4F9PC

Crystal structure of the human btn3a1 ectodomain in complex with the 103.2 single chain antibody
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
243
structure length
220
Chain Sequence
QVQLQQSGAEVVRPGTSVKVSCKASGYAFTSYLIHWIKQRPGQGLEWIGVINPRSGDSHYNEKFKDRTTLTADQSSSTAYMQLSSLTSDDSAVYFCARSDYGAYWGQGTLVTVDIVLTQSPVTLSVTPGDSVSLSCRASQSISNNLHWYRQKSHESPRLLIKYASQSIFGIPSRFSGSGSGTEFTLSINSVETEDFGIYFCQQSNSWPHTFGTGTKLELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Butyrophilin subfamily 3 member A1
publication title The molecular basis for modulation of human V(gamma)9V(delta)2 T cell responses by CD277/Butyrophilin-3 (BTN3A)-specific antibodies
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 220
sequence length 243
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f9pC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f9pC02
4YNYB 3DTXA 3PDGA 3MREB 2YKLH 3QUYD 5HYJD 5DC0A 2HP4A 4PD4J 2I5YL 3SE4A 5B3JE 1HXYB 4R4FL 1CXFA 4N0CC 5L6YL 1WZMA 4FFYH 4GAFB 1MCLA 4XVUC 3MRDA 4M5YL 2FX9H 3HG1A 1JNLH 3D39D 1HQRA 1ZTXH 3IF1A 3CSYB 5T1KB 4ONHB 2HJKA 3PGDB 1OQOA 5GGQL 1UT9A 4FMKA 3W0WB 2ESVE 4GG6F 5EC1B 1KFAL 3O4LA 3RL2B 2FL5A 3RGVB 3HUJF 3TF7C 1ZEAL 2Z93B 4OSUH 5FDYA 3VFWA 4UIMA 3OJDA 4LEXH 4XVJH 3IXTB 2VXTL 4YWGH 4EDXA 5C0FB 1OTTC 4X4XA 2FGWH 2P24A 5IV2A 1DP0A 5JNYA 1PZ5A 4GMTH 3ETBF 3RWJB 5KBNC 4N5ED 4Q0XL 2FSEA 3Q5TA 3UJIH 4CMMA 5AG9A 4MJ4A 5C08E 1MHEB 5FCUH 1EAPA 4YK4C 5DQJB 2BY1A 3FMGL 3DGGA 5JMOC 3MCG1 3MRJB 1U91A 2N56A 1T03H 3WS6A 4WHYH 1ZLSH 4JZNB 3SE3C 3FB7A 1A14H 1G0YR 32C2B 2D31B 3U4BH 3OPZL 3AROA 1YMHA 3KGRA 1P7QB 3SE9H 3MRFB 1EO8L 1I3RA 3DO3A 3L9RA 4YX2H 3B5GA 5AUMA 2K9UA 3WNOA 3LKQA 2LVCA 1FBIL 4M6NH 3X3FH 4Y16C 4PJXB 2ICWJ 2O93L 1ITBB 4BH7B 4OTXL 5DJZB 5LGHL 1MCDA 4LCYA 2ED9A 1EMTL 2PYEE 2VH5H 4JM2F 2ZG1A 1F4HA 4P2QE 1XF2A 3CVHB 4PGZA 4X7SL 3EJJX 3LRSA 3O8XC 5LGJB 5DFVD 4DUXA 5T1MA 4I0KA 3BH8A 5IT2L 