1UVQA 3SDAC 3SKMB 4ELMF 5IMOB 3P0VL 4O2CA 35C8L 4J3OC 2KQNA 4OZFB 1ZA6A 2FRGP 1OW0A 4N8CL 1RD6A 1FFPA 4RGMC 2YA2A 3L3GB 4KRPC 4F3FA 3OTTA 4UDUA 2YPLA 3QO0B 1Z5LA 2AK4E 1WFUA 5EORL 4OLEA 5INDA 3C6SA 3BEWA 1QD0A 3DTXB 5INCB 4MXWH 4NFCA 4YBHA 2GIYA 5HDLA 4V2BA 3ZKMD 2BHYA 3UYOD 2GSIA 2W9DH 1TETL 4BSJA 4N9GB 1GGIL 4QHUA 2VDRL 4JZOB 3ROLA 1MRDL 4ELME 2PCPA 3ARED 3FRUA 4YAQB 4JRXD 1QLRB 3U1SL 1NCBL 3PQYD 5D7LE 4FZ8H 1TQCB 2X89A 3DX9A 3HC0B 1KN2H 3VDAA 5TQ0H 2HVKA 5DJ2B 3GK8H 2MPAL 1PYWA 3CU1A 1XCQB 4JFDA 2AV1B 1GZQB 1NCUA 5D2NE 4LKXB 3B2VL 3SKOA 2OCFD 1U6AL 1NAML 1OT2A 2Y5TA 3C8DA 5FA3A 4GLRH 1J18A 4LBEB 3WSQH 2H26B 1CDYA 4OM0L 2EXWD 1MWAA 3DNKA 4RWYL 4CDGC 3HFMH 4U1KB 4KU1A 1HHJB 2I07A 4JR9H 1FAIH 1NC4A 4O9HH 3S3JA 4I1NB 3WNPA 2W0KA 2F53D 3VFUB 5J13C 2LU7A 1CGWA 1HHHB 1CFVH 1YPZE 3GHBL 3I9GL 5C8JA 1NQBA 3FQXB 3DBXA 1I1AD 4YJZL 5ADOH 1KCUL 3MRIA 5IHUL 2VDNL 1X7QA 2E27H 2IH1B 3HB3D 3TCXA 2HN7A 4L3EE 4JRXE 2VITB 3BHBA 3PQYE 1ZT7A 1R24A 2W0PA 2QLVB 3UTTB 3VXUA 4Z78A 4NN6B 5D7IB 2PXYA 4UT6H 4XNMB 5CBAA 2DLHA 3O2VH 3EOYG 4JDZB 1HKFA 3U48A 1U58A 2ICWI 4XBPA 3QIUC 3QSKB 3IDIA 4K8RC 3K1DA 4HMEA 5BW7A 2A83B 3W11C 3RWCA 3QIBA 5C0FB 5AWNH 4KK5D 4Z76A 3TZVC 4P2QB 3MV8D 5DRNA 2W38A 1YNTB 3MUGA 1YMHA 1ZA3B 3QZWA 2AJUH 5HPMA 5ETUB 5BOZG 4JQVA 4WFFD 4G6KL 3GKWL 1IGML 4X5XB 4TVSa 5I17B 1RAMA 5JDSB 2IJ0C 4Z95L 4PRDB 4LDOB 1MQ8A 4FRWA 1VGEH 1RZIB 4XP6H 4MZ2A 1EHAA 1WIUA 4U1MA 4DEPB 1VFAA 3ARSA 4LCIL 3C2AH 2R9HC 5FDWB 4LNRB 3FN3A 2XG5A 3FQNB 3MMEA 4NFDA 4PJ8B 5EU3A 3O3DB 2KZWA 3VXSB 4L8CB 1A9EA 4AQ1B 2B1HH 2UZIL 2HJFA 2UWEB 3VFVB 4FNLL 5GS1B 5E1HB 1M05A 1IKNC 1Q1JL 3VWKA 4FQLH 4XPTL 3RVTD 4KGJA 5EU4B 2I60H 4Q0XL 4DGIL 3FQWB 2DF3A 4APQA 4KK8C 4PY8J 5I6XB 5J89A 4Y4FA 1U8OB 2EYSA 1NH6A 5EU6B 4D0CB 3BRGC 1AP2A 5C7XL 1U8IB 1IM3B 3MRHB 2YD5A 5F1KC 1L4IA 1FYHB 3L7EA 1EGJH 3A67H 3MV8E 2WQRA 1NEZA 2ZJSL 2J3SA 5C9JA 1OB1A 3EOAB 5J3HC 4PJHA 2I5YL 3SO3C 3RPIA 1E6OH 4WFFE 2A0LD 4DTGH 1YNKH 2BP3A 3HZVA 3QWRD 4GAYA 4GKNA 4ONHA 4PD4K 2ICWA 2BNRE 1N5AB 5GRVK 1MJUH 3WDJA 1M1SA 2OTUB 3CFEB 2VSDA 3BGMA 2VLRD 3RQ3A 3VFWB 1F4XL 4KJQC 1VACA 2R56H 1F4YH 2ZKHH 3O3EA 4JFXB 4LU5H 3WUWB 3O9WC 3G6JA 4RMTA 1KCSH 4L3CA 4PJEB 3O41B 1Z9SA 2A6KB 4ODHH 5JHDA 1RU9L 2C3VA 4NKIL 1F3JA 2Z8VC 4NNYB 3MC0A 1H5BC 3KDMA 1JNNL 3E6FA 3QXDA 3H0TB 1UJTA 4PRHD 4K9EL 1JGUL 2V5TA 5DQJB 4KAQL 5CCKL 2R23A 4IRJA 4YFEA 4E42B 1M71B 1JUFA 2D0GA 1HQRB 3BW9A 4M6MH 2ATKB 4QRSA 4NQXA 3VXNA 1T2QH 3P11L 3CFBA 3MV7D 1DUZB 1G9NL 1P9MC 5KSUB 1AI1H 2X1OA 5EFIA 4FQHB 4ENED 5B8CB 3QRGH 5DEFA 2VH5H 3BKCH 3MNZB 3PWUA 4XCYA 3GBMH 4K2UH 4ZUSB 2CUIA 2VLRE 3RWFB 4Y2DD 4WJ5A 4U4BA 4YXKH 5DDHA 4ZFGL 3F58L 3RDTD 4NGHL 1Z9MA 3QHFL 4JRWA 3DV6A 3W9DA 4ZS6C 3VGGA 3BVNA 1U8HB 1JF1A 4BFBD 5D9SA 3MRBB 