1ZWIB

Structure of mutant kcsa potassium channel
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords monoclonal antibody, heavy chain
publication title Molecular determinants of gating at the potassium-channel selectivity filter.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/ion transport
total genus 47
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zwiB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zwiB01
1FVDB 3OGCB 5LWYL 2BHYA 3C9NA 2D7TL 1A2YA 4M3KB 2BCKB 3CAFA 4A6YA 2AJVH 1NAKH 1U58B 2C9AA 3CDGB 3QFJD 4NQXA 4G8EB 5AD0B 2G2RB 3FO2B 3DUSA 4YO0A 4MSWB 1FFNA 4CADB 3MV9D 4WNQA 2A9ML 1ZLWK 2CK2A 3HNSL 4XHJD 1J1PH 4XP9L 5A16A 1BQSA 3SHSA 3RWIA 5IB1B 2ESVA 2B1HH 4H1LA 4LEXH 3CX5J 4E41B 1AHWB 1AQDB 4I0PC 1HI6A 4DGYL 1BOYA 4JFYA 3LEXA 3VGBA 4GRLC 1XT5A 4RFEA 4MCYB 4L29A 3TBTA 1RJYB 2E7CA 3GMOB 4GXUN 3GO1L 2X4UA 3QDMA 2P5EB 1FZOB 2XN9D 2NW2B 3QNYA 2PO6A 3BJLA 2DLTA 4TSCL 4JDZB 4EI5B 3LQZA 4OCRH 3I6LD 5EFIB 1P2CB 1XGYH 1JHTA 4JLRA 4RAHA 3ZYJA 5KG9B 1BAFL 1NFIA 3HB3C 2JIXD 4JGUA 3RWCB 3NZ8B 4F7MB 5IMLA 5L2JA 4WDIB 5HHPA 3O3DB 4I77L 4TPRH 4PJ9A 5KSBB 3W9DB 4YHLH 1TJGH 1WF5A 3UBXG 1QSVA 2ZUWA 5GSVA 4OZIA 4PJIF 4C55A 2LAAA 1SBSL 3MNVA 3U2SA 4PV8A 2F5AL 5IFAL 2OL3H 4XP1H 2HFEB 3WIFB 1MI5E 3MYZA 4YDKL 3NTCL 1INDL 1I1RA 1U8QB 1NDGB 2DRUA 4LASL 3QISA 5IVZB 3SGEI 2YBRB 3QEGL 1CDJA 3PV7A 2OQJB 5IV2B 1NBVL 2WBJD 3WFEL 4M8QA 2XA8L 3T0VA 4HWUA 1LD9B 5I1LA 4JFOB 3T77B 5DTFA 1CGUA 1EJ6A 2W91A 4CN4A 5F9AC 5C0JB 4YH6A 3VXQB 3GSOA 4GBXC 5F89A 4PYHA 4UT6H 1F4WL 5KS9A 3U46B 4AH2A 4I0PB 1OTSC 3EYOB 1J5OH 4JFDE 1CLCA 4WW2A 3OAYH 4GRLB 4POZC 4LHUD 4I2XE 1BD2D 1XEDA 4HK0B 3WEXB 3V0VB 1U95B 2DQFA 2CRMA 4NDMB 4DTGL 5EORL 4Z95L 1AQKL 2R0KH 4HWBA 4YFEA 1L7IH 3QSKB 1N7MH 2VERN 3CFJB 1EAJA 4LL9A 4HDIB 4KHXH 4PG9B 3VXPB 4R0LA 4PJGE 1EAPB 2NY5L 4Q9CA 4WENB 3U4EA 2PTTA 1FPTH 4PJXE 5DUML 3NMEA 3KPMA 3QG7H 1FDLL 1IC5H 2UY6A 1NCTA 4YUEL 3D3VB 4O58H 4TVPL 3TWCH 4LQFH 1HHJA 1QLEL 3QFDB 5GRUL 3CLEH 1MVUB 2GAZA 3OZ9H 3TIEB 5BOZG 5DRWB 1JI1A 5FYLE 3BZEA 5TH2A 4EUPH 4L8SC 1SVCP 4MNQB 4PY8I 2BNUB 4ZTPH 1AGFB 3MV8D 1BF2A 3PQYB 1RZ7L 3ARGC 2VLKB 4HW6A 3H7BA 4N0FB 2NZ9D 2NQCA 3R8QA 4HULB 2WNGA 3VWKA 1SYVB 4KI1A 1FCCA 3NCMA 5IGXH 5JMRA 3QCVH 2IQAB 2HVKB 1P4BH 4HX1A 1XF3B 3IU3B 4FP8L 1HOCB 5DC4B 2A6KA 1JVKA 3LN9A 5D7IA 3DX6A 4LSSL 5D1QC 1TVHB 2GTZA 2VDPL 5BZDB 3BO8A 1Y18A 1R0AL 5D1XD 4O00A 2B1AH 4AEFA 3W2DL 3HNVL 3FB8B 3JV4B 4G80A 4L3CB 5EU3A 2OL3A 3DVIA 4GBXB 2VC2H 5ITFB 1Z9SA 1G9ML 1ZT4B 1Q0YH 4DWHA 3PP4H 1JUFB 1DVFC 2WIMA 4HGWB 4JQVA 5FCUH 1T83C 4QRQB 2XKSA 4AENA 3TO4D 2ARJA 1I7UA 3MFFB 1NCDH 1E4WL 3T3PE 1RK1B 3FQTA 3FOMB 1J1XL 3ARFA 5C71A 2VQUA 1BF8A 3LEVL 5HHVL 3CFEA 3NFPA 4P5TD 4KI5D 1YEDA 2DQDH 4HUWB 1G7IB 2BFVH 4Z7OF 5KTEH 1UQSA 3P3YA 4XH2B 2BNQE 3M17B 1A4KB 1EFXD 1MCDA 2YPLE 5IROC 4PRHE 5ID1A 4G5ZL 2NTSP 4KMQA 1QFWL 2VZUA 4PJ8D 4OZHF 4HKJB 5D70L 3ZKSD 2Q3AA 4HG4K 3IDMB 4N8VG 4XNXH 4WCYH 2F74A 1KOAA 1N5YH 1NCUA 2YWYA 1U8OA 2AEIT 4U6XB 2VDNL 3U0WH 1NGYA 1OTTC 4I9WD 1CBVL 3WFDH 3OJMB 4L8BB 3EYUH 5K59F 3EJYC 1I3UA 4P5MB 1FE8H 5TJWK 2FJFB 1QRND 3BW9A 2ADGA 5JDSB 3MGTB 2A73A 3QXDA 1IGFH 4NO3A 1K6QH 4OF7A 5ETUA 1CDGA 2E7LA 1HHHA 1F4YH 1HYRC 3CFDB 1MCJA 4PJFB 2J88L 4NBZB 2CPCA 1YEIL 4ZFZB 1J8HB 3G6DL 1F4HA 2HJFA 4OM0L 1PX4A 1S7UB 1BGXH 5I30H 4P3CH 4ZUSA 4XPHH 3UTZB 3SO3C 4X6EA 5IFHH 5AZEH 2Y7QA 4KPHH 4NCC2 2DDQL 3VFTA 4GRWE 4JPVH 4ZXBA 4OGAC 2SEBA 1DVFB 3L5WA 1UZ8A 3D39D 2K9UA 2DQEH 2CMRL 2WQ8A 3D0VA 4KKAD 4OD2B 3GSNL 1T1WB 2YHGA 2VLLA 3PXJA 3KXFA 3GJFH 3B9DA 4U1HB 4HIIA 5HYSA 2GY7B 4NT6B 4PJCE 3MRPB 3DX9A 2M26A 2B5IC 1E4XH 3MC0A 3T1WA 1QFWI 4UQ2B 3FB6B 5J12C 1OF2B 3VXSE 2DBLL 1ZHLB 5DMKB 4R7DA 4YR6A 3STZB 4GLRI 1C5DA 4H5SB 5HHXL 1W0WA 4MQ7B 5E8PA 3SCMA 3KS0H 3FCTA 3OR6B 4M5ZH 4GFTB 2IPUG 3RKDC 5BS0E 3O8XA 2FGWL 5FUOL 5DQJB 2D31A 3NIFF 3FKUS 4Z0BL 5C0AD 5BZWB 1EDQA 4X9BA 1UH2A 5HHMD 1EEZB 2H2PD 4NYLA 4IRSD 4AEEA 5ADPL 1M71A 35C8L 3MLWH 4F2MA 3S37X 1FVEA 1FJ1A 1PG7L 4Y1AB 4Y19D 4JN2B 1BBJA 5JXEA 1JHLH 2ADJA 1CGWA 2X4NA 5JUEL 4CVWA 4Q2ZB 2P46B 5DJYA 1LP9E 2GKIA 1C08B 3O4LE 1QKZH 5SWZA 1KXVC 4HIJB 3TBWA 1CE1L 4LPYA 3AAZB 2WAHA 2WQRA 1YEKH 4PRBA 1MUJA 3KPPA 3EHBD 3AMKA 1XIWD 1HNGA 4MD0B 1MHPH 2VLRD 1IL1B 1LO2H 4ODSL 3DURB 2DN7A 4NPYB 1OSZA 2W0FA 1CGVA 4U1MB 3BYTA 2RCSH 5ESVA 2ESVD 4XMKH 4XB7A 1EH9A 2XNAB 1JN6B 4NRYA 1E6JL 3EYQD 2W0KA 4P4RA 1D9KA 1FVCA 4JY6B 1SMOA 3O6FC 3S3SA 3SDXA 4EBQL 4NRZB 4W6XB 4CMHC 3L9RA 3S9DB 3TP4A 2MHAA 4RBPK 5HD8C 2E27H 4Y5YA 2IGFH 1XR8A 5DMGC 4XAWH 4XC3H 1JYXA 3EO1B 5H94A 4L4TB 2BSED 5JO5A 2B5IB 1IGIL 2D03L 4HJ0D 4OLVH 1MCKA 3HAEG 4NQDD 4ODBD 2Y9RT 3D85B 2VR4A 2PO6D 5J12B 2X6MA 1WC7B 3RWJB 1AKJB 3W11C 4EOWH 4LVHC 4RAUB 5F3BB 2FL5A 2LABA 2EE3A 1IQWL 4GW1A 1GGBH 1JPSL 5JOPD 4S2SB 2L7UA 5TQ2L 5H35A 8FABB 2IJ0C 3U1SL 2AJXH 4UUJB 1C12A 4D94A 4LEOB 3VFNB 2G75A 3VXRA 5HYQB 3OB0H 3OX8A 1R24A 1LO5A 4X98A 2WUBL 2IPKA 4S1DC 5BJTB 1MFEH 5CCKL 1ADQH 4Z7UF 3V0WL 1GCFA 5B8CC 4NKOA 5GHWL 3QUYA 1Q9WB 3V8OA 1VSCA 1I7TB 3C5JB 3EGSA 4HLJA 