4F9PC

Crystal structure of the human btn3a1 ectodomain in complex with the 103.2 single chain antibody
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
243
structure length
220
Chain Sequence
b'QVQLQQSGAEVVRPGTSVKVSCKASGYAFTSYLIHWIKQRPGQGLEWIGVINPRSGDSHYNEKFKDRTTLTADQSSSTAYMQLSSLTSDDSAVYFCARSDYGAYWGQGTLVTVDIVLTQSPVTLSVTPGDSVSLSCRASQSISNNLHWYRQKSHESPRLLIKYASQSIFGIPSRFSGSGSGTEFTLSINSVETEDFGIYFCQQSNSWPHTFGTGTKLELK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Butyrophilin subfamily 3 member A1
molecule tags Immune system
source organism Homo sapiens
publication title The molecular basis for modulation of human V(gamma)9V(delta)2 T cell responses by CD277/Butyrophilin-3 (BTN3A)-specific antibodies
pubmed doi rcsb
total genus 33
structure length 220
sequence length 243
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f9pC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f9pC02
3ALWA 2I60L 3MCG1 4YX2H 4YGVB 2FIKB 5JOEA 3RDTD 1G7HB 4FN0A 4G9FD 4J4PD 1HDMA 4OZIE 2HT2D 3HI5L 3INUH 1IILE 4DFIA 4GW4B 3SBWC 3MV11 2YPLB 1S8DB 1WBYB 5D2LB 3TO4C 1WT5A 4HEME 3QZWA 3R0MA 5CD3B 2BNUA 4PLKC 3W2DH 3TWCL 1Q9KA 2ESVE 2WV3A 3L5WB 1MLCA 2QKIB 1RJZB 5EDXA 3S36L 4X6FA 3NN8B 1Q94A 2XWTA 3BKCH 3RTQA 4M1CC 4S0SD 3KS0J 2X4PB 4M6MH 1R3HA 2Z93B 2X4QB 4WFFE 2CLRB 3QUZC 1VFUA 4YFDB 2R9HD 4GSDH 2VXSH 3TYFA 2EZ0C 1FFPB 5FYKU 4MA7H 1OTUC 4RA3A 4HK0A 2I9TA 2FJHB 1RMFH 4MZ3A 1RUPH 4YE4H 3WIHL 4DW2L 4MD4A 2PUQT 3BO8B 2XKSA 3LZFH 3VFSA 2YUWA 5HYEA 4U1GB 1KCSL 3DIFA 4AIZA 5JDSB 1A0QL 5L9DL 3QIBD 1OD7A 4WFEE 3GNML 1MWAH 1H5BB 3EIFA 3O6MH 1G9MC 2P4AB 3ULVC 3CFBB 4JRYA 4CADB 3UZEA 2AEIT 4QYOB 3V0AC 1NGYB 3DMMD 3FO0L 4D0DB 2PTUA 2AERT 1F58L 2HFTA 4LP5A 4PGEA 1IKFH 1FBIH 5EG6C 3EO0A 3SO5A 4D0BA 2BNRD 1NFDB 4YEEA 1IAIH 5CILL 1CD1A 1YY9C 5T5NG 2GAZB 3AXLA 5B38B 5KVMC 2VZ3A 1A4JA 2D3VA 5JORA 3O4LA 3DTXB 3MV9B 2VABB 3VRIA 4EUPG 4PJAF 2BVPA 2D31A 5JOPE 4X5XB 1PKQA 1L7IL 4HPOH 4PS4H 1BFVH 5F6IB 5BV7B 3S34H 1CXIA 4P0DA 1XF5A 2FB4L 4IRSD 3HLAA 3CAFA 1KN4L 5J7CC 3MA7A 5DHVA 1NCDH 4ORGB 5DO2D 1EMTH 1NGQL 1KCRH 2AKRB 1KXVC 2VUOA 4GBXB 4LQFL 2CGRH 1OTSC 1UB5A 4HCRA 2R2EB 3LY6A 2OYPA 5EH1A 5T1DH 1PKOA 2HFFB 2KUTA 1NCBL 4G3YL 2CRYA 4DUVA 4LBEA 3QB7C 3ZMRA 3D2UB 1ZLUK 5T3ZE 2GHWB 3JV0A 1VENA 4LRIC 2NW2A 1NL0L 3G5YA 2DTMH 3VXOA 3C6LB 2QSQA 1OF2B 4KVNH 4RCAA 5ELIA 3VXME 4OD1L 4XBEH 4HGMA 1XGPA 1F4YH 2A6KA 1SMAA 4OD2A 3QPXL 1G9NH 3DXAB 5EU6B 2EC9U 3MYJA 1P5VA 5HYSG 1GOGA 1Z3GH 3HG1B 5DJXB 4D9LH 5LQBH 2ADFH 3ARYA 2I60H 4R0LB 1UC6A 2UYLB 4Y4FD 4X9BA 1T3FB 1XR9B 4F33B 2NY4D 5IFJB 4YEFA 3HI5H 5FKAA 3TFKC 5DMGC 4MXVE 4M7LT 3MUHL 1XAUA 4K3GA 2ENYA 3WEXB 4W81A 4V1DB 1DUYB 1LD9A 5IF0A 4QHUA 3BP6A 5I6XB 1T7ZA 4HIIB 2IQ9H 2W91A 3MGAA 4L3CB 2QQKH 4M61B 3WNPA 1QLEL 2ATPA 2BOBA 2WINB 4JANA 3HPLA 2OJZH 3CDGB 4L1HA 1KV3A 5D1XA 5DMKB 1J8HE 4NO2B 2R0ZH 4ELMA 1RHHA 1NCWH 3QIWD 1J10A 4PJCB 3U7WL 5E9DE 4E41D 4WI5A 4PRIE 1WITA 3NABH 1FORL 2VC2H 2D2OA 4TVPH 3QT2A 1FL6A 3HFML 3VDCA 1J1OH 3CSBA 3B9KC 3QJFA 4AT6B 5D6DC 3OJDA 5GRVL 5C9KA 4P57B 2Y25A 4UIMB 4OCNC 3D87B 3QQ3A 4L9LA 1LE5B 3WIFA 1HNFA 4S1DD 4Z7UF 1IJ9A 1R5IB 4AG4H 4KMLB 4J1UA 4UILL 3EOBB 2QL1A 4MXVF 4JZNB 1PG7L 2D7PA 4UTBH 1HHHA 2AVGA 3S4SG 5DJCA 3D5OF 1EGJL 4JO2L 5CP7A 4PG9A 4FRWA 1T04B 1YEFL 2V5RA 4RGNB 1U8MA 5ESAB 4PJBA 3KNBA 3BRDA 4UIKL 3AAZA 3EW3B 4K23L 4P2YA 3B9AA 3QUYD 3GK8L 4HFUH 4CDGC 1AY1H 2V9RA 4LAQL 1BD2B 4P5MA 3U79A 3CCHA 4MYWB 3S37L 5SWSA 4XMPH 5F1KC 3QNXA 4HPOL 3PABA 4FQXB 3RL1A 4MX7B 3VWJB 4R8WL 1SYVA 2G75B 3OXSB 5K9KB 1UEMA 4AEEA 2E7MA 1CICD 1VHPA 5IB5A 2O61B 3MV8A 4NFDA 1A1MB 1MCNA 4MDIA 5TJWK 1XT5A 3D1MC 3QXVA 2MQ3A 1FH5H 2EYSA 3ESUF 4Y19A 1HYSC 1I85C 4HMEA 4LQFH 3IDIB 1I1AD 1RPQA 5IIEA 4UBDC 4RAHA 2HN7A 1IGFH 3MREB 2BC4B 4QY8B 3B9KA 5EORL 4IS6A 4QOKA 2E6PA 1RAMA 3OGOE 4ZXBC 3R06A 5T3ZL 1YYML 5E70A 1Z9MA 5KN5B 2W0FB 4X4ZA 1B2WH 4JFQB 3CGTA 3CC5A 3BT2H 3ARFD 4Z8FL 1SVCP 2YD7A 3QXWA 1HKLH 5MEQA 1YN7A 4G9FE 4CN6A 1VGKB 3F7VB 1CFQB 5HGAA 4NZDA 1FVCA 4RQQA 5D93C 4GW5B 1D3CA 3RPIB 3QI9D 2D7NA 5I1DB 1DBAL 3WNKA 2D4FA 4LVHC 5DUPH 1VEPA 1H3TA 1CGVA 3IU4H 4Y4FA 5GRJH 5F6HJ 1ZHNB 1G9NL 1OM3L 4XPHL 1KCVH 3LPWA 4WU7B 1GZQB 2WMPA 4G8EA 5JZ7D 3RWHB 3GSRB 1CGUA 4LLYB 3EHBD 4N0UA 5DMJB 3IJHB 1LO0H 1GYAA 2AEPL 3OL2A 4JHBA 3G08B 3LSOB 1HHKA 4K7FA 1FPTL 5I1IH 4PRBB 4N0CC 5I19L 3MOBL 3T2QA 2NX5B 2J12B 1FL5A 1G7PA 1PY9A 2F58H 1YYLL 2FGWL 4H20H 4Z7WE 4HKBB 5KVGL 4M3JA 4YH6A 1QFWH 5IW3A 2JCCA 1VADB 4J4PA 1KPRA 4F37F 1NGWB 4F3FA 2X4NA 4LGPB 2QQLL 4Y4KD 3ZHDA 3IFPB 3VDBA 3M07A 4JM2D 4NKMB 1ZVSA 5C0IA 4LLVB 4JZJA 1WTGT 1R3KA 2YD3A 4LLQA 4L8BA 3QUKA 1FZJB 2RIKA 4MCYA 4XVJH 3BD5A 1PEWA 2ZUQB 5DJAB 4I4WA 2PYFB 1X5YA 1W72H 4BK4A 1CDYA 4FQ2L 1BAFH 4F58L 1RZJC 3RPKA 1R0AL 1OGAB 4PJAA 4Z0XB 1N7ML 2I27N 3DYOA 4OLZH 1CDJA 1A7OH 3VXRD 4HV8A 1D5BA 5E2TH 3UTTD 3WS3B 5GZOC 4OCSH 2VDLL 4I5BB 3X17A 2RGSA 1KCLA 1EVTC 3MA9L 3X12A 3WS6A 5I30H 2DKMA 2Z8SA 1MHCB 4APQB 5BW7C 1RUMH 1X7QB 2WLZA 1INDH 3H9SE 2G5BB 5IMMB 4P2RE 2UY6A 4PRPA 2DQDH 2VR4A 5BO1L 1T4KB 4MQ7A 2HKFL 4POZD 3EOTL 3D0LB 3ZDXE 4ONGL 4JRYD 