4LLVA 1FZJA 5ACZA 1U95A 1QYGH 4OI8A 4PB9L 4RZCA 1T20A 3HG1A 3S36H 4URTB 3S35H 2OSLB 1N4XH 5TDOB 4M6OH 4LSUH 3S97C 4PRHE 2HRPL 1BFOA 4NUGH 4JLRB 4TYUA 3ZLQC 4EQ3A 1AC0A 3IFPB 2XZQH 3OHXB 1V05A 3HS0A 2BC4A 2CR6A 1XGPA 1T0NB 2CJUH 2P42B 3OKYA 1XF2B 3SPVA 2ITDB 3PHOB 3V9FA 2V17L 3PHQA 4JG0L 4M02A 4JRYD 5F1OB 5D1QC 4IBLT 3MV7E 1C7SA 5K9JL 1LEGA 4YHPA 3BH9A 5H94A 1BX2A 5HGAA 2A6DA 3NMEA 3W5MA 1UH3A 3BWAB 3WUWG 4EI5A 1DBML 4Y5YB 4ZSOA 1VESA 2DQIH 1KCKA 1WBXB 3O3AB 3QUXD 1T2JA 4LF3A 4JY4A 1J1PL 4EBQH 1JN6A 1ODAA 5AUMA 5DEGA 1YQ2A 2CPCA 5C0DA 2OXHA 43CAA 3NFPA 2ZCKL 4Y4HA 4XCEB 4RA0C 4B7IA 3SJVB 2FIKA 4NC1E 4JPKL 1S78D 2BNQD 1U8MB 5HVHC 3L5JA 3QG6A 2YXMA 4HD9A 1OSZA 3G9AB 4YHIB 1A6TB 5EO0B 2VLJD 2VXTH 3LS4L 5IQ9A 4CMHC 3DX6A 1QBAA 4LKCA 4QRRA 2OXGA 4P5KB 5F7EH 4GW1A 3JUYA 1OM3H 3ZYOA 3I2CH 4F7PB 3TBYB 4M62H 3GI9H 4RISL 3CCHA 3ZDYF 2H6PB 4S0TD 4HKJA 2EYTA 1QG3A 1KEML 3BD3A 4JVWA 1AJ7L 3WIIH 1UACL 2CO7B 3Q6FB 1PG7W 3HUJE 1JGVH 2PO6B 4XWGH 1PLGL 4JRYE 2H32A 3AM8A 4NO0B 1P5UA 1ZLVH 2LAGB 4J1UA 3TJHD 4UOJA 3KHOA 3S96B 4R7NA 3DGCR 1A02N 3ORJA 1U3HD 1JYNA 1I85C 4P5TD 2HJKA 3TYGL 1JF5A 3V52H 1PKQE 1UWXH 2XY2A 3KLAA 4W68A 3WEXB 2X4TB 3LRGA 2CLZB 3QPQC 5KBNC 1MREH 4LOUC 4CAGA 3I6KB 5DUPL 2VLLB 5GS3A 3RZCD 1NDGA 3BGAA 3ARDB 1FRGH 2BMKA 1C08A 5HYEA 5LVEA 3P77A 3FT2A 5C92A 5KW9L 2HFFB 3ARFA 1F13A 4JFEE 4QHNB 5DC4B 2VLJE 4X99A 5F44A 1JBJA 1FIGH 3C60B 4UIMB 1HH6A 3HRPA 2WAHA 1S9WB 4JFZL 5I8CA 1ZHLA 5E8OA 3WO4C 5IF0B 3BIKB 4LAQL 3TESA 1HYSC 1T66C 3RJDA 3REVB 3MLSL 2CKNA 2FH8A 4HS6A 3VGEA 5CGMA 5ERWA 3UPRA 1YEDA 2MCPL 4ZS7H 1MI5B 2DQCL 3QEGH 3V4PL 1MRCH 3ARWA 4TRPL 4CUCA 4MNQB 3MRMA 1A4KA 4ZFFB 1BF8A 4JN1H 1NCWL 5E00B 4D3CH 4UV4L 1NGPH 2YBRA 5DJ6B 4DVBB 2X9WA 4O02L 4S11A 2W0LA 5CJOH 1A21A 2DQGL 4KHXL 2XWTA 3RGVB 3DOSA 4X6EA 3STLB 1G6RA 1FORL 1A6WH 1YECH 4M6AA 4ZQKA 4P4KA 4PRPA 2JELH 5IV2A 4MD0B 5E8NB 5H37H 4NQUA 3MLTB 1ZANH 1UM6H 2XZAL 4KPHL 4ZFOA 1FL3A 5CSZB 2GEEA 4Y4KC 2ZUVA 3GMPA 3K4ZA 1C1EL 3K2UL 3QI9B 3TT3H 3DVNB 1T1WA 2EDQA 3RIAF 3T04D 4WRLA 4AYFA 3RX5A 5KN5A 3B9KC 4NHCH 1CI5A 3BOVA 2AXGB 2DLGA 4OZGB 4EI6B 4XH2A 3BT2L 2J4WL 4PRID 4XZUB 5F6HJ 5KVGH 4RFNB 2AJZB 3CZFA 2BSRB 2DOCA 1OL0A 4MHHG 3AY4A 3U0TA 3LY6A 4PJ5A 3HAEB 3KG5A 2NY3C 1W72L 3C9NB 1A7QL 3HR6A 1S7SB 3GM0A 4K7FB 2IAMD 2NXZD 2CDFA 2LVEA 1MPAL 2HLAB 4UI2A 3GIVB 4YUEL 4DWHA 2HTKD 5TPWL 2WANA 2HKHL 4UILL 3IKCA 1CXHA 3IJSB 1HIMH 3INUH 3FHQA 5IUSA 2Z35B 1BBDL 3MLUH 4A6YH 4LL9A 3WFDH 1XF4A 1P4BL 1MHCA 3EW3B 3DRQA 4LCCA 1ORQA 3T2NL 2C1PB 3VXOA 4HKBB 1FGNL 3VFTB 3IU3A 3BX7C 2V7NB 2HKFL 3C2SA 4BFEA 4KDWA 1FL6B 3V4UL 4CNIB 2AXFA 5CIPB 4ZPTA 4IDLA 3LHPH 2ICEB 1RZGA 4D8PA 5D1XB 2W07A 1F90L 4XWOD 1T04B 3VCLA 3UTOA 5F9JA 4X4ME 1MIML 1INEH 2A9NH 2IBZY 3E2HB 4LCYB 4NSKA 1ZLVK 