1BLNB 1BQLH 2BVPB 1UM4L 1Q94A 4I0KA 3PP3K 1NBYA 3RUGE 4L3EA 4GRMB 3RX7A 2IANA 3JVGA 3RA7H 5F9OL 3DX7A 4JO1H 5DURB 4YPJA 2NNAB 4ZUWA 4CU7A 3MRQB 3OXSB 2PYEA 1T03H 3BH9A 3L3HB 4LLYA 4NO5A 1QPPA 4JZNB 5E8EB 1OAUL 5INCA 1YNLH 1WIOA 4LGSB 2OZ4H 5CMAB 1F02I 4JFXB 5HI5D 5DHXB 2A6JA 4KQ3L 2IG2L 4N0UE 5FHBH 1LO0L 1XGTB 2X4RA 4Q9QH 4RAVA 2VLJA 5GISL 5L0QC 1NCAH 1RFDL 2AV1B 5D2NA 1NMBL 3IJSA 4JKPL 5C9JB 4WTZA 3I75A 3O6FB 4H25B 3LB6D 2FO4B 3OG6B 1PZUB 2DWEB 5AZ2L 4CMHB 1UXWA 4OFYD 4JQIH 3L3IA 4LSVL 4OD3H 4RGMC 5CKGA 3UYRH 2XA3A 4PJEA 1MLBB 2VQ1A 4NHUA 5ESAB 1UKQA 4DAGL 3G5YA 1ONQA 2R9HD 4NQCB 2GQHA 3ZYOA 1D5IH 2WP3T 3L7EB 2JJTA 1G9EA 2DM3A 4GH7B 5F6HJ 2XZQL 1ZS8A 3OR7B 4JR9H 2ZNXA 4LVHB 2RFXB 4ALAL 4PLOB 4P46D 3MRRB 1YMME 1NGPH 4H26A 4Y4KA 3TH4T 1AO7B 3M8OH 1ZA6B 3CVHH 3O6KL 1MCPH 4RGOL 2APXA 1J0ZA 2BCKA 4X6CE 3QWRA 1QLRB 3DV4A 2CJUL 3BAEL 5TF0A 4ZSOB 2IAMC 4N0YL 3BDXA 1P7KB 4W81A 4Y8AA 4MNGA 2ZUYA 3B8YA 2AJ3B 3CMOL 3GI9L 5B8CB 1WGOA 1FZMA 4XRCA 4EZMA 5KS9F 2IBBA 4POUB 4Z7VF 3SY0B 2H3NA 3H3KA 1FL3B 1RY7B 3ROLA 4MJIB 4PJDE 4LAJH 4D0DB 1K4CA 4ETYA 3GMNA 4UTBL 4XMPH 1KJ2B 1HIMH 3U4BH 3WSQH 5JW5B 3FFCA 1ORSB 2EZ0C 1KJVA 2Y6SD 3ZE1F 4UV4H 4PRPE 3GSWB 3IDGA 3QQ4B 4GW5A 4Z78A 4NBXB 2V7NA 2VUOA 5T1KA 2ICWA 4WO4C 2BOBA 1OGAA 5HGAA 1CFNB 5EO9B 5HYIA 1F42A 4A6YL 4FFWC 4X7SL 4ZO7A 5L0QB 3TJHC 3AMLA 2J8UF 4OI7A 3MRGA 4H8WL 1TQCB 2XKNA 4HS3B 4FA8A 3PABB 4M7ZC 4JM2D 2DICA 4KAQL 5EFIA 3TO2B 4KK5C 1ETZA 2KPNA 4PJBF 1JPFB 1IEAA 2R29H 4OLWH 4O02H 4YPGA 4OLUL 3V6OE 2QQLH 3VXMA 3WJLC 2OZ4A 1HXMB 3KYKL 4RGMB 2H1PH 1N3NA 2VQTA 4JANA 3S35H 1EJOH 5DUBB 1OHQA 2IQ9L 1MAJA 4LRNL 3T4AA 2VLMD 2F15A 1T7WA 4G9FA 5I8CB 2H32H 1KPUB 1UH3A 4APQD 5IB5A 3GKWL 3KYMB 2QL1A 4HS8H 3O6ML 1N6UA 5C7XH 3QFJE 3VCLA 1QR1B 2HFEA 2GK0A 2YK1H 1CN4A 4PTUA 2IH3A 4U6VH 4I5BB 1MF2H 3MV9E 5KVEL 1RIHH 1GGIH 1LEGB 2QSVA 4G7YH 3FN9A 3VGHA 2YBRA 5E24E 5FKAB 1JHKL 4FG6C 2B4CH 4Q6IC 1UM5L 2IAMB 3DOSA 5C0CB 3T4YB 2ZUUA 5JHDD 3RVTC 4NWTL 1KB9K 5EWIH 1FIGH 2A83A 4X6DA 1QP1A 1WV7T 3DRTB 5D8JH 1U2CA 1Z0NA 1CD8A 3T1FB 4X7EC 3PJSB 1TQBC 1I8MB 4ZOBA 5H37G 3CVHA 4LMQE 4M00A 3CJJA 4QWWD 4ZNEE 3L6FB 2H41A 2R1YB 4WHTB 1ZGLP 2HRPH 3G04A 3SQOL 2DIAA 4WEMB 4HK0A 3ELAT 3UZEA 1JZ8A 4PGZA 1ZVSA 3EYFB 3WUZA 3L3DB 3HC3H 4WO4B 2Y07L 4LCYB 5MEQB 2CDFA 1V8HA 1S78C 2X9WA 4WHCA 3VFSA 4DK6A 3FRPG 3O2WL 3DI3B 3HMXH 1LDSA 2D9QB 5E6IA 5ANMA 4YQXL 3DHMA 5CZXD 3LIZL 4TRPL 4ENED 1N64L 3RDTC 4M7ZB 4XWGL 4I3SH 2A6IA 4UDUA 3IT8D 1VERA 3OG4B 3PWJB 1KBGH 1VESA 3PWPB 5A2LH 4OGXL 3BUYA 4OZGE 5J6GA 5ID0B 2PF6A 5FECB 1U8LB 4C57C 4RA0C 1A9BB 5HVHB 4X4ME 2JB5H 2Y5EA 2VZOA 2PW2A 3TA3A 4Z6AT 4XPTH 1IT9H 4LGPB 5EBMB 3RJQB 2RR3A 1J1PL 1QQDB 3ET9F 5I15L 5IW6B 4HWBL 3VD9A 2IQAA 3O81A 4PJ7E 2QHRL 1OB1B 5DWUL 2HLFD 3RVXD 1BFSA 3GJEA 3O3BA 4KKBC 4XCCH 5DD0L 4RQQA 5DI8A 3O2DH 2YMXL 3BVNA 1IQDB 2EE6A 3SEPA 1QLFB 2FH6A 4UT7L 4QRTA 1U91A 3NIGF 1MRDL 4JRYB 4UI2A 4Q6IB 1KELH 2YOCA 1ZOXA 1NANH 2P4AB 3MUZ1 4P23D 5JXED 2H32A 3QXVA 4MB4A 5F1KC 2J2ZA 1MJ7L 4FQCH 1TQBB 1BD2E 2BERA 4XNUL 1DZBA 1ZLVH 3T2PA 2O5ZH 2ICEB 2XY1A 5I6XC 2VDOL 2OXGA 3STBA 3ILQD 3QZWB 4OCRL 1AXTH 3MV7E 3VJ6B 1X5FA 5B3NA 1XGYL 2QKIB 2FECL 3FOMA 5JZ7D 3UTSD 2W60B 3NIDF 3NFNA 3SDDC 5CJXA 2BRRH 3LN4A 3NBNA 1H3GA 3VFOA 4CJ1A 1DR9A 2A74B 1FAKT 3QDGD 5DS8A 3FAXA 4MVBD 5C0ND 4IDJL 4F8QA 3VXUD 3QDJA 5DRZA 4XCYA 2IH1B 3RGVA 3SOBH 4TPRL 5HXMA 4XWOC 3OJ2C 3WHE1 4M6MH 4YHLL 4JM4H 3STLB 2YEZB 5EIIA 1XGRA 2GY5A 2V2XB 1RU9H 2F19H 1TFHA 3RDTB 3U48A 2YRLA 2W92A 4A2MA 1CXHA 4YBLB 4UIKH 3WFZA 4JGMA 2OL3L 2HJLB 4WUUB 4XP1L 4Y88A 3MRKB 2VXTL 3K80A 2HAZA 1WUNT 4FQLL 4M4PA 2BMKA 4L8SA 2XRAH 4KROC 3VFUB 2UZYB 3U36A 3HMXA 1QVOA 1BEYL 3HI1A 1YEJH 5EU7E 1UVQB 2E6JA 4L8BA 3TBVA 1UYWL 4J3SA 3ARGA 1AGEA 2IF7A 2OSLA 5ACZB 4JKLA 4NKMA 5J1AB 2Q1EA 1ZTXL 2HH0H 4IOFD 4OZ4A 4PRIB 4FTVE 2BVQA 2AERT 2C5DC 5EU6D 1KF9B 4X8JB 3HLAA 2OJEB 4P9MH 4J4PC 3TN0D 1AD9A 3LMJH 5LGHH 3T65A 4K3EH 1URLA 5EOTB 3VXRD 1A4JA 4ELKB 1G6RB 5CHNB 1XCQB 2PW1B 2V5SA 4F7EB 1INQB 5A3IC 3WUWB 4JO4H 3IETA 5D1QA 3DXAE 4XZUA 1M7IA 1V7NH 5CBAB 3HZMB 1IAOB 3EDJA 3QUYD 5CJ5A 4QOKB 2FECI 5LXGL 1L7IL 1YMHB 3ECBA 5EBWA 3UPRA 2GJZB 2ZSWB 4KHXL 2XWJB 1A14H 3L1OH 5CZKA 4IEFB 1E4KC 5I6XB 1MCEA 2Z31D 1XFPA 1IC5L 5M94B 3OAUH 4EDWH 4N1EA 5EPMA 1AJ7H 3TWCL 4LQFL 5ERWA 2P5WB 4KI5E 3SDDB 3OZ9L 1JNLL 3MRPA 4XPFH 3G6JE 3BZ4A 1YYML 1N2RA 4LRIC 2HTKC 4JFFD 2VLJD 5E2TH 5LQBH 2R39A 5JOFB 4XVSH 3GHBL 3T04D 4ZTPL 4NQEE 4OZFG 3TYFA 1DQJB 3JWOC 2ZUQC 2DQCH 3RIFF 3REWA 1SJVA 5EB9A 5D7KD 4OKVB 3W0WB 5ISZD 1BQHB 2R4SH 1SY6A 2BDNL 3JTSA 4DZ8B 1UACH 1P4BL 1Q9OA 4YJZL 3BP7B 3PF2A 1KLGB 4C56E 3TFKC 4Y4HB 1U6AH 3IFLL 3JUZA 4KROB 3RKPA 1REIA 4MNHB 3GMQA 1U8MB 5IHZA 4YHMH 3CMGA 4QHLA 3ULSA 3GIVB 2GYSA 4TSAL 3K3QA 1F6FB 5TDOA 3GEWB 2F54D 2R23A 1A7OH 4F8TA 1KJMA 2B1AL 3T0XA 3O4OC 1FZKB 2VOTA 5KN5B 3HI5H 3KPNB 3QDAA 3SKNA 4AM0A 3QHZH 3TT3H 4M3JA 4PS4H 2F53B 1VKXB 1KLFA 5F96H 3CPLB 4JQXC 5TGBA 3RIAF 1KCRH 2PCPA 2X4TA 1KXTB 1QSEE 2EYRB 2V2WA 3Q6GH 4MXQD 5K9QI 4F7TB 3KYNA 1I7RA 3OKEA 