2A6IA 2GKIA 5T1MA 3C08L 4PY8I 1OWWA 5EOQL 3BPCA 4RISL 5D5MF 4XMLH 4JG1H 3IDGB 1M05A 4TSBL 1IGYB 4NO0B 3VH8B 5GS3A 8FABB 1BEYL 4KK8D 4JPIB 3KPPB 1BVZA 1ONQA 1T1YB 3CMGA 1F97A 4CL7A 5J6HB 1JYVA 1QO3B 3LV3A 4R97C 4YDIL 1HINL 2W65A 4H1LB 1H0DA 5CJOL 4AENA 5FK9A 2J8HA 4B50A 2BVUA 3UTSE 3KPSD 1U93B 3ZZ1A 4AIXA 3V0VA 4NZRH 1H8SA 4NQEB 1D6EA 3CPLB 5CBAB 2HLAB 3FZUD 3L1OL 5ICXA 2NZIA 1DL7L 4EI6B 4NIKB 3TLRA 1RVFH 3QHZL 4OQTH 1A7PH 1I9RL 3NZ8A 1B0RB 3WHXA 4R4FH 5E8OA 4XP4H 2HH0L 5T33H 1LO3L 3H7BA 4PJHB 3VXSD 4FXGB 4E0RA 1F4AA 4CW1A 3BT2L 2GJ6A 3VGGA 4F7EB 1A6AB 4LDEB 3BGAA 4HKZB 5AD0A 5FECB 5JHDD 1U3YA 2VLMD 5DWUH 3L3OB 5AEAA 4WFHD 2DLTA 1A6UL 1KEML 1ZLSL 3RVWD 2R1WA 4HH9B 2O5ZH 4NZTL 2YD9A 4YQXH 2IPUG 4JHZA 3BHBA 5DK3A 1PQZB 4U1MA 2FCBA 3MLPA 4M7KL 2DQJH 3DRTB 4OLVH 3IT8D 4ELMF 2OK0L 5KJRL 1NANI 1BBJA 4NQVB 4Y4HA 4M8QA 2Q76B 5JQ6L 3FO1B 3IXTB 4LCCC 1MH5A 1N0XL 3Q2CA 3WNMA 2P42B 2J6EA 5C08A 3QIWB 3DX8B 2P44B 3MOBH 2IALA 5GSVA 1FNGA 3UJJH 3NIDE 4ZUTB 1FSKC 5B8CB 4X9IA 3QUXD 3ZDZE 3T0EB 4ZAKB 3NBNA 1SY6H 5SV4A 2DYPA 4IJ3B 2CLZB 4N1CA 3HS0B 5DD0L 3STLA 1WC7B 2KZWA 4JY6B 2APXA 2NY5L 4JCLA 1MCOH 3HNVL 3UPRA 3UCRA 2V2XA 4OZFH 4NN5C 2YWZA 5ADPH 1PKQE 4DJMA 5A40E 3RJQB 3ME0A 5A2FA 2QEJA 3NIFF 2BXYA 1K8IA 5ID1B 4KZDH 3LMJH 2RCSL 2IAMD 3QO1B 4HS8H 4R6UA 5C6WH 3LKOB 2XWJA 4JRYE 4E42B 2XG4A 1UYWH 1XZ0A 5FCSH 4E9LA 2C1OA 2QQNL 4QEGA 3I75A 1A6WL 4YX2L 1R0AH 3QXAA 5C0NC 3PUCA 1ORQB 1OVZA 2VDML 4WUUA 3U30C 1HSBA 2R1YA 1R5WB 3ARSA 1TFHA 2DLGA 4OCSL 5IFAH 5I17A 3MV7A 4O5LL 5DVMA 4ZFZA 4H1LG 4ODHH 1CGYA 5AUMB 2FH8A 4U1SB 5FYLL 1T1WA 1CF8H 2ED9A 2MFNA 2XZAL 3QYCA 3O4LE 1D9KC 3TWCH 3GMMB 1PY4A 4GRLA 1NGXB 1EIBA 1SJEB 4KRMB 1U8IA 1N64L 3SKJL 5DLML 5HYQB 4M1DL 2HKFH 3AMKA 5HHME 4OF7A 5MENB 5C0BB 3BDXA 3GMNA 5H94B 1T66C 5DDHA 2JJTA 2HVJA 4K71C 1M7DA 1YPZB 4OZGF 4PJGA 3CFDB 3CXDH 3PDDA 4XPAL 5D7JB 2CQVA 1H3PL 3GMRA 3UPAA 5FB8B 1UZ6E 3QDHA 4L9LC 4NN6C 3GIVB 1GPOL 3QHTC 4YE4L 3I3DA 4F2MB 2LV4A 4FZ8H 1S7TB 4NWTH 1RV6X 4MJ4A 1C16B 3LIZL 4C4KT 6FABL 4WDIA 5IVNA 3V6OC 4XNQB 2I9LA 1T89A 1UWXH 4XNXH 1RIVH 2EDXA 1HINH 1LVEA 3D69A 1KEGH 5CJOH 3VWKB 4HXAL 4EQ2A 3TZVA 3RQ3A 1FZOA 4GQ9L 3WDIA 3MRGA 4YAQA 3RNQB 3B43A 2XTLA 3PQYA 2V5MA 4O02H 2V7NB 2KL6A 3EZJB 4R7NB 4P5TC 1A1OB 1I9IL 4DN3L 3HAEB 4JKKA 4XB7A 1F4XH 1FVDA 4Y5XB 3VXSA 3ULUL 1EX0A 2VDKH 2B8OT 2BY3A 3QG6B 3FQWA 1RULH 3DARA 1CG9A 4EXPX 2RBLA 1NBZA 3P9MA 4O2CB 4I48B 5DJZB 1R3LB 3BKJL 4X4XB 1LO5B 2GTWA 4LCUB 5I2IA 1P53A 1YPZE 1FG9C 3FOLB 1BFVL 3MUY1 1MOEA 3S34L 1KIRB 4TOYL 1TLKA 4YHPB 3MRCA 1FYTB 1KB5L 1XGUA 4JQXA 4NZTH 2YKLL 1I4FA 2ZSWB 2VIRB 9CGTA 3E2HC 4ODVH 1HILA 3NCYS 3W39A 4LCYB 4X6EB 5TE6H 4KI5F 4K9EC 3FRPG 3GBNL 4BH8B 2WP3T 4I9WD 2ED8A 2FECI 2P49B 4WEMB 2NTSP 4MDJA 1JHLL 1WQVT 3EOYG 5HHMD 1QSFB 1CZ8L 2DQHH 1WBXB 4KJPD 1CGXA 3NCJH 2EO1A 3IF1A 3WLBB 1JHTA 2FYYA 2A9ML 1KPVA 3PHOB 4HZLA 5BZDA 2X4UB 1YNKL 4KUCF 2JK5A 3TFKD 5ALBH 1UQSA 1CGSL 5CJ5A 4J4PC 4LPWA 4JLRB 4C83B 4LLUB 4P2OB 2CPCA 1V3KA 3K4AA 3IETA 3U0WL 4URTB 1L0QA 3ZE0E 2J4WH 4MA7L 4PJ7F 4EJ1C 2DBJA 2EXWC 2EKJA 2IH1B 3BEVA 3BQUA 4HWNA 5HJ3B 1EA9C 25C8L 1AIFB 5HY9A 1UYWL 5KSAD 2R0KL 1AQDB 5GS2D 1I7UA 2FO4B 1SYSA 3RWDB 4DGIH 5CJQL 4HS3B 1EHXA 2BX5A 5E94A 5FFLA 1UVQB 1VKXA 1NEZB 4FQIL 4QRTA 2VH5H 3N85L 3GSNL 5GGUA 3FO0H 5DRWB 3DBXA 4OGYH 2PO6D 4Z7WF 1GGUA 2BVOB 3VXUE 1JGVH 2J6EH 3ZTNL 3KPOB 3HAEH 1BBDL 5EBMA 43CAB 4I3SL 4NQDD 3T2NL 3MRLB 3BZEB 5JHDE 3GSXA 4KQ4L 4PLJC 1I8MB 1QNZH 2AK4A 2DDQH 3MJGX 5C0JB 3O41B 4ETQB 3MRDA 1WEJH 5CD3A 3U7WH 3TH4T 4YJZL 3QI9C 3N1FC 4KAQL 1SBSL 1YEGL 3OV6A 1UEYA 3ZKNC 1KPUA 3VFTB 5IM7A 1G6RL 3D48R 2Z4QB 6FABH 2X4PA 1MRFH 2CLRA 1HSAB 5D96C 2AK1H 5H35A 4LHUB 1UH4A 3HE7A 4NYLB 4TNWF 2BHUA 1XF2A 2BRQA 3BMWA 1CGTA 3PL6C 4LPYA 1FYTE 4CGTA 1IAKA 4HJGA 3T3PE 1T22A 3MRRA 2ADJB 3VFSB 3QQ4A 4WWKA 2HKHH 3DIFB 5CHNA 4OM0L 4QRPB 2P24B 1LK3H 1TZHA 3MLUH 1WAAF 2FHCA 3SDCA 3MV9E 3ZDXF 1VGEL 4YHZH 5EWIH 3ARXA 3B4NA 3B5HA 5EA0L 3IDUA 4EBQL 3VMOA 4NQUA 2E3VA 3DWTA 1DZBA 4LAQH 3FAWA 2EXYC 3C60C 4QCIB 2F8XC 4IJ3C 5E4EB 4PJIF 3HZKA 5HHQA 3GI9H 4FS0A 4OD3L 3DMMC 2L7UA 3FB7B 3LEYL 4NHUA 3ROOB 3V7MA 4F7CA 5IJKC 1KJ2L 3MFFB 1NFDA 3KPNA 4I2XB 3VG0L 3B9VA 1N0LA 3L3GA 3T3MF 1I7RB 3AXLB 3GSQB 1S7RB 3RHWF 2Z31D 5JORB 4JM2C 3O4LB 4F7MA 4YIQB 4WNQB 1RZJL 1ULVA 5MEPA 4ODVL 4M02A 3QSKB 5D6CA 2PTTB 4JDVB 1BFOB 2BVPB 2Q3AA 3CSPA 4HK3N 3MRFA 3FT4B 4GKSA 1D6VH 2NCMA 3L5XL 5JW4N 4HZAA 3AM8C 2YC1A 5GGQL 1S7VA 4ZOBA 5CMAA 2DL9A 1MCDA 4BSWA 1E6OL 4LCCB 3ZT7A 2NXYC 1I1YA 1I9JH 1NLDH 1WAAE 2XFXA 3BXNB 2AKRA 4Q9BA 1HKLL 2HYMA 1IC5H 1I8LA 5BS0E 4QXWA 3B9KD 1U8NA 5GISH 2ZJSH 5EZJA 5B8CC 5DT1H 1UB5B 3FFCA 5B39G 4WW2B 2YHGA 4KV5F 4G6JL 2N7BA 1OP5H 2Z8RA 4XWOC 4TN9A 4MJID 1W72B 2P5EA 4Y89A 4EZMA 1UWEL 3RJDA 1OM3H 1QR1B 2E6JA 3UTZB 1NDMA 4UMGA 3T2OA 4ZYKB 3C6LA 3C5ZB 3MGTA 4QRPD 4I2XE 2AEPH 2WIIA 1AXSB 1CVSC 3CH8A 4OGZA 4AG4L 4MAYC 4LLAA 3G5ZA 1A3RL 2FX8H 1YYLH 3Q3GA 4FFWC 3DXAA 1X3DA 1MFEL 4PB0H 5MERA 2FGZA 1A14H 1F5WA 1CL7I 2BHZA 2J6EL 3RZCD 2XZZA 4GMTL 5B22A 3WUWB 1Z5LB 4U6YA 4KKCD 2ADIA 3MCLH 5ITFB 1MPAH 1G1YA 3WFBH 2KDGA 