3KLSA 1N7MH 4L8SC 5C07B 1EEYB 1G7PA 3O6MH 1EEZB 1W8NA 1RUAL 3OKEA 3OF6A 2FYYA 2FHFA 1P4IH 1UWXK 1KG0B 4LFHD 4YE4L 3SDCD 1I9JL 4TVPH 5DK0B 5GJTL 1CFTB 1RZJL 5MEND 1ZHBA 1ITBB 3TH4T 1WBYB 2NTSP 3ECBA 5JR1H 4WWKC 5T1KB 5BZWA 3X13B 5HI5C 1OCWL 4U6YA 3CXHJ 1Q8MA 3WFBL 4Z77A 4MXQC 4JZJB 3FO0H 4MS8C 2EH8L 1U9KA 3QUZD 1JMXA 4PRBA 5D71H 4HKZA 4K3EH 3VFRB 3FO2A 4XP9H 3WFZA 4EOWH 1QA9B 1WISA 4GRLA 4WW2B 5CINL 2EIZB 2O61A 2YPKA 3V6ZB 2ADIA 4PJ7F 2CKBL 3L95A 1NLBH 3TVMA 4GKZA 1T5WB 3HAEG 2XPGB 1KNOA 3DROA 1DVFC 1RZ7H 1EMTL 4NRYB 4CBPA 2RCSL 4HJGA 4Y19A 4HCRA 4G7VH 1F3DJ 3RL2A 4Z7WB 4H0HB 3TO2A 1NMBL 5CEZD 4PJ9A 4NZTH 1AD0B 4R0LA 4OLVL 2XICA 5EPMB 1FFNB 4LRNL 5HHNB 1BIIA 1MVUA 2N7BA 3N1FC 5GRJH 2H2SC 1ORSB 1A47A 1CGSL 3MCG1 3KYKL 4LSVL 2YSSA 3B8YA 4LLMB 2DKSA 2NNAB 3ZE0F 1U8JA 1CGTA 1PSKH 3P73B 4QXTB 3G5ZB 1OWRM 5D7KE 3QDGE 3JTTB 4F7EB 1NJ9A 2Z31A 5HDOA 4XVUD 2E9WA 4RFEA 1EZVY 1U8LB 1WITA 2DICA 1I1FB 1IC7L 3KPSD 4WEBH 4U3XA 2CGRH 3UTZA 2JJUA 1A9BB 1CXIA 4NRXA 4LPXA 1DZBA 5FM8A 3W9EA 4AQOA 3BQUC 4LLDA 1EO8L 1JGDA 4TUOB 2NW3A 1IZKA 4K3DL 4TN9A 5HYQA 4OD2B 1MLBB 4MD4B 1NFDE 4XMKH 3HZYB 5I30L 3RUGB 5KSAA 1KEGL 2VDQH 4LLYA 1YNLH 4M7ZC 5HD8C 5DT1L 1SVCP 2P49B 2F9BT 3HZMB 4Q6IA 3PWVB 3QQ9D 1U42A 3MO1A 4FXGB 2PETA 2FJHA 4JFFB 4NKMB 4ZUTA 1CFQB 1CL7L 4LSTL 5MEQB 5C2BH 4OGYH 4LLUB 5I0ZA 1QUNA 1H0DA 4OKVB 2NTFB 4HDIA 4MB3A 5DFVC 4UQ3A 1C12B 2MQ3A 1QFWM 1KIRB 5BO1H 3VXPA 2GK2A 3ARBB 1IM9D 1YY9C 4XVSL 3TWCL 3BP7B 5KVEH 1RIHH 4OBRA 1LEIA 3GRWA 4GG8A 2E3VA 3BEVA 2QSCL 4IS6B 2VLMD 1QQDB 3Q3GB 4KMQA 5I16A 3KPSE 1RHHA 4JM2B 1ZE3C 2LTQB 3CVHL 1MWAH 3HC4H 4UUJB 3EYVA 3N85H 4WV1C 1Q0YL 3MLRL 2C3WA 4K7PY 1NAKH 3X3GH 3CDGA 1MCPH 2GFBB 2W9EH 5TFSH 5JOFA 1IAKA 1IAII 2L4OA 1Q0XH 2W0FB 4JHAL 3AMLA 3SBWC 5E9DB 5C0BD 4PJCE 1UYWL 1HZHL 3C5ZD 1BLNA 1LO4H 1FJ1B 4CMMA 4IHOB 4F9PA 4NWTH 4V2CB 3Q0HA 5C1MB 3IAQA 2ZUYA 4G5ZL 2ITCA 3X3FL 2B8OT 1F97A 2DQTH 2GKIA 2F8VA 5J06A 3IVKB 1YYMH 4M3JA 3B9DA 1DQJB 1IEAA 3QFDB 3CPLB 3VGHA 3QH3A 5ECJE 1GHFH 1AGBB 3SGDI 3FTGB 4FQJL 3SKNB 1FVDB 4OZHB 3ULVL 1T83C 4CN6A 1KCVL 1FG2B 1XGUA 5C0IA 1I75A 5C0NC 3DIFA 5KG9A 3C5JA 5ITBL 5DWUL 5C70A 1CR9L 3BP4B 2QBWA 3WNOA 1M7IB 1KELL 3GI8H 2VLME 4PGZA 3OG6B 1A7NL 1QFUL 1JZ6A 4NJAL 1GIGL 2UZXB 4MZ3A 1WEJH 1R0AL 2X4OA 5T1DH 1EAPB 3L6FB 5KANI 1OD7A 1XIWA 2Y6SC 4YZFF 4HWBL 4H25B 3Q6GH 2IBZX 3RVUC 4U1JB 4KROC 1HSAA 3OGCB 2GJ6B 5C0BE 4ZYKA 1JRHI 3GSOA 4XX1E 4QGTA 4KKAC 3IXTB 3QUYB 4FMKA 4I3SH 4NKOA 4DKDC 4DN3L 5DJ0A 3PJSA 4HULB 3LIZL 1KTRL 4M5YL 2NXYB 5D70H 1S5HA 2VDML 1UWGH 1T2XA 3OBAA 5MHSD 1QRND 4X7EC 5C08A 2P24A 4YZFE 2FJFB 3P9WB 4PRNA 4Z0BL 3SKJL 2FR4A 1IGTA 3QNYB 3T3PE 2VOTA 1JPTH 4F58L 4DKEH 5E7FA 5DUML 3RHWK 3ZHLA 3OXRA 1JYVA 3OAUL 5DVNA 4M43L 5EN2B 3UPAA 1H3UA 2AJYL 