1ZWIB

Structure of mutant kcsa potassium channel
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/ion transport
molecule keywords monoclonal antibody, heavy chain
publication title Molecular determinants of gating at the potassium-channel selectivity filter.
pubmed doi rcsb
source organism Mus musculus
total genus 47
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zwiB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zwiB01
5ITFB 4XHQA 1KJVA 3VXOA 3TO4B 3QH3B 4X9FA 3PGCB 3V0VB 4AIOA 1RIHH 3MLZL 3RTQB 2JK5B 3WDIA 1OQXA 4MD0B 3SGDI 2CGRH 1J8HE 1KB5H 1NDMB 3FB6A 3SDXB 3GRWH 3VFRB 3CFIC 2AEPH 4WEMB 3WLBB 1A1OA 3TIDA 3MR9A 2P8LA 2OJEA 3HNSH 5D7IA 1DFBH 4H25B 4UI2A 5IMOA 4BFIB 1ONQA 5DVNA 1KPRB 2BVOA 1EV2E 2UYLB 3KYNB 1CDUA 1P4IL 1U0QA 3GMRA 5C08A 3ARFD 3HNVH 3MRDB 4XWGL 1FVCA 4KZEL 3HNTH 2EO1A 4HBCH 2MPAL 4PLJC 1K6QH 4GO6B 1NL0L 4KRPB 3PNWB 4PG2C 4X5LA 5LVEA 5HGHA 3TZVA 1I7TB 2FO4A 4G8GE 4OFDA 5ID0B 3LPWA 1WT5A 3K4AA 5CGMA 1A7QL 5L2KA 2M2DA 1VSCA 2NLJA 4YBQD 1NH6A 3B5GA 1HK6A 3V4PH 2R1WA 5EN2B 4FMFA 1Q94B 2VDNH 1CFSA 4HG4K 2K3TA 4W6YB 5GZOC 4MNGA 3HE7B 3TYGH 3L3JB 2HFEB 3MRNA 1KCSL 4W68A 3RZCA 2ID5A 2A9ML 3G6DH 3L5IA 2IADB 3PWPE 4OCNC 4BZ2L 1N4XH 5DUML 5I73B 5JQ6H 2AEQL 4XPBH 3SE3A 4YHIA 1SVCP 1YYLH 1CE6B 1BBDH 3I6GA 3GSNH 1D6EA 2OZ4L 3MXWH 3UYRL 2Z8RA 3ARGC 3MCKA 4YXLL 1N5AB 4S2SB 1DUZA 3V7AG 4IM8A 4TVPH 4HIHA 2AGJL 3IJSA 4A6YH 4OZHF 2O61A 4QRQA 1AXSB 3HC4H 1Z3GH 2P45B 1EEYA 3HAEB 3EIFA 2Z31C 3SHSA 4GUPB 3F5WA 5DJ8B 5IR1A 3MGTB 3WJJA 3K3QA 4BQBA 1R5IA 4APQB 4WEBH 2IAND 4ODTH 1J5OL 5DK2B 5CGYD 1MOEA 4CJ1A 4JQVC 3QPXH 1I1AA 1A7RL 5EBGA 3F7YA 4XBPB 3MLPA 5DFTA 1ZA6B 1EJ6A 2YPVH 4U6VH 3ZE0F 1YY9D 3ZDZF 1T1XA 4Z77A 2E27H 3FO1A 3PWJB 3STZB 2EH8H 5AG9A 1JIBA 4JPVH 4OGAC 3QISA 3VCLA 4JB9L 3CSYA 1ZE3C 1MY7A 1TVHA 4HJJH 5EWIL 5C09B 3IJHB 3LCYA 4Z7WA 4OLUL 1SVZA 1OAXH 4M7ZC 4OZGA 3UTQB 3MRCA 4X0KA 4K23L 5I0DA 3ZTNH 4ZFOB 3V8OA 1MCOL 4TSAL 1OPGH 5K33A 3LKOB 2X4UA 1INEL 1MF2L 5E9DE 2JELL 4QRTB 4MNQA 3D39A 4JANB 4YXKL 2XNAA 4OZIE 4DQOL 2J8UA 1K4DA 3LKQA 5FOBB 3GI8H 1A5FH 5T1LA 2VXUH 4EI5C 3IVKA 2X4QB 2VABB 3KYKH 3QQ9C 2NY7H 1L0YA 5E2UH 25C8L 4YXHH 1KPUA 5HHVL 1LE9A 3CC5A 3P4LA 1W0WA 4ZO7A 2G5BB 2GITA 4ZO9A 1EVTC 1V7ML 1DDHA 2IANE 2X4RA 4MLSA 1HH6A 3S98A 4KK5D 2ZCHH 4Y5YC 5C0BD 3VW3L 1EUUA 1P9MA 1I1FB 1CR9H 3TIEB 4GW1B 5TGBB 1SMOA 3F7PC 1NFDF 4GKSA 1QFHA 4NKOA 1VPOH 3RNQA 3BXNA 1T22B 2UY6A 5K9JH 4LGSB 4U1JB 5IK3B 4ESKA 3H7BB 3QUXB 4POYA 4MAYB 4BH7A 4Z8FH 1EJOL 2BX5A 2PYEB 4LVEA 1S7UB 3SJVD 1UXSA 2ED9A 4KKAC 4GMSH 1U2HA 4DWHA 4ZSOB 3SKJL 2AQ3A 3VI3F 1INQB 1XGRB 5FV2A 4QCIB 2VDPH 1RJLA 1AGCA 3EJYC 4U2YA 3DARA 5KW9H 3KDMA 1YNKL 4XPGH 4U6XB 2OTUB 2WIIB 3S5LA 4OT1L 4DKFH 5EIIA 5EDXA 4ODBD 1BLNA 3IS0X 5F1OB 1YPZF 5D6CB 4JKPH 2RB8A 1PGRB 1CE1H 2FGWL 4MJ6B 4LHUD 5DRXA 5IQ7H 4AIXA 4OD1H 2VZ3A 3LZFL 4DN4L 2VUOA 4JHWH 1V3LA 4XMPH 4YK4C 5JPMA 3G5ZA 5E6YA 5C0BE 2EEDA 2C1OB 2YD2A 1BMGA 3LV3A 3BQUA 4G8IB 1UB6B 5GJTL 3WKMH 1DBBL 3HZVA 1XF3B 1A8JH 2A74B 2DYPA 4MCZA 2A6DA 3PABB 1X5XA 1JNLL 4NQXB 3KAAA 2F8VA 4PV9A 2NTFB 1MFBL 5JHLL 3BH9B 1B88A 3WXWH 4OCMC 4JHAL 4AL8L 4HEPG 1WIPA 1R3IL 1FO0H 4IIQC 5FA3A 2ZSWA 3SJVE 3X3FH 2VSDA 1U9KA 3O6FA 3U0PB 5E6IB 1WZ1L 1KEMH 3LAFA 1NAKH 5IJVB 1DN0B 2V2WB 2IPKB 5EC2A 4NZJA 5E2TH 4CMHB 1IAOA 4JFDE 5IGXL 1DBJH 5ERWA 3QJHA 5KSVB 4PJ8D 4ZFFB 2X7LA 3K0WA 4O2CA 4OLXL 5E5MA 3DSNA 4J23A 2XA8L 3UTZB 5L2JA 4OD2B 3TVMD 3MJGX 3PGFH 3LN9A 1RJYB 5IROC 5DD1L 1UEMA 1XGYL 4AEEA 3VWJA 4BA8A 3D25B 1CFBA 5TE6L 3FRUB 1JWUA 1P84J 3SE9H 1PKQE 2QADD 3H9YA 4KUCD 3VD4A 4LAQH 4OLEA 5KZCD 1QFUH 2BY0A 1DQTA 3QG6B 4BZYA 5IKCA 3WIHA 1A1NA 4ZAKC 4OI7A 3F6IA 1XF4B 3VFUB 3V52H 1ACZA 2VXVH 4LCCA 4JDTH 5E8DL 5I8OL 3FO2A 4F7TB 5D4QA 3NMEA 4O4YH 1BBJA 2Y7QA 2QSVA 3EHBC 4OF5A 1IAIL 1G6RL 2VZSA 1RULH 4OZIF 5EORH 1S9WB 1FORL 5CS7A 2X89A 5HHXH 2WP3O 2DKMA 1I9IL 5KTEL 4NZTL 1IAIM 5IMMA 2P5WA 2ESVA 3P9LA 3C6LA 3WIIL 3MLRH 1M05B 1E6OL 4HT1H 2R0WL 4MJIB 3SCMA 4FA8A 3G6AB 4Z6AT 4MDJA 3VXSA 1SM3L 4P3DB 1N7ML 2YA0A 4JPKH 3P0VL 1NANI 1EMTH 5T3ZD 6FABL 5I1EH 4LPXA 1EK3A 1Z9LA 4XNYL 4DUXA 2ZOLA 5TFSH 3TBVB 4CGTA 3F7VA 4P48A 4HKJB 2IPTL 1GC1H 4NQCD 3ALPA 1S7QB 4ZS7H 1AP2A 5FKPA 1L9NA 3T2OA 4BK4A 4E5XA 4IOFD 3EYOA 4UT6H 4YHOL 1QUNA 4MD4A 4YHYC 4M3KB 5JA8B 1RFDH 2MHAB 5DR5H 1IGCH 1LEIA 2JJWA 2C5DC 5GS2D 4MJ2A 3IFPB 2FHFA 3ARDC 5KAQG 4K7FB 2K7QA 4NWTL 1DL7H 1EZVX 3FOLB 2XRAH 5E1HB 2H6PA 2EDYA 1I9JH 5EU6D 3P9MB 4JDVB 3QIWB 4KAQH 5INCA 1A2YA 2AV1A 3MLSL 4F9LA 5CSZA 4LLYA 3WEXA 3UBXG 4R90L 4D0DA 4KU1A 1H0DB 4NO0D 2H32A 3OKNA 2W9DH 2X9WA 1UKQA 4EXKA 3KXFA 1VFBA 2F9BT 2FSEA 1YEJL 4QOKA 3OAUH 4QYOB 5IBLD 3X13B 1YMMD 4OCRL 4X4XA 1N26A 1EO8L 1UCBH 4LPWA 4QHKJ 1OVZA 4PRPB 1F58H 3Q5OA 3TN0A 4JM4H 3QDMD 5C0NC 2X1XR 3EYUH 4X4MA 2VXQL 1GSMA 2P42B 4U6TA 2J5LB 3PL6A 3L3IB 5HHMD 3WE6B 3Q0HA 2A1WL 5DWUH 3KLHC 1PX3A 1Q72H 4LIQL 4NQCE 1ZTXH 3O2WH 4I48B 4WWKA 4NZRL 3I75A 4PRHB 5CHNB 3SKMB 1QEWB 5KVGL 1OGAE 2VLRA 3RWFA 4UIMA 3V0AC 4S1SH 4ZNCD 3H9HA 2XICA 1NMAL 1UM6L 4AEHL 3WUWG 