1CL7L 4Y16B 3WL9A 2DF3A 2RFXA 4R96A 1QYGL 5E1HB 3C09C 3FT2A 1BLNB 1TITA 4KQ3H 4JKWA 4MB4A 4KGLA 5JIKA 4JJ5B 1HN1A 1N7MH 3TGXA 3GBML 3HZVB 3QUYC 2GK0A 1BQLH 3MPCA 6CGTA 1BOGA 3GGWA 4J3XA 4RGOL 1CK0L 2E5EA 3RUGA 1I7TB 3BD4A 4JFFE 4PB9L 5SWSE 4JN1L 1S9VA 2YA0A 5E2UL 5E56A 3H3BC 4U6XA 4S10A 2EIBA 1INDL 3S3JA 4PLNC 3RWCA 3L9RA 3OX8A 1IAOA 3BE1L 4NRZB 1MELA 1N3NA 5EORH 3K4ZA 3OXRB 1ADQL 3PGFH 1QSEE 5F97E 2FBJH 5FYKH 4GBXD 3EYOA 4ZTPH 3PDGA 4PRAB 2W9DL 1TJIH 3SY0A 5F93C 1LE5A 4JO4H 3PIQA 1I3RB 3QULA 5DRNA 1LNUB 4JG1L 1S7WB 2DMKA 4EBQH 4XVTL 4QHLB 4KVCH 1JRHI 4S1DC 1JMZA 4EOWH 4XHJC 5E8EA 1UB6A 1CFNA 3TH3T 5JOPD 1MCWW 3TT3L 2LU4A 5MI0B 1KJ2B 3CD4A 3CIQA 1QOKA 2GT9A 4O00A 4WU5A 1TZGH 3G9AB 3O2DA 5D2LF 5F9WC 5JTWA 3CDCA 2DQFB 1WIPA 1GZPB 3VI3E 5DA0B 3LHPH 3TF7C 3CCHB 1YEIL 3TBSA 4DEPC 5EZOL 2FSEB 2ZCKH 1Z6JT 4LSTH 3FN0H 3IXAB 4NKDB 1XIWA 1EO8H 4Z77A 4MX7A 3QRFM 4NOFA 5GIRA 3MRKA 4PJEB 1PX3A 4G7YH 1LO3H 4NRXB 4WFGD 3MMEA 4AEHL 3BH8B 1I9JL 1BWWA 2D7OA 3FJTA 1CICA 4M93C 3JV6A 2V7HA 4MJIA 3QIUB 1YZZA 4KRPC 2Z91A 5DT1L 2G5RA 2HJFA 4IMKC 3DVIA 3MREA 1FE8H 2O5ZL 4JVWA 4FQ2H 3P4OA 3EDDA 1JPSH 1F6AA 5KW9L 5DZLA 5EC1A 2R2BA 2ITDA 3BQUD 4Y1AD 1S5IH 3ULVE 1MJ8L 4HUXB 4QHKI 1CFQA 4HT1L 3NVQA 2AI0H 1VEMA 4G7VL 5D2LE 3TN0C 2DBLH 3FTGA 5DEZA 4IOSD 4YC2B 5A16B 3FQXA 1N5AA 5KSVA 5LXGH 4Z7NE 4QXTA 4PJXB 4R2GC 2ADGA 2EDQA 1P7QA 5DD5L 1ACYL 4BQ6A 1MFEH 4PB0L 4JFED 4TVSa 2B1AH 4DTGH 4P59H 2H8PA 2A6JB 3RWHA 1QHPA 5EO1B 3D25B 4N0UB 5EIVA 2NY5H 5GRUH 5I8OL 2NX5A 1JWSB 1ZHKB 2BK8A 3OB0K 4PJIB 5FM4A 2HAZA 4U1JB 3SDDD 3PWUA 5KS9E 4I77L 5DEGA 1HE7A 4TNWK 5DVLA 2ERJC 3WXVL 1RI8A 4M4PA 1KJMA 5FUZH 1SEQL 1AI1H 3MRNB 5DD6A 5IHUL 2DLEA 4YHNB 1CD0A 1NCCL 3WHE0 4JFEE 1NMBL 3BRGC 1T1ZA 2F15A 1RZGA 5I0DA 2DI8A 4NKMA 1J8KA 3ZL4H 1QSEA 4YBQC 2LAGB 4KU1A 4ZODA 1QKZH 3QUKB 2DL2A 5CLWA 1P4BL 4X9HA 4DCQB 2NTFB 2AABH 1DQDH 2X70A 4MA3B 2XG5A 4PGCB 5FYLH 1TTUA 4Y5YA 3H42H 5D7LB 2PXYB 4POUB 4IEFB 3ARBA 4HH8A 1EUTA 2XZCL 3IAGC 1EK3A 2IAMB 4YHLL 1IGCL 5EBLA 1ITBB 1QFWI 4NGHL 2GY7B 1A6ZB 3O11A 4R4FL 3BE1H 4PJFB 1UENA 4I5BA 5K33A 1T2QL 3OKKB 3NCBB 4BH7A 3JTSA 4HDIB 1D5XA 5JW3L 1U6AH 3SQOH 3L3HA 3VJ6A 1INQA 1AKJB 5IMMA 2F8VA 5IBUB 3ZKXB 5KS9F 3D85B 4S1RH 3EYUH 2ED7A 3KJ6L 2GJ6E 3PNWB 1CE1L 4JFYA 5IHLB 2XNAA 4GLRI 1LO4L 4WVRA 4IBLT 5HDQL 2P46B 3VXPB 1BFTA 3F5WA 2HJLB 5JXEC 1K4CA 5DVNA 2D0HA 3I2CL 1E6JL 4GFTB 3THML 1FNLA 3TVMB 2QADB 1S9KC 4GQ9H 1AHWA 2C5DC 4MNGE 4YXKH 3O0RH 8FABA 1ZA6A 2OMNA 3KYOA 1I9IH 4DN3H 2EE9A 2ZCKL 1A4KB 1MNUL 3LEXA 4L4TD 1Q9OB 4L8SB 4LVOC 1ZHLB 1JGUL 2C4XA 5FK9B 2E9WA 1T0NA 1BQHA 4XP1L 3BGFB 4OGAD 5KOMC 5SWZD 3AROA 1FZMA 3HAEG 1CXFA 2HLAA 3IJYB 2VL5B 4OBSA 4U31A 2X4SB 4PJ7B 5D2LA 1QBMH 1G7JA 4MNHB 3P4MA 4GAGH 2XTJD 3VFOA 2O5XL 1A47A 4ODWB 1PJ9A 3L5WA 4HF5L 1AO7E 4LSPL 5HGDA 1V8HA 4WTXA 1CQYA 2XWTB 4LPXA 4TQEL 3RTQB 1WTLA 2E27L 1QPPA 4QHNB 3L6FB 1A6AA 3ZSSA 4P2OD 3HZMA 3GBNH 1FFPA 3QWRA 4HT1H 1HXMA 4NBZB 3L3OA 1N6VA 4Q7DA 3A6OA 2DBLL 3A6CH 3QIUD 4NQED 1C5BH 4LDLB 4I0CC 3UTPD 3MGOB 4UOW0 3KPSB 3MV7E 1DLFH 5IB3A 5KVEH 3SKJH 4M1DH 4HJ0D 1CGWA 1M4KA 1DVFC 1IEBB 2QSTA 4Q9CA 3V9FA 1CGSH 4NC0B 1KJ3H 4M8QB 3IKCA 4ERSL 3SO3B 4JRYB 1BIIA 3FQTB 4X5LA 3QIWA 3TNMA 5JMOC 1GOFA 3BP5B 4X7TA 1A2YA 1X5HA 4MS8C 3QEQA 4GRWF 1EAPB 5D5MB 5HDLA 5L6YH 1GPOH 3C2AL 2DWDB 1YJDC 1CXLA 2VXSL 2CK0L 2Z0BA 3IVKB 1SM3L 5SX4I 3TV3L 3HS0A 3STLB 1NC2A 4XNXL 5E8PB 4U1KA 5CJQH 3UPRB 4RMRA 3VXRB 3UEZA 5EU7C 2E7LA 4U7KA 2CUIA 3MV9A 4HKJA 5F72S 3BDYL 3GSNH 2FEEI 2EYTB 2W1NA 3GKWH 4XHJD 1DQDL 1NCUA 3OKOA 1J86A 2C1OB 4PG2A 3SE8L 3V5DA 3OKEA 5FYJE 4PTUA 5EOCJ 5ADOH 1V3LA 3SGEH 2WWKO 1AXIB 4MJ5A 4O2EA 5C0RL 4XTRD 1UM4H 1OPGL 1QNZL 1U8KA 4DZBB 3K74B 1DQMH 1SY6A 4R9HA 1BX2A 3GJFK 4GBXA 4OLYH 1U91A 3DURA 1MFNA 3FHQA 3GB7A 3ILPB 1IAIL 5DJ8B 2CO7B 4RRPG 3ARTA 2HFFA 4EEEA 1U3HC 4WW2F 4V1DE 1T2XA 4TOYH 3EYUL 1A7RL 5AAMA 4Y4HD 4P2QB 4WHCA 2VUYA 1CE1H 3RBGA 4B41A 4RMVA 3G5YB 1BIHA 3TVMC 4CVUA 1KOAA 1YPZA 4RAUA 5DR5H 3C87A 3IU3B 5SX5K 1EJOH 3E0GA 2BY1A 5B3JE 3DYPA 3O9WC 2UWEF 4JREC 2LTQB 2NX5D 1B90A 1HZHL 2DKSA 4OZ4B 3BW9A 3M1BB 4LQ1A 4GAJL 4XNQA 4WWKD 4KY1L 1A21A 3HG1A 4X9GA 5DJXA 4YHOL 1VGEH 4OF8A 4WO4C 4M62H 3OF6D 3TPUB 4KKCC 1ZTXL 5F7UA 1LE9B 1INEL 5ALBL 1CTOA 2PR4L 1ZOXA 3ARFB 4YAQB 2MTPA 3T8XB 3HE7D 2CKNA 4NN7C 4QRUB 4MHHG 5HGBB 1A1OA 4OD3H 3BD3A 2EE3A 1QFOA 2EC8A 1DUYA 1ZXQA 3VXQB 3FQWB 5EPMA 3RZCC 2E9IA 3TNNA 3RIAF 4FTVA 5L2JA 4M61A 1TMCB 4WUKH 4ZFOL 2BOBB 4JRXE 1A5FH 5CJ8A 4BK5A 4JY4A 4P3CH 5IWLA 4ZQKB 4LCUA 4LLMA 5I2IB 3D9AH 1F13A 3MRMB 1JGLL 4LSQL 1RHHB 3VE0A 5EZIL 4N9GA 1RZKL 2ARJQ 2WUCH 3QXUA 4LCWA 2UVFA 4WI3A 4PJCF 5GGQH 1H15B 5LWYH 2VIRA 2JTDA 3CH1B 3OG4B 2YBRB 1G84A 5D7IF 4J2XA 3AREC 2BDNL 3VFPB 4UIMA 4XCFH 5E8DL 5IEHA 3QDME 1QLEH 3EOBA 4IDLA 3WD5H 1DSFL 4JG0L 2ICCA 4JFHE 1N4XL 3REVA 4PV8B 5DJ6B 4LDOB 4AQOA 1UWEH 2AJUH 1VPOL 5GGRA 3O4LD 3PHOA 4C4KO 3C2AH 5CP7B 1XCTB 1WLHA 3H9HA 5F3HB 4JKPH 5JHDB 3OZ9H 1KIQB 3VA2C 1DBBL 4N8VG 2IH3B 5DEFA 4PP1D 1ZT7B 1L6ZA 4YK4C 3HFMH 2EDWA 4XZUA 3BDYH 5GS0C 4Y1AB 3BQUB 3V0WH 2Q8AL 2ZNXA 5EIQA 2DWEB 3P30L 2BNQB 