5FYJU 5CJ8A 3V2AR 3TLRA 3KXFD 1JPGB 4Z7UB 5I74C 5FOJA 2GK0B 2D03H 4M9OA 4DAGL 1X4ZA 4PJDE 1QR1B 4P3CL 4AL8H 2JJTA 1HXYB 5CHNA 5C0JB 1WAAA 3WXWL 3OZ9L 4G80A 3QA3A 5DJ8A 3D85A 5HHQB 4PR5A 2DI8A 5FUCC 1DBAL 3GO1L 4JAMA 3QWOA 1Q9WA 4OD1H 1DBJL 1GC1L 1HH9B 5JXED 5I1HH 5CJBA 5FYKD 4NN7B 2X42A 4I4WB 1G7JA 4R4BA 3WS6A 3KPLA 5JOEA 2V2TB 2Q76A 4JO3L 5IQ7H 4ISVA 4R2GD 1GGUA 5K59E 1A0QH 3Q48A 4Q58C 1OAYL 3QUKB 1ES0B 5MHSE 1QRNE 5GS0D 2XRAL 5LKNA 4X6DE 3EHBC 2AK4A 1XGYL 4PJAF 4LSSH 1ACYL 3H9SD 1J1OH 1IFHH 2E6JA 3A6BH 2BSTA 5MI0C 3EDJA 2NYYD 4OLYL 3SOBH 3L5XH 2V2WA 5GRUH 4LNVA 2MKWA 4WI9A 4K23H 3HI1B 2NY0B 3KXFE 5IKCA 3RP1A 1EZVX 4JN2A 4G9DB 4DN4H 2X4RA 3MFFA 4YHYC 1FNHA 5D7LA 3STBA 3EO0B 4HHAB 2DQUH 4HIIB 1A7RH 1T22B 4DUXA 1F6LL 5CSGA 4KHTH 5AYQA 3ZYZA 5ESQB 5DD5H 4PJAE 1IGFL 4PJBB 4CADA 1F6FB 4TTDC 5D2NA 2Q86B 4PB0H 4RCAA 4Z7VB 3G5VB 1MRFL 1XGTA 5FYKE 3BISA 3PDOB 3QXAA 1EHLL 1DLFL 1KBGL 5CJQL 5BVPH 2Y7QA 3FN0L 5KJRL 2A74A 2BK8A 4RGMB 5BW7C 4NWUH 4K3JH 1INDL 3QIBC 4KRPB 5GGVY 5LAXB 4DGVL 3DO7B 5DO2D 2I9TB 3GIZL 3H9SE 1YEKH 3TNNA 1U92B 1DUYB 2NCMA 4QRTA 1YPZA 1Z0MA 2JIXB 1BD2B 1QSVA 3QQ3A 4J7RA 3FT4B 4JQVC 2R2EB 3C8KA 2XKNB 4N90D 1FGVH 3HNTH 4R96B 5D1ZB 3WUZA 5ELIA 3AREA 3D0LA 4L3EA 5HGBB 5HGHB 4JRXA 4RMRA 3PQYA 1PW3A 4BKLA 4QXGH 4B41A 4I13B 5DI8A 5BVJB 3D39D 3N1MC 3LEVL 4D9LL 2DB8A 2Y36L 3GSRB 1CU4L 3CMOL 5F7WC 4O4YL 1FNAA 1OT1A 4FMFA 1MH5B 1E28A 5T3XL 1DBKL 4TPRH 4H26A 4APQC 1CDBA 3JWOL 4P57A 5CEZL 5GSVA 1MCEA 4JKPH 4Y4FC 3MXVL 4NHUB 4WFGD 5IFHH 1V3MA 2A2QT 1AY1H 3MA9H 5E03A 3VFGH 2NY2B 4X6BB 5I8KL 4UB0H 3QDJD 4JJHA 4ONGL 3F62A 2EE6A 2VR4A 5D7IF 5J13B 2VMFA 1ZTXL 3S88L 4IIQA 4ZO9A 3VU2A 2A6IB 4YBQD 2VRAA 1I1AA 4BQBA 1I3RB 3GSVB 2H32H 2EDOA 1OLZA 1JZ8A 1PX4A 3F6IA 4J23A 4MA1C 4XP5H 4GUPA 1Y6NR 4MJ4A 1XF5B 3UX9B 3BZEB 1FZOB 4P46D 1YC7A 3WYRA 1KJMA 3D39E 2P8MA 3K74B 3VXSD 4NJ9H 5KAQF 4P9HL 2AJSH 2DYPD 3NIGF 3PV6B 4N0CC 3QIUB 1R3IH 2EDHA 4HJJH 5D7IE 5FECA 3P9LB 5IBUB 4YFLF 4FP8H 3GKZA 5IK3B 4XAKD 3MV8A 4GRWB 3O45A 4Z8FH 1BVLB 3WLBB 3GNMH 4ORZC 1I4FB 4WFGE 4FFVC 4RGNC 4HK0A 3SDDC 4QNPF 1FH5H 3EYSH 3R4DA 3QDJE 4NRZB 1MNUH 2SEBB 1K8IB 4YR6A 2IFFL 2BNRA 1X5GA 5JIKA 3U0PB 4DFHA 3BD4A 5F7FA 2V5MA 3QEUB 1UM4L 2VWEC 2ZPKL 1QTYT 2FLBT 5A40E 4M3KB 4I2XB 5C0GB 3MXWL 4CW1A 1RJLA 3NIGE 4H8WL 4M1CC 1XR8B 2IQ9L 3V0WH 2XA8H 4FG6D 3U36A 4KZDH 1SYVB 4NZRH 4HV8A 5GGSA 5FF6B 4LCWB 5I18H 4P2RB 1BM3H 1KENH 2IALB 4QRPB 2EECA 2WLZA 3N06B 2NY1D 5JUEH 2I9LA 3TO4B 5L7XH 1SY6L 2FX8L 2A77H 2EDXA 1OF2A 1G6RH 3VG9C 3M45A 4GSDH 4NO3A 3ZZ1A 4JO1H 1NL0L 4XAKE 2LV4A 2EO9A 4MHHI 1ZHKA 3LKOA 3REWB 1QBLL 3LQZA 4NNPL 4NZUH 1UB5A 3DRTA 1X5YA 2AJVH 3VFSB 1GH7A 3SO3B 1TNNA 5AD0B 4U6HB 3QWRA 3TPUA 5CZVH 4WO4D 1F58H 3I84A 2ORBH 2VLRA 3VRLF 5CP7A 2X1XR 