2J88H 4XTRD 4ZMAT 4X6BB 3RHWF 3VXMD 2ZUSA 1RHFA 5BV7H 2P4AB 3TYFB 2C4FU 2A9NL 3BN9D 5E7FA 3NTCH 3OR6B 4HUKB 4JQIH 4RGOH 5B4MD 3VMPA 4O51B 1X5YA 5B21A 4IHOA 2Q8AH 4XPTL 3OGCB 5HGBB 2GT9A 3BESR 3BPOC 4R4BA 1BJ8A 3GGWA 5A2FA 4G6JH 1TTUA 4MHHG 3UTSA 1T6VN 1K2DA 1Q9LB 4S0SD 5SWQA 1YMME 3NFNA 1SHMA 5DUPL 1QFWI 1FFOA 3C60D 1ZT1A 4AZ8A 3BIKA 2AV7A 4YHNB 3VFMB 4HXAH 1G0YR 2PCPB 1ZA3B 2BJML 4PJBB 3JWDH 3ARGB 2J8OA 1DQJB 5D5MA 1S8DB 4ZPTB 3TC9A 1CDJA 2NY0D 4LQFH 4X99A 3A6OA 4P9HL 4QF1A 3OAYH 3CPLA 4ACPA 1TZHA 4NZDA 3GJFB 4OF6A 4DZ8B 1EZVY 2CK0H 5H2BB 3QFJA 4K3HA 5HHME 1N5YL 4L9LB 5T1DL 2Z31B 4FXKA 3FFCA 3ARWA 3H9ZA 4NT6B 2BSSB 2B0SL 3NOIA 1S78D 1BQSA 2UUDK 2XTJB 2OXHA 1OM3L 2DM2A 2DL9A 3C5SB 4IOIA 3BW9B 3AAZA 1TENA 1MCSA 1JNJA 3P4MA 3DHJA 1A21A 4PJ5B 3AREA 4PJIB 2BCKB 2DF3A 3QPQD 1DQMH 4OD3H 4FQJH 3BEVA 4NJAL 1F2QA 1KULA 5DO2C 3D3VD 3LHPH 3GI9L 1NL0H 1A7NH 1OLLA 3VXME 4GRLC 3K46A 4FFVD 3H3PH 2XWJA 1NGXA 4XGZB 5I30L 5TE4L 1G7IA 4UTAL 5HVGB 4N0RA 2F53A 2WANA 1KGCD 3UJIH 5H8DA 1A7QH 2X9XA 1KJ2L 3JUZA 1FSKC 1U3HB 4U49A 3VGFA 4WU7A 3QUMA 1RUPL 2DWDA 3UJJL 4QGTA 3D85D 4AJ0A 4E41B 5C6WH 5I1LA 3CUPA 4K71C 4L4VE 1O5DT 3KR3L 5E5RB 2HT3C 2X6MA 4P5MA 3MRHA 3BZEB 1IGJB 5D2NC 3UZEA 2PUQT 1ND0B 3DV4B 2J4WH 1MFEH 5L7XL 3NACH 5C6PB 4TUJB 4KUCF 3W82A 4M6MH 2J12B 5EO9B 2AEQH 2RJMA 3O6KL 4TUOB 4S0TD 1JN6A 4JRYB 4OLZH 5E2VL 3DXAD 4WDIB 4GW5A 3MREB 5TPWL 4G9DB 3MOAH 1Z5LA 5J06A 4A2MA 2AGJH 5SWZE 1VEPA 3ARPA 2N1KA 3QQ4A 3V5HB 1PG7H 1WAAE 3UX9B 3ZKXC 5IHBA 4Y5YB 3GMQB 5GSRA 1QA9A 1BVLA 1AKJD 3F7RA 3K8LA 4HZAA 3QXUA 4CN6A 3FFDA 2FJFB 5E5UB 4HIEA 1ADQL 1LEKB 3MROB 3D0VB 3D3VE 4NQDA 4GOSA 3NABL 5C0DA 3D2UB 2ICWI 1KSRA 3KPQA 3OBAA 4HUXB 3SDCB 3TBYA 1A7RH 3ULUC 3L3DA 5JHDA 4JFXA 5IHUH 2VSCA 1RZKC 4LVNC 1EA9C 4EN3C 3OKOB 4HK0B 5ICZB 1DQQB 1KGCE 1I8KA 3O6ML 2AP2A 1TCRA 1QLRA 4LLMA 4UOJA 3VGGA 4CKVX 4N0CC 4LGRB 1HILB 2AJYL 1ZEAL 2VISB 3I02B 1OTTC 1YZZA 5BZDB 1HCFX 3SEPA 4LCUA 4P3CL 4LSTL 2R4RH 4NKDA 4LCWD 1BQHA 1KNOA 3TA3D 4M4PA 2NXZC 3KPRA 2D7TH 5C70A 5J8OA 4P2QB 2EDDA 5EC1B 1M1SA 2VXTH 4G80B 2DWEB 2ZOKA 4K9EC 4FQPA 3DXAE 3FJTA 3GSUB 1INEH 5DRZA 1NAML 1MHHB 4YXKH 1MUJA 3MBXL 2JIXB 3HG1D 3I6LD 2DQUL 5K9OB 3DIFA 2ADFL 3BHBA 4LLVA 3H2WA 3CDGA 1ZGLP 5DQ9B 5E08L 3PIQA 5JTWA 4YK4B 4CMMA 3FO9B 5HHVH 1OGTB 3BZDA 5EOTB 5DJ6B 1PW3A 4M00A 1V7MH 1BEYH 3VXUD 1Q0YL 1P2CB 3W0WB 4AIZB 3VW3H 1A14H 4XCYA 1MHEB 2OS7A 1NCAH 1AE6H 4F7MA 2DTMH 3MLYL 1BAFL 2F54B 2P47B 4X4YA 2AXFA 2D0GA 4JVWA 3HMXL 1F3RB 4GXVL 4Y5VB 3BPNC 3DMMC 1HNFA 4I2XB 4C56B 5CP3H 4R2GD 5AUMA 4P2RA 5GRWA 3RI5F 5D70L 2APTA 3SDAD 1RQ5A 4LL9A 2B7DT 3B9KD 3TNNA 3MRFB 2OJZL 1J1OL 3C9NA 4OZ4A 1H3UA 1DBML 1X5KA 3A67L 1QLFB 3QUYC 1FE8L 1J1PL 4MVBD 2X4PA 2DLFL 3MRLB 4LHUG 4HIIA 4PJCE 2QQKH 4HKXA 2HT4C 1WF5A 4L5FL 4M6NL 4FFZH 1XCTA 1FNSL 5D1XD 4JHZA 3HPLA 4OLYH 3CIQA 1NFDA 2FJGA 1I1RA 2LE9A 5CGTA 4YNYA 4F7PA 5IVXE 1QNZL 2QKIA 4P2OA 3LKPA 3HG1E 3I6LE 4QKXB 3DUSA 5AYQA 1AR1D 4FTVA 5ALCH 2OR7A 2FGWH 4WW1A 4N5EC 2YN5A 1E6JL 1FYTD 1C5DA 3L5XL 5DZLA 3S37H 3QEGH 3PF2A 3LZFH 2EYRB 2ARJB 5IM7B 4HV8A 1NFIB 5CEYA 1OP9A 3DVGA 1C08B 4HCRH 2JE8A 3G9VA 3QEQD 4G8EA 3AGVA 1D7FA 4N9GA 1XGPB 1BZ9B 1FGVL 4O5LH 5HDBE 3OKLB 4JJHA 5GJTH 4D9RD 5CCKH 4PUBH 5D7JA 1P7QD 1JHKH 5JIHA 3QNZB 2X44D 4WI2A 1JNLH 4JFFB 1KCUL 4HC1L 1JZ8A 1K8DA 5GGQL 3OXRB 4J3OC 3GUTA 1I1CA 4NM4L 3GJFK 1R3IH 2Q87A 1KELL 4K3EH 1RZ7L 1UJ3C 3MUZ1 3S36H 2SEBB 1RIVL 2GUOB 3G9AB 5EO1B 1KB5A 2CR6A 1RUQH 3WUWA 4J3WA 4Q0XL 4JLRB 5IWLC 2F53E 4FQCL 3QNXA 4KMQA 3LKRB 3R8QA 3PP4L 4KY1L 1T7WA 5HDQL 3DURB 4GAJH 5GJSL 3WUZA 1P4BL 4YHYB 4NHUB 1I8MA 5TDNA 4HWZB 4PJ9D 4U1SB 5I1JH 3QEHB 1ZT4B 4P4KC 3ARDB 5DJZB 3NN8A 3UPCA 4CVZB 2NY4B 4U31A 1G7MB 2XA8H 1SEQL 3T0DA 5DD1H 5ANMA 1D6VH 1XGYH 2DM4A 3I50L 5TE6H 3WO4C 2C3XA 1FZOA 1SJXA 1IJ9A 4GW4A 1ZSDA 4D9LL 4NSKB 5HI3D 4RISH 5F44A 3RKPA 4WY7H 4NNXB 5IESL 1V3KA 5KN5A 2FATH 4I3RL 3CFKB 1QRKA 3CVHA 3M1BA 4WW2A 3BZFB 1BZ7A 4N0FA 4QRUA 4D9RE 3WFZA 3QP3A 5KS9B 5E8DH 3RVXD 4ELKB 5I8OH 4EVNA 1J0ZA 2MCPL 5DRWB 4XAKD 4O2FA 1IAIH 1G6RH 3DYOA 5FYLH 5T33L 2GY7B 5JIKA 1YUHB 4NO2A 4HMCA 1LO0L 1NBZB 2ITDA 1DLHB 1K85A 1CGSL 1I9IH 5B8CA 2FHCA 4Y8AA 1LMKA 5CKAA 3TZVC 4Q2ZB 3GHBL 4PJGE 4LARL 3WIIH 5DMKB 1WT5C 2R0WH 3R8BB 3N1QC 4UZGA 3AXLA 2NCMA 5MEOA 3BP5A 3P0VH 2KUTA 4L1HA 6FABH 2XKUA 1E28A 1UJTA 1X4XA 4XNYH 4PJDE 1CXKA 2GAZA 1FP5A 1MI5D 5JXED 3BEWB 4XX1E 2YBRB 4JPWH 3UPRB 3B8YA 4L8BA 5L88L 1MFAL 3RZCC 4WVRA 2IAMD 4FS0A 1GIGL 2D03L 4YHOH 1CD0A 3INUH 5FM4A 4XCFH 3B2UC 3MYJA 1B0RB 2EE2A 1RD6A 3SE3C 3RNKB 3EO9L 3ROLA 5ICXB 5FCUL 5ECJE 2E9BA 3OHXA 2R0ZL 5IQ9A 1RY7B 4ZUSA 1CFTA 3LQZA 3SDYL 3Q1SL 3BPOB 1NGYA 1JNHB 4FQXA 4R90H 1AO7E 4P59L 2W0LA 4NQED 4G6FB 1RK0B 3WJJC 2H45A 2XY1A 3MZGB 4EXPX 1S3KL 4XAKE 1FNFA 4M6AA 2LABA 2E6JA 5H35B 5IVXF 4YDJB 1DSFH 4R26L 2Y23A 4E9LA 4OCRH 4YBHA 1I1AC 5JO5A 5DUBB 1S7VA 4EKXA 5DMGC 1U2CA 4DN3L 2AI0L 2BHYA 4P49A 4YHKH 1FCGA 5JDJA 4M9OA 4XB8A 1PQZA 4NYLB 1ZS8B 1SBBA 1F11B 3LB6D 4OUOA 3FQWA 4DZBB 3VE0B 1MI5E 3FCTB 5C7XL 3EYVB 3T0EA 4LIQH 