1YEKH 3D69B 4P5TA 3GMQA 5E8DH 2B5IB 3GB7B 2J8UB 4LSPL 2KH2B 4XBEH 1RU9L 4MSWB 3P77A 4K9EC 4Y0GA 3I6GA 2VKXA 4IRSA 4KWUA 5CP7A 2CR6A 3UYRL 4H25A 3T4YB 4HWBH 1NDGB 5JDJA 4HJJL 4FFWD 3P30L 3B9AA 2RIKA 3IRZA 1FNAA 4OIBA 4G6AD 3PP4L 4UT7H 4ZXBD 3REWB 3RVWC 2BVTA 2I07B 5EBMA 5F6IB 3FO2A 2HKFL 3GO1H 1MIEH 4XNXH 3VFUB 3ARVA 4RRPG 1AXSA 5F7KC 4IBLT 4QRRB 5F70A 4LLMA 4R2GD 4DZ8B 2DM4A 3L3KB 5KSAC 1MCSA 3B9VA 3EOBA 3U46B 4NRYB 1KIPB 3QNXA 3Q0HA 1DQJA 3X14B 4FQCH 4GUPB 3W9DA 4F7MA 1S7QB 3DETD 4TOYH 2WAHA 2EH7L 3DWTA 2FX8H 4GKSA 1L7IL 5EBLB 5I16B 3B9KA 4RMVA 4XH2B 1FRGH 5GS2H 4CW1B 5C9KA 3ZKQD 2JE8A 5CSZB 1IL1B 1OAQL 3MRPA 4XNMA 3EJYD 4U1HB 5EBWA 4KJYA 5ETUB 4K55A 1JF6A 2V2WA 2FH6A 2NR6D 2ICEB 4NSKB 3A6BH 3KPLA 1YNTA 3VRIB 2RR3A 4OI9A 2ZCKL 3L3IA 1Q9OA 3GMNB 3QQNA 4ONFH 3QDJE 4R4BA 4XTRD 2OI9B 3KXFB 3VFTB 5BS0D 1T1YB 1HH6A 3JWDC 4LLUA 1AO7D 2NX5A 1FZKB 1YQVH 4ZSOB 5IKCA 3TA3A 3ARDC 1L7TL 3I84A 1F6AA 4PJIA 4HT1H 4P3CL 3KYMA 3Q1SL 2EYSA 1HHHB 1IC4L 2FX7H 4FQXC 5ICXA 4C56A 2LQRA 2ZSWA 5I18L 1QLEL 1MCQA 4RMTA 3V5DA 3HNVL 2A6JA 4G9FB 2XOTA 5DJXA 1DBAL 3SE8L 3RVXD 2VTFA 2ZG3A 3F5WB 4HLJA 5DEGB 1FE8L 3MMEA 4P2CG 3QG6A 3GSQB 3BT2L 1P7KA 1LVEA 3QUZD 4C59B 2D7MA 1ZANL 3LPWA 4FQPA 5ACZA 5EN2B 2A74A 3BZFA 4K7FB 1CYGA 1WBXA 5LXGL 4FABL 3DJ9A 1UH4A 1U8QB 2ZCHL 3ARGC 1M05A 3IDUA 4FQLL 1FG2A 4LP4A 3Q6GL 1LE5B 5CIPA 4AIZA 1CIUA 3DRQB 3RWIB 4U6XB 5C08D 5I8CA 1YEEL 4OCLC 3W2DH 4NN6B 4NQED 3L3OA 2J4WL 5GS2D 1PG7H 3FKUS 2IH1A 2BNRD 3F7RA 2BMKB 4MQXD 2VLKE 3O3EB 4ZMAT 4I9WD 1RZIA 3RA7H 2DQFB 2IFFL 2FJFA 3T04D 3IJSB 3HE6D 2BY3A 3V5KB 1RZGA 4LCWB 2R29H 5F7WC 3BO8A 2FATL 4WFEE 1LDPH 4NQXB 3QI9A 4NO0D 4PREA 2HVJA 2O5ZL 4Q9BA 3EDDA 5L2KE 3B9EA 1UCBH 4MNQB 2FO4A 4P59L 5ADPH 1TJHH 3TC9A 1WC7A 4PRDB 2JJSC 2QQQA 5CD3A 3WUWG 3KAAA 1NFDA 2F15A 4KPHL 4HUWB 4L3EE 5TQ2H 3LD8C 2CK2A 4EVNB 5L2JA 2YK1H 4FFZL 4HIJB 3BGFC 2FEEI 4QHKI 4L4VB 1J0YA 2ORBL 1CN4A 1QBBA 4P0DA 