1BVKB 3CXDL 1NCDL 5IVXA 2EDYA 3HZYA 2P48B 1WFTA 1H3WM 1E28A 3RY4A 1D6EB 1HKLL 3NCYS 5JMOC 1WT5C 4OB5H 4BFGA 3D39E 4NNXB 1IKFL 4UNTA 4E41D 3BZDA 4HWNA 4LVOC 1C16A 3BXNA 3IU4L 1Q9KA 5I8EA 3E0GA 5E2VH 4KVNH 4U1KB 1R3JB 5L88H 5IM7B 3JWDC 4NZUL 4L5FL 3UTTA 2BFVL 1JTPA 5KTEL 5EU5A 5DK0B 1NGWA 1T1XA 5SV4A 1HYSD 3IYLW 4UILH 2X4QB 3L3KB 1EEYB 1TITA 3C2AH 3AXLB 5CFHA 4MX7A 1MFDH 4WCYL 4XNXL 1N6QL 1N5YL 4P5KB 5F7FA 4EI5D 5D1ZC 5FGBA 5C0AE 3MGOB 2ZUQB 4JY5H 3EYUL 3EO0A 2CGRH 1FE8L 1NUFA 1YN7B 1HILA 4PG2A 4RFNC 1DTUA 3W81A 1K6QL 2CRIA 3V79C 5FO7A 3ABZA 3B2UC 4X0KA 2ADIB 4Y19E 2R4RL 1TVBB 3VXOB 4PP2B 3ZTJH 1CLOH 3EIFA 5TDPB 3WNOA 1UWEH 4ZFOA 3UEZA 1U3HA 3OPZH 3UDWC 4AK1A 2O61A 3CXHJ 1BGXL 3H9ZA 5I30L 2NX5B 2ZKHL 5AZEL 1LDPL 3O4OB 3Q6FA 2VLRE 2CXKA 2H26B 1X5ZA 4UINH 2V5RA 1T04B 2D7OA 4GQPH 2NNAA 2P45B 5EOCL 2R2BB 4QXUH 1HEZA 4PJAF 4PLNC 4NO2A 2ESVE 1PAMA 5FHAL 1I7ZB 4XCNA 3VFRB 2CIIB 2N56A 5C09A 1V3KA 3G9VA 5DJ2B 1DBJH 3ZDYF 3S96B 1X5IA 4LVOB 3UBXB 2MQCA 4I0PD 3SN6N 3SJVA 4HUNB 5IF0A 2LV4A 4H25A 1PKQA 2EDDA 2PTUA 4GRLD 3IB4A 1CD9B 5EC2A 3QDME 3IS0X 1Z0MA 3DJ9A 4M5ZL 1VACB 4ODHH 4ZAKA 4P59L 1N5AB 3G5VA 2HTLC 2M8XA 2CR6A 4MMZC 1ZAGA 2GIYA 5FO8A 5E70A 5GRXG 1KPRB 3N1MC 3B8SA 4HIEB 3MLWL 2AKRB 3JV5A 5D1ZB 5JOPE 1TXKA 3BKML 4H1LG 5JPMA 3BPOC 3GSQB 5IHLB 3BESR 3HB3D 4RFNB 1QKZL 3T0WA 3T0AA 3WE6A 1J05B 5AYQA 4Z7QE 4OZIE 4X4YA 3O3AA 1B0RA 1KIPA 4MQTB 4MNQD 4NKDA 2KKQA 3BQUC 3DRQA 3VRJB 1MHPL 2DQIL 2DWDA 1LO2L 2ATKB 3PQYD 5KBNC 5FV2A 4X6DF 5EG6C 5F88A 1G7QA 2HP4A 5I19H 1EO5A 1VGKA 3SY0A 2XICA 4HKBA 5GJTH 1MI5B 3B9KA 5FUCE 3LN5A 3I02A 5DQ9A 3MNWB 3QXUA 4GS7C 1DUZA 5JIIA 4XBEL 3QQ3A 5I8OH 1HE7A 3FMGH 1M7DB 2RHEA 4GG6A 2VSDA 5ENWA 2OBGA 2WINA 4H88H 2E8ZA 1SEQL 3ULUL 5HYEA 3H9SA 4OLVL 1JWSA 4GBXD 1PYWB 3P73B 4R4NC 1OTSD 1FG2A 1NC2B 1YPZA 2DLGA 3H0TA 4JFDB 5D2LA 5DO2C 4EOWL 5A40E 1RD6A 4I2XB 5CD3B 4MDIB 4POZD 1A5FH 1SYSB 1CXLA 2WUCL 2VABB 2PXYA 5SWQA 2J6EH 3HI6H 1VGEL 3AU1A 3ARBC 1IAIM 5EZOL 4ODUB 1UZ6E 4F3FB 4JZJA 2AJXL 4UU9A 3V8CA 4HF5H 1EIBA 1IM9B 4RIRB 1TCMA 4CW1B 3NACL 1IEBB 1NH6A 1IBGH 4Y7MA 4LLMA 4DKEL 4XXCA 5CIPB 3FOLA 4ONHB 1MFEL 4XVUC 4HUVB 2FATL 3F7VB 3TZVA 2Z35B 1YNTB 3BPOB 4E5XA 3TNNA 3IAQA 1BQLL 2HYMA 3FFDA 1RUMH 4YNYA 2NTFB 4ZOCA 4JVUA 3RVWC 3RA7L 1G7HB 3GSRA 2GFBB 3KVQA 2XFXB 4R90H 1BBDH 3BQUB 4HC1H 5GRVK 2Q3ZA 2EDKA 5B38B 4Z7NF 5FA4A 3ARGD 3IVKA 2WSKA 1YNLL 3N1PC 4ZUUB 2OZ4L 1X5JA 5FHBL 1X7QA 5T33H 4MAYC 2NXYC 3BWUC 5D7IE 3WLWC 1Q8MA 1KTDB 2CDGB 3DBXB 3GSVA 4U0QB 4RRPA 4WHTA 1UT9A 2W9EL 3DIFB 2DMCA 2X40A 2VIRA 3MCG1 3CK0H 3ORJA 3TPUB 1T20B 4G42A 4JAMB 1J8HD 4K7PL 3VFVA 5I1JH 4GS7B 5D1QD 5FAAA 1XH3A 3DI2B 3ULVL 3OKKB 4JQIL 4OD3L 1ZT1B 3TVMA 3SBWC 1FL6A 3UAJC 1K8DB 4N8VB 4WGVB 2X70A 4F37K 3GMMA 3P4MA 3BKYL 5EUKA 2APWA 1H8SA 4LFHG 1D5IL 1DVFD 5DJZA 4MYWB 5EZLB 1A6UH 5CJ8A 1JGEB 2DQHH 3RWHA 5HI3C 3U6RB 4GAGH 4XBPB 5FF6A 4Q9BA 3B83A 5I1AA 4ZS7H 2WLYA 2VXQH 5F9WC 2ICWI 3M8OL 1I9RL 3CVHL 3ARBB 2VLME 4MQXC 4TSBL 4QRPB 4KHTL 5I2IA 3C8KB 4XNQB 1L7TH 2DS4A 3I6GB 1BQUA 1JPST 2NXZC 2BNQB 2YPLB 25C8L 5F1SA 4JB9H 1L0XA 1I3RB 4MJ5B 4PRHB 2AI0L 2Z8RA 3WS3B 1GZQA 3MJ9H 4TYUA 4IOIB 2VUYA 1DBMH 3S37H 4IRZH 4Z9KB 2ZOKA 5GGVY 5JHDE 3RZWA 3U4BL 5CJQL 1YDPB 4Z0XB 1B6DA 1F5WA 4R97C 1AGDA 1OTTD 1JPTL 1T7ZA 4Y1AD 3IF1A 2ILLA 4UV4L 1H9VA 3RFZC 5TDNA 3MO1B 4RGNC 3EJYD 4Q58C 3BHBA 3KDMA 3F6IA 4BH7B 1LO4L 4KRMB 4B41A 3V6FA 2OTWB 3MLVH 3QCUL 4NN7C 3X3GH 1TJHL 4MAYB 4BSWA 2NXYB 4P99A 2QADB 2B2XL 1FL5A 2C3VA 1YECL 3OF6A 1NSNH 1TETH 1DQMH 1Q72L 4HC1A 2FYYB 3E2HC 5DHVB 4O02L 4JFPA 1XZ0B 4FS0A 4XXDA 2QQLL 1TVDA 4R8WL 3AY4A 1UWXH 3DPBA 5DGRA 4Y4FC 2X4SA 3FTGA 4GRWB 1JF1A 2H1PL 1RK0A 3GBNH 3LVEA 5K9QG 1CTOA 5IIEB 2QSCH 1EJOL 1I1AC 5J1TC 4OGAD 4C58B 3KXFE 3TV3H 2ITCA 3RDTA 4BZ2L 1ITBB 3PGDB 4RDQF 1N8ZA 4HS8L 3RPIB 1J86A 4WUUA 4PJCB 4RMRA 1PG7W 3VGGA 2DF3A 1BFVL 4G6ML 4HS6A 5F9WB 4L4TD 1OAZH 4U6VL 5DT1H 3UXFA 1RIHL 5EUOA 1HH6B 1PQZB 2EYTB 1S8DA 3VXSB 3D85D 4QCIA 4TUJB 4NP4H 4XI5C 5C0IB 2UV3A 2X4OA 1AKJD 2B4CL 3H3PH 3IGAB 4JVPA 1CFTB 2BOCB 4HMCA 5GGTA 5BS0B 2NXZB 3RKDD 5EWIL 3WL9A 1FIGL 5SV3A 4E42B 1U8JA 3RI5F 5D8JL 4HLZH 5IP4A 3GSUA 4XP4H 1VFUA 3D0LB 3VA6A 5F1IA 2OP4H 4KRPC 5E5UB 1RI8A 5EZJB 1HINH 2OTUA 1IVLA 5FK9A 3PWUA 1MCHA 4V2CB 3K0WA 1KXQE 3QPQC 3MOAL 4R97B 4JKWA 3JXAA 3NZHL 4WFEE 5HYSG 2R15A 3VW3H 3HC4H 3I3BA 4RGNB 2C3XA 4U1NB 4MXVE 1T21B 1LP9B 1JGDA 3RP1A 3HAEB 5F8QC 1RZ8A 4JCLA 5HDBF 2VXUL 3HMXL 2CKNA 1FO0H 3HZKA 5SWSA 3S7GA 5DURD 4BFIA 3UC0H 5FYJU 1OWWA 3HCVB 3QXTA 2DD8L 1HHKB 5JPNB 3LD8C 2MTPA 4XNMA 3GI8H 3VXUE 3E2HB 3WFHB 2VE6B 3TESA 4MZ2A 3IDXL 2G9HB 4NRXA 3SDXE 4DOHE 4Y4FB 4K8RH 1XCTA 3B9VA 5DF0A 4WWKB 1F8TL 3O2VL 5K9KA 1I1AB 2XWBA 2P43B 4P57B 3O6FD 5FA3A 1NEZA 5C08A 4XPTL 2RQ8A 4ZUTA 1IT9L 4ODXB 3LKSA 4PRDA 1DN2A 4U1JB 3P2TA 3UCRA 5HD8D 1H0DB 2KL6A 3LRHA 5DMGD 4MWFA 3HE7A 5CEZD 4HBQA 1OW0C 1LK2B 2AEPH 3EFFB 4PB9H 4G6AC 4NQCD 4XCCL 1U8MA 1UEMA 5IQ7L 1ULVA 4M7KH 5I66A 3W11D 5FDYA 1DLFH 4MA7L 3ME0A 1UA6H 5AYUL 3PNWB 4M1DH 3VXRE 2YPKB 1AO7D 5J6HA 4FQCL 