5IOPA 1T1XB 2YPVH 2Z0BA 1UKTA 5D8JH 4EI5C 3ULVC 3CSBA 25C8L 3O9WB 2RBLA 4G8IA 4I18A 5I71B 2OP4H 4KI5F 1IMHC 1R3KB 3BMVA 4KKCD 4LGPB 4Y4HC 5KOMC 3MTRA 5D7JA 4DK3A 3OKNB 1H5BB 1FN4B 5IBUG 1KB5A 3H9HB 4F37F 1T1ZB 4CN4A 2X4QB 4PRHA 3EYFA 4P5MA 2ADJB 5FM4A 4YDKH 4ZUWB 2AI0H 5IB4B 1EO5A 3V8CA 5ICZB 3RKDD 3RWEB 3OPZH 2WSKA 3RPKA 3VRLE 3MODL 5K9KA 2GCYB 3BE1L 3O0RH 4OD3H 4PRAB 2FDBP 3MV7A 4KY1H 1KSRA 3ZKQD 1AD9A 3LRSA 1NGWA 5BJTB 3JV6A 3PUCA 3R8QA 1G7IA 2FZ3A 1A1NB 1WWWX 4HIEA 1WWAX 3BO8A 1PX3A 1T1YA 4LIQE 3VWJC 1J9CT 4P3DB 4Y2DA 1MFEH 2QJDA 4Q7DA 2Y72A 4QGYA 1LNUA 4OZIE 3A6CH 4KTDL 3T09A 4FHBD 4AEIH 4XAWH 3U83A 2APVA 2BOCB 4G3YL 5F89B 4C83A 2AK1L 1P7KB 3U46A 3ZT5A 4H20L 3SJVD 5EWIH 5C0RH 4BFIA 3P30L 2NR6D 4YNYA 3UZVB 1BOGA 1D3CA 4PG2A 5ICXA 3ARFC 3IF1B 5DYOB 1DFBL 1C7TA 1RMFH 3MJ8A 4ZUUA 4QYOA 3FO9A 2BSED 2GITB 2IQAB 5K33A 3VW3L 2BY3A 3BGFC 2XN9D 1RPQA 2E7HA 3HUJA 2VKWA 4JRYA 3WKMH 2P4AB 3HHRB 4YXLL 1JGEB 2CIKB 3L1OL 4LCUB 2I27N 1SBSH 4LVOC 2B1AH 1CD9B 5JTWA 5DMGD 1FFOB 5DJCB 1CF8H 1NMCC 3QUXA 3TN0D 2FH6A 2UVEA 5DMKA 3T65A 4YK4C 5CLWA 2ICES 2NLJA 3LEYH 4Q9RL 2A9ML 4HPOL 2P7TA 5I1EL 3O6LH 1NCBH 3IU4L 4PV8B 2C1OA 2GSGB 1JHLH 4XNQB 4XPBL 4QOKB 4ZAKC 3DURA 3MOQA 2MPAH 1Q9LB 5KVDH 3MUZ1 4MA3B 3S5LA 4M7LL 1CDGA 5HVHB 4JFEA 5T5FL 2VLJA 3SJVE 5K9QI 4M1GH 5LQBL 4HCRH 4OM1H 2EE2A 3PWNB 5DHYB 2D9CA 2AGJL 4CMHB 4P4KC 2CRZA 3CFCH 4ODSL 1D5XB 4PJXB 5E2UL 1IQWL 2GJZB 4OJFL 4AG4L 1B6DA 1I1RA 1KACB 3FAXA 3UBXB 1FBIH 3DGGA 3K0WA 2XN9E 1G7MA 4X4XA 5DTFA 4D0BB 1GAFH 2VC2H 3U6RB 12E8H 5ESVA 1U3HA 3GGWB 4P5TA 1MI5D 3JV5A 4YX2H 4OCWL 3NN8A 4HUXB 1TVHB 3GMMA 4NNXB 2OJEA 3F7YA 3MRLB 2FATL 2FX9L 3P9MA 1UM5L 5I2IB 3RZCA 2VZSA 4ZDHB 3J8F7 2Y1VA 1RK1B 1ZLSL 5JPMA 2KZ1B 1OAXH 4P2CG 2J88L 3JV0A 3MCLL 2FL5B 3GJEB 2M26A 4WUKH 4KKBC 3TYFA 4HUWB 4OLXL 3TFKC 4Y1AE 2J8UF 1T6VN 2X1PA 5DVOA 2BVEA 2VXQL 3TA3A 1L0XA 1L0YA 1VCAA 4IRZL 1D6EA 5DA4A 2DRUA 4MJ2A 4WHDA 3V6FA 1TZGH 4F8QA 3U30C 3WO4B 3D69B 3ZE1F 4MMXC 3OJDB 1UZ8A 4G6KH 3LZFH 3SKUD 3IDJB 1NBYA 4L4VB 2R39A 3F12A 3LPWA 4L4TB 4LCCC 4WHTA 5HY9B 3LDBC 4KUZH 1RULH 5I1GL 2DD8L 1A3RH 3BPCB 2EKSB 3PABA 5I1LA 5JORA 3MRJA 1AC6A 3GB7B 4QHLA 1KN4H 1LO3L 4GG6E 4XMPH 1T89A 3DYOA 5I75C 4GMSH 3L3KA 1U8PA 2J8UE 1R5WB 3RWDB 1YN7B 3GRWH 1GGBL 1YEGH 3DWTA 1X5IA 4LQFH 2BRQA 3KNBA 1HEZA 5JNYA 1QLEH 4CDHA 1S7WB 4BA8A 3Q5YA 2HT3C 3ZKXC 1TCRB 2YMXH 4E0RA 3ZE1E 5TJWK 5IHBA 3DX8B 1SM3L 5AZ2L 1KT2B 3OGOE 5FHBL 4HH9A 5DRWB 3UBXG 5T3ZL 4R8WH 2R2BA 3EDEA 2AJXL 3HE6A 4I0PC 4U1SB 3L7FB 2EZ0C 4Y5VA 4JG1H 2E6QA 3FQUA 4Y4KB 1H15B 5TH2B 1S9XA 3TBVB 2DWDA 2DJSA 1K6QH 3CSYB 3TH3T 1BJ8A 1FDLH 3B9KB 2NW2A 5C09B 3WLWD 1HCVA 3GMOB 3SE9L 4BH8B 4X4MA 5EBGA 4GRLC 2B5IC 4TNWF 5TE7H 1HINH 5JW4Q 3ZSTA 3TIDA 3UJJL 2BVPA 5D1XD 4HZLB 5ITFB 