5I1KL 4BQBA 5SWSB 1ZT4B 1I7UB 1SYVB 5JNYA 2AJZB 1CR9L 2IQAB 3KG5A 1WFUA 3HZYB 1TPXC 3WFBL 4FXLA 3LD8C 4PY7A 3FB6A 4ZFFB 5C0RH 5CCKL 2O61A 1QRKA 4NNYA 1FIGH 4L8SC 1A1MA 1Z9OA 3LVEA 1AO7B 1BJ8A 2JCCF 4XX1E 4GG6F 3LKNA 3IDIA 2O5YH 2R29L 4PJ8B 1OHQA 2YS4A 3Q6FA 3EFFA 3GMPA 5CBEA 2YSSA 1W0VB 4B53A 4K23H 1R3IL 4BQ9A 3ZLQC 5IWLC 1LEGB 3O2WL 3MRLA 5DRZB 5HGGS 5SX5H 3GMOB 5DUBA 4ETQA 4FQ1L 1FNFA 1ETZA 4PTTB 1K6QL 1HH6B 1YNTA 1GCFA 2F74A 4FG6C 3RPIA 3QAZC 1UM5H 1TVHA 4PJBE 5EU4B 4MGXA 4H8WC 1J0KA 2DQGL 5T3XL 3TBYB 1KPUB 4OCXL 4U1NA 4WHTA 1ORSA 2H32H 1A6VL 5LGJB 4Y4FB 5FO8B 4HUUA 1ADQH 3PGFL 5D2NB 3C9NB 4ODTL 4WU7A 1GZQA 5D5ME 2CXKA 3C6LD 1PSKH 1FV1B 1JZ5A 1OAKH 5SWQB 4PP2B 1N59A 3CX2A 2CRMA 1BM3H 1QBLL 5C2UB 3CFCH 3VCLA 1UGNA 1T7XA 3MBEB 4HC1L 1H9VA 4Z8FH 4QT5A 4ZXBB 5CHNB 4Q58C 4NQEE 3P0YL 1U92B 5EUKA 3HTLX 1PVHA 4TNVF 1P9MC 4POZC 1UM6H 4QLRA 3WJJA 4OZHF 1PZ5A 2R0LL 3FRUB 3V5HB 3E3QE 1IM9D 4D9QE 2EDLA 5KVDH 4RZCB 2OL3B 4P3CL 1T66D 2C3HA 5C0IB 3SN6N 1R3KB 4LLQB 3BZ4A 4QOKE 3HZKB 3W0WA 5IB2B 2EEAA 4N90E 4PV9B 1IC7L 5I6XC 4XVUD 4I4WB 5E99H 3M8OL 2NR6D 4I2XA 5T5FL 1LO0L 1MIMH 5GRWA 3FL7A 4C59B 2KQMA 4NQSA 5J8OA 2EH7L 1S7RA 1Z9LA 1CFSA 4GMTH 1BWMA 3O2DL 2V5YA 2PTTA 5EULV 3FOMB 1BFOA 1U8LA 2Z31C 5HHOE 2GFBB 3UTQB 1JV5B 4NJ9H 4XCFL 1XCQB 3G6AB 1MHHB 4HUWA 1AE6H 1QEWB 2ZWLT 5EN2A 4JG0H 3SE9L 1ZGLB 2VR5A 4NSKB 3WFCH 4KHTH 4XNZB 4LARH 4NCDA 4JQIH 4XNYH 2NY4C 2XFXB 4U2ZA 4P23A 1DEDA 2BNRB 4LKCB 4NRYA 5IBUG 3FKUS 5T1MB 3P40A 3DECA 1K5NA 3BIAX 3PWPB 1KCKA 5J1TC 4N68A 5D7KD 5IB1B 5DYOA 2X9XA 3GSUB 3WUWG 4Q9QH 5ACZB 3DO3A 4RIRB 4EUPH 1P5UA 3K1KC 3HB3C 1ACYH 3QIWC 2OSLB 1Y6NR 4GLRH 2ZSVB 1P7KB 4NCC1 2YR3A 1A7BA 1UWGL 5J6HA 1OAYL 4WTZA 3IRPX 1OB1B 3HE7C 5JXED 4OV5A 2H26B 1BD2E 2WIIB 1BJ1H 1TQCB 4PJAE 2W9LA 4LASH 4JZOA 2BVEA 3TYGL 1D6EB 3RVXD 1DTUA 1PAMA 4Y5YC 4OZIA 1P4LB 4YFLI 4EI6A 5CWSA 1CE6A 5KTEH 3K80A 1F4HA 5IHUH 3DPBA 1QRNE 1NGZA 2BRRL 1VFBB 1MRCH 1WZ1H 2ZOLB 1T80A 1X4YA 2OTWB 3ZO0A 3UYPA 32C2A 3MLWH 4X7SL 5FUOL 4FQJL 3HR5A 3LRGA 5A2JH 4POYA 5IB4A 1QUNA 1N8ZB 1WF5A 4HKZA 5AD0B 5FECA 3QCTH 4YDIH 1BVKB 5DJ2B 2ATKB 2J5LC 5J9PA 3UJIH 1OOAA 4WGVB 4ZUUA 3H0TB 4MNQA 2PYED 3DRQA 3MLSL 4KMQA 5KSUB 3MRBA 2MHAA 3AS1A 2P45B 1IGCH 4Y4KA 3S5LB 1EO8L 2CIIA 4WI9A 5D71L 4U1MB 4Y5XC 1A6VH 1OAQH 3GJEB 3LEVL 2Y9RT 5EBGA 2A9NH 4X0KA 3LS4L 4NQCA 1JNNH 3LQZA 3A6BL 4HUVB 1JWUB 1BZ9B 3S5LG 2C4FU 5JW3H 4H5SB 1KNOA 1HEZB 5IR1B 5F7DB 2NY6B 4NC1E 5D7IA 4XCCL 4ZUTA 4RA0C 4XI5D 3ARDC 4JFHD 2ZCHH 4LKXB 5GS0D 2M26A 1DANT 4Q74A 1BPVA 1JPSL 5IV2A 2B2XL 2DYPB 1MVFA 2CLZA 3P0YH 2CDGB 2RAMA 3DX9B 3PIQB 1E6JH 5TE7L 5J12B 5T1LD 5F44A 2DQCH 2JJSC 1K2DB 1S7WA 4YHYC 3B2VL 3RZCB 5TQ2L 3HE6D 4NNPH 2W9EL 5HSFA 1CFNB 2E9BA 1AGDA 2GW5A 3FCTA 2XWJB 3IGAA 4DFHA 1XZ0B 3HNTH 3P11L 1KJ2A 3T1FB 4HS6A 4GG8B 1GJIA 1YN6B 1NMCB 1QQDA 3KPLB 5ERWA 3Q5OA 2XQYK 4XH2B 1OSZA 3NACL 4XAWH 4OUUA 4ZAKD 3R1GH 2DQFA 4Y5VA 5JIPA 4XTRC 1TIUA 4OZGA 4PGZA 3T0XA 4M5YH 3LRSB 5C0EB 3TBSB 3KAAA 1DQJB 1QRNA 1FVEA 4DZ8B 5I8CB 4MNQD 5SX4H 4MA1C 1NGXA 4XC3H 5HDBF 5JUEL 1AI1L 5FYJL 4RMQA 2A2QT 1RU9L 5I1EL 1MCKA 4GO6B 1NBYA 1EXUA 2PO6B 3RA7L 5FYLD 3OAZK 1JPGA 1H3UA 4KZDL 1WUNT 2BMKA 1FJ1A 3IJSA 4A6YL 1RUKL 5IP4A 4J6RL 3MLVH 3TBTA 1KLGB 2CKBB 2CDEA 2VXUL 1MFAL 5FDWA 1KB9K 3F12B 3QP3A 4K3EL 4MAUH 1MY5A 4HAFA 1S7UB 4KJQD 3P4OB 1LWRA 4F2MA 5DO2C 4R4NC 2ITDB 5CUSL 5C2BH 1MFBL 4N5UA 3GSOA 3S8WA 1JF1B 3G6JE 1MVUB 1IC4H 2AJYL 2D7TL 4K2UL 3QUZA 2QHRH 4OB5L 4M7LH 1IT9H 1CDGA 4I3RH 1WSST 4NC2B 3HCVB 1U6AL 4X4YB 2IG2L 3MLTB 5CEZH 1N5AB 5DLMH 2V7NA 1S9XB 4BFEA 4OSUL 4YHIA 1WWAX 2X9YA 4R7NA 5CJXC 2MCPH 2Q7NA 2H2SD 2B1HH 3LQAC 1C08A 1XGTB 4G8FB 3UBXA 2A6JA 4M7ZB 3RI5F 5EO1A 3V52L 1NC2D 4HMDA 3TT1L 3D3VA 3SKMB 5DK2A 1I3UA 1FHGA 3RAJL 1L9NA 1WZ1L 5SV3A 5D7JC 1LEKB 4O2CA 5K9OA 2I24N 3BVNA 3GJFB 2HT4C 1AGEB 3G04A 4B7IA 3VMNA 4EN3A 4NO0D 4KKBD 3PGCA 4CMMB 1RURL 3GSVB 1GC1L 5E6IC 1MF2H 2D03H 3SE8H 5C07A 5I66A 3QHFL 1CLCA 3MLSH 4QNPE 4W68A 4IIQA 5F7EL 1RIUL 2ARWA 4XP6H 1RUQH 1SQ2N 1OAQL 5T3XD 1HILB 1EVUA 1OPGH 2JIXB 3LS4H 2R2CA 3VD4A 4N0FB 2YA1A 4HKXA 5A2IH 1KFAL 1IQWH 3QR2A 5T3ZD 2PXYA 2WBJA 1KGCE 4MAYA 3QRGH 2X44D 3SCMD 2O5XH 4BUGA 5F88A 1RK0A 4MWFA 2ZPKH 3ARGB 2X4UA 1WWBX 3K4DA 3P9LA 3RX8A 3VXSE 4LLUA 3WMSA 4J8RB 2Q86B 4KRNA 4ZD3H 3B2VH 3L7EB 4OCLC 3V6ZA 4PJBF 1MCPH 2OZ4H 3HMXA 3HRPA 4XCYA 3SDYL 2VB5A 1HQRA 1VCAA 2XQYG 2X89A 4L8CB 3WS6C 3PNWA 1IL1A 1KT2A 5IJKA 2AXFB 4JN2B 3VXPA 2ITCA 4CVXB 4LLDA 2HJLA 4JM4L 2P7TA 1QBBA 4GAYA 3BEWA 1EUUA 4PP1C 1MCWM 5AZEH 2DD8H 1X5IA 3ARUA 3WUZA 2EO9A 1NEZA 5EOCL 3JUZA 1CTNA 4HXBH 5LAXA 5HYIA 5KSAB 4BQ8A 4WENB 2XACC 2BNUB 3RWGA 1T89C 1WWCA 1WFNA 3D3VE 4MMXC 2MJWA 1YEKH 2EICA 1TNNA 4ODUB 4KJWC 1ZHLA 4WTWA 1Q94B 1BQSA 2BVTA 5EBMB 3JV5A 4WUKL 3MBED 1KJVA 4XC3L 3MODL 2V2TB 4M48L 3STBA 1B9ZA 2X4QA 4AEIH 5IK3A 3VFNA 4P2OC 2FRGP 3NFSH 5HHPA 4W6YB 3IJYA 4V2CB 4PREA 3V2AR 2BERA 4XNZC 2UZIL 4M03A 1E27B 3IDXH 3KPQA 3QUXC 5CSBA 5KSBA 3P4MB 3LN5B 3NCYP 3GKWL 4HIEB 2PW1A 4DGIL 2GJZA 4ZS6C 1L6XA 2HT3C 3CFJB 5CGYD 4HWBA 4OI8A 3U4BH 1EFXA 2Z4QA 3NCFB 3GBLA 1MAJA 4PRID 1GGIH 