3R0MA 4KRPB 4RZCB 3CFBA 4Y2DC 1QO3A 5HGDA 3F62A 1JFQL 2UYLA 1AXTL 1AGCB 4MB3A 5IUSA 4XTRC 1BFOB 5DFWH 5J8OA 4S1DD 3LKRB 4JO2L 1AR2A 1SY6L 5DD6A 5AG8A 1V3MA 1A7RL 2DYPA 3RL2A 4L3EE 2BRRL 4KZDH 2IANE 1OOAA 4WFGE 4FQ1H 1U41A 2BSTB 2NY5C 4HCRH 5M95B 1VFAA 3E6FA 5IM7A 1WAAF 5KAQF 2PYEE 3RQ3A 2PUQT 2L4OA 4JM4L 1RJLA 1M1SA 3DVGA 4G43A 2F19L 1P7HL 3FONB 5C92A 4KGLA 1LK3H 3LD8B 4JFFE 2VLJE 3DMMB 4XCEB 4ZTOH 4L9DA 1HHGB 4DVBB 5D2NE 4N0UB 5KW9H 4UIMB 4TQEL 5E8OB 5D7KE 1OLZA 5ISZE 1A3LL 5AAWA 2DKMA 1AP2B 1YEJL 4JG1H 1SJHB 4ZQKB 1KENL 1T1ZB 3THML 4HMEA 4PJEE 1ED3A 3WIHA 4F7PA 3V6OC 4I48B 2DTSA 2PR4L 4R2GC 3MRFA 5GZOC 1NANI 3X11B 3BPCB 4JG0L 3BIKA 3LMJL 1ZHNB 4K3EL 4CMMB 5DEGA 4X4XA 5MP6H 3QQNA 1T1YA 1GOHA 3U7YL 2V5YA 1T6VN 4HH9A 3QH3A 5DDHB 2ED9A 4JFQB 1BX2B 2D0FA 1J0HA 5L8LB 3P4NB 5DHYA 3KYOB 3ULUE 1G9MC 1A6TB 2BSSA 3O9WA 1OVZA 1BFTA 5GRJH 2H26A 3OKMA 4I18A 4RA3A 2GJ6A 1VFMA 4X6CB 4LVNC 5JW4R 1TIUA 1NPUA 4WTZG 4EIGB 1B2WH 4MNGE 3L1OL 3P9LB 3NGBC 4JFEA 4M6OH 4Y2DB 3S36L 1GOFA 1Z5LB 5BMFH 3OAUL 2IAMD 4EDWL 1J8KA 4E9LA 1IEHA 5C0CD 5DRXB 3MLTA 3FB5A 4LP5A 3RPKA 3CCHA 1KPVA 4XPFL 1LEIA 3CSYA 2C7UA 1WT5A 3L3OB 4PJDB 4QXTA 1RMFH 1YPZF 1BZQK 1QOKA 5D2LF 1F3RB 5EU4A 4ZFOL 2M1KA 3HN3A 3NA9H 5TE4H 2YWZA 2EZ0D 1OGAE 2ATPB 3QULA 3VDBA 4S1RH 4PRPB 5E08L 1BVZA 5E1AB 1N5AA 1V05A 3DO7A 5IBTL 4WO4D 5TF1H 3K81A 1MHHB 2DB8A 3FQXB 4LSRL 3S97C 3EW3B 2C3GA 4MXWH 2A2QT 1ZGLA 4FFWD 1NGQH 1U6AL 2YKLL 3X12B 1YYLL 1ZLSH 4HIHA 1F3DJ 4YHML 3VXME 4KK5D 1G1YA 3MRBA 3ZHDA 2YA0A 4WY7H 3C8HA 3PWPD 2NZIA 4R2GB 3NN8B 3FQWA 4HZLA 5GS0H 3MPCA 3LDBB 3HI5L 3QHZL 3TT3L 2GSGA 1A7NH 1W8OA 2VYRE 3EOAB 3EOBA 4KV5E 3IFOA 3QXWA 1U92B 5CD5C 3B9EA 2YSSA 1JZ2A 2OK0L 5J3HC 1KCRL 3ULVE 2ATKA 1JF5A 4QF1A 4LK4A 4M02A 4QXGL 1CF8L 1X9QA 4OCXL 1HZHL 1RVFL 2O5YL 5J4MA 4XP6L 4ZFGH 4GQ9H 4IMKC 4NZDA 1EXUB 4JHZA 4QGTA 2UY7A 2OX5A 3PHQB 1R5IB 3MV9B 2XXMB 3QCTH 4KJPC 5IWLC 5E2VL 4U6YB 5DEFB 4LVNB 2ID5A 4BFBD 1JWMA 1FAIH 3NGBB 1FRGL 4FG6D 5E5MA 5ICXA 3UTQB 3WIIH 3PL6C 1EX0A 4A2LA 1M7DA 3QNZA 1GL4B 2UZXB 4OUUB 3L5XL 4UILL 5C8JB 3RVTD 3QRGH 1I8KA 2DM4A 4JM2F 3C2AL 1WTGT 4ISVB 4HIXL 4BKLA 3LV3B 3H42L 3P73A 2Y5TA 1KTLB 2VB5A 3KNBA 5F21B 4QRRA 4XHQA 2VL5A 2GTWB 1T0NA 5TPWL 5BXFA 2VXVH 4JHAH 4AG4H 5IFJB 1VEMA 5C9KA 4W6YB 3IFNH 2CGRL 4EKXA 5IKCA 1M6OB 3L7FB 2JCCA 4NC0B 1CICA 1W0VB 4P3WA 4HUUA 3HC0B 1S78D 1NDMA 3R06A 4M48L 1NGZA 3HPJB 4FN0A 1F11B 1ZEAL 3BWAB 2GSIA 1TCRB 1WBYB 4YDVA 1DCLA 1UWEL 1H5BA 1H3UA 3KWWA 3C8DA 5I1KL 3RDTD 1D5XA 4R3SA 1F4XL 1T5WA 3WHXB 3MJ8B 4YXKH 1S7RB 4LCWB 4ZG1A 5MERA 4OZGB 4WUUD 5FCSH 4N0CC 5GPRA 3PQYE 4UINL 1AD0A 4ZPVB 3MRCB 3ALPA 1QHOA 2DLEA 5T3ZH 3VRIA 2IMNA 1KJ3H 2P8MA 3BQUA 4G6KH 5DR5L 3INUH 2O93L 5B38A 3LPFA 3HNTH 5IEKA 1B88A 4HFUL 2BC4B 3VD3A 5ICZA 1HXYA 2XWTB 3N06B 4PJ7B 3RL1B 1DBJL 2WBJB 3K2MC 5IR1A 1S7TB 2CDGA 4O5LL 5GJSL 1T89A 3C60A 1FNLA 1D5ZA 4UOJA 3W9EA 2I9LB 5B3JE 4DFIA 1IC4H 3GSNB 3E6HB 3P4LA 4IRJC 4KKBD 5KOVC 2FJGA 3D25B 2AABH 3VD5A 2EEBA 3PL6B 4IMLB 4ODHL 5KSVB 2GITB 4QT5B 3BT2H 3BH8A 3OJDA 1OAKH 4OLEA 4YC2B 4QOKD 3FRUB 4BH8A 3ZE2F 4LCUA 1KG0A 4MA3B 4D8PA 5TFSH 3P30H 4FQPA 1BD2B 1RHHA 4NGHH 3OL2A 4XX1E 3F65A 2HLAA 3VRLE 1K3IA 2AQ3A 3CSGA 3MV7B 4MJ6B 2JKXA 1KN4L 5HYJB 2E9WA 5B4MC 3K8MA 2P5WD 4I1NB 5D71L 3SDDD 3QDJE 4Z77B 1G7MA 2J7LA 2VKXA 1JZ5A 2P7TA 4X5XA 2AK1H 5CGTA 3WS6C 4ELMF 4OD1H 5EO0A 1CYGA 4H20H 1MFBH 4XWOD 3IJYA 5FGSA 3SE8H 3HPLB 5C08D 3VI4E 4DN3H 1T5XA 4FQXC 3BKCH 3W0WD 5CWSA 2QLVB 4PGDB 5J89A 5I19L 1RURL 5C3TA 4DKDC 2FBJL 4EDXA 1G7JB 4I4WB 5GJTL 4ETQB 1QFWM 3D87B 1C5CH 3A6BL 4J1UA 4O4YL 1S7VB 3U7WH 1R5WA 4KROD 4XX1G 4ZOEA 3I9GH 1OLLA 3GMPB 2YD4A 4OLXH 1J0YA 1GJIA 2EDEA 5MENB 3FMGL 4FTVB 1XGUB 2EO9A 4LCCC 5CJOH 4QTHB 5K93A 4H88L 4HJGA 4PJFE 5T1MB 2AJYH 4N8PA 3ES6B 2QQNL 3B6SB 3MFGB 3AVEA 4J4PD 4BSVA 4C83A 2F53D 5C6TH 3VH8A 3ZTNL 3S8WA 3LH2H 4OZFB 4QGYA 4F57H 1VADB 1T80A 1VFBA 3WYRA 4IRJB 2V7HA 5I1IH 3SDCC 5C2UB 1S7WB 4LSUH 3T09A 1A5FL 2PNDA 3TT1H 5A3ID 3DETC 2E7BA 3DXAB 1ACYH 2UUDH 1T4KB 4YXHH 1PY9A 1D6VL 1MFNA 1B4RA 2XTLA 2OR8A 3SBWA 3BSZH 1A1OB 5D9SB 1RZJL 3JTTB 1DEEB 5MEPB 6CGTA 4HF5L 2JJSA 4MCZB 4JPKH 1XF5B 4LPCA 5C2BL 1IBGL 1DSFL 3MROA 3CU1A 3GM0A 4KU1A 3QNXB 4IIQB 3HRZB 4PGEB 5DSCA 3G6JB 1DQDH 4CGTA 1WVZA 3HE6A 1DEDA 2ZCKH 4WI2A 3SQBA 3R4DA 3VFGH 2HTKD 4WHDA 3LRSB 4P2RA 5EBGA 1CQKA 1MJ8H 4NQEB 1SJEB 3V52L 4H0IA 3IDJB 3MR9B 2R69H 4HC1L 1ZWIB 4MAUH 1GGYA 4FABH 2C1OB 3CH1B 1YY8B 1FHGA 4FQXB 2YC1A 5BVPH 4QHNB 4U1IA 3GSXB 3QIUC 5T33L 1YN6A 5GGSA 4M7LL 4QYOA 4Z7WA 1DANT 1FNEB 1A1NA 3C5ZA 5GGUA 1TZGH 2DLFL 3DROA 1I9EA 3SGKA 4C56B 5E4IA 5INDB 2X4PA 1X5GA 1PVHA 5CKAA 2AV7B 3TFKD 3Q1SL 3ZE0F 3CK0L 4ONGL 3CFKB 3WDHA 2CXGA 1W8NA 1N4XL 3MREB 4OF6A 2FJHB 1UEYA 2DI7A 3DUUA 5FIEA 4G8IA 3MACH 4HV8B 2NX5D 2CDEB 3MRMB 5HDQH 3RWEA 3M45A 4LCCB 4H8WC 4N8CH 2B20A 3BOVA 5C0GB 3RBGA 4ZS6C 5JNYB 4LNRB 4YZFF 3QI9A 5IVXE 4JFED 3Q2CA 3HUJA 2ZUXA 3BGMA 1QSEB 3OKYA 1OAYL 4KKCC 3LKPB 4NM4L 5GGTL 5HHOB 5F1OB 3SDCB 1MHEA 5A2KH 4RDQG 2DQHL 4K94H 1Q9LA 4NN5C 4ZS7L 2VXQL 4DW2L 