3K8MA 1UZ6F 3N0PB 5HGDA 4EXPX 2GHWB 1K85A 2IAMA 5DUBA 1SQ2N 3KPPA 2WWMC 3B2UC 2X4SB 1BIHA 4YHKH 1T3FB 4PY7A 4CU7A 1NPUA 3PF2A 4TUJA 1NEUA 3LN5B 1IBGL 2I24N 3X14B 4K55A 4PJ9C 1N64H 1P6FA 4R0LC 4WNQB 1TJHL 2Y07H 4H8WC 2YD6A 3MLWL 1U8QB 1VADB 2Z4QB 4FFZL 4I3RL 4XXDA 2QHLA 1TZIA 4QRUA 4R3SA 5E1AB 4ZODA 1BZ7A 3GMLA 1G9NH 3HMXL 1MEXL 2DQJH 3ME0A 1BFVL 2FO1A 1FYTE 3ULSB 5A16B 4QXUL 3MBXL 3JZ7A 3HMWH 5F6IC 2Z31C 1IAIH 5GS2D 3T0AA 1I8LA 1XZ0B 5J1AA 3KPOB 1NCTA 4AIXA 3D2UB 1WZKA 4UTBH 4L8SB 3BDYL 3KPRB 2GTZA 4XPGH 5L2JB 1HHIB 4XCFL 2QADB 2UUDH 1L7TL 4F7MA 1JZ5A 5EZOH 5J57B 1U2HA 4PGDB 1HDMB 4PB9H 4MMZC 2MTPA 4E41B 2GAZB 3VGDA 1S7VA 2VL5B 3SGDH 5DR5L 1CYGA 2BDNL 4HAGA 4FQXD 1MUJA 3E1F1 2RGSA 5IVZB 2R4RH 2R1YA 1WT5A 2XIDA 5ANME 5EUOF 2DQEH 1RZKH 1KIPA 1NGYA 2X2YA 4Q6IC 2VDLH 4UNTA 1VHPA 1QO3A 1G7HA 2F19H 5C0EA 3QUZA 3O11B 4XMLH 4UIKH 4G9FE 2FECI 1A3QA 4JFPA 4XBGB 3NA9L 3QDGA 2XYCA 3S98A 2P8LA 1F4WH 1INQB 4WI8A 4NQEB 1JV5B 1E6JH 2WK2A 1BVKB 2AJ3B 2HA1A 2OTPA 3AFLA 5JIPA 2H3NA 1FNEA 3EZJB 3LMJL 3W0WB 2BXZA 2RJMA 3UTSD 5F7HA 1Z9OA 1DVFB 1SJXA 1V3KA 4EJ1C 4HGMA 4JANA 1JRHH 4QTHA 2PW2A 5F72S 5EUOE 4GQ9H 5EOCJ 5SWSB 5C6TL 3S37X 1NFDA 3G5XA 1IILE 1F8TH 1BEYH 1WWCA 4UZGA 3RBGA 2DQHH 2HWZL 5FGRA 4FQIL 5FCUH 1DDHB 4Y0GA 4MAUL 3LKSB 4QT5A 5A2KH 5D5MF 2IF7A 2WW8A 2R2HA 3B3IA 3DLQR 1FE8L 4U3HA 4G8GE 4GAGH 2CDEA 1LMKA 2V7HA 3N1PC 1NCDL 2Z93B 4KKLD 3STZA 4TOYH 1X3DA 4IOIA 5B3NA 3UPCA 3LVEA 3U2SB 1RUKL 3X17A 1TZHB 2EEBA 5F7LB 3RUGF 4Y16D 2HH0L 3WIFA 3KPSA 4OZ4B 4TSBH 2EDBA 2ZNXA 3IFLH 5E7BA 4S1SH 5J6HA 2FO4A 1WUNT 3MOAH 3DX7A 3AS2A 5EOCH 3ZDXF 4OF3A 1AO7D 1GZPB 5D5ME 3GBNL 4JPWL 4WCYH 3UTSE 2YWZA 3BQUB 2CXGA 1YUHB 5I1AA 2R69L 2UY7A 1ONQB 4RIRA 2R4SH 4UDTA 4YFDB 1J8HE 3N9GL 5EZLA 3QULA 5J8OA 1QEWB 1XIWC 3FFCB 5TGBA 4HK3N 4PJCA 1EJOL 4U2ZA 5EUKB 4HZAA 5E94B 3VRIB 3O2DA 1VFUA 5DK2B 1VFBA 3AAZA 3FZUC 1IQDB 3DSFL 5FYLD 4M7ZB 1A7PH 1LD9B 3FB5A 4IOSD 2PYFA 3RWGA 3RWIB 4AM0A 5C3LD 2NY5C 2D31A 3RUGE 1AIFB 4I77H 5E9DD 4A6YB 5I1CH 1L6ZA 3LD8C 1ZGLP 1VKXA 4RNRB 3ZL4L 4PLKD 4JZNA 4V1DB 4XC1H 1VSCA 5KTEH 4LASL 3LQAC 3RWJA 1X5JA 1IM9A 2DQCH 3V4PH 2O5YL 3FL7A 4XPAL 5F1NA 2VB5A 3IJHA 1CD1B 3IJYB 1MCRA 3QHZL 4PG9B 1H3VA 5EC1B 5JW3L 1AQDB 2VXVH 3BYTA 1FQ9C 4MDJA 1BQLH 4N9OB 1WTLA 5IR1B 2V2XB 3C6LA 3VI4F 2GY5A 3RA7L 2BJML 5CMAB 1AO7E 4U1GB 4WV1B 5KS9B 3V7MA 1P7QB 4MYWB 1RJYA 4M6NH 4ELKA 5IBTH 3SQOH 4YGVB 5H37G 3HLAB 5J0BA 3PL6B 1NFIB 5C0BA 2VQ1A 5FYJL 4HGWB 2DM7A 5FYLE 2APTA 3UJTL 3NCYP 1E4XI 1RZKC 5H2BA 5LGHL 1LEKB 3CDFA 4O2FA 1SMOA 2JJTC 3O8XD 3SE8H 2UUDK 5L6YH 5AAWA 5JW4M 1T0MA 3UJIH 3L3JA 3QDMB 4XCCL 2XTJC 3S4SA 3QJFA 3VI4E 4MD5A 4XRCB 2VXUL 5F8QC 5IB5A 3GSUA 1JYWA 1DEEA 4WDIB 2HJLB 4H0GA 1WICA 2A73B 1XH3B 1LQSR 3WS6C 3U4BH 3FRPA 1K4DA 