1HSAA 4R7DA 1B88A 1OWRM 2APVA 3NMEA 4D0DA 3ZTNH 1DQML 1HXMB 5E8DH 3RU8H 4ZOCA 1BBDH 4KGJA 1FN4B 2GCYB 4I3RL 4JRWA 4GG6B 2F54B 4YHMH 4XPGH 3EO0B 5DD3H 3HHRB 2DIBA 1LILA 4IRSC 3W11C 5ETUA 5DHYA 2C3XA 5F71A 3GKZA 4N90D 4GSDL 1TZHB 3IS0X 5L8LB 3B83A 5B38A 3EDKA 1A4JB 3VWJD 1MLBA 4H0IA 1C8PA 2BNQD 1AP2A 4KUZH 1NAML 1RMFL 1UA6H 1ZGLM 3C5ZC 5DR5L 5HI3C 4K8RD 4X5XA 4RFEA 1GGTA 3PXJA 4MXQC 1MCHA 3FQNA 2CUMA 3IDMA 1EAPA 5D5MA 1L9MA 1J18A 3VA6A 4UZGA 5DFVC 5I1KH 2AK1L 5SWSD 1RURH 2BSRA 5C3TA 1GC1H 2H2PC 3ZKMD 4CJ0A 4N8VB 3MA7B 4FABH 1NAKH 2X4OA 4RDQG 4RGND 1AHWC 3NIGE 3D0VA 2C3GA 4TNVK 5HI4D 4RAVB 3GRWH 4Z5RA 4U05A 3BP7A 1LO2H 3KVQA 1FYHB 4L4TB 4O9HL 3OKOB 3QCUH 1S7VB 2D7QA 5TGBA 3JXAA 3EFDL 1XGYL 4AH2A 4GKZA 4ELME 1J7VR 2PTVA 4NP4L 4PJ9C 3TVMD 1OCWH 2CRZA 3MRQA 1U3ZA 1U8KB 4DZBA 5DRXA 5L2KB 4PRIA 5B3NA 1J0ZA 1RFDL 5KVFH 4JQVC 1I1FB 2YRLA 4TUKH 4Y1AE 2B4CL 2ICWJ 3BQUC 1HCFX 4S2SB 5DJ8A 4FTVE 4WW2A 1JGLH 4P9MH 1V7MH 4XMKL 4TVPD 3CXHK 2A6KB 4OD2B 4BZ1H 2AQ3A 1UJ3A 4HWZB 2NYYC 2Y07L 4EDWH 1QLRB 3CUPA 3CVHB 3JV4A 3HI6H 3V4UH 4P2QA 1RJLA 3CX5K 4YHKL 3N1GC 3T09A 1CLOH 2GITA 4UQ2B 1MQKH 1XR9A 3ZHKA 4NZJA 5IFJA 1JYXA 4KTEL 4JHAL 3GIZH 1QLFA 1F00I 1GVIA 1FZKB 4V1DD 5LGHL 3O8XB 4M93B 4BM7A 3QDGA 4PJGF 1H8NA 3PE9A 3UZQA 3SGDI 2NLJA 3S36H 4JPVH 4LHUD 1EDQA 5FKPA 3SE3A 2E7LC 5GISL 1VPOH 2Z8VC 4EDXB 1EZVY 4UAOC 2X1QA 1Z5LA 3DROB 3HG1D 4JQVA 2APWA 3RNKA 5ITFA 1JMXA 3B3IB 5D1XB 5DMKA 5F8QC 4DUXA 3AY4C 3T8XA 4JE4B 3VI3F 4BSVA 4XBEL 5DGQA 2JB6B 2PCPB 3VD9A 1F4YL 2OXHA 2IBBA 3K81A 4W4NA 5HGBA 2IGFL 1ES0B 5SWZA 3WHE1 5BRZB 5MP6L 2YEZB 1HHGA 4Q6IC 4MSWA 3VXQA 1HHIB 5E1AA 3TNNB 5L9DH 3SDDB 4JJ5A 5DJYB 5FGSA 3Q48A 2EH7H 2Z35B 4P57A 5JIHA 1L4IA 4QXGL 4G42B 4LMQI 4ZUVA 1UACH 2R23A 1T6WA 3AS0A 4A2LA 4LLMB 4LL9A 1GGIL 3BN9C 5DQDL 4F7TA 4NQTA 4JZNA 1UZ6F 4N9GB 2IFFH 2V9TA 3SCMC 5IHBA 1ZAGA 3MLYH 2YK1H 3QJHA 1E28A 1S7XB 5HYSB 5DJCB 4XPGL 3BUYA 1ITCA 5TQ0H 5HDBE 2NMSA 4KKAD 3ZYOA 3L9RB 1LP9E 2XA3A 2OJZL 4KK6C 4L8DB 3HPJB 3O3EA 4N5EC 3O3DB 2YBRA 5IVOA 3FZUC 1A1NA 1WBZB 1WCBB 3HMWH 4NHCH 1UXSA 3OBAA 1YEHH 4ZPTB 12E8L 3GUTA 1KC5H 3LKSA 3OMZA 3NABL 2R1XA 5K9QG 4M7ZC 3VFRB 2VAJA 4UT9L 5HHXL 2D9CA 1IQDB 1DN0B 4IRSA 1WV7T 3U9UA 4MLIA 3RVVC 1TCMA 3QNXB 3PABB 4FQXA 4HGWB 2W07A 2Q8BL 1NCDL 1XF3B 2IAMC 4M9PA 1FLRL 5JOFB 4FABL 5IB5B 1NFKA 3G6JF 4K3JH 2GT9B 1AFVL 1PSKL 2EYSB 1OAKL 3ULUD 3L7FB 4HIXL 4LLWB 3LKRA 3FB5A 4Y1AA 2MWCA 4W4OA 1NKRA 3WO4B 3DMMB 5HHVL 1JNHB 3T65A 4HC1H 4NKDA 2VAAB 5C09B 4JO4L 3R06B 3QIBA 1P2CB 2Q7YA 4UIKH 3S98A 3I50L 4ZPVA 5CIPB 1MRCL 3TBVB 1S7QB 3HZYA 4K9EH 5SWZE 5I1JL 3MJ6A 4PY7B 3MMEB 1J5OL 4BFBD 4Y4HC 5L88L 5HGAB 1FVCB 1Z0NA 4RQQB 3JV6B 1DANU 4Q6IA 1T1XB 5I1DA 2A0LC 3ULVD 5KG9B 3QXDA 1S7SA 4ONFH 5E99L 3EGSB 4XCNA 1DBKL 3I6GB 1OP5K 1GIGL 1BZ7A 4IDJL 3T0EE 4PD4K 3IJHA 5IMLA 3FQUA 4LK4A 3A6BH 2OL3L 5IMOA 2ESVA 1OGTA 3U7YL 1EJ6A 4OM1H 1MQKL 3MXVH 2YMXL 4PJ7E 1M7IA 2XWBB 3WNNA 4LGRB 3FO2B 4AZ8A 4HKBA 5FAAA 4U3HA 4MVBC 4QXTB 1YYMH 4PJXA 1F6LL 2ADGB 1R6VA 2BJMH 3SE9H 1LDSA 5D1QB 1BHGA 4HK3J 2W60B 5D2NA 1KELH 3AGVA 5F89A 5D4QA 3MACL 1J0HA 4G9FB 3IFPA 4JQIL 4XNYL 1ZVSB 2YUVA 1HH9A 1T83C 3RTQC 3TO2A 1FE8L 4YO0B 4HGKC 2YXFA 1YUHA 1DBAH 4DVBA 1JWSA 1ZHKA 5TQ2H 1U2CA 2W9EH 4Q9QL 2CDFA 1S5IL 5IOPB 5MP6H 2GTZA 3TO4A 4Q0XH 4Y2DA 4CVZB 3BPLC 3GEWB 3KYMA 5C0BD 1IC1A 2BVQB 5I73B 5JPMB 5BV7L 1TTFA 5IVXF 5AG9A 5EBWA 5I1GH 3FRUA 3V5HA 5I19H 4GXVH 4V2BA 4Y16C 4K8RH 3HN3A 3U48A 4M5YL 3X12B 1AKJD 3W9EB 5E4IA 1MHCA 2YPKB 3E6HB 1FFNB 4DCQA 1FL3A 3SPVB 4MNGB 1EH9A 3CMOH 2VLKD 4HLZG 2ICWA 4JO2H 2FL5B 2YK1L 3K8MA 2EYRB 4OF6A 1UT9A 1ED3B 3WN5A 5HD8C 4FQHA 2Y5TA 2NR6C 2XXCB 4BFGA 1E4XL 5JW4R 4PJFA 5D7SH 4TYUA 3FOMA 3V4VH 2XXMB 3MLWL 1OARH 1D5XB 3KPSE 5T1LB 3ARZA 1GAFL 3UTQA 2Y1VA 1BAFL 1V5JA 12E8H 2OP4L 3L5IA 2CR6A 1ZHBB 4MQSB 4K3EH 2DYPD 4WGWB 1ONQB 1F11A 1T1YA 2D4DA 3VD7A 3UJIL 2FR4A 4R8WH 3RDTC 4F15B 4LSUH 3INUL 5HHXH 2EDFA 4TUJB 2W65B 4H1LA 1KB5A 1MY7A 4IM8A 1MFBH 5CZVL 2FIKA 4JFYB 2Q8BH 2ZG1A 5I18H 5DFTA 1TENA 1YMMB 4WI6A 3ES6B 3AS3A 3O3AB 3PWPA 1KBGL 4U3XA 5F96L 5IESH 1I1AA 4TSCH 5CBAA 4RIRA 4JDZB 5ICXB 1P84J 4KROB 3T0AA 3NCMA 2AV7A 4NPYB 5GGRY 3D2UD 4MHHI 2OSLA 4P5KA 3NZ8B 1B0RA 3WHXB 2ZSVA 5L2KD 1P7KA 1FAKT 4QTIH 2BSTA 1MLCB 2QKIA 4L8SA 1GGBL 4ODBD 5E2VL 2ZCHL 2YA2A 3H7BB 4PJHA 3ARQA 4JFEB 2ZUQC 1I1AC 1CXHA 1UWXK 1J05A 1TZIB 5DGRA 4DK3A 3MJ9A 2HMIC 4K9EL 3E8UH 2IAND 4M00A 4OLUL 1FZMB 4TUOB 3KDMA 4RWHA 1T0PB 4NQDE 4OZIB 2X4SA 2I9TB 4PJ7A 3K8KA 4D3CH 1MAML 3FMGH 3HR6A 1QG3A 4WV1C 3F7YA 1KCVL 5F7KC 2ID5A 2IFGA 3OKDB 3THMH 3UTSB 3HMXL 3BESR 3DRTA 3BPNB 4QGTA 2OTWA 4M5ZL 5CFHA 3DVGB 1NLBH 4WO4B 4NQCE 4CADA 4BKLA 1G9NC 4QYOA 1F90L 3C6LC 5FHBL 1KUMA 1H3WM 3MXVL 3KPRD 4Y8AA 1BJMA 1JGUH 2IALB 3P0VL 5DJ2A 4Y2OA 5KVGH 1A3QA 3BP4A 5T33L 3QRGL 4QWWC 3RL2A 4E41B 4CUCA 2XQBH 1RUAH 4OZGE 4I13B 4JZJC 4MQXD 4RFOL 3KPSA 2X05A 2Y06L 4JGJA 1NKOA 1AGFA 1YJDH 5I1EH 3LQZB 4HBQA 5L0QC 3RA7H 5FXCH 3JWOL 1IEBA 4H5SA 1A6PA 2EDDA 5J06A 3PWPD 4PS4L 15C8L 2VN7A 3DTXA 3MLVL 4NDMA 2VABA 1JRHL 3BI9X 5GRZA 3QG7L 1MFAH 1DLHA 2EDTA 5F7DA 3LKOA 2AJVL 4X7TB 