3GMLA 5FYKU 3D39B 4D9RE 4PJHA 3UTTE 1OAQH 3U9PH 3SKMA 2X41A 4U2ZA 1L7TL 5T3XD 1X4XA 4RMQA 4XCFH 2QHLA 1H15B 3WFCH 2EIDA 2UWEA 4JB9L 2KZWA 3UO1L 3MOQA 5LGJA 2IBZY 1Y6MR 3K7UA 5H2BB 2FIKB 3NA4A 3S37L 5BW7A 2VAJA 3PWLA 3FO1A 4IRZL 3RJDA 3MYJB 3RZCA 4R7NA 3QBTB 1E27B 5C0AB 4Z8FH 5D1ZD 4B7LA 4ACPA 2OJZH 4NNYA 4YDJB 3O6LH 3UJIH 1DL7H 4PJ9C 2KDGA 2EE2A 4EVNA 1BJMA 3QIUB 2BJMH 4QHKI 5DEZA 2ED8A 2X42A 2YUZA 3MODL 3X3GL 5BVJB 3GDBA 5KVGH 4L3AA 4Y19B 3B2UD 3F7RA 1U8PA 1IGTB 2JJVA 3S88H 2Q86A 4K3HA 4Y16C 4GUPB 3LKRA 1TETL 3HR5A 3N0PB 1DQML 5F71A 1LGVA 3V4VH 1XR9A 1IGML 2L0DA 2OCFD 2P42B 2LU3A 4A6YB 3KPLB 2EE9A 4NQXB 3P0VH 1DDHA 3TPKA 1I8IA 2D9CA 3V5HA 1CD0A 1BVLB 1MI5D 3DUSB 4YO0B 5FUCC 1FFNB 1NFDA 2ZG3A 4WNQB 2NW3A 2W1NA 1BREA 5A16B 3EOYG 2VDRL 3RWIB 2ESVB 4H1LB 4L8CA 4LCIL 1MQ8A 5T1DL 5GS1A 4YAQA 3IAPA 5DJ8A 2BZDA 1GZPA 1HI6B 2ERJC 1Z9LA 3I50H 3G5ZA 5F1NA 5DUPH 4JFYB 4NN5B 3MBEC 1FFQA 3LEXB 1KULA 4WW2C 7FABH 1OAZL 1PKQE 4OT1H 3MCKA 5GXBB 3NPSC 4L29B 3TBTB 4MA8L 2WIIA 1NC2D 4YHOH 1FLRH 4ZQKA 1JYVA 3RTQA 1LO3H 4PPTA 1IM3A 2X4UB 3QDMB 4MDJA 3WLBA 2ZJSH 4TUKH 1BZ7A 5KSBF 5GSRA 3SPVA 4P49A 2PO6B 3MCLH 3PWNA 2HTLD 2I27N 1ZHNA 2OP4L 3LQZB 3EBAA 1OW0A 4NZRH 4LPUA 1IM9D 1JHTB 4JLRB 1HINL 4IOSD 5LAXA 1GAFH 5DDHA 1NCNA 1NFIB 1CGYA 2Y36H 2P24A 4JVWA 4X9FA 5IMLB 5K9JH 1CL7L 5L2JB 5HHPB 2V5TA 2Q7YA 3V5KB 1DQQA 2CO7B 4G7VH 2LU4A 4XP5H 2OR7A 4PJ9B 4PV9A 5GSVB 4OZIB 3ZYZA 2CRYA 4GKOA 3CFCH 3JWOL 3VWKC 5IBLC 3MNVB 3U2SB 4U2YA 4HXBH 4PV8B 3UC0L 1MHCA 3BQUD 3KPRA 5D4QA 3WIHL 4Y16B 4U6HA 3FO0H 1OP5K 3S5LA 1B4JH 5ACLA 3GI8L 3V2AR 2NLJA 3UMTA 4M8QB 4XAKD 5IMOA 3SGDH 4DKAA 2P47B 3EYVA 3KLAB 3BMVA 5I1LB 3O11A 2YRPA 4K2UH 4GG6E 2DQJH 3NCEB 2JCCF 3GSOB 4JQVC 5LBSH 5KS9B 1JJUA 1LVEA 1WWCA 3FQXA 4N1HB 4AH2B 2ERJB 3MBEB 1F6AA 4WW2B 5EULV 2OYPA 3K1KC 3NPSB 4R4ND 2YPVH 5HSFA 2HKHL 2DQFB 1X3DA 3ARFC 5I74C 5ICYA 4M7KL 5GRZA 3JSSA 5DO2D 2D0GA 4XBGA 4XB8A 5D7JA 1UA6L 4RMVA 2HG5A 2AJSH 4M1DL 4P4KA 5ACMA 3U4EB 1CL7I 3ARBD 4NQUA 2PTTB 1KSRA 2IBZX 3KPMB 5T3XL 3F7YA 4QRPD 4NQSA 5E2UL 3V7MA 5J13B 3DYPA 4GKNA 2CLZA 1HHJB 1EHNA 4M5YL 2GAZB 3ARZA 3IJHA 2BNQD 4XVUD 2YPLD 3BZEB 5TH2B 5T1LA 3R8BB 4KVCL 5F7HA 3NH7H 4KZDL 1CFBA 4FQ1L 1MRFH 1PBYA 1TTGA 4LLDA 2VZTA 1PKOA 3ILPA 4XPAH 2YN5A 2BP3A 4IS6A 1DFBH 4CBPA 3VFMA 3RAJH 3H7BB 4PJIA 4OAWA 3RVWD 1IKNA 4FHBD 5FYJL 3UTQA 3VWKB 4BZ1L 3IS1X 4HQQH 1M4KA 1LK3L 4MGXA 4PJ5A 4JHWH 2P1YA 2E7LC 4HX1B 5T5NG 5J06A 3GBMH 5I8KH 4ZTOL 2ZCLH 4F9PA 5KW9L 1CDIA 2A6KB 4P2OA 5D7IB 3DX6B 4MAYD 2NXYD 3WLWD 2Q8BL 4OV5A 2GTZB 1P1ZA 3N50A 1MWAA 3BO8B 1EMTH 1Y18B 4JG1L 1A6WL 1R3IL 5HTSA 4ZXBC 4G80B 4UNUA 5EU3B 4AMKH 1FP5A 2OL3B 3L7FA 1TTUA 3BDYH 4L8DA 3BKJL 3UAJD 2WWKO 3QG6A 3QEUA 4AENB 1F11A 4DUXA 2ARJB 1I7UB 3P0GB 1CIDA 2BK8A 3ARFB 5I74B 4DVRL 1YQVH 4RMUA 3QXAA 3MRHB 3CFEB 4RMWA 1S9VA 4LCWA 1UJ3A 5HGHA 4WI8A 3NFPB 5HI3D 2EDWA 1G6RH 5GRJL 1MJUL 1YEDB 2B8OT 3C6SA 4RRPG 4OI9A 1RUKH 3JZ7A 4MQXD 3SCMC 3S35X 4CRPA 4PB0H 1UQSB 3VXSD 1JIBA 1B2WL 5I16A 5KJRH 3O8XC 2XTJE 5J7CC 1EPFA 3QWOA 3HMWH 4W4OA 5BCAA 5FUZH 5ID1B 4MHHI 1WZLA 2NXZD 1DBKH 4BUHA 2QBWA 3EKCA 5B39A 1EA9C 2F74B 1Z6JT 4XNYL 1S7TA 4ZYKA 1CDUA 2NY6C 1RMFL 3BPLC 5F9DC 4GSDH 2GCYA 3NA9L 5TE4L 1HCFX 2ADGB 3BW9B 1ZSDA 3LKNA 2A73B 3QXDB 4NO3B 5KSVA 2H6PA 5E8DL 4KY1L 4YGVA 5ETUB 5FM4A 5JXAH 1P84K 4RGND 1UB6A 1OAXH 2FD6L 3DLQR 3FRUA 1CFQA 4MXWL 1ZHBA 4FXKA 3KLHC 3QWQB 1NGQL 2HJFB 5DJCA 1ZLSL 2YD3A 3D5OF 4ZUSB 1X4YA 2JF1A 4NJAH 4X6EB 1H8OA 2Y7QB 5KANI 2OXHA 4ZXBB 3VFTB 3R1GL 1D3CA 1EHXA 4KDTA 4AT6A 4WY7L 1D9KC 3OAYK 2SEBB 3L5WB 1UZ8B 1A7NL 3D0VB 4QHUA 4Y4FD 1HN1A 1H3VA 1UXSA 2VLLB 3MRIA 2CK0H 3KXFB 4Y5YC 1I1AD 2XOTA 3QJHB 4FQQA 5HYSB 4HIIB 4P9HH 4WUUE 3WN5A 2QV2A 1EGJA 3DX9B 5F7LB 3FHAA 4PGDA 5CGMA 1IGYA 4KXZH 4HHAA 1X44A 5EUOE 4Z7WF 4HK3J 4R7DB 1EVUA 4YR6B 5IVNA 1BMGA 1WIPA 1C5DB 3QCTL 3QQ9C 1W0WB 2VKWA 3VD4A 5E8PB 4JPWL 3SCMB 5SX5H 3FCTB 5F7WC 3N1GC 4ZFFA 3EO9L 4XI5D 3O8XB 1EBPA 1FAIL 1FNAA 4ZPTA 4KQ4L 2D31B 1QFUH 3WIIL 3C08H 1QBMH 5BV7L 3WCYA 1AIFA 2EC9T 4OZHA 4NYLB 4UQ3A 4IHOA 4ZO9A 1UWGH 4RNRA 5IHBA 1M71B 2DTMH 4KTDH 4F2MB 1FVEB 3GK8H 3FQNA 1FJ1B 4KRPD 1I1YA 2NY6B 5GGVH 1BBJB 3KLSA 2ADJB 1MY5A 4X6FA 2X4NB 3BPLB 1XF4A 4AG4L 4X5LA 1RZIA 3QPQD 5DJYB 5IB3A 1JV5A 1FC1A 5SWZB 3IFNL 3ARQA 3QP3A 3TBWB 3O3EA 5I73C 1NLDL 3IKKA 3JVGC 3CH8A 1XGPA 1Z9OA 4PJHF 1MUJB 3KPPB 5SWSE 4V1DA 1MEXH 1KFAH 1T0PB 1P6FA 1R3LA 2F8XC 1FFPA 3LQMA 1FNGA 3NFSH 3E8UL 2ZG2A 4P2YA 4FOMA 1A9EA 4UV7H 4X80L 2EH7L 2P5WE 1OSZB 2W0FB 1NLBL 2V9TA 2MNUA 4BYHA 5ESVB 3LS5H 1GOGA 5FFLA 1B6UA 5D7LA 4YXKL 1KCSH 4XMLH 4NRYB 5D2NC 5D7SH 4P4RB 5I1CL 1D9KB 1FVCB 2W0PA 1X5KA 4DQOH 4YX2L 3SDXB 4DOHB 2BY0A 5FB8A 4YHKL 5C08E 2C26A 1S3KH 1U8NA 2Z93A 3L9RB 5DZNA 5T3ZL 1EBAA 4MMXC 2E3VA 1QSFA 2MHAB 4NSKA 3CX2A 3INUL 1GPOH 4Y5YB 4F9LC 1XR8B 3B5GA 3IDYC 3EZJB 4XT1C 5H94B 3S3PA 3QRFM 1A7BA 5JO5B 4KTEH 3UPAA 2G60H 4EN3A 2JJTC 3LSOA 4QTIH 5C0BA 1IAIH 3B43A 5F9JA 2PKDA 1IC4L 4J7RA 1S7SA 4G6AD 2FL5B 1BOGA 3CFKA 3ARDA 4KJWC 2HKFH 4GW1B 4KFZC 2UZIH 2CR3A 2ITDA 