5HDBF 2JKXA 5IB2A 3GJFH 3I3BA 3TH4T 3DO3A 1HSBB 1B90A 4XCCH 1WWWX 1SBSL 1BVKB 4KK6C 4OAWA 1TMCB 4NZRH 4U0RC 1EERB 3REVA 4NOBA 3DETC 1DLFL 3O3BB 4JR9L 1CDIA 2V6HA 4H0IA 4OGXL 3SKOB 4KJQC 2E6PA 3K4DA 2BNRB 2FWOA 4HUVA 4FXGB 2WINA 5LGHH 1HHKB 3QFDB 2GFBB 3IFLL 5FV1L 1UM6H 4Y5XA 2D9QB 5CJOL 3ULUL 4Q97A 1TJGL 1K4CB 1RZKL 4F8TA 5DJ0B 1ZHLB 4OI8A 2FD6L 2AXGA 4UNUA 5C8JA 2A9NH 1FSKB 5E2WH 1MJ7L 1ACYL 3F62A 2ZSVA 5AZ2L 2AQ2A 4PP1D 4MCYA 3HAEG 4R8WH 1JV5B 3TV3L 3P77B 1CLCA 5ISZA 3QXWA 1ORQA 2YD4A 5D2NB 1WGOA 5HVFB 4DKAA 1P9MC 4ODXA 4QY8B 5C86A 3VFGL 3LRHA 4MLIA 5KBNC 4JREC 1PKOA 3D1MC 1WIUA 1S7SA 5MERB 4WHTA 4L3CA 2YSSB 4R6UA 1MCWW 2F5BL 4F80A 3D18B 1NGQL 3OL2A 5FIEA 2HKFH 3VRIA 1N5YH 1FFRA 5T1DH 4ELME 5C0AB 2OX5A 1J7VR 2ZZUT 4ODSL 3STLB 2QSTA 3TBWB 2B0SH 2VNCA 3BIAX 2IALA 1HXMA 4TVPD 5JLZB 4FXLA 3I3DA 2IQAB 3IGAB 2J8HA 3RVUD 3V6FA 3U4EB 1FL5A 2JB6A 2JJUA 2VIRA 1HSAB 2I26N 5FOJA 5EU5B 4WO4D 3NA9L 2BRRL 5DF0A 4LHUA 5FGRA 4QRPD 1GGCL 1TCMA 4EN3B 4OGYL 1CCZA 5DGQA 1KTDB 1LO4H 4PB0L 3GI9H 4PJGF 4QWWC 3A6BL 4RAVA 3DRTA 3O3EA 4XI5C 3N9GL 1JK8B 1HYSD 3BISA 2XFXA 1FRGL 3OKDA 5TE4H 4FQLH 2DL2A 4EJ1C 3RL2B 1SEBB 3VFOB 3IXTA 5DMIL 3H9SD 1KJ2H 1G6VK 1ROWA 2NXZB 1A4KA 3P30L 3U4BH 1RUPH 3RIFF 1EEUA 5ICYA 5A2KH 2DS4A 2DMCA 5HYEA 3DTXA 3BQUC 2P43B 2LTQC 1IGYA 5K93A 3C8KA 1W2KT 4PD4J 3IXAB 2IMNA 3P73A 4JKKA 1QRNB 5HVHC 3VD5A 3V6OE 5F3HA 2FZ3B 5J56B 4F3FA 5HPMB 1MNUL 2O5XH 3IDMB 2IBBA 4EQ3A 2EXWD 1CG9A 2WQRA 4OM1H 3WLWD 2AJUH 3U7WH 4MD5B 3O6FC 4K94L 2P7TA 1CDHA 2HN7A 3FMGL 5B3NA 4KROC 1Q9OB 3WFEL 5D7LB 4G5ZL 4JO1H 3KPMB 4TVPE 3ARYA 1AD9B 4QRRD 3N50A 5CKGA 4JO3H 1JMZA 4GAYB 3EYQD 3M45A 5DRNB 1ED3B 5GGTH 3RDTA 3KLSA 1W72B 5GGVL 1RJZB 5IVNA 2BP3A 4QRPE 4OZFG 4Z7VE 2YC1B 2YMXH 4YDKH 4YHLL 3NABH 3BPNB 1I7RA 5FUCC 3DMMB 2YS4A 2WWKO 2DD8L 3GB7A 1IARB 3VWJC 2E8ZA 3FN0H 1CTOA 2Z92A 5GGSY 1LP9E 1XH3A 3LRGA 1KOAA 1QR4A 4HWBL 1KTLA 1QBAA 5MENE 1UXWA 4X7DC 4R3SA 1NBVH 3QUYB 2AJYH 1ZEAH 3AB0C 1T1YA 3HB3C 3P4NA 4HS3A 5IP4A 3TT3L 3S3JA 2IMMA 3GMPA 1PLGL 5CZXC 2XN9B 3ISWA 1KLGA 5FB8A 1T0MB 4LNRA 3RWCB 1II4E 3L7FB 4Y2DA 1JTOA 3DVIA 4V1DD 2GSIA 1WITA 4FQ1H 3T77B 1QSFD 4I0PA 1U95B 5C0IA 5JW5B 4F7CA 1QBLL 2GTZA 4ZD3L 5DHYB 5TDPB 1MJJB 5DEGA 5AYUL 3C6LC 3E8UL 3MBXH 1F3JB 4YDIH 4YDLC 3MNZA 2F15A 1WFTA 4HX1B 5DVMA 2UWEE 4GLRH 3SCMC 3B2VL 1H8OA 3VMNA 2EE9A 3R1GH 5HGDB 2DIJA 3PHSA 4XXDB 4QRRE 2Y25A 3ZYIA 4KGLA 4MQTB 2WUBL 5DJAA 3ROOA 2IQ9H 5B22A 1I1YB 5I1CL 2B2XH 4JCMA 3QUZB 4X9IA 3N85H 3B9EA 3X11A 5IBTL 1Q0YH 2HTKC 2EIZA 2G75B 4KVCL 2XWBA 2VKXA 4NZUH 1FL6B 4KRNA 4IRJD 1UB5B 1WK0A 4HK3N 1FG2B 3HUJB 5BS0D 2VN4A 2W65B 4WFHD 1E4XL 3WXVL 5CEXB 1FH5L 4ORGB 1AHWA 1S9XB 5DVOA 3X12A 4DAGH 2I9LB 3QI9A 2I5YL 5FUZL 3UYPA 4NRZA 1XR9A 3L5WB 5D70H 5LBSH 2Z4QB 1GJIA 4OTXH 1U8LA 4K8RC 1IBGH 4OFIA 1HIML 4F9LC 1FDLL 5IB5B 1T80A 3QH3A 4I77H 2YD9A 1J1OH 4OGZA 4KKCC 2JK5A 5C0JB 3A67H 4LHJB 3FONA 4OCYL 2YXMA 1FE8H 1Q38A 2DLFH 4LGPB 1X7QB 3JUYA 4ONFL 4P4KB 5EIVA 3QDMA 3QWOA 1DVFD 4L5FH 4M6NH 4RWYL 1GGBL 2NZ9D 2ZCLL 4HXBL 3BAEL 3I6KA 5F93C 4H25A 3TFKD 1KJVB 5CILH 1MQKL 3MLWL 4CRPA 2NR6D 1MCKA 1HHJB 3WFBH 3WO4B 3KYNA 1BGXL 1JPFA 1BFVH 5E24E 1QNZH 3TN0C 4HIXL 2Q7NA 1A1OB 3TIDB 2APFA 4KJPD 3MR9B 1BD2B 2P8LB 5EUOE 2DQTH 2OJEB 1T21B 3PL6C 5EPMA 1UA6L 3L3KB 4YHPA 3L5XH 4M93B 1ONQB 2ZPKH 5T5FL 3CFDB 3GMRB 4WWKC 5C08B 5T3XL 4Z0BL 5ID0A 4HKZA 1FVCB 1B0WA 4TNVK 5F8RC 4LPTA 5IB3A 5BS0E 5KOVC 1MCLA 4WFHE 3OJDA 4RFNC 3GKWL 1Q94A 1RUAL 2DQEH 5HGHB 2YWYA 3TZVB 3W9EA 3DI3B 4HC1H 2FO4B 2IPUG 2NY3C 2WWMC 3HZKA 1OAYL 5L2KB 2NLJB 3QDJB 1KELH 5F70A 1YNLL 4MXQD 4RQQA 1RIVH 3O4LB 1CE6A 4RX4D 5I8KL 3OKEA 3ILQD 3ZTJH 1Y18A 3C60A 4HWUA 4OCSL 4FQCH 4B50A 2Y4SA 4MNGB 3JTTB 4N8CH 3PP4H 4XBEH 4AK1A 4G9FD 5HDQH 1N5AA 3MRNB 1A0QL 5GJSH 3RZCB 3BKJL 4Z7VF 1FIEA 1YN6B 1P4BH 1AXSA 4ODHH 5CD5D 4L3ED 4YHIB 3HAEA 1CXIA 2JJSA 2WSKA 3I6GB 4GUPA 1D6EB 4HH8A 1OWRM 5DJ8A 1LP9F 3MCKB 3MGTA 4YZFE 1UH3A 3DX9A 1QSED 5C0RL 1RU9L 2M26A 4G6KL 2CRMA 3I50H 3LS5H 4FZEL 5DK2A 1BM3L 3AFLA 1U6AL 4QRQB 4AH2B 4L4TA 4KK8C 1EEYB 1OWWA 2FGZA 5L9DH 3LKNA 4G42B 2X05A 5L8LB 1ZA6A 4D9LH 2OXGA 3DJ9A 3F5WB 3GMOB 2AK4D 4JGJA 5C0EA 4YO0B 4NWUH 4JFZL 1XIWB 4I3RH 4H20H 3STZA 3VI4E 3HPJA 2H9GB 5D1QD 3V4VL 3H42L 1JE6A 3AREC 3F7YB 2NYYC 5ESQA 1I7ZB 3PQYD 2PR4H 3RWJB 3SGEI 4PJHF 3WS6A 5C09A 1T1XB 5FYJU 5BCAA 4HAGA 2R2HA 5CJQL 1LO0H 3UYOD 3MBEB 5FECB 1CGSH 3VXRD 1MCCA 1RVFH 5CINH 1UM4H 4ZFOA 1NEZG 3HRZA 3VCLB 4JQXA 4WFGD 4LPCA 3GHBH 4LARH 1KBGL 3RY6A 1EAJA 4LEXH 1TVHB 5HHPB 3J8F7 3NA4A 5SX4I 2R56H 4G9FE 3KPNA 4Z7WB 3ARBB 4OCWH 4UTBL 1HOCA 3AU1A 4OZGB 3RJDA 3MRCB 4X0KB 4KHTH 4NQUA 3UP1A 2KDGA 4MQ7A 4L3EE 2EKJA 3TO4D 3C2AH 2VABA 4PLKC 3RWIA 3RTQD 1UYWL 4NO5B 1M7DB 3K7UA 2X4UB 4TUKL 1AGFB 3CMGA 3RUGE 4KTDH 4MNQB 3D39B 5E2JA 2XNAB 2J8UB 1QSEE 3LKQB 3T09A 1BZQK 1E4WH 4JY4A 4F7EA 3EO9H 5T1LB 4U1MA 4KKNA 3IVKB 3IJYA 5EBMA 1N6UA 4GW1A 4FG6D 5B38B 1V7NL 1XAUA 3CC5B 2AK4E 5ALBL 5MEQB 2R0ZH 5F6IC 4C58B 3ZE2E 3GO1H 4PGBA 1T22A 3VGDA 2HVJB 4X7CC 4POUB 4U1JA 5IK3A 1DDHB 1HH6B 3GIZL 