4Y2DC 2EZ0D 3QO0B 3O9WB 3U9PL 4OFKA 3QDMD 4U1HB 3UXFA 3DX9A 5DHVB 1TCRA 1JPST 2CK2A 5B4MC 1GC1C 4G3YH 4NC1C 3RZCA 3UJJL 1RUML 2H41A 2E9JA 4J3WA 1MJUH 4HKJB 1T1WB 3E3QC 2IG2H 5CEZL 3GMMA 1AGDB 1I85A 4M4RA 2L0DA 2P8MA 1SJEA 4ETYA 3T1FA 4GG8A 5HYQA 2A0LD 2DJ4A 4LBEB 1PFCA 4F7PB 5I15L 4PTUB 4WW1B 4J3UA 4U4BA 5H94A 5ADPL 5CGMA 5JA8B 4UDUA 3ZKMC 1ZLVH 2FNBA 4PJGB 1ZLWH 3RAJH 3LRSA 5L6YL 4DW2H 3JWDL 3HUJB 3U7AA 1U91B 3O6LL 1XF4A 3LDBC 4UV4L 4YK4B 4NKIH 3PQYE 1A0QH 1ZLVK 2UUDK 3CZFB 1MWAB 5GZND 4NO3A 1K85A 5DXWA 1D5MA 2NY3C 4O51A 4GJTB 5HD8D 3D69B 1JPGB 3U4EB 3KPTA 3PJSA 2BMKB 2HLFD 3IJSB 5IFHL 3O6KL 4LCIL 4RX4D 3NTCH 1IFHH 1BVLA 1FBIL 4L4VD 3T0EC 2IQ9L 1GH7A 2W92A 5FKAB 3IU3A 4YDKH 5IESL 4HD9A 4KI5D 5DD3L 1S7UA 4GMSL 4Y16D 4RMTA 4QHUB 1QSFD 1DEEA 5HHMB 1DUZB 4HFWB 5C0FB 2Q1EA 3SGKA 1J1XL 3MV01 4L3CA 4GRLD 5A43C 2IANA 3P4NA 1NBZB 5E2VH 3CXDL 3P9MB 3KS0H 1H3PH 3CDGA 4RWYL 1W0WB 4TRPL 2PF6A 2GTWB 2N4IA 3HCVA 4TVPL 3MLTA 1W0YT 2WAHA 5IJVB 4QRUA 1ZLSH 1J1OL 3B2UD 3LIZH 1E4KC 2UZXB 3BGMA 1UG9A 4NFBA 5BOPA 4KDVA 1UKSA 4UUJB 3T77A 2JIXD 1BP3B 3QEQE 3QWQB 4ZSOA 2XY2A 4OLVL 4YPJA 2YRZA 2ZSWA 1KF9B 4WIQA 5EU3A 4HQQL 5DZOA 4HXAH 1QACA 3QJFB 2CGRL 3J7HA 3HMXH 4LU5H 2CR3A 2NY1B 4X6EA 3WXWL 1KENH 5EU7E 2JCCE 2JJWA 3GRWL 5JIIA 4GAJH 3DV4B 5TH2A 4MDJB 1R5IA 1QSED 5DC4B 4KY1H 2NYYD 1WBXA 5J0BA 2RB8A 5DUML 4NKQB 2KZ1B 1NL0H 5ACMA 1HHHB 3MOQA 5DD1L 2EC9T 2JJSA 1H15A 2B5IC 2APFA 4HZLB 5BZDB 2ZUSA 1T04A 3P4LA 3MROA 1U8MB 4NP4H 3ULVF 3HRZA 3GRWA 4J3VA 4U6VH 4LVEA 1DP0A 4Z7VA 4PJFF 4RFNB 3VFPA 3S37H 4H8WH 3AAZB 3MJ9L 4ZTOL 3OPZH 1IBGL 3QPXH 3HKFA 3P9WB 5FO7A 3SOBH 5BCAA 4KC3B 4HG4J 3LH2L 4PR5A 2Y07H 4EDWL 2FIRT 1RK0B 2VDMH 4MWFB 3SGJA 3B5TA 3U9PH 2J88H 5AZ2L 2NQCA 4PLJD 2HG5B 4U2YA 5JHLL 2J2ZA 5KSBE 4GXUN 2XKUA 1IGFL 1RZKH 2WUCL 3AY4A 3GMQA 3HB3D 1I8IA 3P9LB 5EOTA 1KGCD 1JHLH 5JHDA 5D8JL 1KIQA 5MEND 5DTFA 1TETH 4TPRH 5ISZD 2IH3A 4J8RA 3WJLC 1JHKH 2Z31B 3TO4D 3ROLB 1JCKA 4KI1A 4XZUB 1BGXH 4M1CD 1JFQH 1NDGB 2BVYA 4C56A 1IL1B 1KT2B 2KH2B 1YNKH 4PJDA 5IG7B 2WP3O 2DWEA 4QY8A 1JL8A 3MBEC 4CVXA 4YFEA 2AXJA 4QRRB 4LLDB 3C5SA 3BZEA 3S88L 1ROWA 5GJTL 5JNYB 3U4AA 3BEWB 3PHSA 3FB6B 2FJGA 3S4SB 4ZFFA 1YN7B 1VGKA 5B39B 1AC0A 3MRDB 3OJMB 5E5RB 4OKVB 3OKMA 3LRHA 3EJYC 3GMLB 3K7UA 5FGCE 3VFTA 1I8KA 1FDLH 4P9HL 3Q6FB 3CFIC 5CBEB 3O45B 1T21B 4YXLH 4K55A 5C9JB 2V2TA 1MJJA 1E4JA 1Q9WB 2C1PA 1D5ZA 3EUUA 5IK3B 2Y4SA 4FQIH 2WLYA 2LQRA 1CXEA 5HVWA 1VSCA 2CKBH 1W2KT 5F70A 5CEYB 3HE7B 2Q8AH 5HHPB 1ZEAH 4LCIH 4Y88A 3G08A 1AGCA 3LSOA 5FYJU 3AU1A 1HHKB 3NTCL 3GMOA 2CO6B 3HE6B 5DUBB 3RVWC 1IAKB 3BH9B 4YWGL 5KSBB 4HJGB 5C07D 1OSPL 3AB0C 3A67L 1LO2L 3MLYL 1CDUA 1TJHL 4FA8A 2F74B 1YEFH 2QQLH 5EO9A 4WWKB 4QRPA 4UAOB 1NGPH 4WHTB 1QFHA 1JN6B 2X7LB 2JCCB 4NQDB 3TH2T 4Z7QE 4KV5E 1NGWA 4KROC 2DDQL 1CWVA 5J6GA 2R56L 4DVRL 4PY8J 4R97B 4KUCD 4NHCL 1SJXA 4JZJB 4PP2A 1N59B 4G5ZL 1UZ8B 4TRPH 1UJTA 2FATH 1JWMB 3UDWC 4P2QD 4UT9H 5DJAA 3VCLB 3KGRA 4BZ1L 3JSSA 1JZ3A 4P2RD 5DHYB 1WZLA 3KLSA 3B8SA 5KS9A 2CLVA 1I7RA 3GSQA 1AQKL 4N8CH 3V4UL 1MLBB 4F7MB 3OWEA 1D5BB 1S3KH 3WS3A 4C57C 3C6SB 5HBBA 4UBDD 3NAAL 4CU8A 2OL3A 3MV8E 2FEEL 4HIXH 3EOTH 1R24B 4OM0H 3BMVA 4P4KD 4PV9A 3QNZB 2D9QB 3K1DA 3SBWA 4BSWB 4N8VA 5EWIL 4YHZL 2VZSA 4RISH 1T4KA 1M71B 3O3BB 4LSDA 3C5JA 3U2SA 2HT4D 1DBJL 4FG6D 3U0PA 3AC0A 5I1JH 2OTPA 4ONHA 1G0YR 2VLRE 3U0WH 3WFDH 4Z5RB 1X5AA 3FFCB 3BP7B 5EO0B 4ZTOH 1IBGH 4GW1B 4L5FL 2G2RB 3DGGB 4HBCL 5DQ9B 4YDLB 3L3DB 2HTKC 3MUGB 2DICA 4OAWA 3UO1H 4P46A 1O7SA 4OV6F 5KVDL 3LV3B 1MQ8A 2I07B 2PETA 5ISZE 3C8DA 3DETD 3MGTB 3MRQB 3L1OH 4LOUD 5DRXB 2J88L 5AZ2H 1YQVH 4KK6D 5GS1A 5L2KA 4UTAH 1IC7H 1Q0YL 2F58L 2R0WH 1U93A 4KI5C 3NIDF 4OFPA 4S2SA 1NSNH 4NQEA 2ZZUT 4R26L 3MRIB 3IFNH 3K2MC 5TFSL 3EYVB 2BJML 3ZDYF 1B0WA 1P69B 3EYFB 3WUWA 5FYKD 3VGAC 4G8IB 4KQ4H 4OLWL 1J0YA 4KMTH 4UQ2A 3ARDB 4UT6H 3J8F7 4FXGA 1P6FA 4Y19D 4EVNB 1BF8A 4G6JH 4E0RB 1IKNC 1WEJL 3MLZH 1BLNA 1YEHL 1CFVL 1U41A 4JJHA 4LARL 2VZUA 4JFOB 4M7KH 4U1GC 2NLJB 2H32B 3RGVD 4F80A 2VXQH 1WJ3A 5CWSB 5AWNH 2R1WB 4HH9A 5E2WH 3VD3A 1MUJB 2GQHA 4NT6A 3WN5C 4AL8L 2GK0B 1SJHB 1NGZB 2X1PA 1IM3A 1VFBA 1I7TA 2XTJC 1FLRH 3B3IA 1QA9B 4GXVL 2R4SL 2J7LA 4ZDHB 1BBJB 3PWVB 2R2HA 2OXGA 2XIDA 5DMIH 4U6XB 1ES0A 5SWZB 1CDIA 4PUBL 2X4RB 3WLWD 4BSJA 5CINH 3TA3D 1HHIA 1FO0A 1FNGB 4ZUUB 3OR6B 5B8CA 2MHAB 3EYQD 5GXBB 2IEPA 2Z35A 1OAUH 1OTTC 4NJAH 2P48B 1UXWA 5HXMA 5DI8B 5LBSL 4KK9C 1WZMA 1UH2A 5DK0B 5JR1L 1G9EA 1Q0XL 4ZXBD 5K93A 3PWNB 4HUVA 4DAGH 1BZ9A 2QADD 5ITBH 4BJLA 1MIEH 1TQBB 1A6WH 3MSPA 4NWUL 2ZUVA 2WZPD 4OGXL 5C0AE 5ISZA 1K8IB 5ID1A 4M6OL 1UB6B 1QVOA 5HYSA 1X5GA 2FATL 3BUYB 2VO5A 3ALXA 4WHDA 3VFMA 2OBGA 1EGJA 2C9AA 5D7IB 3VG0H 2ZCLL 5E5UB 4E42A 4RGOH 3TM6A 5GPRA 1CK0H 3D85D 4EN3C 1HHJB 4NZRL 2JKXA 4ZNCD 4MMZC 5CZKA 5MEOB 4MLSA 4DN4H 2VLRA 3U7YH 3ZE1E 1CDCA 5CS7A 1I9RH 1D6VL 3SKOA 4ZO6A 3VFRA 1BF2A 1J0JA 3L3JA 1DDHB 3NAAH 3O8XD 1OP3H 5ACLA 4U1SA 4Q9RL 3OG6B 4U7SA 1OD9A 1E6OH 1X6LA 3FN3A 3IGAB 1IGMH 4XP5H 3V79C 4NRXA 2G60L 2PXYD 5JOFA 5D7LD 1B0GA 3B6SA 3KPLA 1JGDB 1GGCH 1YY8B 3O6FD 3U1SL 1CICB 4DKFL 4EOWL 5DFVD 