2NXYD 3EYUL 4G42B 1DEDA 1LO2H 3MR9B 2F54B 2PTVA 2V6HA 4ETQB 5FUZH 4BSWA 1TFHA 1OP5H 4EIZC 4R26H 2YZ1A 4FABL 1A6AB 1JNJA 4I3GA 5T5NG 2NX5B 3SCMD 4ERSH 5I15H 5GZND 3PNWB 5AYUH 4NYLB 4PJDA 3TH2T 3MNWA 1WF5A 4MJID 4DZ8A 4NKDB 4LHQB 4WHYH 2J7LA 4I9WD 3I6GB 4JGUA 1YC8A 4RDQG 4NO5B 1MFBH 3DXAB 1HQ4A 2FEEI 3EO1B 4KROB 4OF7A 4F33B 5BMFH 1S7RA 5CBEA 3RBSA 5A1AA 2ARJB 4HT1H 4QTIL 5HDQL 4DVRH 2X7LA 1WWBX 4QHMA 2ZOKA 3LKRB 2YD1A 5KSBB 5GRZA 1D5MB 1MCIA 4PGEA 1JNLL 4HFWB 3KYOB 3H42H 3UDWA 1CDJA 4RAVA 2BERA 5D2NC 1FL5A 3ZKSD 4GW5B 4Z7UF 5MEPA 1QRNA 3ULUD 4UINH 3ESUF 3DPBA 1W0VB 4F57H 4X6DA 1UVQB 4WWID 9CGTA 1S9VA 5ISZD 4O2CB 2M2DA 2BRRL 5FO9A 1ZA6B 4C54A 3NCJH 1GGTA 1FFPB 1MFAL 4R6UA 4F3FB 4UDUB 1N5YL 4NT6A 1FFRA 2YPLB 3CFDA 4ZG1A 3GUTA 4L9LA 3KXFA 1Z5LB 3ULUF 4K71C 4XP4L 1JIBA 5INDB 3C6SB 3RGHA 3BEWB 4XI5C 1WVZA 1DCLA 1H3PH 5LXGH 5IMMA 4S1DC 4PJ8C 5I19L 2FJGA 1ZMYA 4MJIE 2NY0D 4PPTA 4Z7UE 5LBSH 4I9WE 1GPOH 1HN1A 4ONFL 3QB7C 2GSIB 1RUML 4GMTH 5I1JL 4AH2A 4QHUB 3RAJL 5J1TC 4PJAA 5EO9A 3ROLB 3WD5H 2PCPB 1PZ5A 2QQNL 3FRUB 3MRCA 5B3JF 1X9QA 1YQVH 1F02I 3U9UA 5JXEA 5T33L 4IOFC 3DX9B 2CUHA 5I8OL 4DOHB 1MCWW 2CMRH 2HVKB 5I1IH 5D4QA 1PYWB 2Q8BH 4JFDB 3ULUE 2AKRA 2MFNA 1KB5H 3SKOB 3NCEB 3S3PA 2FHBA 5CGYC 3SDAD 3H9SA 5ISZE 2Y5TB 3ZDZF 3NH7H 3MPCA 5FA3B 4XNUL 2APFA 3EJZD 4C57C 1MWAB 1SJEA 4KRPD 3QCTL 5MI0B 1QSFD 3UZEA 2RCSH 2I07B 4R4FL 4PJBF 2E9BA 2ZCHH 3QCVL 1JP5A 1NC4B 1EJ6A 2MKLC 3OQ3B 3OR6A 5B3JE 3CK0H 4Z7VF 3D25A 3TCLA 1KTLA 2WUBL 5J12C 5GHWL 4M61A 5DMIL 1OTSD 1TJIL 3WCYA 3MV9D 4AEHL 4YHYB 5C8JB 1QVOA 2DMKA 4HC1L 1DL7L 1ZOXA 3DBXB 3HB3C 1ITCA 3DJ9A 1CGSH 3MRIB 3AMKA 1X7QB 3DI3B 5BRZD 2HN7B 5IEHA 3BHBB 1ZT7B 1R24B 1MJ8H 3VXUB 4Z78B 1I9IH 4O51A 2PXYB 1CIDA 3ARQA 4YQXH 5CBAB 1DLHA 2AXJA 4JM4H 3JV4B 2PW1A 1U58B 2JTDA 1IZJA 2R0KL 4XBPB 5KZCD 3SE4A 4YFLI 4XPFL 4KZEL 3FT3A 4UTAL 1EXUA 5FIEA 3RWCB 2J8OA 3QIBB 3T0DA 4TSCH 3O6FA 4JY5H 4Z76B 4X6FA 1WBZA 5DRNB 3MUGB 5A2LH 3VD4A 3CAFA 4YDVA 1YMHB 1QSFE 1F11A 2CR3A 2B4CL 3AS0A 5F9AC 1CZ8L 3QZWB 4YWGL 3F7VA 5HPMB 5T1LD 4OCYH 1BJMA 1UWEH 1TLKA 1OP5K 3C09C 4XPHL 1T7WA 5DT1H 3AROA 3HNVH 4FQQA 3MV9E 1F6AA 1G7LA 1AGFA 2JB5L 3MQIA 4U1MB 3D39A 1VFAB 5E56A 4LSTH 3MMEB 5EU3B 4J12A 5BRZE 1A9EB 2X05A 3TP4A 1RUPL 2DM4A 2HJFB 4Z7QF 5D7IA 1M05B 3MZGB 2CLRA 2X09A 3NZHH 3VWKB 5FUOH 2YUWA 1A6UL 1V7ML 1D5BA 4WTWA 5E2VL 1E4KC 4APQB 1CLYL 3HZKA 3KPQA 1JPSL 4D9QD 5F3HA 1J5OL 3QIUD 4IMLA 4Y4FB 2EYSB 2J12B 3QDJA 1AP2B 3FONA 3CVHH 1NMAL 3TZVD 3L7EB 1J0ZA 4M7JH 1NEZB 1ZV5A 3CFKA 5C9JB 1OB1B 1FCGA 2A0LC 5FGBA 5I17A 3RPIB 3MLZH 1ZAGA 5GGTA 3VGAC 5HTSA 3HZVB 4GAYB 4GKNB 4ONHB 4OFYD 2ICWB 5E5MA 3P4NA 1I7UA 1HZHH 3OKDA 1DQDL 4MA1B 3BGMB 4P49A 3T4YA 4HIXL 4AIZA 4P46A 4UAOC 1GYAA 1VACB 3O3EB 2D7TH 4ALAH 3G6JB 