2CSPA 3H7BA 4P59H 1CLOL 4MAYA 4LSDA 4HWNA 1S5IL 3T8XA 4JREB 4NGHL 2Y6SC 1S7UA 4ZDHA 3PQYE 5IFAL 1S3KH 4PJFF 3RNQB 4PRBB 5A16A 3BXNB 3W11C 3ZDYE 2BSTA 1INQA 4FOMA 4JFHD 2FJHA 4MB4A 5DZNA 1S7RA 1O0VA 1A1MA 1IGML 4BH7B 2A73A 4LCWA 4OZFA 4PJXB 1T1ZA 1NQBA 4TTDD 4U6XA 5D96C 3MA9H 5DQDL 3DNKA 1W8OA 4DOHB 4OIBA 2W92A 3HC3L 2BVQA 1RJLB 3DPBA 3QDAA 3DUUB 2B5IB 4NC1C 1B2WL 2BY1A 2AJVH 4DK6A 4MJ6A 2ADIA 1SBSH 4FP8H 1R24A 3KDMB 3J7HA 4N0YL 2HKHL 4Q9CA 3SDXE 3WBDA 1GHFL 2HFGL 3S5LB 5F7UA 1NFKA 1DLFH 1RZJL 4UAOC 5EIIB 1BLNB 3CZFA 2HJLA 2Z8WC 3QIUB 5IW6B 3MGOB 4Z7UB 1PFCA 5DHVH 2C1OA 5FM5O 1L0XA 3R06A 3W9DB 4LSPH 1OARL 4FHBD 4YFLI 3ULUH 1TJGH 1RZKH 1LQSR 3T1WA 1N8ZB 2ADGA 5JMOC 4FQQB 4WHYH 3VXUA 4GBXD 2NTFA 1MJ7H 2DQIL 5JPMB 5KJRH 1T0PB 4XB7A 5EZIH 3TO2A 5AZ2H 5D93C 2EH7H 5J11C 3LV3B 3HZVB 7FABH 2ICWA 2RCSL 4X9GA 5C07A 2DYPB 5C9JB 4MCZB 4I18B 2V9TA 2A6DB 5KSBE 5HVHB 2D7PA 4JFHE 4UT9H 3WJLA 4PV9B 3I9GL 2PXYA 9CGTA 3U1SH 3MUGB 4ZUTA 3B9KA 1LEGA 3SGJA 1ZANH 5DSCA 3TGXA 5BOZG 4K9EH 2R0LH 4U05A 2NY1B 3IDNB 3O6FB 5KOMC 3QWQB 2QHRL 1RUKL 5HY9B 4KROB 1YC8A 4YUEH 1NEUA 3UTZA 4OD2A 3BI9X 1HHHB 5EC2B 2DQGL 2A0LD 1R3HA 4X80L 1DP0A 3VI4F 3QIBD 2JB5L 4FFWD 4ODSH 5D1XA 1BWWA 4MA1C 2R8SH 1SJEB 3QJHB 1AR2A 1H3PL 1GCFA 1FPTH 1WFOA 2HTLC 5L2JB 5EH1A 2G2RA 4OKDA 3K1DA 4OQTA 5FM8A 4X5WA 4RGNC 3VWJB 4PJEF 5IBUB 3RY5A 1PEZA 3VFUA 3V95A 5JUEH 4X7FC 1W72H 1FYTA 1GGCH 1TQBB 3WHE0 4P2OC 2JLLA 1LD9A 1IKFL 3AB0B 3GSVA 1CYGA 3UTTB 4K8RL 3TM6A 4YEFA 3T04D 3V2AR 3TNMA 3LDBC 2V2TB 2XIDA 4B41A 3RGVB 4MJIA 3U9UB 5K9QI 3G6AA 1BREA 4ZUVB 3U2SB 5IOPB 4P3DA 4GKOA 4R0LA 4XCNB 3BVNA 3QUXD 4BH8B 4H1LG 5EG6C 2AS5M 3IDYB 1A6AA 4NPYB 3UJTL 3TBVA 5D7JC 3WFDL 4LPVA 2PYED 1S7QA 5IMMB 5CZKA 2P5WB 4M03A 2ESVB 4BSJA 3P9LB 4DK3A 1ETZB 4PYGA 3C6LB 1MNUH 3I2CH 4OLWH 2A6IA 2I07B 4DGIH 3SCMB 1HINH 4MDJB 3VXSB 3ZE2F 1JBJA 2CQVA 2ADJB 2ZOLB 3F7VB 4Z7OF 3FMGH 3IFPA 3TJEH 1S5HA 4O2EB 3G08B 4PJ9A 3QEUA 3FOLA 1PVHA 5CFHA 5FKPB 3T2PA 5JZ7D 1ZLVK 1Q9KA 4E5XB 4TYUA 3D0LB 3EYOB 3ZDYF 3NCJL 3HI1A 2GJ6D 3GM0A 4DEPC 2D2OA 4KI5E 4Z5RA 4HUMB 1G9EA 5I19H 3OAZH 4RAHA 1QR1A 2ICEA 2BK8A 4YHLH 2GCYA 2H6PB 2DD8H 3G6JE 2DQDL 3KGRA 4NNPL 3OZ9H 4QYOA 1MWAL 1MFCL 5F96L 5INCB 3X13A 1A2YB 5IMKA 2AV1B 4LLDA 4Y4HD 5SX5K 5CSZB 1KJMA 3WEXB 3F7QA 4HWBH 1KXTB 2H32B 1UACL 3OKNB 5DJCB 3EFFA 2Q7YA 5DXWA 4J3XA 1FBIL 3KXFB 4XP4L 3TT3H 5HYJA 1VFBB 1CL7L 4WW2C 4QOKB 3VG9C 4ENEC 4G8FB 4GAGH 1KB9J 4ZTPL 4UUJA 2FECI 1J18A 3HCVA 4X4XB 5IF0B 5L0QB 3W5NA 2Y5TA 4PY7B 2PYEE 4AG4L 5GISL 4M7LL 3KYMB 1A9EB 4ZSOE 2Z9TA 1QBLH 5CWSA 3I84A 4PRHA 1Y6KR 5BZWA 5B8CC 2YK1L 5CHNA 2AXHA 4WI6A 2ILLA 4XP5H 3EJZD 5D71H 4MA8L 3S35L 1VFAA 5KVFH 4WWKB 5BRZB 1HZHL 3E6HA 4JFPB 1NEZA 2FX7L 3ZMRA 2KZWA 5KSBF 3Q6FB 2QHLA 4EUPG 3OR6A 4JCLA 3TWCH 5I1CH 1JP5A 4F57L 2VQ1B 3MRQA 5JQHC 2YKLL 3RWFB 4RFNB 5J3HD 4UIMB 4O51A 4LSSH 1IC7H 3OGCA 2EKSB 3KLAA 3V9FA 2YD5A 1E4XH 4HS8L 1Q9LA 4LFHD 2JF1A 4X6CB 2I5YH 5FUZH 4NQEA 4YHNA 3QCVL 1U3ZA 2PCPA 4RAUA 2V17L 4CU8A 4PJBA 1FNAA 3GGWB 5BO1H 1HIMH 4FQXC 1FDLH 4O02L 2IGFH 4WTXA 4GQ9L 3UTSB 1JF5A 4KKBD 4GRWH 1GVIA 5IHLB 5HD8D 3MJ9A 3M17B 1FFOB 3UCRA 3D6GA 4L9LA 2AV7B 1AQKL 4NT6A 2BSSA 1BFOB 1GGBH 2ZCLH 5D5MB 3LH2L 4WFEE 3ZZ1A 1WZMA 3MLWH 1UG9A 4X99B 2RAMA 3C5SA 1EFXB 3BW9A 1BGXH 3GM8A 3S34L 1UWEH 4HIXH 5D7SL 3IFNH 2BCKA 3TESA 3E3QC 4WEUD 4WI8A 1IAKA 5EOCL 2VH5L 1LO3L 2D4FA 1T04A 2LU3A 5DMJB 3T0EC 2IWGA 3AAZB 4QRSB 3FZUC 2HMID 3P4MB 1SYSB 2JCCE 1GZPA 3SDDB 5T3XH 3SO3B 2X42A 2XKSA 3PHOA 3BEVB 2UZIH 1U3HA 3BP7A 5L8KB 5DJ2A 4EDXB 3KLDA 4RBPK 2F58L 3K8MA 4TVSa 1OW0A 2XWJB 4UINH 5I9QB 1FFQA 1L7IL 1OAQH 2D4DA 2OM5A 4Y5XC 3HZMA 1DEEA 4RMSA 3S4SG 1ND0A 3DV4A 5JOPD 3BE1L 4Y19B 4KWUA 4WU7B 3QUMB 2DWDB 3CX5K 4TUOA 4JRYA 4NKMB 5DDHB 1J86A 1MSPA 4WDIA 4OCSH 5SX5H 3CUPB 3Q6GL 5SWSA 3MREA 3W2DL 5C0CB 4PRPD 1NGPL 3CDYA 5GGRY 1MY5A 4OBSA 4B7LA 5J12B 1U8KB 1F42A 3GJEB 2FEDC 1XGUA 3MMEA 4P0DA 3IKCA 1IGFL 1JN6B 3G6JF 3OQ3B 4YFLF 2Q8BH 4GW5B 2WBJB 2APXA 2FEEI 4TSBH 1YEFL 1Z5LB 5EO0A 3MSPA 2FJFA 1ORSA 5I1IH 1MCRA 1LEKA 5F6IB 5HYSG 3D0VA 2VLJB 3D2UA 2B4CL 2GHWB 1EPFA 4P4RA 3SDCA 3P4OB 2QJDA 3ZKMC 5ETUA 1S9KC 5EOCJ 4GH7B 1BVLB 3OKOA 5I18L 5J7CC 4J2XA 1WVZA 4HK0A 5ICZA 1DQQA 3FFDB 1J0YA 2DMBA 3CFBB 3NIFE 3BT2L 3O8XA 5TH2A 5I1GL 2ZJSH 5I76A 1IM9A 3O41A 5E4EC 5C0DB 2VISA 1OTSC 2ZP0T 3I02A 4WUUD 1EAPA 3LY6A 3TBYB 4PR5A 3L3DB 3JWOC 4JFXB 5E94B 4MX7A 3CCHA 5F72S 4OBRA 1U93B 1KPVA 2I9TA 2VKWA 3LEXA 1I8KB 1QBMH 3H9SA 1JGLH 4P2QA 5JOPE 1TCRB 5GZOD 5FYLE 4OZHB 5D96B 1QLRB 4LLMB 4ODUA 5EC1A 4OM0L 5C6TH 2MKWA 1SJHB 5F1NA 1PAMA 4LCUB 3JSSA 4NKDB 1MHHA 1NMCC 4LMQI 1BQHB 1KNOB 4PRPE 1EEQA 3ZYOA 1RPQA 3KPRB 2MQ3A 5FKAA 1UCTA 5K9OA 2VDKH 3ARGD 4ZFZB 4UAOB 2OL3A 4LCIL 2ZOKB 3FO9A 4ONGH 5CJ8A 1OGTA 4JEGB 5TJWK 5DRZB 4XP9H 5EOTA 4DKDC 4PJHA 3GEWB 1T89A 2XQYG 2Z31D 2IH3A 1MUJB 4HFWB 4H1LA 3DIFB 2MQCA 3W0WA 5LGJA 4LLVB 4DFIA 4YBLB 3EGSA 4OLVL 3PIQB 3ARQA 4CMMB 1TJIL 3FTGB 4M02A 2R29H 1KB9K 1VGEH 1V7NH 5D93B 5ALBH 4PJ5D 1M71A 1QQDA 4XP1H 3VWKB 2BFVL 4Y5VA 2QQNL 2FDBP 