3ORJA 1YPZF 1KEMH 4OZGB 4IOFD 2B5IB 4LPCA 4LSRL 4NNXA 2OI9C 1P7HL 5FB8A 2GK2A 1MAMH 3FMGL 2VAAA 4QOKD 5HPMB 5C09A 1J12A 3PP3K 4L5FH 4R0LC 4WI8A 1ZS8A 2AV1A 4HBCH 4P23D 3DX7B 1C16A 3VXMD 5EU5A 5CIPA 2D0FA 3LS5H 3RBSA 3CFEA 3TBVA 1B6UA 1S7QA 1N0XH 5LCVL 4JVUA 1EXUB 2PO6A 3ARBC 4S11A 4EI5D 1NLBL 3GM0A 2FX7L 4YDJB 1EEUA 5E08L 1EBPA 2P5WA 3TZVB 3SHSA 3TBTB 1FZOB 2CKBA 2R0WL 5INCA 5E00B 5A16A 3V5KB 5KSVB 5FGRA 2DJSA 5IHZB 5I1HL 5DJDB 3EGSA 4G6FB 3CMOL 1HQ4A 4XCNB 3I6GA 4R3SA 1JF6A 3QPQC 4Y5XA 3VXSB 1XFPA 5J13B 3MRHB 3QG6A 3HE6C 3SDXE 3IDNB 3D25A 5IMLB 2R69L 1CG9B 1N6UA 3M17B 3L3KA 2VRAA 1ZSDA 4XBPB 3JWOH 4LIQE 2A1WH 3SE3C 4OCMC 3HG1E 1R3LA 5JUEH 3S7GA 2NNAA 1V3MA 4FQLL 4WEBL 3MRNA 5DD6B 4HC1A 2FWOB 5D1QA 4ZNEA 5A3ID 1FYTA 1JUFA 3W81A 3CVHH 1RZGB 3QUMH 3U30B 5I1AB 1CZ8H 2DQHL 4MAUL 1T5WA 5BVPH 2E7BA 1CF8L 1PLGL 3JWNC 2W38A 4NM8H 3IS1X 4GG6E 1DVFA 3BVNB 4BH8A 3SDCD 4TSCL 4FQQA 2CDFB 3MTRA 4Y5YB 3EOAB 3S97C 2LABA 5IOPA 1N64H 3PGCB 3WJJC 4CMMA 4U0RB 1Q1JL 2UY7A 3KYMB 4Y0GA 1CN4A 2BVQA 2LAAA 4OB5H 4IRJC 2J4WL 4IIQB 4ZTPL 3OKKA 4K07A 2JK5B 4X5WB 4OSUH 4XRCB 1UQSB 1RJCA 1NEUA 5JR1H 2IBZY 1Q0XH 1FNAA 2YPKA 3JVGC 3E6HA 4C83A 3DV6A 3KWWA 5FUZL 4HKXB 3O6LH 3QWOB 1AKJA 1U8PA 3TJHD 2IADA 3JWOC 4ZFOB 4NKIL 4PJHE 4Z76A 3D85A 2ICWB 1KCUH 3TT1H 1VFOA 2FECL 4OGXH 3VRJA 3PL6A 4K3DH 2APBA 2VLKA 3CSYB 4KJPC 3HC4L 2OZ4A 4FQHB 3UTTB 1Z9SA 5HY9B 2Q87A 3O4OB 2VH5L 3H2WA 4XGZB 3F5WB 4CU6A 4UB0H 1SYSB 1OGAD 3G5VB 7CGTA 4HS3A 1AHWB 1MF2L 3T3PF 5T1KA 5C0GB 5EZOH 4N0YH 1UVQA 4YGAB 1VKXB 1D5IL 4M6NH 4QRTB 4RGNE 1DQLL 4KPHH 2NY6C 5FHBH 1F11B 1RULL 4PYGA 3L7EA 3PF2A 1MSPA 3K2UH 4JAMA 5JA9A 2Y5EA 1K8DA 3WFHB 2V2WB 3T4AB 2DI7A 5IROA 3BKJH 4BYHA 4PPTA 5HGHA 3AUVA 5KANI 5D93B 5E95B 3KXFB 4RBPH 2VSCA 2MSPA 2P7TB 2BFVH 5GGSA 4GAYB 5J12C 4WFFD 4UU9B 4KKLD 4QXUL 3KLHC 4S1RL 5C0JA 5LAXB 4KK9D 3O41A 3GO1L 1BZQK 4JPWL 5AYUH 4OFDA 4P5KB 2EIEA 5DS8A 3VFOB 2AJVH 4KH2A 2BXZA 2VSDA 1K9TA 1RHFA 2Z92A 5J1SC 3ARGD 4U1LB 1EHNA 5IGXH 5GGVY 2VNCA 1NFIB 1Q38A 4M7JL 3V8OA 4QHNA 1J05B 4JRXD 3L6FA 4C56E 1GRWA 1OTTD 3NPZB 4NM4L 4NBYB 4U3CA 5H35B 3VGBA 5J1AA 4TUOA 3KDMB 5EC2B 1N5YH 5LXGL 3NCJL 3MLUL 4HX1B 2EIZB 3VW3H 1E27A 4P5TB 4FP8L 3F7YB 4JM4H 4WW2C 1T22B 5DD1H 1GXEA 1RY7B 3IYLW 1MI5A 2PYEE 3GHEH 4HXBL 1NPUA 2EDKA 4WO4A 5FOBA 4E5XA 1R3JA 4BELD 2J1KA 3MV8D 4NKOB 4OCYH 4PD4J 3TNMB 3JTTA 25C8H 4QCIA 1MCFA 3QFJA 1FN4A 1FIEA 1HOCA 1SEQH 4GG6A 4BZYA 1F3JA 4UV4H 3T4YB 3UC0H 5KAQF 3RL2B 4IOIA 4E41A 3FB7A 3LH2H 1QRND 2YN3A 1G7LB 1NMBH 43C9B 3MFFA 1NC2B 5M7QA 1AGFB 1XR8B 4PYHA 3ZTJG 1PGRB 3SDDC 3BFOA 1URLA 1KTDA 3UP1A 3L5XH 4OGYL 4WNQA 1AP2B 5MEPB 2EDJA 4Y8DC 5D6CB 1IFHL 1DLHB 2RHEA 4RFEB 3TN0D 3U4BL 1PG7X 3QFDB 3UTTE 3VXRE 1JJUA 5I75B 4S1SL 1T7WA 2W0LA 1ZLUH 1FGVH 2ZJSL 2BSRB 1XF1A 4IRJA 4LHJB 2YUXA 4JRXB 4U1HA 3C2SA 1TQCC 4ZS6D 4YHML 3MJ7B 5IW1B 3QUYB 2XICA 3RWEB 1MFDL 1H3XA 3MNVA 1RZFL 4CBPA 2OR7A 5C0CE 3ILPA 3QZWG 2SEBA 3RI5K 1G6RH 1IAII 3RZWA 4L4TA 1OW0A 3MC0A 3TV3H 4IRZH 5DHXB 3KXFE 1NAMH 4YXLL 1DBML 5L2KE 2OI9B 2YN5A 3D39E 4GKZB 3QUMB 1OAXH 1NDMB 2OQJB 4LPUA 4RAUB 1OTSD 2CKBL 4YXKL 5F7HA 3RX5A 3DHMA 2UWEB 4P2CG 2X6MA 1I1FA 1XF4B 2GIYA 4ELKB 4YFLF 1VFAA 4H25B 3A67H 2ZUWA 3P3YA 1LK3L 2AAVA 1TJHH 2PYEA 2F54E 4HWBH 3MOAL 1Q8MA 1T03H 3LN4B 1FO0H 1NGPL 3S36X 1BJ1J 4PRNB 3DJ9A 5F7WC 2A74B 3U4EA 2WWMD 4QHMA 3DGCR 3TPUA 1RJLB 3UAJD 4JHWL 3NZHL 2GITB 3ARFA 1VEOA 1BVLB 4U6VL 3GI9L 3LEYH 4R96B 3C60A 4IRJD 2H2SC 3MLXH 4PJ5A 3AVEA 5ENWB 2DQIL 4JPWH 5AYUL 1LK2B 4Z9KB 5C0FA 5GGTA 3JWDC 1CFTA 4Z0BL 4JFPA 4N8CL 3P4NB 3BWAB 2DMBA 5D96B 3T0DA 3DROA 3ULUF 1F3DJ 3GSWA 3VH8G 1FAIH 1ZGLP 4ZQKA 3ZSTA 4QRRE 4EUPA 3MRMA 5BOZG 4QTHB 1HXYB 3AFLA 1S9VB 3KJ4C 4AMKH 1C5BL 1JHKL 1Y6KR 5GGVL 3QDMA 3F7QA 2YEZA 1CLOL 1BGXL 3VW3L 4M62L 1OQXA 5EU3B 1ZTXH 1IAOB 1A8JH 1N3NB 4I0PC 3P0GB 3TPKA 1VFMA 4CNIB 4KVCL 1PYWA 2AK4E 4G42A 3PXHA 4J7RA 4LNVA 2B39A 4PRAA 1A6TB 3L5HA 5K9JL 1I3RA 3QULB 5DRNB 1ZT1A 1LNUA 3G9VA 2MCG1 4KWUA 5BW7A 2VXTH 4P4KA 3LOWA 1KLFA 3X13A 5E8EB 2XN9B 1E28B 1RZ8A 2OS7A 1S7XA 5GGRB 2DLIA 4K7PX 1BQHG 5EUOB 4LRNL 2EDBA 3DVNB 4XPBL 2BY2A 3HPJA 1I3GH 4JREB 2IGFH 1YQVL 4WU5B 4F57H 4LSQH 1WBZA 1WICA 1TVBB 2GJ6D 1RK1B 5JPNB 4FFWD 1ZEAL 3GUTB 4XBGA 3LKSB 4OZFA 5FA4B 3BJLA 4P4RB 1ZANL 3ZKND 4JDTL 4G7YL 3TEUA 1MCEA 3KYKL 2FSEA 4LIQH 4OIIL 3TZVD 3QIUC 3MCLL 4IRSB 3IXAA 4L3EB 1U8JB 3WDJA 2BDNH 4FFVC 4FMKA 3Q1SH 3MRKB 4G8GD 3BZFA 1B3JA 3VXMB 3GMQB 5EOTB 1I8IB 1YEDA 5FM8A 5C0ND 1LDPL 3OHXB 4KQ3L 3C09B 2VZVA 2F5BL 4U0RC 2DQUL 4JO3L 5I1CH 3OAZH 3MCKA 2P8LB 3QIUA 4G6AD 5F1NA 3DOSA 5FM5M 5CGYC 2AJUL 1NDGA 2H1PH 3H8NA 4C56B 3T65B 1EHAA 3GM8A 4LF3B 3ZYZA 5EZLB 2AI0L 1PEZA 1LEGA 4IRZL 4QRRA 3KYNA 1F6AB 1KC5L 3QIBB 1X5JA 5GZNC 2FLRT 2R4SH 3CVIH 4NZUH 4XPTH 4XXDA 1MCLA 2A73A 4JFFA 4BQCA 3VFWA 3PL6D 2QR0A 2AJSH 3TBYA 1XEDA 1I8KB 3VGAB 3H3PL 1IGTB 2YWYA 5C8JB 3QXDB 1S7SB 3SDXA 2ENSA 3X11A 4M1GH 1X5KA 1TJIL 5FO8A 4Z7UE 1MJJB 5HHOA 5I8OH 4WCYH 1Q9WA 1WAAA 1LP9B 2C1PB 3ZE2F 1NUGA 5BS0A 5LGKA 3BJ91 4X6CE 4OT1H 1QR4A 5CEYA 5SWQA 2YZ1A 4DAGL 4JHWH 5TDNB 4ODSH 5IVZB 3DUUB 1C5DB 2EXYD 1M7IB 