4Y4KC 3CVIH 2AABL 4NCC1 1HHIA 5H35B 3MLZL 5IB4A 2F53E 3ULUC 4JFHE 1C12B 2EDTA 3VWJA 4U3XA 4LF3A 1OAKL 2G75B 1SQ2N 4QHMA 5A43C 3JWDH 1JYNA 2D7MA 3OX8B 1R24B 5BQ7A 1SEBA 4R26H 5TFSL 1LO5B 4X98B 4NGHL 2IPKB 4M1GH 4NM8H 1NEZG 4Y2DD 4OFVA 2FBOJ 4NKOB 1QZ1A 3EGSB 4XTRD 3DTXA 1Q94B 1NBYB 4KZEL 4L3EB 5I73B 4CU8A 1ZANL 2IANB 3K4DA 2NY7H 2MPAH 2Q87A 5JW3H 2NY2C 5D5MA 3DX7B 5E56A 4HUMB 4XVJH 4ZUWB 1UKTA 2PYEB 3BH9B 1MFBL 4LLYB 4NO5B 3T0DA 3VI3F 1UFUA 5IG7A 3GMRA 5INCB 4TVPD 1JZ3A 1GHFH 3BKCL 2X4RB 1NL0L 1W72A 3Q0HA 3AC0A 2VLJB 4RAVB 1NMAL 1UCTA 3KPSA 2FIKA 1CR9L 2AK4A 5D2NB 4QLRA 2FHBA 3IJSB 1EEQA 3RIFK 4KH2A 3I75B 1C5CL 1A1MA 3GJFK 4N90D 2R56H 3U7WL 1UXWB 4PD4J 3L3IB 3Q48A 5GGRY 3X13A 1KIQA 4PJEB 3DNKA 3MZTA 2VQ1B 2Z0BA 4NHUB 1I85A 1ES0A 3MRLA 1NUDA 4DUVA 4UZGA 3G5YB 4R2GD 3SGJA 3LZFH 5DXWA 1ONQB 2AJYL 2JLLA 5GZOD 2BNRA 1ZS8B 2RAMA 5C6TL 4R4FL 5FYKD 1G0XA 1IGTA 4F57L 5GZNC 3ULVC 1SMAA 5JQ6L 2R2EA 1N59A 3N85H 4LKXA 5MI0C 1LEKA 4GAYA 4LSUL 4H26B 4Y4KB 1ACYL 3BP6A 3CZFA 3VU2A 4GW4A 4PYGA 3KPLA 3RIAK 1QA9A 3EDEA 3BSZL 2EKJA 3IDIA 4JFEE 1BVLA 1DN0A 3DV4B 3QEQA 2ZNWA 4JPKL 3V4UL 5AWNL 1MFAL 4HK3N 3MOBH 4MNGB 1A21A 4Z7UA 3C09B 3G08A 1BECA 4LIQH 1FZMB 4XRCB 5JIKA 4PJ5D 2H3NB 3ROLB 2D4FA 4O9HL 3TBYA 1K4CB 3GMNB 4G3YL 5F7UA 1DQDL 5T3XE 3FFCB 5GRYA 2NY2B 1KJVB 3F58H 3VFGL 3QIBA 1J0JA 2FRGP 3IDGB 3ZDXE 1MJ8L 1YEHL 4GW5B 4Z78B 2V7NB 5T1KB 1T7VA 3PV6A 2ICWB 5E2WL 2BOBB 3T0EA 5FYLH 1OGAB 4AEHH 5HGAB 4CVXA 4FABL 4K9EH 1F3DH 1KB5H 3BRDA 1KTKE 4KTYA 2Q7NA 1CXFA 4N5UA 5E6IC 5BO1H 1DQLH 4Q0XL 3MRGB 2XKNB 4NUJA 3DUHA 1TZGL 1ETZB 5FYJE 1FBIH 3GRWH 1IEAB 1RUAH 4YPGB 4BUGA 3W39A 4JDTH 1H3TA 5C07A 1MCWM 4NJ9H 3VXMB 1EHLH 1Q1JH 1RSFA 4UOW0 5IQ9A 4WEBH 3V5KA 4LLVA 4P2QA 1ND0A 4LCWD 1N3NB 4JANB 3GBLA 3TA3C 4N8CL 3T4AB 4M62L 3VFPA 4G9FB 4UTAH 5IB5B 5CD5D 4EEEA 3MGAA 4S1QH 5JW4M 5J3HD 2WWMC 4Y16A 3VCLB 2GK0B 4PTUB 2IH3B 3OB0K 4FZ8H 2DJUA 1CFVH 3T2OA 3MLXH 3H9HA 4R4BA 4LHJB 4CKVX 3U9PL 5KZCB 3MLPA 4KJPD 4MHHG 2JELH 3KLAA 3U83A 3NCBB 1SHMA 4Y8DC 4MD4A 2A83B 4X6DB 3UJJH 4Z5RA 4OKDA 4RFOL 5F7EL 3PL6D 3WD5L 4QKXB 3HZVA 3CVHB 4Z7VA 4E0RA 4QRRE 3MBEA 4NN6C 3QHTC 3EUUA 4RMTA 3G04B 2B4CC 1PSKL 2VZ1A 3WHE0 5CJXC 1ZVSB 5CSZA 1MAMH 3KLDA 3MV7D 2UVFA 3I84A 4Z8FL 4U4BA 1AGBA 2ORBH 2CDFB 1J9CT 2OJZL 5HYJD 3VGFA 3VFSB 2QR0A 4MJ2A 3RGVC 1DBAL 1DL7L 4HKXA 5DJ6A 5E6IB 3IKCA 5ANMB 2BJML 2EIZA 2J8UA 1IFHL 4PJXA 5KVGL 5DLMH 1JWUA 3MZGB 5IW3A 3BN3B 2A6IB 3L95A 3MNZA 4UDUB 3TYGH 5HVFB 5KANG 2AXGA 4G8FA 3S88L 4PJBA 1KYOK 1T66C 3N9GH 3BUYB 1U0QA 5J6GB 2HJKA 4M7LT 5BRZA 1KB5A 1B9ZA 1FZJA 4PBVC 2EH8H 2YUVA 4GKSA 3VDCA 4PLJC 1RV6X 3MLYH 3QUXA 4N0CD 1VEOA 2PW2B 3TA3B 3U7AA 5DHVH 3SKOA 5J9PA 1KV3A 1F58L 4TNVF 1GIGH 1CXIA 2R0ZL 2ICES 3C87A 1PLGL 5ILTL 4XPGH 4GRWH 4JY4B 4NZTH 5MEND 4XAKE 4FTVD 1FQ9C 4U1GC 4QRUB 3GJEB 2Z9TA 2A77H 2OI9C 5DUPL 5T5FH 2EYSA 3O3BB 2JTDA 1YEEL 5FYKL 4J23A 4RQQB 5DI8B 3BVNB 5ESQA 4ZNCD 4OT1L 4P48A 3MBXL 4QRTB 2LFGA 4X5WA 1U91B 5E6YA 2H32B 4IRJD 4LU5H 3QO1A 3DXAD 3TBSA 4OIIH 2VH5L 4TUKL 5B22A 3J7HA 4WI4A 3QUKA 1BJ8A 1HQ4A 3MCLL 4AL8H 2FX7H 3CZJA 4NUGH 4FFVC 4Q74A 5ITBH 1OPGH 1F45A 4NN6B 2I07A 4NZRL 5F3HA 5DMYA 2H2SC 5EZIL 1GAFL 2VAAA 5B38G 1OL0A 5FEBA 3NFNB 4OQTH 4PREA 3PDOA 4RISH 3O45A 1PJ9A 2DMBA 2X9XA 3LN4B 3VFOB 3K74B 3MRHA 3PHOA 3BE1H 1NC4A 1G9NH 5DS8B 5K9JL 3SKJH 1QG3A 5D7LD 3OKLA 4QRPE 5B4MD 3QDJB 4XP5L 4XCYB 5DRZB 3RGVB 5DVKA 4RSVA 1JYWA 3UYPA 1KIRA 4HAFA 4PRNA 4YDLC 2BHUA 2K1MA 5IJVA 5EIIB 1XGRB 2ZSVA 4HWEH 1MWAL 4NQED 1QSFD 4JREC 4L4VA 3MLUL 1A7QH 2X1XR 4NOFA 4CJ0A 3F7PC 3HAEH 4U1LA 3ZSTA 2Z4QA 4FQXD 1B4JL 1WLHA 4GMTH 4Y89A 2BMKB 4L8SB 3U36B 1QVOB 2AEQH 1MPAL 3HI1B 4WU5A 2HVJA 1MCFA 3TBVB 4C56D 5CBEA 1OY3B 3NCJH 2C3WA 4M43H 2YD8A 1AGEB 3ARGB 2OSLB 1F2XK 3CIQA 4NKMB 1EZVY 1U8HA 3P0YH 4OZ4B 2EC8A 3ZSSA 2BVQB 4K2UL 5KSAA 2DQJL 1CFSA 1R5VA 4WEUD 3HLAB 1QTYT 8CGTA 4EUPA 1AD9B 1KIUA 3DVFA 3T65B 2IADA 1DANU 4JRXA 4U1GB 3SE4A 2OI9B 1KNOA 1A4JB 1CGTA 2EDHA 2MWCA 1VENA 4J3UA 4OCLC 3IETB 5D1QB 3VDAA 4XZUB 5LWYH 1M7IB 2F58L 1L6ZA 1QSED 3AS3A 4MLSA 5HHOD 3HHRB 1CDYA 3SDCD 1FV1A 1B3JA 4OCYH 3ECBB 3DETD 5EBWB 4CU6A 3UPRB 3BISA 1NEUA 4XP9H 3LS4H 3PIQB 3HG1A 1UENA 3B9AA 1RJZA 2J1KA 5EPMB 5CP7A 3QJHA 5DRNB 5ERWB 2BVOA 2CH8A 4HT1L 4DGYH 3BZ4B 5EOCJ 1N2RB 4L9LA 3CDYA 1OCWH 1JF6A 4P2RE 3OV6A 3KPSD 1NCBH 4KUCD 5FGBC 3VH8G 1J7VR 1NBZA 2AP2A 3TYFB 4XPAL 4YDLB 3REWB 1DFBL 3RAJL 4QY8A 3U0PA 3LQAH 3OSKA 4PG2C 3Q5TA 2X1WL 4JREB 1FG9C 4HQQL 5KSUA 2WANA 3FT2A 3M07A 3JTSB 4WFHE 4JHWL 4OIBA 4PBXA 1Q9OB 4CL7A 3SDAA 2XZCL 5EC1A 5DVMA 3GBML 1TDQA 1P9MA 3QIUD 1FYTA 3W82A 1BAFH 1U3HC 1BWMA 3GMQB 2BNRD 5IHZB 1PZ5B 3ZDZE 2DJSA 3KJ6H 3ZLQC 4QHLB 3BEWA 3ULSB 2D4DA 3D9AH 5TDOB 4R6UA 4RGNE 1EGJL 1ZHKA 2R23B 1WBZA 1KJMB 1WFUA 4BFEA 4I77H 2ZWLT 2WV3A 4AMKL 3RY6A 4OF8A 3SKNB 4AM0B 5IT2H 2O26U 5D5MF 3BDYL 5JLZA 4F33B 3BEVA 5TGBB 5I1GL 3C6LC 1SBSH 2PCPB 2X4TB 4WHYH 3HUJE 4UB0H 2F5AH 1TNNA 2V2WB 3X14A 4PGJA 4QNPF 3KYNB 4OM1L 1I7RB 2ICCA 3OKEB 2FX8L 5D6CA 5IVXB 4ZS6D 3HZYB 4X6BA 3WKNA 1E28B 1INDH 