3EYSL 3OX8A 3BZ4A 5HHOD 5M95B 3BMVA 1FC1A 1MPAL 3GIZH 4NKQB 2Y07H 1CLOH 1WISA 3FQUB 3A0OA 3RDTC 5JPNA 3RKDC 1S5IH 4NGHH 4PJ7F 2WUCH 4F7MB 1AXTH 2QADC 4U6HA 4OGAD 2AXFB 1G7JB 1MFDL 2FX8H 1QLFA 1XR8A 4YHML 1OT2A 1CIDA 1JPSH 3QDHA 3P9WB 4QHUA 5AUMB 2WNGA 2ZUQC 4FABL 3PWLB 3TJHC 4MGXA 3FN9A 3MLTB 1YQVL 3C9NB 2V5SA 5DQDH 2CGRL 2D7QA 1KB5L 2JCCF 5IG7A 4V1DA 4JFED 2AEPL 1BF8A 3DROA 1QSFA 4HKXB 4YJZL 5F7KC 4Z9KB 1NMBH 1D5BA 3HNSL 4IOSD 1HYRC 1CK0L 4LIQE 4WV1A 1NFDB 4Y2DC 2FJGB 4RGNB 4EI5D 4PJFA 4F7PB 3QQ9D 2FR4B 1NFIA 3LKPB 1C08A 4LRNH 4BFBD 1ZGLA 3BKMH 3VG0H 4K7PL 3HNVL 3EO1A 3DUSB 5A3IC 1XGPA 3HNTL 4FTVB 4HBCL 5D2LE 4WW1B 1K6QL 4QNPF 3QDGD 4N0UB 1C5DB 3Q2CA 3T0XA 1OP3K 4PJ5E 3VFNB 4PV8A 4XNQA 4CVWA 4PJIE 4HV8B 5CEYB 3DVGB 3CH8A 3LDBB 4JFFA 4X8JA 5IV2B 3MYZA 4G8EB 2DQIH 3RJQB 1KCVH 1HH9B 5IFJB 1C8PA 1A6ZA 2I25N 2WZPD 3WIHH 2VLKB 5I17A 2RCSH 2SEBA 2GUOA 2PKDA 2IC2A 3G04B 1YNTA 3UC0H 3TYGL 4G8GB 1YPZB 3I9GH 1K8DB 1F90H 4KKAD 1OP5K 4EUPA 1Y6NR 4JZNA 3GSRA 3PDGA 3GUTB 3G6DL 2VDOL 4KDVA 1JVKA 1HEZA 1JI2A 1AHWC 3QR2A 4NHUA 4E41E 4XMLH 3THML 2B1HH 3QI9C 4XPBL 2FB4H 1YYLL 2E7HA 3EJYD 4U1SA 1BBDL 3LEVH 1RUKH 4CVZA 3CFCH 3MXWL 1G7MA 5JORA 1R6VA 1EEZB 3CVIH 4V2CB 5DJYB 4PTUB 3FRPG 5IBLC 4IMKA 4MNHB 4YWGL 3HC4L 5A2LH 4QXTA 1YEHH 3VA6A 4DEPB 5TDNB 1H3PH 4XH2A 2J2ZA 3NN8B 4N8PA 4FZ8L 2JIXD 1CFVL 5ANMB 3BO8B 4OF0A 4UDUA 4OF3A 1MREL 4BUGA 4F33A 3BZFA 1FAIH 2PF6A 1FZOB 3VRJA 3QDGE 1JHTA 2EIBA 2ZKHH 3GSWA 3QPXL 1ZSDB 8CGTA 5FAAA 4U6VL 2YPVL 3IFOB 5FYKL 4KK9D 1NC4D 4BM7A 5ELIA 1KIQA 2EE3A 3DRQA 3TBTA 2EZ0C 2E27L 1YUHA 4BSVB 4KRPC 4KXZH 5KN5B 1NBZA 3OGOE 1X5AA 3M1BB 1DLHA 2CRIA 3CVHB 4CVXA 4F9PA 2EH8L 4K8RH 1BZ7B 4JPVL 4LRIA 2C7UB 2F54D 4Q2ZA 5I8EA 2H32H 5DMKA 1G9NC 4EVNB 1FG9C 4K3DH 4DFHA 3MRBA 2DBLL 4XTRC 2IBGA 3E6FA 1OAXL 2ZWLT 4PJEA 4NBXB 3VXTA 4QTHA 5B8CB 3BEWA 5B4MC 3UPRA 1OPGL 1NCTA 4PGJA 4PBXA 3I3EA 3HR5B 3AXLB 5DQJA 3BP5B 4MSWA 3VFSB 1B0RA 5J6GA 1A5FL 4IRZH 5LKNA 2VXUL 3C60C 5ICXA 3S4SA 1IM3A 4IJ3C 1OD9A 4L8BB 3KYKL 2NY7L 3BX7C 5E2UL 4J4PA 1QVOB 4IRSD 3DECA 2G5RA 4OZIB 1ZHKA 3IAPA 3JTSA 1WC7A 2R4SH 4UOW0 1VACA 1JNHA 2CRYA 2JJSC 1AGBA 2ZCHL 3ROLB 4MZ3A 4ZAKD 1OTUC 5GRXG 5GS0C 5I1HH 2ERJB 5K9QG 1YY8A 3OHXB 2DQDH 3QAZB 1S78C 4NNPH 1VPOL 4I3SH 4Y88A 5IQ9B 4JG1H 2DAVA 1CFTB 4XZUA 4EEEA 2D0HA 3LQZB 1BHGA 5K9JL 1NGYB 2IANB 3EDJA 3EHBD 5D1QA 4PG9A 1SJVA 5JMRA 2V7NA 4PRAB 2F54E 1CD1B 5HYSA 4Y1AD 1FBIH 5ADOH 5AEAA 4NYLA 4I2XE 4C56E 1CL7H 2CDGA 4GMSL 4M5ZL 4HUWB 4FFVC 4DZBA 5JO5B 2VDPL 4UT7L 1S7VB 3IDGA 3FCTA 2DB8A 2DQJL 4AG4H 5D2LF 5GISH 3WS6C 4M7LH 1BVKA 4YE4H 1CXFA 2P5ED 1QSVA 4XPGL 1PQZB 4XNZC 2IH1B 3FL7A 2CRZA 2OK0L 4DKFL 2EDJA 2YK1H 1FZMB 3HMWH 1DE4A 4MZ2A 4TRPL 1NBYB 2HH0H 4JQXC 3WDHA 3T0EB 1JZ7A 5IB2B 4Z7NE 3QFDA 2Q86B 2GFBA 3WYRA 5FUOH 1Z9MA 4LFHG 5IQ7L 3ARDD 4CBPA 1BWMA 4OD1L 4I0CC 4JM2D 1ZHLA 1A7PL 1DR9A 3MV9D 5DJ0A 1B9ZA 3WIFA 5FGCE 2EE6A 3KPSD 4XMPL 1TVBB 4B7IA 1A64A 5BVPH 3CLEH 2FWOB 1TVDA 4U7KA 2WINB 3WKML 4Y5XB 3P77A 1AD0A 1JHLH 1JL8A 4N1EA 2AXGB 4QY8A 3RL1B 5C0BB 3WXWL 5C3LD 1MFNA 1SQ2N 3LPGA 1U3JA 3PJSB 5MERA 3QCVH 5A2IH 1I7UA 4MCYB 2YRZA 1OHQA 3DOSA 4Y1AE 3X3FL 4PJAE 4WI3A 3O11B 4OFPA 1KEML 5JNYA 4PGDB 1NAKL 4MAYC 2X10A 4LDEB 4FRWA 3QUMH 4ODXB 3K81A 3VXQB 2KQMA 5E2TL 3CXHJ 1S7SB 2X41A 2EICA 2I60L 1HQ4B 1G7HB 4L3CB 1S9YA 1CXLA 3KLHD 1DBJL 3MV8D 3B5HA 1I4FB 3OV6A 2IQAA 3IGAA 3FQXA 3PGFL 4P5TD 3S34H 3VRIB 5D7SH 3HC0A 1JYXA 3SE9L 3CDFA 3WHXB 1EHLL 4LAQL 5EOCH 4AT6B 1HXMB 4KDWA 2VH5H 4FQIH 2CKNA 3MV9E 4P2YA 5FK9A 1VDGA 2X1PA 5DEFB 3V6FB 4NN5C 1JK8A 2JB6B 1JMXA 3KPSE 3OB0K 5E4EB 4ODVH 4KRMB 4GKZA 3RL2A 2GY5A 3BMWA 4LHUB 1N2RB 2P1YA 2XZQH 1MAMH 1NKRA 2OTWA 2VXVL 4YAQB 4H0HB 1H15B 4RAVB 1ZV5A 2F58H 4O4YL 1JUFB 2XFXB 3OKDB 2HFFB 3CSGA 4KMTL 3IXAA 3MOBH 5HHXL 3QWRA 1EHAA 1QRNA 2UV3A 5KS9E 1NMCB 3DHMA 3ZHLA 2BNQD 4AY0A 1A4KB 5B38G 4PGCB 3MLRL 3MTRA 4H8WC 3IDMA 5D1ZD 5EA0H 3H0TB 5ICYB 1MQ8A 3HFML 5E70A 3C09C 3DTXB 2R15A 4JPKL 3IAGC 3W2DH 2BDNH 1IGYB 3C8KB 3RVTC 1EMTL 4MMZC 3GIVB 4KV5E 4R2GC 3MV8E 5D7LA 3WJLC 5F3HB 3KPMA 4F3FB 3E1F1 2PXYC 3ECBA 5GRZA 3B9KC 4UT6L 5C2UB 3RP1A 2KBGA 4CMHC 4GAYA 3SGJC 1CG9B 2I24N 5DRNA 1VGKB 1ED3A 3LMJH 1HQRA 1RFDL 1YEFH 2L4OA 1RJZA 3QIBA 2OZ4A 1K5NA 4TPRL 4MVBC 2P7TB 2HN7B 4OFYD 1WWCA 4U3XA 1G9MC 4PJ8B 1DL7L 3CSPA 1I9JL 2X4TA 3JV4B 5GRUL 3SGKA 3KPTA 3WL9A 4RDQF 4KAQL 3TVMB 5D1XC 3WS3B 2GSGA 4J3TA 3RDTB 1X5LA 4GRLD 5I18H 2BNUA 4LVHC 2QADB 3MRPB 3FRPA 1A7BA 5I1GH 2W9DL 4D9QD 1R0AH 1I7RB 5KZCB 1QD0A 3PE9A 1AR1C 3V4UL 3RA7H 2ZUQB 3OAUL 4Q9QL 4MWFA 1QYGL 2Z92B 1WZKA 4PRID 1UCBL 4NC0B 1ZOXA 4Z7NF 5GGVY 4R3SB 5FGBA 1D5IL 2OYPA 3P4NB 1T1YB 4JM4L 4AM0A 4Z95L 1WTGT 3HN3A 3GMPB 3IDJB 5JXAH 4Y4FD 2Q1EA 3ARSA 4N8VG 1G7PB 3BGFC 4LNRB 2BVTA 2P8PB 1J8HD 1T7YA 1F3JA 4Y2DB 2CLZB 1F6LL 1ZTXL 3QCUL 1JJUA 4HX1A 3F12A 3GMMA 1T1WA 3O2WL 1J05A 4R0LC 2X4NB 5HGDA 3S8WA 1F8TH 5C0IB 4F7CB 3BDBA 4PBVC 1ZAGA 4X6DE 4RFOH 3S7GA 2GK0B 4JE4B 4JFYA 1I1YA 1T4KB 4I3GA 1MCHA 5C0AD 5ACLA 3QUZA 5B39B 2XTLA 3I85A 3NCYP 4HJ0C 1S7WA 4J12A 2J1KA 4PJAF 