1CICB 4K3JL 1S7XB 1FG9C 1KJVB 1AR1C 1NC2D 2XN9E 4KKLD 4MJ5B 2LU7A 4AIXA 3BDBA 2BSTA 4U1JA 1J0KA 3FOMB 2A6KB 1A0QL 3MQIA 4G8FB 4HCRL 3FN0L 1J1PH 1KCLA 4HS3A 3VWJC 4JFQB 1T0NB 4LVOC 4XP1L 2D7PA 1YMMA 2GITB 2OK0H 2AEQL 1RK1B 2CRZA 3N1GC 3QUMH 1TQBC 5KAQG 3PNWB 5F7DB 4RGNB 2PXYB 2A73A 3PQYE 4BELD 1CD8A 4N8VG 4PG9A 3QUKB 5I19L 4AMKL 5HI5C 5F1NA 3FCTB 1N8ZB 3I75A 4BK4A 4JY5H 4UDTB 1OB1A 4WY7H 5TE6H 4OLWL 5HY9B 5J56B 1QFWL 3LS5H 2VLMD 4XCNB 2ITCA 3KPSE 2P43B 3TWCL 4YO0B 1FNFA 1HCFX 2H41A 2V5SA 4JKLA 4NBZB 4ENED 5I66B 4B5EA 1IEBB 1X3DA 3DRTB 3MLTA 4P4KB 4TSAH 2P5EE 1EVUA 4ETQA 2PR4H 1S3KL 4YEFA 1H3PH 2AXGA 4MQ7B 1C7SA 3LZFH 2PTUA 4ZO6A 1QO3A 2VE6A 4P5MB 4IMKC 3S88L 3ROOB 2DQTL 1W72L 4NQDD 4N0YL 5J11B 1N3NB 1XCQA 1DLFH 2FHFA 5C7XH 1HQ4B 5I9QB 2IBZX 2KUTA 3FQUB 4U1NA 1MCHA 5DGRA 2FR4A 2BOBB 2R2CA 4QF1A 4KK9D 2GFBB 3HZKB 4YGVB 1UH3A 2WNGA 1IBGH 3VD4A 5JPMA 3CLFH 1CGYA 4HWEL 4PJBB 2GT9B 3IDXL 4GS7B 2BNUB 3ZKXB 2XFXA 4NQSB 4YQXH 3WFBH 2Y5EA 1BREA 1YPZA 1AI1H 1GC1L 2Q1EA 1XEDA 3CSPA 4XVTL 1BZQK 1CXIA 4O2CA 5J8OA 3Q48A 4N1HB 3OGCA 1SJVA 2Y9RT 4Y4FA 1K85A 1FH5L 3CVIH 1DLHA 3O2VL 2E8ZA 1TJGH 4U7MA 3TO2A 4M1DL 5I1IL 3HAEG 2P5WA 4MJ6A 5IQ9B 3VCLA 4RIRA 1AY1L 3D25B 4MQTB 4X98A 4F15C 1WWAX 1KYOJ 3I3DA 3BAEH 1FNSL 3RIFK 2ARJB 2AK4A 1XH3A 1Y18B 3TH4T 1TTFA 1I9IL 1A6UH 1G7HA 1S9WA 4YDJB 2K1MA 2VLLB 3QQ4A 4RA0C 3FQRA 2DM3A 4RX4D 3BP4B 1SVZA 1QSEB 2H3NA 4P46A 4G6FB 5HHMD 1NMAH 1ES0A 2LTQB 3MV9A 2HT3C 4RZCB 1I7TA 3QXAA 5HHNA 1ZHLB 5GZOD 2EEDA 3ARTA 4GBXC 4X9HA 3RVVD 4P23A 3LKNA 3RKDC 1EDQA 5DRNA 1NMCB 1XIWB 3QFJB 3MRIB 4G6KH 3FO9A 5DJCA 3QNZA 3RWHA 3BEWB 3PWNA 1CLOH 2MHAB 2VDNL 2C1OB 2C3HA 3NGBC 2OJZH 3RDTA 4NFCA 3PWJA 2AI0L 2H2SC 1FO0A 3FQTA 5I1KL 4MYWB 3WEXB 3L5WB 4HFUH 5KANG 3KDMB 4D3CH 2J6EH 1SBSH 1ZGLA 3SKJL 4U49A 3EHBD 4AEHH 3ZHDA 1KCVL 1EEUA 3SDAB 1RZFL 2DLHA 3CFCL 4JKPH 1K2DB 4OFYA 2ZOLB 5HHXL 2YPLA 5F3HA 2X1XR 3D2UB 1IQDB 2R69L 1NBZA 