2KL6A 3RIFF 3M8OL 4L3CB 3NACH 2DYPA 1S7TA 5JHDB 4YIQA 2C3VB 3WHE0 1F3JB 3SDXE 5JLZA 3WBDA 1I3GH 5D7JC 4P2RD 3KDMB 4WU7A 1E4WH 3V5KA 3SGJA 3E6FB 2XOTA 4GKSA 1IAOA 3QXDB 5IG7A 5ITBH 4KK8D 5DWUH 1OPGL 3MLVL 2H45A 1YEJH 4HMDA 1ADQL 2R23B 2VDKH 4KJWC 4BZYA 1OP9A 2PO6C 3RNQA 4GQPH 4RGNB 3QZWG 1LE9B 3WNMA 4XNXH 1JUFB 4OCXH 3X12A 3BW9B 5L9DL 4OB5L 4QRSB 4NQXB 3VXNB 5B39A 3O6KH 2YXFA 5E8EA 3CFBB 4OV5A 2FLRT 4K94L 4GXUM 4QXWA 4UT7L 5F9OL 3RVVC 3ES6A 1UJ3A 1MJ7L 5EFIB 5EOTA 5IW1A 3P4OA 3WFCH 1IEHA 5DEFB 4FQ1L 3UC0L 4MLSA 1AGEA 3BESR 3PWUB 3ARDC 1YMMD 4XCYB 5GJSH 3JWNC 3VXRD 5GGUA 4WJ5B 5F93C 4NC1C 5DDHB 2DLEA 4BZ1H 3O9WD 3L5WA 3LS5L 1IT9L 5ADPH 3DV6B 3W9DB 4J3XA 4NNYA 3ARPA 3DVIA 2MJWA 4RBPH 4EXKA 1MCQA 1QNZL 3MLXL 2BFVH 3JWDL 1Q72L 2AEQH 3BVNB 3NGBC 1HHKA 1OTTD 1JF1B 1C5BL 5D9SB 4PY8I 2YR3A 4LLVB 5DD1H 1FZJB 5ACZB 3C8HA 3EGSA 1U95B 3VG9B 4KTEL 4RZCB 3RTQA 1T20B 3HG1B 4PG2C 1YEHL 1T7VA 3QPXH 3SKJH 4FN0A 1NEZG 1BFOB 5HDBE 1FNSL 3UTPD 5DD3L 2A1WH 1MIEL 3NAAH 3HS0B 5LCVH 2BC4B 4OCRH 1XGPB 5CUSL 1ZT4A 3SPVB 4WO4A 4XVTH 3DECA 4X6CE 3PHQB 4KVCH 1LEGB 4DAGH 4YHPB 3G04A 3BH9B 5H94B 1BX2B 5HGAB 2A6DB 2HFEA 4DQOL 4OZIA 3QUMA 4P3CH 2YD3A 1NCAL 5FEBA 4EI5B 2FIRT 2DLTA 4PJIE 3WXWH 3RGVC 4ZSOB 4LF3B 4ZFZA 1YJDH 1YMME 4J8RA 4JY4B 1JN6B 3RFZC 3VXRE 2R0LH 4MJ6B 3RI5F 5AUMB 5DEGB 5C0DB 43CAB 3NFPB 4Y4HB 1CE1H 2RB8A 2FIKB 1HKLH 3QCUL 4ZS6D 5C71A 1RIVL 2KBGA 4U6VH 5I0DA 4RA3A 3QG6B 5DF0A 1RUQL 3MOBH 1OSZB 4MQSB 5B4MC 3FB7A 5HVFB 4KC3B 1CCZA 3DX6B 4LKCB 3I3EA 4IJ3B 4QRRB 2DBLH 3NFSL 5EBLA 4NM4L 4JO4L 4GW1B 5BV7H 3VMOA 3UTPE 3CCHB 4HKJB 2EYTB 4EDWH 4UT9H 1QKZL 3I75A 1FLTX 1S7XA 2IPTH 3TJHC 5D1QD 4FFWD 2H32B 1D6VL 1U3HC 1MLCA 3DUSA 4G7YH 4J1UB 4R7NB 3R1GH 2PR4L 1SVZA 4XVJH 2AABH 5DHVA 2HJKB 3WV0A 5FAAA 2DAVA 3KLAB 3ZTNH 1EO7A 3H7BA 4ZTOH 1RZFH 4NPYA 1L6XA 4P23D 4OLWH 5D72H 1U8MA 1PG7L 1D9KD 1NDGB 4KMTL 4UV7L 2BMKB 4M9PA 4CU8A 1C08B 1MCJA 5CJQH 5CWSA 3P77B 3FMGL 1MQKL 2XFXA 4YHLL 3ARFB 1S7UA 4P9ML 3PGFH 2VE6A 5AG8A 1J87A 4X99B 1KJVA 4OCSH 3TA3C 2XN9A 3MLYH 1JHTA 4W4OA 1HH6B 1J0IA 3BGFB 5I8CB 4JB9H 1A8JH 1ZHLB 5E8OB 2FWOA 4YO0A 1Z6JT 1N2RA 2XNAB 3HR5B 32C2A 1MSPA 3LKNB 1PEZA 4OGAD 4HW6A 4HS6B 4LVOB 5ERWB 3CGTA 1YEDB 3UPRB 3CDYA 3TN0A 3UYRL 2DDQL 1XFPA 1NMCB 4AMKH 1WV7T 4C56D 1JK8A 5L88L 3IDNA 5DQ9A 4PJXF 3MRMB 4FS0A 1A4KB 4YK4B 2NZ9C 1T89C 2ID5A 4BZ2H 3PP4L 4CGTA 4M7KH 1M7DA 2J5LC 2I25N 1JWSA 4OQ1A 2YBRB 1KYOK 1I8KA 5C2UB 3QPQD 1W8OA 4LOUD 1CU4H 2B2XL 4OUUA 4Y1AA 4OV6F 1PFCA 4HWEL 3AB0B 5ENWA 3LKQA 2XWTB 4X6EB 1G6RB 3MACH 5EU5A 4HUNB 3VH8A 4ZQKB 4P4KB 2LFGA 3MXVH 4PRPB 4C4KO 5D2LE 1I8MA 5IV2B 2VDPL 3EBAA 3HE6C 4ZFOB 4WW2C 1FL3B 1FNLA 1AR1D 1NUGA 5HHOD 3RIAK 1A6VL 1UXWA 3GMPB 3TBTA 4GG6A 2H1PL 1EUUA 1T1WB 4PJFE 4L4TD 2J8UA 5KN5B 4R7DA