1UB5A 1FG2A 1KLFA 4NRXA 1U8PA 4J1UA 5HHNA 5CEXA 5DJAB 1HHGA 2BNRE 1QO3B 4PJ9C 1WCQA 3NTCL 3ULUD 3MCLL 4K55A 2I9LA 3L3GA 5F89B 4O9HH 4RGOL 3X11B 4EN3D 1MPAH 3VDCA 3RVWC 2AJSL 2Q8AL 4D9QE 1CT8A 1QG3A 5EU6B 3UAJC 1CU4H 4YFDB 4G6JL 2EDLA 4N0CD 2NXYC 1DEDA 4HW6A 4CN1A 4JRWA 3OB0H 1AHWB 2HAZA 1MH5A 5IBUG 1X7QA 1JGUH 2PO6A 4NRZB 3RFZC 2NXZD 5HYIA 4HXAL 1BECA 5D2NE 3DBXB 3PWPD 1WBZB 3VJ6A 4JM2F 5I8CA 1YQVH 4LQFL 4U1GB 1YMMB 3BRGC 1NCBL 1HHJA 4MAUL 4KRLB 1CICD 3FONB 2CK0L 3W39B 3RVXC 2VLMD 4LSRH 1FLRH 1K8IA 2CUMA 3U83A 3DGCR 3KVQA 3QDMB 3QWOB 1BD2A 2J5LC 1T21A 1CK0H 4PJ7A 4UB0H 3I6KB 5GZND 3VFVB 3L3KA 5F1KC 5HHMB 1JPFB 5C0AE 3CFDA 4JJ5B 4RMWA 3RBGA 4K7PH 1PYWB 1JGEA 3QQNA 3LQAH 5IW3A 4M7KH 1LK2A 5MP6H 3ARTA 1DQML 3WDJA 4OD3L 4FQJL 5GS0L 5EPMB 3LHPL 2R69H 1FL3A 4YHPB 1A7NL 5IIEA 2HJKB 3H3PL 1KEGL 3ULUE 3WKNA 3CXHK 4ZS6C 3DYPA 4HKZB 3UJIL 4KV5F 1J9CT 3EAKA 3QDJA 2E6QA 5IB3B 3VXMB 4W6WB 1UZ8B 3CVHH 3OJDB 3O4LA 1MCPH 1F4XL 3W5MA 1G84A 4HJGA 3W9EB 3JTTA 4TOYL 3EYFB 3HZKB 2VDOH 4DGVL 2J4WL 1MFEL 5F6HI 1GPOH 3NACL 1YMHA 3PG2A 1YN6A 2D3VA 4M6ML 4WHCA 3THMH 1FN4B 2F5AH 4RQQB 2HT4D 4OLZL 2Z35A 2NX5A 3NVQA 3OKEB 1Y18B 3C60B 1ES0A 5E9DD 4ZFOL 4LSVL 3S3PA 2VLME 1QRNE 1Z9SA 4IJ3B 4PFEA 3FT2B 3AS0A 3MOAL 2QEJA 2YPKA 4HHAB 2AKRA 1NCWL 3MRGB 4YWGH 1QFWL 5JOFA 4AH2A 5T5NF 1JRHH 2NY0B 3TEUA 1JPTL 1PG7L 1NJ9B 4L9LC 4ZPVA 3L7EB 4G42A 1HHIA 4N5ED 2VO5A 3WSQL 3GMOA 1QFWM 4FZ8H 4YO0A 3IDXL 1IT9L 1CFVH 1IGTB 2XTJC 1XIWA 5D7LE 3DX9B 4X6FB 4LPYA 3SGDH 1MREH 2H9GA 1ZLWK 1S9VA 1PX4A 4L4TB 3BGMB 4QT5B 1KN4H 3LKNB 4ZUUB 1H3VA 5FYKH 5I15L 1I7ZA 5IHUL 3RWJA 3IDIA 5C0EB 2CD0A 1HWHB 2DKUA 3Q5TA 3MBEA 3FQTA 5FECA 4TQEL 3HPJB 3D3VB 1R3JA 1E27B 5I6XB 1LDSA 5IB4B 4ZFGL 2R4RL 4YX2H 5ESQB 3ZHDA 5CLTA 5HHPA 4X6DF 2DBLH 4BUHA 1U3HC 2D7TL 3ARBA 1CVSC 4RMUA 2R2HB 4XNZB 5EIQA 1OW0C 5T1MA 5TQ2H 2FIRT 2VXTL 2XN9E 3MV7A 3HRZB 3D85B 3MO1A 3R0MA 4NO5A 1M7DA 1AGFA 2DLTA 4GG6A 1OSZA 1P6FA 1WCBA 3KPNB 4P4KD 1HOCB 3AU1B 4HH9A 3ZL4H 1QBBA 1BFSA 2CMRH 4MQ7B 3HI6L 5J1AB 3RWIB 3DXAB 3M8OH 4L3AA 2YRLA 5B38A 3T3PF 5MEQA 4JO4H 2HVJA 1K3IA 3NIGF 3ULSA 2B20A 1BEYL 4Q7DA 4JY4B 4F7EB 5DYOA 1OCWL 1DQLH 5HSFA 3TT1H 2E5EA 4U1MB 1A14L 1F4YH 3IJYB 5DI8B 1RZIB 5EBMB 3PXHA 1NCAL 4TNVF 1AE6L 3OXSB 2DTML 3MGAA 5GIRB 2CLVB 3V0WH 3GBNH 4PRBA 4PGBB 1DCLA 4LSUH 4XBGA 5IEKB 4L1DA 3SDCC 2VC2L 3WO3B 3HUJE 4WUUA 2DQFB 2EYTA 4PJXA 3T8XB 2OI9C 4ZDHB 2D31A 2GTWA 2P48B 3O8XC 2XT1B 4M5ZH 5A16B 1JI1A 2BSTB 4FN0A 2PNDA 2FJHB 1T2QH 35C8L 1KIRB 3D69A 4UT7H 1CFQA 1HYSC 2QQKL 1TPXC 4W70A 3LKSA 2R1YA 3DUUA 1S7RB 5JIPA 2DQJH 1A1MB 4YEEA 1BIHA 4FFZL 2A73B 4JFDD 4LCWB 4OZFB 3WFHA 2C26A 1T1ZB 4OLYL 1IL1B 1PZ5B 4GT7A 3TA3B 2OK0H 3QSKB 3ULUF 3BSZL 2QTEA 3RZCD 3QIUA 4TRPH 2BVQB 3T2QA 3LN4B 3SQOL 5IW6A 3B2UD 1G9ML 3MGOA 4H88H 4Z7UA 4LCYB 4QXUL 5ALCL 4NN5B 1N0XH 2ADIB 1VESA 1MHPH 3W9DA 5JR1H 2XPGB 1R24B 3GSXB 3S37L 2C3WA 3QEGL 4NM8L 5IVXB 1A7PH 1N8ZA 2X5PA 4HLZG 4FQQA 4HCRL 3CZFB 2HJLB 2LU7A 4N8VA 1CWVA 1BD2E 2EXWC 4NN7B 3KHOA 3CLFH 5D7IE 4ZXBA 2BY2A 4O5LL 3R06B 2UVEA 1T89C 4OQTL 4ZUWA 2XI9A 5T3XD 4KTYA 3JWOH 5CCKL 4PUBL 5C08E 4LP4A 5C9JA 1X5JA 1LE5A 3O2DA 1JHKL 4I18A 2E7CA 2ADGB 4MXWL 5HHOA 1IC4H 5J13C 3VXUB 3LS4H 4WU5A 1T66C 3ZE1E 1I3VA 1DJSA 3TO2B 3BD4A 3MUGA 3IB4A 5C3TA 3C09B 1ZLWH 1I1AD 4K3EL 4Y5VC 3S36L 5DMGD 3EO0B 2ICWB 2DICA 3UZVB 3K2UH 5C07B 1RUQL 3IDNA 1UFUA 5HY9A 4PGZA 2CXKA 4R2GB 4D0BA 4HSQA 2D7MA 5L2KE 3MZTA 1HHHA 2PXYB 4GRWE 4GAJL 1CS6A 4IMLA 3SDAB 2YPLA 2RBLA 4ZUTB 3B9KB 1MEXL 1P53A 2ICWJ 1LEGB 4CU7A 2I60H 2VN7A 2FNBA 5DSCB 4UQ3B 1SJEA 1Z6JT 1CGUA 4MNGE 5I1JL 4OSUL 4KK6D 4JFEA 1NUGA 1JGDA 2BRQA 2YA1A 1FGNH 4OUUB 4PS4H 1D6VL 3DETD 1R3HB 4BZ1H 5D1XB 3R4DA 3WNKA 4KJQD 2IBZX 4NIKB 1AJ7H 3UTPE 1EHLH 1URLA 1UC6A 3D39D 2M8XA 4LVHB 1Y6MR 1BQHG 5FDWA 4RISL 1XF5A 3C08H 4WY7L 1BF2A 3FQNA 2G2RB 4R4NC 4PLOB 4WV1C 4X5WB 2FATL 2F19H 2QLVB 3MRJB 3UTTA 1OF2A 1FYTB 5FGSA 5T3XE 2V2TA 1NCDL 1TZGL 2X9YA 3DX7A 3RGVA 4ALAL 3U9UA 4ZUVA 4BFGA 3QEQB 2WK2A 3U2SA 5F7YC 5IOPA 5FYLL 3OAYK 1LD9B 1TLKA 4XCNA 4BH8A 2ORBH 4KMTH 3GSVB 5SV4A 4NPYA 1I3GH 5BQ7A 1UWGL 4UDTB 4YC2B 4HQQL 3BKCH 4Y2OA 3TNMB 3BGFB 1P7QB 1ETZA 2AERT 5KSAA 4OB5L 5CJXA 2I07A 4L9DA 1VFUA 3HFMH 5FHAL 3PDDA 1DBKL 2E8YA 4R0LB 5FDYA 2K1MA 1FYHB 1A4JA 3BVNB 3S35X 4LDLB 3VGHA 1GAFL 1A6AB 2ADJA 2AJ3A 4O2EA 4JPWL 3L95B 5TQ0H 2Y5EA 3G08A 5CIPB 2Q76B 3FB7A 4NQVB 4JPIB 1ZK9A 4Z7WE 2A6IB 3L1OH 2E9IA 3D0LA 3INUL 4XCFL 4OZGE 2ATKB 4DCQA 1KG0B 4TPRH 3KWWA 2HRPH 2BZDA 1OGAD 5E8PB 5T3ZH 1S5HB 5HYQB 1IMHC 4XVTL 2NY4C 1KTKE 3QQ3A 4PJ9B 3QEUB 4MNQE 4HLJA 3D39E 5C0GA 4E0RA 5GRUH 2J8UE 3S88L 1Q9KB 4IMKC 3MFGB 1A6UL 4B53A 1I85C 2XY2A 1JYNA 4QWWD 1J0HA 3HI1B 4LNVA 4Z5RB 5D9SA 3HLAB 5EZOL 1QR1B 2NXYB 4ORZC 2ICEB 5F8QC 5DJCA 1ADQA 3U7YH 3GKZA 2GCYB 4UILL 1NC4A 3V4UH 1I9EA 3DVFA 4RGMB 1YJDC 4G8FA 4Q9QH 1QYGH 1DSFL 3LRSB 5IMKB 4LLDB 2DLHA 1OAZH 1UEYA 1KJMB 1T7XA 5IF0A 5IUSA 3MA7A 3BQUD 4PY7A 5HGAA 5KVDL 4FFYH 1HN1A 3EFFB 5C9KA 4CADA 4YHKL 2Q7YB 1D5IH 3KYMA 4HS6B 1A9EA 4Q74A 2DI9A 1JWSB 3VGAB 2EDNA 