5AZEL 4K3EH 3SKNA 5IB3A 3DX8B 3VFOA 5JW5A 1R3LA 4GXVH 2W0FB 4G43B 1WBZA 1RI8A 2C4FU 1H5BB 5E1AB 3L7FA 5IMKB 1LEGB 4G8GA 1U93A 3C60A 1G7IA 3GIVB 4NQCE 1TTUA 2VDPL 4YFLI 3HZMB 4XPBH 2LABA 3TLRA 1BJ1J 3U9PL 2CDEA 5GS0C 4K23L 5A2IH 2OYPA 5E99H 1BD2B 3WHE0 4BFEA 2DQHH 2EH8L 5C3LD 2B1HL 1JBJA 4ZUVB 4Y5VA 3OKNA 4WRLA 4YDKL 2XXMB 4BUHA 5FGCE 3MBXL 1CDHA 2XWBB 5DD1H 3WD5L 5HBBA 4Z0XA 3HC3L 4NKMB 1E4XL 4Q2ZA 1U8JA 3G5VB 4JQXA 1IJ9A 5DK0A 2MJWA 1WZLA 1URLA 1F3RB 3DV4A 5EU6E 3QEQE 2Y06L 2ADIA 2FO1A 2YUZA 5I1HL 4PJCA 1QFUH 5F3BA 4MAYA 4ZFOL 4X4MA 4NNXA 4JZJC 3GRWH 5D7IE 5E2WH 5TE4H 3S6CA 3C8KB 1KGCD 1VKXA 5CJOL 4YHIA 1JE6A 5T5FL 1JNNL 3MV7B 3WIFB 2WP3T 4GW4B 5ID0B 2BHYA 1AXTL 1TCRB 3HC0A 1BVKA 2Q20A 3CVHH 5MERA 1S7SA 4OCYL 1HSAB 1NUFA 1XR8B 2VLRA 5IB4B 3VRLE 5SWSD 5T1KD 3N1QC 5I15H 2NMSA 3IDJA 5IW1B 2R56L 3W0WD 4M61A 4E41E 4M1GH 4S2SB 2FRGP 3O6KL 4NYLA 1E0OB 1EFQA 3RGVD 3VFRA 1KELL 2WM0A 5L0QC 1MIMH 3BWUC 4CUCA 3KPRA 4OCMC 3MGTA 4PJEA 3PV7A 2K7PA 2VZ3A 2ZKHL 3O2WL 4LPUA 5ISZB 3T0XA 4BUGA 1CXLA 5A3ID 5FECA 5FAAA 5INCB 2C4FT 1ADQA 1BFVH 3MR9B 1IKNA 2MNUA 1F3JA 4O5LH 3SDDB 5JOEA 3VXRA 2JCCB 1MAMH 2AJ3B 1DUYA 4MVBD 1OGAE 4OV6F 5F93C 1FYTE 5I71C 4R7DB 2AQ3A 1LO4L 4OZGF 3QH3B 4WFHD 2DYPA 5F7YC 5CSBA 5BXFA 4OQ1A 1TVBB 3LDBB 5I30H 1V7MH 1G9NH 1YEJH 1FJ1B 1RSFA 5JOFA 1HYSD 5DR5L 4LKCB 3OV6A 1P7QD 1TETL 1QYGH 4HIEB 3S97C 1NSNL 5L9DH 1S7WA 2W65A 2PYFB 2WBJA 1Q9WB 2DQJL 4JRXA 5C0CA 1EEZB 3V0WH 3O3DB 1G7JB 4DUWA 3U0WH 1UKQA 5HGAA 4M3KB 3W5MA 3T0VA 1NAMA 3KNBA 1BLNA 4OLUL 4GW5B 5IESL 2W07A 5I2IA 1KLGA 3AB0C 4H20H 1A8JH 3UDWA 2IANA 4JRYE 3PGCA 4PG2A 5CMAA 3VFVA 1M6OB 4EKXA 5GS1C 4QT5A 3GSOA 2IALA 4TSBH 4H1LB 3MA9L 4G6ML 5TFSL 4XCEB 5DHVB 2BK8A 2IH3A 3P40A 2A9NL 5EIIA 3WO4B 1NGPL 3BWAB 3IDMA 2BSRB 4DTGL 1AQDB 4IRZH 3ULUL 3MX0A 4YH6A 1F4XL 5SWZE 4DZBA 3GSVA 3UYOD 4JB9H 3VI4F 5GGTL 1NAKH 5CJQH 5GJSH 1RZ7H 5IMMA 5IOPA 4ZFFA 4B7LA 1WZ1H 4JFFE 3QAZB 