3T8XB 1A3QA 4KKCD 4XNZC 4LASH 5GGQH 1ZLVK 3SO3B 2FR4A 2YS4A 3T3MF 3QEGH 3IXAA 4LARL 4YHNA 1C16B 1NBVH 3BXNB 5I8EB 1Q9KB 4YWGL 2HFFA 2YD1A 5TE6L 4K7PY 1QD0A 4QRSA 4XPBL 3UTTB 2QSTA 4AIOA 5EU5B 2WM0A 3PE9A 1NGWB 1FCGA 1KGCE 1T1XB 4ZAKC 4DCQB 2UWEE 2LQRA 5FUZL 1F4WH 3BYYA 3QDMD 4FMFA 3RBSA 1QNZL 1DBKL 4KK8C 4MX7B 3VXTA 15C8H 2F8OA 1AI1H 2W0LA 1OP9A 2B0SH 4LLUA 4DGIL 3WDIA 4U7KA 4DTGH 5EORH 4Z95H 1AQKH 3EO0B 1GXEA 3PGFL 3RI5K 1MJJA 5IEHA 3U0TB 1HILB 3GJFA 4JDVA 4Y0GA 1K2DA 43C9A 2P8LB 3VMNA 5FO7B 5DUMH 5JXAL 4X0KB 1FDLH 4D9LL 4PJ9D 5E8NA 2FSEA 32C2A 4ZFOB 5JHLL 1QLEH 2AAVA 1U3HB 3UZVB 5GRUH 2GJJA 2O61B 1IGCH 4PLKC 2XV6B 1YJDH 4KK6C 4NJAL 4Y16D 1BZ9A 1KN2H 3QIWA 3B9KC 3Q6FB 3RUGA 2VITA 1NFDE 2I25N 2Z8VC 2ICWJ 2C1PA 5C0EA 1CI5A 5HDLA 5MHSE 1HNFA 3WNKA 1HEZB 4N0RA 5JIPA 2EXYC 3DVNA 4NO2B 3HTLX 4J3OC 2YA1A 4K3JH 1BHGA 4F58H 4KKLC 2X9YA 2CK0L 3CSBA 4D9QE 2XIDA 4XCNB 1S5IH 1NCCL 4P9HL 12E8H 1MREH 3QO0A 5C09B 4YHPB 1KEML 4XNZB 5IESL 2D0HA 1JE6A 5DMIL 2VDPH 2XG5A 3G5XA 3SJVB 5IF0B 3MBED 3OBAA 1PKQB 4NO0A 1Z3GH 1I1CA 5EC2B 4ZUVA 3HNVH 2PXYC 2Z8SA 4ZAKB 4F9LA 3G5VB 1G9MH 9CGTA 2VXSL 3C08L 5SX4H 3VFWA 1QBML 4JZJC 3BD5A 5FO8B 3E1F1 3P9MA 5I76A 1U9KA 3PDDA 4W6WB 3UTPE 4XXCC 1E4WH 4HMDA 1ZV5A 1J1XH 4HXAH 3TZVC 5I1DA 1IMHC 3OKNA 5JPMB 2IALA 2EDFA 1ITCA 1YMMA 1W72L 1QEWA 4UBDC 3TCXA 4RX4A 3WE6B 5F7NC 2K7PA 4X4YB 3O3AB 2OLDA 1B0RB 1KIPB 3M1BA 4NKDB 5HJ3A 4FXGA 3DRQB 1KFAL 2DWDB 4LFHD 4G5ZH 3NFSL 3DECA 4UV7L 1F6LL 5F88B 5D70H 4RWYH 5F6IC 5DYOA 4J3TA 3T2NH 3VWKD 1G7QB 4AJ0A 5IBLD 1J1OL 4JN1L 3LS5L 1VGKB 1IARB 1RZKH 4HKBB 2VDNH 3B9KB 1KCSL 3H7LA 1CBVH 3LN5B 4KXZI 3I02B 4PGBA 4TVPE 5HYFA 5DQ9B 3VGDA 3AREA 1Q0XL 1JGVL 4PJAA 1DUZB 1ADQA 5GRWA 3QQ3B 3TVMC 4GG6B 4LPTA 5ENWB 2WINB 3ESVF 2J88H 3H9SB 2VISB 4PJGF 1CG9A 1JWSB 1YEIH 4NKQB 1HCVA 4N90E 5DJDA 2J8OA 4PJXF 3G6DH 3QDHA 4ODWA 3D2UA 4OM0H 1FG2B 4QTIL 1YPZB 3H0TB 1IAIL 5D2LB 2AGJH 1QUNA 5IOPA 1R3HA 2XG4A 2DDQH 2PXYB 2COQA 5AUMA 5HGBA 5SWQB 2UZIL 2KQNA 3S5LG 3ARFD 1ROWA 3AU1B 3CVIL 4NC2B 2VDQH 4JZJB 4UU9B 2E5EA 5FYKE 4AY0A 5JW4N 2CKBH 3RNKA 4U1SA 1J11A 4LLMB 2FLRT 3FOLB 3K1DA 2XTJC 4M1GL 4OLYL 2X09A 3TZVB 4HG4J 1E6OH 4L4VD 3EJZC 4E5XB 3TNNB 3FFDB 4YHIA 1RIVL 4YNYB 4RWHA 1RZJC 2X5PA 5HHXH 5IB2B 2NY7L 2MPAL 3EZ8A 4OBSA 4PJIE 2ZPKH 1CD1A 3GSRB 3Q3GA 4PJ5E 5FA4B 3IVKB 4U31A 4FXLA 3ARSA 4O2FA 3LOWA 5F6IB 1GHFL 2FCBA 3CX5K 1X7QB 4HUXA 5ADPH 5C0DA 2EDRA 5CEYA 3TGXA 3BFOA 3GSVB 1KLUA 1PG7H 2VIRB 4GXVH 5HY9A 5HHQA 3P11L 3T3PF 2P8PA 4G42B 3VFVB 4WI3A 1XH3B 1IAII 1IGJA 2XN9A 3SDYH 3TVMB 5HHNA 3AY4C 4HPYL 1ZLUH 1FL6B 1VCAA 2NY0C 2X70B 2EXWC 4ZXBD 1FNSL 3WO4C 2FWOB 3GMMB 3P4MB 4Y5XA 5EUKB 4PRAA 5DJZB 3UBXI 2DQGH 3OKDA 2JIXA 4MA1C 3S98A 1RQ5A 3HG1D 2IWGA 1JL8A 3KXFD 3RWHB 4LCWE 1LE9A 5FF6B 5I1AB 3N85L 5GIRA 5IMKB 3L3JA 4HPOH 4M9PA 2AJVL 1NAKL 2BX5A 5I2IB 3N1FC 3LHPH 1GGTA 3V7AE 3SCMD 1PD6A 5J57B 1KUMA 4UOW1 6FABH 1P4LA 2XTJB 3BGFC 4M03A 3O8XD 1IGIH 2B1HL 4LEXL 1XMWA 4LIQL 4JY4A 1GZQB 3LKOA 4YEFA 4TOYH 4QRUA 3VA2C 1LE5A 4BK4A 2ZOKB 2CKBA 2EDXA 3KJ4C 1I1FB 1IQWH 3AS1A 4PUBH 1AGDB 1S7XA 1KCVH 3IF1B 3U30C 2NY6D 5C6PB 5TDNB 3P77A 3BHBB 3KDMB 5FYLL 2EC9U 4GRWF 4K9EL 3V6FB 1KB5L 2ENSA 4WFED 5SWZD 4TUOA 3K4AA 5F70A 5DK2A 4LHUA 4BSWB 5BO1L 1XF2B 3V0WH 3H9YA 3OWEA 3RWDA 1EUTA 1KTRL 3ETBF 1FL5B 2C3VB 3VE0A 4D0CA 1X6LA 1FBIL 2F9BT 2LVEA 1JTTA 5HYJE 3KLHD 1UM4H 3V7AG 3FQRA 4PJCF 1KEGH 4JFPB 1K85A 4JDTL 4XXDB 4K7FB 1Q1JL 5B39G 5F9OH 4WEBL 4YK4C 2NY0B 2X4SB 3FTGB 1JF1B 3WO4B 1RK0B 4YHYC 1D9KD 1K4DA 1TJGL 3OAZH 4M8VA 4TULH 4M61A 1OAUH 4DUWA 2WW8A 1WCBA 2AJZA 4GT7A 2ITCB 4GAJH 3BRGC 4MA1B 4UTAL 4KQ3H 2IG2H 1N8ZB 1MSPA 1UB5A 3QJFA 3HE7C 3TIDA 3T08A 1ZKAA 4HS6B 3MV8A 4JKPH 5EUOB 4OJFH 4FZ8L 2HN7A 1S8DB 2ARJQ 1CFVL 4G6FB 4Z7OE 4QCIB 5AZ2H 5E00A 4MZ3A 4LSVH 2X4OB 1P5VA 4CNIA 3QQ9D 1A6VH 3KYAA 1NAMH 5MENE 3BMWA 1LP9F 4WGWB 4OZHE 2R8SH 3BGFB 3WL9B 1MNUH 3UJJL 1U8JB 5MEOA 3GSUB 4NWUH 1YEFH 5F1IB 3K8KA 4UT6L 1ZT7A 4XGZA 4JJ5A 2XZQH 1S9WA 1YUHA 5CEXA 4BM7A 1J5OL 1OGTA 2OTUB 2CUHA 3PDGA 3PWUB 5FK9B 2A9NH 2YUWA 5K59E 4I8DA 5D1XA 3KJ4B 2CRZA 2CLVA 3U30B 3O6KH 2DAVA 4OFDA 4X9HA 1MAML 2V17H 1WWAX 2E6PA 2H45A 2R0KL 2GUOB 2ORBL 1N7ML 1JGDB 1RZ8B 4V1DE 3FQUA 2AXFA 4L3ED 1N0LA 3TO4A 2IAND 4N0YH 4WFGD 3HZKB 1DE4A 5SWSB 2X05A 1FPTL 4BFIB 3QG7L 3O2DA 3TNMA 3CMOH 3PIQA 3GUTB 1TZHB 4O58L 2PYED 5DRNA 1H8NA 5D7LE 4XNMB 3CLEL 4P5TA 1NUGA 1JPGA 3N9GL 4F7CA 3BP5A 4NRXB 1JK8A 4YK4B 1XCTB 2VDMH 4HWZA 2O5XH 1EFXA 4YHYB 3MLYL 5EBLA 1OD9A 2R0LH 1QSFE 5K9KB 2XWBB 5FA3B 1NEZB 4NO0D 4PJ8A 5C08B 4WV1C 4ZUTB 2APTA 4FQHA 3ROOA 4P0DA 1Z2KA 4X7TB 3KPTA 3LKSB 4PRDB 1KT2A 1MCSA 1PEZA 1C1EH 3CD4A 1MAKA 5IGXL 3QCVL 4DFHA 5F93C 2NCMA 4FQIH 4MWFB 3HE7B 1SVZA 5C0BE 3OHXA 1EVTC 4K8RC 4TVSa 2A77L 5T5FL 3BIAX 4AQ1B 3IRPX 1PZ5A 2HT2C 2ADFH 1SM3H 4H1LH 4S10A 1QRNA 5LCVH 5I66B 4GKZA 3NIFE 3TH3T 1K8IA 3PG2A 4N5EC 3O9WC 2AVGA 4KJWD 2BRQA 3FAWA 3V95A 4I18C 3P4OA 4LU5L 3RUGF 4Y4KD 4OIIL 5J6HB 2IQ9H 4U6TA 2VC2L 4LRNH 1ZE3C 4WTWA 3HKFA 3V5DA 3DV6A 1Q0YL 3DSFH 3PP4L 3QWRD 5K9OA 3ULUD 