1CFNB 4Z95H 1F97A 4M1CC 5HYJB 3WHE1 3VDAA 4F9PC 2V2XA 3HS0A 2IBZY 4G6AC 4LRIC 4UUJB 3HCVB 1BIIA 2Y5TB 1A7OL 3QHTC 5D7IF 3X3GL 2VWEC 1QSZA 3H7LA 3QCUH 3VRLE 3MJ9L 4HD9A 4XCCL 3O6FD 5BRZA 1QTYT 4DOHE 2CLRA 4JFPA 5CWSB 5BOPA 3OR7B 5BZWB 3Q6FA 5CBEA 2CKBB 1NAMA 5JW4M 4C59B 1MI5B 2VQ1A 2BVPA 3LSOA 1VFAB 4DUWA 5LGHL 1NANH 1S7TA 4IRSA 4Z78A 5HJ3A 3E6HB 2EKSA 1NEZB 2RQ8A 3C5ZD 4HUNB 3MLVH 1NC2A 4EIZC 3E2HC 2YRPA 3VWJD 3G5YA 4X6CA 5E2WL 3U0TA 3MCLH 4D8PA 3EFDH 4GRWF 3MRQB 3T3ME 3BP6B 4J4PC 3MNWB 3O2VL 4MJ5A 3T2NL 2AJSH 2FIKB 1HKLH 2VDMH 4LLWA 3NIDE 5TF1L 4R8WL 1EFQA 4OIAA 3KLAB 3BRFA 1G9NH 4X9HA 4KJYB 2NW3A 4XXCA 1WFUA 3BWUC 2CJUL 2DM7A 3HB3D 4OCXH 3M17A 4L4VD 1FFNB 3HMXA 2X4OA 4NQEB 1CD8A 2NZIA 3KJ6H 3SKNA 4RAUB 2Z93B 5ADPL 2CIIA 1BFOA 1Z0NA 3BD5A 5D1QC 4NCC1 4P5KA 3CK0H 1NCBH 1EFXA 1EXUA 4MAUH 3ZKND 4ETQB 2HKFL 1MCQA 4Y16D 2WM0A 2ED8A 1S7XA 2V9RA 1W0VA 5CBAA 2ESVD 2P5EA 3C6LD 5SWZD 4GRMB 1MELA 2V5TA 3FO0H 5AZEH 3SCMD 5GRJH 1HXYA 1N59B 4BFEA 2P8MB 1I9RL 4QRSA 2DI7A 1SYSA 3HAEH 2ZCKL 1OQOA 3SDDA 1P1ZA 2P49B 5J89A 4MDIA 5GS0H 43C9A 5HGGS 2Y1VA 1IAKB 4JM2A 1LO4L 2HTKD 3QULA 2DQHH 5DEZA 2E9WA 1T04B 5FUCE 4EDXA 2VE6A 1KEGH 1J8KA 3LEYH 2CK2A 3N0PB 3QXTA 4FQLL 1GZPB 4Z0XA 1TFHA 3PHOB 1T7ZA 3WN5A 3V5DA 4BQ6A 4Y19A 4C54A 2EC9T 1PDKA 3MNVA 3BP7B 4HPYL 3U4BL 1A6TA 2FBJH 1LK3H 5DJ2B 4NKMA 5DDHA 4K8RD 1F4XH 4GSDL 4FG6C 3WNOA 3SO5A 5C0CA 3HZMB 1DEEB 4M7JL 4JRXA 3HKFA 4TOYH 1P84K 4RCAA 4DGVH 4UBDD 1U8KA 5HI5C 1U36A 1D5ZA 3GJEA 4P2CG 1X5IA 4QOKD 2O5XL 2J8UF 3OSKA 4F2MB 4N90D 4L8SA 4W81A 2WBJA 4LSVH 4Q9RH 1NLBH 3QA3B 4OM1L 5SWSB 2AJUL 3U7WL 2P5WE 2ESVE 1NCWH 3TN0D 1QFWH 4O58L 3MLUL 4JO1L 1XGUB 2VLJA 3MMEB 1TJHH 4P46D 1JPTH 3N1FC 3IKCB 3VXSE 3KYOA 4M43H 3P4OA 3PL6D 4JO3L 4P5TA 2OL3L 1IVLA 3WSQH 5JOEA 3BKYH 1OSPH 5GGTL 5DK3A 1RIUH 1H8SA 3GSNB 1IT9H 3IDXH 3B43A 5EO0B 4YR6A 4D94A 5AD0A 4G6MH 2NY2D 3CFBA 1ORSB 1RUMH 1FFPB 3Q3GB 4QXGH 1CZ8L 4WWKD 4M61A 3ILPA 3MQIA 3QXAA 1UWXH 2YMXL 2YA2A 1LWRA 4YDKL 3SY0B 1F5WA 4A6YB 4HAFA 3DSFH 4P4RB 3UTOA 5ETUB 3BRDA 5I15H 5E94A 3FN0L 4JY5L 2VLRD 1U93A 4MB3A 1XEDA 3ORJA 4LASL 3AY4C 3KPPB 2OI9B 1G7LB 3O8XB 4OZHA 4Z7VB 1VKXA 5TH2B 4TQEH 5K9KA 1B4RA 5I76B 1IM9B 3O41B 2NY3D 1NBVL 4WWID 1SJHA 2X40A 2WWMD 4ZFGH 1EAPB 4PR5B 1TPXB 4MX7B 3CCHB 5E99L 2X09A 3V7AE 1KPVB 5EUKA 2I9TB 3LEXB 3H9SB 2BNQA 3NCBB 4FQ1L 4ODUB 1LGVA 3KXFE 4UNTA 4ZFZA 2Y06H 1RI8A 4QOKE 5D1ZA 5F1NB 2VZVA 4MA7L 4N90E 1IC5L 3KHQA 4XMKL 4OZFH 5M7QA 5MI0C 3O9WD 4K7PX 4HFWA 3T3MF 4YDIL 5FKAB 4MQSB 2X2YA 4Y89A 4ERSH 4Q58C 4CW1A 3GNMH 3NIDF 2OL3B 3HI6H 4X4ME 1T5XB 3R1GL 3HR6A 3IS1X 4LF3A 3FTGA 1AC0A 4POZC 3QFJD 4PJHB 2I27N 2W07A 4IBLT 3VWKA 2IQ9L 5DT1L 2IH3B 5H37G 2B2XL 3N85L 3FFCD 5C2BH 2VDLH 1X5FA 1OCWH 4H1LB 2EDRA 5LGJB 3P3YA 3FQUA 5J13B 3EGSB 4W4OA 2A0LC 4NZUL 3RWEA 3QIBC 1EH9A 3MXVL 2VLRE 4XAWH 1SMAA 3RX5A 1G7JA 1M71B 1QQDB 3ARED 3GFUA 2NYYD 4DAGL 1ZGLM 4P23D 1JCKA 3OX8B 3BZ4B 2ED7A 3SGKC 2VC2H 2VQTA 5LBSL 1G0DA 4LSQH 3S97C 3PWLA 4OTXL 4K2UH 1IBGL 5JPNB 4H8WH 3MLTA 4ZTOH 4I77L 3KG5A 4U6HB 3MRMA 1N64H 4PRIA 2ARJQ 5I1DB 5CD3A 1GGIL 2F53D 4HBQA 1RURH 4PRNA 1NUFA 1XR8B 4KZDL 35C8H 3PWVA 1ZHNA 5CAYB 4QHUB 2OMBA 3NFSL 4M48L 5DTFA 5ITBH 1JNNH 1TIUA 3UTSE 4P9ML 1C5CL 3QZWB 3NZHL 4Y4FA 5J9PB 5CILL 1GGYA 4PLKD 2HLAA 2FR4A 3WFBL 1QZ1A 3DX6A 5FGBC 1BFVL 1J8HA 1GGUA 3BSZH 3O81A 5IG7B 4V1DB 2AEWA 3DROB 1QSFB 3SQOH 1X4ZA 1G9MH 5D5ME 3JV6A 4QXUH 1ZHBA 3F6LA 2F74B 1D5BB 2DQTL 3DYMA 5DFVC 4WV1B 1I75A 4N0UA 3OWEA 1P69B 3P2TA 3QFJE 2MMXA 3RWGA 2ZPKL 4PJFB 3VFNA 4NM8H 3QXDA 4Z7QE 2R23A 1NGWB 3FFCE 1ZGLB 4X7EC 3CNKA 5IV2A 1U8HA 2EDOA 3EO1B 1HH9A 1CDYA 3FHQA 5IFJA 4U7MA 1FHGA 3U79A 4KTEL 4NDMB 2VLKA 4OQTH 4I13B 1D9KA 3QUZC 3O6LH 5IEHB 2IFFL 4P99A 1U92A 2G9HA 1YJDL 1CBVL 1KF9B 4PV8B 4XNQB 4MXWH 2DQEL 3G04A 1HI6B 5DD5H 4NN6B 2Y6SD 8FABB 4X8JB 4G8GA 1YPZA 3GSQA 4NQDD 1A6ZB 3PXJA 4IRJB 4JVPA 3RBSA 4K7PY 4HDIB 4AENB 1KFAH 3RAJL 5I17B 5JHDD 4I1NB 2EO9A 1WAAF 3P0GB 2VZOA 4MMXC 1YNTB 1XGQA 3RZWA 4N8CL 3V6BR 1EEZA 5JA9A 4XBEL 1RZGA 4EUPB 5DJYA 2BMKB 4PTUA 2AAVA 4V2BA 5HBBA 4JZNB 3GSRB 1MEXH 3NCCB 3PWPA 4MNHA 1HEZB 1T5WA 4ODHL 1X3DA 1YQ2A 2YZ8A 4M6OL 1OL0A 1FO0B 4WUKL 1LDPH 2PO6C 5F7LB 1CICA 4LAJH 4OSUH 4OJFH 3IETA 5JORB 1A9BA 3H8NA 4R7DB 4FNLL 3ULVC 3BO8A 1WBXA 4ODWA 3LS5L 4KPHH 3PP3K 4QXTB 4K3JH 1FJ1A 5GS1A 4XH2B 5L9DL 3V5KA 3IFOA 2XWTA 4C4KT 3ARFA 3T0AA 3H3BC 4CDHA 4NWUL 3NCEB 43CAA 2AEIT 4BSVA 2GYSA 4M93C 5GRYA 4H20L 4UDUB 4LK4A 1CLZH 1ZWIB 4F33B 1AO7D 3B83A 3VRJB 4RMVA 5LWYH 1JHTB 1NCDH 2C7UA 3GSWB 1TZGH 4YPGB 5T1KD 2QL1A 1F6AA 4ALAH 1BQLL 2PR4L 3D87B 3QB7C 1KIQB 5B39G 3DRQB 2V5RA 3TBTB 1G7QA 5F7EH 3MUY1 1B0GA 4NQDE 1QHPA 3TP4A 4CVXB 1UWGH 1KIPA 4HQQH 5JHDE 1RVFL 1WEJH 3NPSB 5CINL 1UM4L 1X44A 4C4KO 5LAXA 4GKNA 2CDFB 5I8EB 4OB5H 4NKIH 3HR5A 4LEXL 3KJ4B 1KYOJ 5FHAH 3MRBB 3OKMB 2R56L 1F4HA 1DBKH 4P2RD 4WI7A 3VFSA 1N6QH 1OD7A 4OCWL 3E6FB 4PJEB 1GAFH 3LD8B 1OAUH 3VXTB 4QTHB 3CFEA 4KHTL 5IT2H 5EU7C 4UMGA 2PTTA 1XZ0A 4NC1E 1FNGA 3C2AL 2DJUA 1QVOA 3GK8H 5E9DA 5EU4B 4KDTA 3KPRE 2X1QA 