2J8UB 2XWBA 3C60D 1ADQA 4PJIA 4PJ9D 4Q6YA 3V6BR 2CRIA 1DN2A 4QT5B 4ZG1A 4H26A 1NFDF 2KBGA 5MI0C 5EUKB 5I8KH 3UO1L 4WV1B 4WRLA 3RDTB 1P4BH 3MX0A 4LCWD 5LVEA 1T1ZB 5CIPH 4PJXF 1KTKE 1ZA3B 5D7JD 4RZCA 4GRMB 3FN0L 4YHLH 2VLJB 4RRPA 3W0WB 5IB2A 5F9OL 1D7FA 2NTFA 3SDCC 3EYSH 3VXNB 4MA3A 3CNKA 4PGCA 1KSRA 1U2HA 3DI2B 4R26H 4YZFF 1NQBA 5LWYL 5BJTA 3IFOB 1AXTH 3ULVH 2FO1A 2GTZB 1ODAA 4CVZA 3F7PC 5GGSY 2OJEA 3TESA 3RWFB 4WHYH 2VDNH 4ALAH 3RIFK 3RWIB 1XGQA 4BH7B 2AJ3A 1DSFH 1C12A 5IQ9B 1R24A 1XCQA 2YUZA 3G6AA 5BS0D 1MHHA 4HUWB 3PP3H 3Q6GH 3I02A 2X4TB 3T0WA 1RZ7H 2FL5A 3CJJA 3I2CH 4KKBC 3E6FA 2EYRA 2R0LH 2Y7QA 2H9GB 4OCRH 4AL8H 3U0PB 2MKWA 2NXZB 3MBXH 3OZ9L 2DRUA 3VXUB 1K5NB 4EI5A 1CBVL 4QRQA 2VZOA 4PJ8D 2Q3ZA 4PJXE 2NY7H 1C5CH 3TN0A 3TVMA 5ICYA 4Y4FC 5DD5H 3M8OH 4KTYA 5T5FH 1ZA6B 7FABH 3ZT6A 3FFDB 2VLJE 4P46B 3NOIA 2WM0A 5JO5A 4OIIH 5C6TH 4LPTA 1OB1A 3RY5A 3BRFA 3ZYJA 3LKPA 2CD0A 3MRJB 1A9BA 3Q1SL 1S9YA 1BQHB 3RX7A 5IBLD 4IMKA 4MA8H 4UT7H 2AJXH 4NBXB 1WFTA 5L0QB 1F42A 4YXHH 5ITBL 4D0CB 5I1CL 2E6QA 1G7JB 1EAJA 2JLLA 4M6OH 4NOBA 2HVKB 5ESQB 3ZL4L 2ESVD 2APTA 2BSTB 4I18A 3ARDA 4X8JA 2HA1A 4QRSB 4WEUD 2AABL 3B9EA 2N56A 2XT1B 4Z7WB 5IB4B 2KKQA 5C0DB 2V9QA 4UDTB 2LE9A 2ATKA 5J9PB 4OCXH 3IAQA 4NGHH 4NFCA 2B7DT 1OAYH 2ZKHL 5FIEA 5E5MA 1Q1JH 3S5LA 2YZ8A 3C8HA 4N8PA 1IGIH 1P1ZB 4HJ0C 3MGOA 1KBGH 4ODTH 3UTSA 5AAWA 1PD6A 4NQCB 4U1IA 3RIAK 5ANMB 3MNWB 4X4MA 2PW2B 3MUZ1 3IDJB 1A3LL 2IPTL 4OT1L 3CFCL 4XNUH 3IDYC 3IKCB 5DVOA 1JNJA 3U46B 1BIIB 2F5AH 4BKLB 4DQOH 2VWEE 1CU4L 5JW4M 4XCEA 2ZUTA 3X3FL 1CLYH 1FO0B 3BP5A 3U36B 1A2YB 3QEQB 3OKNB 2BRRH 3OAUL 4GUPA 4JQXC 5C0AA 4ZO9A 2MQ0A 5B21A 3PWPE 3E8UL 3KHQA 2DWDA 4AM0A 3LKQB 3W5NA 4XI5C 4FQJH 5DK0A 2CDGA 1FRGH 4JFDB 5C92A 2NY3B 2ZUYA 2L7JA 1UKQA 5FEBA 2Q6WA 4L3EE 1NAMA 5GJSL 4HUMB 4ISVB 3VXRA 4BA8A 1UJ3C 1NCTA 3UJTH 5DURB 3ZT5A 4NDMB 4BFIA 1UCBL 2QV2A 4PJGE 1QVOB 4NUJA 5F9OH 4WWID 1Z0MA 4M5ZH 4M3KB 5EIIB 3EYSL 4JM2F 4OLXH 3I6KA 2A9NL 4X80L 1CD9B 4HS6B 3QXTA 1YN6A 3FQRB 3OKEB 3EO1B 1F90H 5I16A 1ZMYA 5MEOA 4OUUB 1OTUD 2NY3D 1QBML 1X6NA 2FHFA 4OFIA 4ZUWA 5C0EA 3SKOB 2XQBL 3L3JB 1BX2B 4WFGE 3DURB 3QDJB 1DVFD 5JMRA 2VDRH 4DZ8A 5I8CA 2E8ZA 2F8OA 4P23C 1JTTA 2C4FT 3EO9H 3I3BA 3D39A 2LTQC 3V95A 3VFUB 4F7PA 4WW1A 3QG7H 1YY8A 4R90H 4QO1A 4YDVB 1JE6A 1FJ1B 2VZTA 4PRHA 4U7MA 4UV7L 3ULUE 4UDUB 1MRDL 3GZKA 5IBTH 4IMLA 5GZOD 3IFLH 5FDWB 4NNXB 1HI6B 3F12A 3D18B 1HWHB 3HUJA 2NY7L 4OJFH 1KTLA 2DLFH 4YR6A 1EO7A 1ZWIB 4OZHA 4DWHA 4P46C 5HPMA 4FP8H 5JXAL 1F3DH 4OZ4A 2DQTL 3OAYK 1JPFB 1GSMA 3BW9B 1INEH 3M1BA 3CZFA 4ZFGH 3WBDA 1MWAA 1N26A 7FABL 5CAYB 3ZE0F 1HNGA 3CFEB 1KIPB 4KJQC 5HI4C 1M1SA 4UOJA 4O51B 3VG9C 3DO7B 1MVUA 3OAYH 1XH3B 3ALPA 3QUZB 2P5WB 2AEQL 5GGTH 1LE9A 4BZ2H 3LPFA 1A02N 3N06B 4X4YA 4MA8L 2IPKA 3NPSC 3FB8B 2K3TA 5B4MD 3JUYA 1OLZA 5DJDA 4R3SB 5A3IC 2B4CC 3LQAL 3IDNA 1I7ZA 4JFZH 2F53A 4O58H 1T0MB 5HVHC 2EDYA 5EZIH 4MCZB 4X6BB 4F8TA 1JZ6A 4K94C 4X98B 2NY2C 1D9KA 2P8PB 3HC3H 5IJVA 1B4RA 3VE0B 3NH7H 5GS0L 4KPHL 3QQNA 2FWOA 3H3KA 2XKNB 5DMGD 2ZKHH 1UM4L 4WI4A 4KTDL 1CT8B 1MCSA 3W2DL 2OMBA 3NCEB 4DGYL 1P4IH 4NO5A 3RIFF 1JYNA 4S1QL 3CH1A 1XIWD 2YD1A 4KDWA 5CEXA 1N4XH 3WO4C 3BOVA 3I85A 4FQQB 4QXUH 3QISA 3EOAA 2WBJB 4MD0B 3K3QA 2MPAL 5DJ6A 4RMSA 5IQ7L 4GKOA 3W0WE 4J3SA 3WIHH 3KLHD 4M8VA 1T6VN 3H9HB 4M7JH 5F3HA 3LZFL 3VGFA 1FRGL 2ILLA 3OQ3B 4JO1L 4OIBA 4QGYA 1YNLL 5I75C 2Q86A 2IADB 4LSSL 4ZFOA 1N5YL 1AC6A 4HQQH 2Q20A 4PRDB 3WIIL 1EEYB 5FYJD 3S35H 5FO7B 1HQRB 3HNTL 1J1PL 3P11H 4PBXA 3SGEI 4L8CA 5D9SB 1T2JA 5HYJD 1NC4A 3VWKD 2BNQA 5BXFB 2PR4H 2ITCB 4Z7NF 3W0WD 3SQBA 4XGZA 3R1GL 5E6YA 3GHEL 2DN7A 2HG5A 2C26A 2GUOA 4UNUA 5C0GA 4PBVC 5TDOA 4NNYB 4OCWH 1JZ8A 5DTFB 5JLZA 3RWGB 3MLXL 3PHQA 1C7TA 3LKNB 2CIKB 4L1DA 2VDRL 4ODUA 1U3HB 4HWEL 5E9DA 4FFVD 2V2WA 3T4AA 3GMPB 1L7IH 1G7HA 3QAZB 1W0VA 4NQXB 2FX9H 5HGHB 4OTXL 1K6QH 4FTVD 3K46A 2FB4H 4MXWL 4GW4A 5E6IB 4Z78B 4G80A 1S8DA 5B39A 3KPQB 5FGCB 1KCRL 3U0TA 3LN5A 5IVXB 2XYCA 5F1OB 4HIEA 3VDAA 4YZFE 3OKMB 5LJYH 3CFJA 2WNGA 2OTUB 2Z92B 4R4BA 4U1LA 1C1EL 1ORSB 4LSVL 5LGJA 1Y6MR 4X7EC 3LCYA 3VG9B 3TA3C 1BMGA 2QHRL 2XY1A 3X3GH 3TYFB 5FA3B 4CRPA 5J1AB 1IEAA 3EYQC 2NY4B 1PX4A 5EC2A 3FT3A 2WW8A 1Y18A 2AEQH 4HK0B 2EDRA 5CJXA 4WY7H 1QBAA 4M6ML 4P5TA 5I1LA 2RJMA 4MD4B 3BO8A 4Y7MA 8CGTA 5ETUB 3GDBA 4M48H 3EAKA 1N2RA 3PP4H 3V52H 5HVHB 1VERA 1SHMA 5DJ0B 1T5XB 2BCKA 1I3GL 3CU7A 1F6FB 4O58L 5J11C 1R3JB 5J6GB 1PZ5B 2DM2A 2UZIH 2VQTA 4D9LL 5LQBL 3IDXL 2NY2B 1U36A 2YD4A 3CZJA 5IKCA 1MIML 1FDLL 3JTTB 2BNQE 3P30H 3QCVH 4OZIF 1V3JA 4PGEB 3IDMB 3KPRB 1MWAL 1F3JB 2GSGB 1S9WB 2F19L 3RVTC 1CR9H 4D0BB 4W6XB 5D1ZC 2I5YH 2FHBA 1CD1B 5KS9B 4NQSB 3ABZA 3D0VB 4HIJA 1KTDB 3AREB 1OSPH 1AE6L 4S1QH 1NBVH 1F02I 1YY9D 3C6SA 4FFZH 3VRIB 2AGJH 2DQUH 4JO3H 1NBQA 5FHAH 3VFVA 3QEUB 2XPGA 3EHBC 4MAYD 5L7XL 2DTSA 1EFQA 4DKAA 5EUOE 4HAGA 4I3GA 3CK0L 4WWKC 1DQQA 2W0PA 3F58L 1G0XA 4KK5C 1QEWA 4QKXB 5CZXD 1Q72L 2UUDH 3QNZA 5TGBB 4JRXA 4L3AA 4AH2B 5HYJA 4KUZL 1M71A 3O3BA 1W8NA 4ORGA 4EIGB 4XPTL 2PKDA 4P23B 3ZKQD 1HCVA 4LKCA 4CJ1A 1JGEB 1CCZA 2H6PB 2CMRL 1K4DB 3FO9B 5EU6E 2R2EA 2RR3<