2FO1A 4F33A 4ORGA 4HH8A 3CFBB 2FX7L 5FCUL 3JV6A 1QO3B 2FHCA 5HGDB 1NKOA 3GKWH 2OMNA 2UYLB 3O6MH 4O2EA 2Q76A 5HHOE 1MVFA 3UJTH 1NCWH 5DD6B 4LP4A 1NAMA 2DYPB 3RL2B 1KACB 5KVEH 3Q5OA 3T8XA 5F72S 3DHJA 1G9NL 1BIIA 1JHKH 4X7CC 3SKJL 1VFAB 4R96A 3R0NA 4NNPH 1D5BA 3E6FB 4PTTA 4FMKA 2DQDL 3VXNA 3FFCD 2NY2D 1RJLB 3DVGB 4NWTH 4HWEL 5IK3A 2KUTA 1MCIA 1T6WA 4G43B 3NCFB 5C0FB 4DCQA 2ZOLA 1A47A 3F8UB 2LAGB 2FX9H 4JCMA 1GGCH 3IFPA 5T1KD 2AS5M 1UWXK 1IC7H 3KPSE 4BZYA 1OGAD 5FDWA 2AK4E 2HMIC 3DSNA 5FXCH 1G7LA 1TZIA 3TEUA 5KVFH 3U0WL 2AEWA 3WFDL 2Y07H 1EO7A 1ED3B 4F7PB 5FOBA 3U0TA 4OUOA 1AR1C 3IDNA 1JNJA 3X17A 1F90H 3MRFB 4IRSA 3VXMD 1IGFL 2P8LA 4X6CF 4YQXH 2BNRE 4GAFB 5E9DB 3BIKB 1F4YL 4M1CC 5DEGB 1DBBH 3NABH 2BSRA 4X4XB 1T1YB 3REVA 1AE6H 2HFTA 4ODTH 4GG8A 5EO1A 4HH9B 5GQBA 2J4WH 3QH3B 3JUYA 4G9FD 4OGXH 2UVEA 5GZND 4P3CL 3ULVD 5DHYB 4XPHL 4D0BA 1P5UA 5IFHL 3GM8A 1D5MA 2BSSB 3O9WB 4KPHL 2HFGH 1XIWA 3OKMB 4I18B 4JPVL 1QFHA 4OCYL 4PJDF 2GJ6B 2VLRA 3QEQE 5CAYB 3CNKA 1T22A 5CGYC 3SE9H 2DQEL 3C6LA 4JFEB 5DJXA 4Z7UE 3LS4L 4NQVA 5I15H 5F8RC 3I6KA 1KB9J 2HT3C 4HWBH 4BQ6A 5KZCD 1HQRA 2E7MA 2QHRH 1GC1H 5DWUH 2I24N 2WWKT 3MLTB 3FB5B 5DC9B 1HSBA 3CCHB 4YHPA 1KPVB 1LEIB 3CSYB 2C7UB 1E4XL 2HWZH 5DD0H 2N7BA 5FGCE 2YMXH 4CUCA 2OR9H 2YN3A 4OF5A 4QXTB 4S0TD 1OCWL 2Q6WA 4UT7H 1NCBL 1MRDH 5EU4B 3IAGC 1WAAA 5KVDH 1ORQA 1V3JA 3T0EE 2QEJA 5I71C 3QULB 3E3QC 1P53A 3RRQA 3C2SA 1WEJH 1WICA 3LQAL 2XPGA 1MJ7H 1CICC 4NQDA 4XNUH 3DO7B 2X7LA 4WJ5A 1CT8A 2VDOH 3F12A 5ADOH 1NJ9A 4JHBA 3S4SA 4F80A 5IBUG 1T2XA 1ZGLB 5E6ID 1H5BC 3KPQA 2Z91A 5C07E 4HIHB 1O5DT 3KJ6L 1JHLL 1X5AA 1Y6KR 3DX8A 3MRBB 3D9AL 4P2QE 2AXJA 4IDJH 2G5BA 2VZ3A 4HZLB 3FQWB 5JW4Q 4PP1C 5IT2L 1B0GA 2GSGB 3EOBB 1YEKL 4JJHA 3IFOB 2YSSB 1A02N 3EFDH 2IBGA 4UB0L 2W65A 3TA3D 4QF1B 1Y0LA 1HSAA 2J3SA 2PYFA 2VXTH 4FQLH 2RCSL 2WWMD 1YY9C 3KG5A 4XMKL 5GGQL 5GS0C 4YIQA 1T89C 1BEYH 1M05A 1TENA 1DLHA 1CLZH 3C60C 1MH5A 4EQ2A 5CS7A 1E4XI 1UYWH 1A6AA 3WJJA 3T0BA 1ZTXH 1JWMB 1CU4H 5E5MB 5ICXB 3OXRA 2E27L 1G7PA 4ONFH 3MUGB 3QNZB 2IGFL 2FHFA 2VNCA 4LPWA 5KS9E 4Z7VE 4XAWL 4XC3L 1I8KB 1VA9A 2VISA 4MD5A 5IMMA 4BKLB 2Y5TB 43CAA 4Z76A 5L7XH 3KNBB 1DJSA 4QRRB 2DJ4A 2BXYA 3DGGA 1WBXA 2VL5B 15C8L 4OFYA 1T0NB 3ZE1E 1AI1L 2NY3C 5BXFB 2B0SL 1CTNA 2OMBA 3KHOA 5HPMA 5I71B 2JK5A 5LXGH 1QACA 4LIQE 1INEH 5BV7C 1S7QA 1GGBL 4OZGF 5IKCB 2JCCB 1CICB 5ELIA 5HBBA 2R2HA 2BHZA 4HUUB 2J8UE 2APFA 1NDMB 3R06B 1NGZB 4PY7A 3QDJD 3RGVD 3BD4A 4WU7A 2GSIB 4YDVB 4P46A 4PJBE 4RCAA 2EDJA 1H5BB 5CZVH 3UTOA 3VMPA 1WQVT 1ADQL 3G6AA 5E95B 3KWWB 1JNLH 4WRLA 2ENYA 1D5XB 1IGCL 1YYMH 4R3SB 1T5WB 5BRZE 4PJ7F 5EN2A 1W0YT 5MERB 1YJDL 1KN2L 1T66D 1UM6H 1NKRA 3GHBH 5IB2A 3IXTA 1AD0B 1QBAA 4JO1L 4N9OB 1QFPA 1TJIH 3VRIB 3F5WA 4PLJD 2P8MB 2OTPA 1ZA3A 3KPOA 3MA7A 1T03L 4K3JL 5EOQH 1EO8H 3VG9C 2BDNH 2MJWA 5JA9A 4F58L 1ZGLM 4KJYB 5IEKB 2VZSA 1FNHA 1S5IL 5DJ0A 5ICZB 5L8JB 12E8L 1HXYB 1MREL 4Q9QL 1O7VA 4U05A 5HI4C 3IFLH 5GGRA 1NCAL 5IR1B 3C60B 1D5ZB 5TE7H 3W9EB 3W5MA 1MCRA 5F7DA 3FB7A 2NY1C 4TSAH 4HFWA 2FJGB 1Z3GL 1F00I 3MMEA 4L1DA 4JZOA 3L5IA 5DJAA 2A6DA 2C4FT 2MFNA 3UYRL 3BH8B 3OJDB 5HGGS 4BH8B 4LCUB 1KG0B 3RNQB 4JM2A 2FWOA 2JJSC 4D8PB 4HKZA 1QBBA 1RHHB 3MUJA 1FGNH 3V6ZA 2HLAB 1AC0A 3TCLA 3MRDA 1IAKB 3H8NA 5E1HB 4QHKJ 3CXDH 1WK0A 4JR9L 4FFVD 2NY3B 3CLFH 2WLZA 1HKLH 2DI8A 2ED7A 4YEEA 4HXAL 1OQOA 5DA4A 1LILA 2H2SD 3U4AA 1IKFH 1RULH 1OP3H 4DKFH 5IMKA 1BP3B 5BV7B 1MQKH 1NGPL 3IU4H 3MJ7A 1G7MB 1F4AA 1WTLA 1MCPL 3HE6C 1NGXA 4NZUH 2P7TB 4X5XB 3S34H 4L5FH 3CDFA 5I17A 1KCUH 3PGCA 5EO0B 4APQA 4J6RH 3TM6A 2DQUH 3DWTA 4AIZA 3EJJX 4L4VE 3P9WB 4KK9C 4PFEA 3IJYB 2MCG1 2CIKA 1T5XB 3BP4A 5I18H 5CWSB 4RWYL 1QYGH 3T2NL 2J6EA 1N6QH 4LVEA 1RZKL 1XGQA 4EDXB 4CN6A 3C5ZC 4UDTA 3SGKC 3ZL4H 4MJ4A 4XMPL 1HIML 3WSQL 3I3DA 4J1UB 1AFVH 5JHDA 1R5WB 4B50A 1I1FA 1ZK9A 2OS7A 3ALXA 1R3KA 5E94A 3VG9B 4K3DH 1FFOA 2H9GA 4HJGB 4JRXE 2R4RH 4K23H 2W38A 5EDXA 3ZYIA 4Y5VA 4BSVB 4C83B 2HRLA 4FRWA 1XF2A 1RPQA 5JA8B 5SX4I 3VH8B 3D6GA 3LAFA 2ZUSA 3QI9C 3T2QA 1VFBB 1AH1A 3NIGE 2V7HB 2VSCA 4LBEA 2NY1B 2BXZA 5JORA 2ZKHH 2AGJL 1CDCA 2R29L 4KI5F 1LDPH 4OLWL 1L9MA 3G6JF 3RU8H 4K7FA 2IPTH 3L3GB 4OLZH 5I9QC 2VDQL 5EOCH 4LPXA 1PGRB 1F3JA 3S35L 3HG1E 2CKBL 4HZAA 3MRNA 4LMQI 5FHAH 4X99A 4D9RD 3ZKMC 5CP3H 4RMSA 3UTTD 2E8YA 3FO9A 4O2CA 5D6DA 3MROB 2JB6A 3NIDE 2GT9A 5C7XL 1E6OL 1OSPH 2YK1L 5DSCB 4C54A 4EUPG 2JJWA 1MF2L 5BW7C 1GGIL 3HE6B 4G7YL 3RZCC 4ELMA 4P2RB 2E9JA 1U36A 2LVCA 2ZPKL 1YC7A 5FKPA 3RWGA 4P59H 2Z92A 3GB7B 4EI6B 3RX5A 2YC1B 1A6ZA 1YEGH 4U1IB 4NC1E 1YN6B 4KKNA 5GGSB 4Z7WB 4QYOB 1FYTE 1A1NB 3C5ZB 5D72H 5GGUB 3DROB 1NMCC 3O41A 4ZO8A 3QUMH 2X4PB 2HRPL 4P23A 3ARTA 3BKMH 4GXVL 4HGKC 1ZLWH 1M7XA 3QEHA 1DUYA 1U3HD 1WZMA 5SWZE 3DUUB 4DZBB 3DYOA 3EOTH 3SDYL 3HC3L 4G8IB 2GUOA 2H8PA 3RWEB 5C0RH 1HDMA 4BJLA 3MJ9A 4NN7B 3LKQA 2DQIH 4WW1A 3D18A 2VDLH 2JE8A 3UTSA 4UT9H 3QI9B 2DQGL 1K5NA 3C6LD 3CUPA 3HUJB 3GUTA 3BGMB 3OGOE 4I3SL 1TZHA 3RWFA 3GHEH 3QDGA 5GS1C 1FN4A 1MHEB 4O51A 1KBGL 3U9UA 1Q9LB 3VXUA 4KUCF 1QBLH 5C09D 3GMLB 4NCDA 4HPOL