1BJMA 4KTDL 4OZIA 4G9FB 5DQJB 2QR0A 4MSWB 2OMNA 3G5XB 2MWCA 2HTLD 1E4WL 1PSKH 2XG5A 5J6GB 5F88B 2XXMB 4L3EB 3S4SB 3MJ7A 4XVTH 1IM3B 1EGJA 3EOTL 5E00B 5AWNL 3E2HB 5JIIA 4RGND 3ZDZE 1RMFL 4LU5H 3S88H 5GXBB 4P2OD 5GGSB 1HDMB 1A6UH 4YIQB 3GO1L 3V79C 3MFFB 1MJUL 1ZHKB 3JTSB 1BX2A 1WC7B 1VACB 2IANA 2LAGB 4HZLA 4FTVD 2AJXH 1AGBB 5EZOH 4PJCF 2VMFA 2W38A 4PRAA 1A6PA 1CD1A 2H2SC 1P5VA 4Q6IB 4UILH 1XIWC 1YY8B 4QEGA 4XZUB 4HUWA 3BUYA 5EULV 5CMAB 3BUTA 3QO1A 5D1QB 4PG9B 2HMIC 1UVQA 3T0VA 3O3AB 5KVDH 2V7NB 3ZT7A 5HYSB 3JWNC 5D7JD 1MCJA 2GQHA 1TZIB 2IH1A 3O3UN 3AMKA 3MBEC 4ZOCA 3MA9L 4Z7QF 2CDGB 5FYJL 4P2RE 3Q5YA 1FZMA 4WI4A 1MIEH 1NBYA 4NFDA 4U1HB 3IDGB 1A7OH 3VXRB 3X3GH 4YGVA 3KPLB 2AJVL 3MJ9H 2Q86A 4I5BA 1EO7A 4FP8L 1YC7A 3ARBC 3L9RB 3CAFA 4M8VA 2NTSP 1DE4B 4MXVE 3P0YL 4NJ9H 5ENWA 3RX8A 1TVBA 2QBWA 2A6JB 1CLYL 3FB5A 4O00A 4RMRA 1NFDE 4RGNE 4LSPL 2YD7A 4KQ4H 3WIFB 2XZZA 4OFKA 1JYVA 2Y36L 4KHXH 4FTVE 3RL1A 5C0BA 5KJRL 5EZIL 3O2VH 1JGVH 4G43B 3T2NH 3PJSA 2EH7L 3MACH 3C8HA 3PP3H 4N0UE 1WV7T 4EZMA 4WCYL 3VI3E 5FYKU 5TF1H 7FABL 3U46B 1AD0B 3O11A 5M94B 3C5JB 4QTIH 3ES6A 2CJUH 4PGDA 3NZ8B 4UT9L 4MQXC 3CFJA 5BV7B 3GMNB 3VXQA 4ENED 1CXEA 2W91A 2VLKE 3U1SL 1RHHA 1X5GA 3GSOA 4UOW1 1ZANL 1I7UB 1HQ4A 1JZ2A 1G7HA 3EOAA 2XXCB 4K9EL 5ADPH 3SJVA 2R0LL 3L3OA 3VXPA 5F97E 5JW3L 3ESVF 2EXYD 4F37K 1I4FA 5KSBB 1YPZE 5JNYB 2XV6B 3LVEA 1U41A 4YUEL 3QBTB 4OI9A 3KPOB 1KACB 2N56A 4JFDA 2MSPA 1G0XA 1S9YB 4AMKH 2H2PC 1OLZA 4Q6YA 2R8SL 3RWDA 3WHXA 4AT6A 4ETYA 2JJTA 3ARRA 1SY6A 1FPTL 2B5IC 5DEFA 1I9RH 5HVWA 3FQXB 3WNPA 2R2BA 4R96A 2ZCKH 4J6RL 2DLGA 3FT3A 4X7TA 3HC0B 1N2RA 1C5BH 5JUEL 1PKQA 1W72L 2Q3ZA 5LQBH 3ZKSD 1N3NB 3U36A 3QIUC 1XF2A 4NC2B 4YAQA 1LO2H 4U1LA 1H15A 5F9AC 5FK9B 2AJZA 1F00I 1JUFA 4JO2L 5DD0H 5ANME 2W0FA 3B3IB 2P44B 5L6YH 4JZOB 2HFFA 5E1AA 4JDZB 4CU6A 4GKZB 4D0CB 4U7SA 5FYKD 3OTTA 1BVZA 1REIA 3O3DA 4PJDF 2GIYA 1MLBB 5MEND 2L0DA 2OTWB 4HPYH 4WRLA 4PGCA 4ZXBC 3H0TA 3IF1A 4GBXB 4FQXD 4LLQA 2APWA 4GSDH 4YDVA 5DLML 4N5UA 4M7JH 3DO7A 3GIVA 4I18C 4PLNC 1A3LH 5MI0B 1CN4A 1F4WH 3I2CL 4OLWL 2UZXB 4DGIL 3OF6D 1HINL 3D48R 1VGKA 4XPFH 4WI9A 2NY1C 1DBAL 3TJEL 2OSLB 4O58H 4PJ8A 1J0KA 1C1EH 3MLUH 1VEMA 3JV4A 3ECBB 4JY6A 5BMFH 3V7MA 3TVMA 1GZQA 2OL3H 4M1DL 5IW1B 2ICES 4NNYA 1SYVB 4FQ2H 3WS3A 3T0ED 1HQRB 1O7SA 4Y4KD 2OR9L 3QIBB 1K5NB 5I19L 3FZUD 3UEZA 3MRPA 1CZ8H 1MCBA 4EI6A 4P9HC 2X4TB 1KYOK 4H1LH 3WL9B 1B3JA 3OZ9L 4JY5H 2GSGB 1MCNA 4IDJL 1TQBC 5DURD 1QPXA 1J1XH 5FYKE 5KAQF 4LASH 2BNUB 2BVEA 2XKNA 3SOBH 1F45A 3OKKA 1J88A 4H0GA 5J0BA 3RIAK 3GBLA 4U3HA 4BSWA 2VDRL 3G6JB 2NY6D 3DI2B 1TNNA 4UU9B 5GPRA 4YHZH 1IZKA 3IDJA 5E99H 1GGTA 4I4WA 3QNYA 1W0YT 4GAGL 4MWFB 4LQ1A 1G7PA 4MXVF 2R2EB 4OF8A 2P8PA 4LLAA 2CLZA 3RGVC 3UMTA 1KCKA 5ISZD 3FOMA 4PRDA 2X4NA 1TNMA 4AM0B 2Q20A 3IDYC 3UXFA 4MA7H 2VAAA 3TPUA 1IC5H 2FEDD 4XMKH 5KANI 2GK0A 4XP5L 3ULVL 3U0WH 1CVRA 1T4KA 5D71L 5B39A 4NQCA 5KSAC 4S1DD 1NSNL 1QKZH 2CIKA 4PY8I 5CJXC 1KTRL 3F12B 4HGKC 3GMMB 1T1WB 5KVFL 1J05B 3E3QE 2EDXA 1I3RB 3BPLB 3CMOL 4M3JA 4S1RH 1YEEL 2K7PA 3C6SB 3IU4L 3GMLA 5H94A 3VXNB 3T0EE 2YEZA 3ZKMD 1QO3A 1A02N 5DT1H 2E7MA 5KG9B 4JFYB 1OGAA 3TWCL 4F15B 5F89A 4QHLA 1RK1B 4LSSL 4DVBA 4Q9BA 6CGTA 1IC7L 3V6ZA 1S7WB 5EU6A 3KS0J 5BXFA 2APBA 5DJXA 1CF8H 3TCLB 4NRXB 2GJ6B 1U8PB 1EVUA 3MXVH 3MV11 1OTSD 4J1UB 1HHGB 5HHNB 4R4FH 4NQSA 2Y9RT 5DK0A 3RWHA 3ETBF 4NO0A 3L3GB 1KC5H 2Y72A 4ELMF 3WD5H 3SBWA 1CT8B 3DBXA 5BO1L 1WBZA 1IEBA 3U4AA 4WI5A 2IGFL 2YN3A 1YMMA 4Y4HB 4UIKL 1KN2H 3W39A 1GGIH 4M5YL 4EOWH 2PTUA 4KZDH 1MH5B 4KK9C 1BJ1J 1OAKH 2PO6B 3WV0A 1D5XA 4FQHA 2DTSA 3NFSH 2XQBH 4CVUA 5ISZE 12E8H 4M48H 2HVKA 1PG7X 3BGAA 1GL4B 4EUPH 4P9MH 3P40A 3VJ6B 1C5CH 5L0QC 3NZHH 3VFVA 5I8CB 1IQWH 2VL4A 1YEIH 1MLCA 1ZT7B 2X70A 4JJ5A 1UWEL 1PYWA 1K8IB 3IFNL 1XGTA 1IGIH 2FECL 1L7TH 1X6NA 4HFUL 4KMLB 4PJ7B 2HJKA 4CJ0A 4DKEH 4QHNA 2FO1A 3AROA 3O45A 4WW2F 2YD1A 4HIJA 1JGEB 1G1YA 4NOFA 1LK2B 3ZYZA 4KFZC 2YUXA 4HEME 2H26A 2UZIL 4KTEH 1MVUA 2ARWA 3C5ZA 4LKXA 1FL3B 3VXMA 2XQYK 4MS8C 1UZ8A 1FNLA 2IFFH 4YQXH 5IIEB 1YJDH 3RDTD 1CBVH 5GSVA 5HDLA 4UINL 3RKDD 1OAQL 3JVGA 2JCCB 4IRSC 3RPIB 2C3VA 4XX1G 3EKCA 2WP3T 3EYFA 4KUZH 1Q1JH 5FO7A 4KKLD 5TF0A 1ZVYA 3RAJH 1FN4A 1YECH 3MRKA 2NW2B 1Z9OA 3TJHD 2FHBA 2XYCA 3ZLQC 2B1AH 4L4VA 3PWNA 4HJGB 3VH8G 3FT2A 4JAMA 4HHAA 4XXCC 3T4YA 1ITBB 2BSRA 3MRGA 1YMHB 3B5TA 3MRIA 4J3VA 1NUNB 4OV6F 4M6OH 1NJ9A 5MEPA 4WUKH 2Z35B 3EJJX 2NX5B 3L7EA 4U3CA 2Q8BL 4RIRB 1YEDA 2ENYA 1CXHA 1ES0B 1Z0MA 4Y16A 5EBWB 4Y2DD 3EBAA 4LLUA 4TSBL 1FVEA 2YPKB 2J6EA 1IGTA 5ABDE 4FNLH 2AKRB 4X6FA 5SWZA 5I1IL 4I0PD 2FYYB 5JOFB 1LVEA 2QQLL 1MCWM 4XNUH 4GMTH 5A3ID 1WAAA 1WSST 5I74B 3BGMA 4BQ9A 5HTSA 3A6CH 4QT5A 5E8OB 4ZPVB 4ZUUA 1HHIB 5F9OL 4PD4K 5GHWH 1CTNA 4X6EB 3WNMA 4H26B 2ZUTA 1IEAB 4PIRF 3RVVC 3HE6D 3D3VA 2ZJSL 3L3HA 1S9VB 1E27A 5IB4A 4PP2A 5BVJB 1C7TA 1RZ8A 3NCFB 1P7HL 1U8MA 3SDDC 1HNGA 3L6FB 3SO3C 2A77L 5KSUB 4XNXH 1BQLH 1ZLUK 4GXUM 1YDPA 3IDIB 2Q6WB 1H5BA 3S96A 4JM2C 5ILTH 2KZ1B 1QBML 1JGLL 1WICA 3FQTB 3O0RL 2UWEF 5I9QC 3QRFM 1R3JB 5C6TL 1IFHH