5CWSA 2R1WA 2ITDA 4NT6B 3UYPA 5IHLB 5IG7B 5D2LF 4ZFGL 1DFBL 5CD5D 1D5XA 4ODWB 3MLZL 4PJFF 2FJHA 1X7QB 3BD4A 4Z77B 2XT1B 4ZUTB 3DBXB 5JUEL 3C08H 4QRRD 3B6SA 43C9B 2Z4QB 3V4PH 4UTAL 2QQKH 3UTZA 4X6EB 5E8EA 5FO7B 2R0LL 2X40A 4JN2B 3LOWA 2EE2A 4PJ7F 4FTVB 4WENB 3AREB 1W0YT 3CFIC 4GRWH 4N0UA 1EBAA 5DD3L 4KMTL 3ARYA 4KUZL 2AEPH 3R1GH 3K4ZA 3WFCL 2R8SH 2DBJA 2N7AA 4PJDB 1KC5H 1WQVT 2X2YA 2MMXA 5IVXE 5HD8C 3BPCA 5F9DC 5DYOB 3BOVA 1KTLB 3RUGB 3BDXA 2CGRL 3MLWH 2R0WL 1XFPA 4XWOC 5C0BE 1FVEB 3CU1A 4PRPE 3N9GH 4NKDB 5BQ7B 4AENA 1BBJA 1OM3H 2PO6C 2X10A 4LVHC 5HHOB 1FLRH 3MNWA 1U8LB 2CUIA 4PJAF 3UZQA 1JFQL 5IQ7H 5D96C 5L88H 4F80A 1EX0A 1YECH 1IGML 4YFLF 1WT5C 1SY6A 4B50A 3SDXF 1ONQA 4XRCB 4QRUA 3KXFD 3LY6A 4KH2A 3TT1H 1JPSH 4GSDL 2O61A 4F58H 4YE4L 4XHJD 3CDGB 4M9PA 3MJ7A 4ZFZA 4U6YB 2G5BA 1RUPH 4XWGL 3FO1A 4RMSA 5IHZB 5ADOH 4R0LB 3HRZB 1J18A 1VGEL 2J1KA 4WW1B 3OB8A 4QXUL 2AW2A 4I2XA 3VGBA 1KIRA 3SQOL 1Q0XH 3VXMA 5BRZE 4G9FD 2NY1C 3ARBA 3C2AH 2DL9A 3VDCA 3IJYA 3U83A 1LO0H 1B4JH 5B8CC 2OR9H 2X4UB 4G42A 1Q72L 3VWKD 5KVEH 4E41D 3SGJC 4DFIA 4Z7VB 4HPOL 4YXKL 1CGTA 5HI3C 1UEMA 4GG8A 4M6OH 4OZIF 1MELA 4A2MA 1NANH 4WTZA 3S37L 1CT8B 3ZSSA 4XCFL 4MQSB 4Y5YA 4J3TA 3N50A 3PWUA 1KEGL 4GAYA 2P4AB 1KJMB 4R3SA 4JFEA 1HZHL 1MSPA 2IBBA 5EWIL 5C3TA 4RQQB 3S5LB 1F5WA 2BSSA 12E8L 1A6TB 1DJSA 5EOTB 3QULB 5CZXD 3QCVL 3D3VB 2OXGA 5IVZA 3BSZH 4UQ2A 5IF0B 2MOVA 3MBEB 1AGBA 3UJJL 4LCWD 5E24E 1NGZA 4FQ2H 4LVNC 1RJZA 1MLBA 2HT2D 3QDGA 2EO9A 4W70A 4PRHA 4NJ9H 4LLQB 1IGJB 4MNQD 4EN3B 5LQBL 4E42B 5TDPA 4RAUA 2DF3A 4LOUD 3L7EA 1B9ZA 1L9NA 2DDQH 1DZBA 1DUZA 5I1AB 3BQUB 3SEPA 5T1LB 5GRVK 4LU5L 3BZEA 3VXUD 4NFBA 5DFVC 1CGVA 1HHKA 5B38G 3RIAK 1FO0L 1KCKA 3MRHB 3OKMA 5SWQA 4L4VD 1U3HC 1CICD 2P46B 1FNLA 1NC4B 1A7NL 1WITA 5E08L 4I0PA 2APVA 3SCMB 5CCKL 5KTEH 4OLZH 5L7XH 4LASL 1GJIA 3V4VL 5C07B 1J1OH 5E9DE 2ZSVB 4FRWA 2EYTB 4F7EA 3T2QA 1J5OL 3BH9B 4XVSH 1K4CB 3BKCL 5FYJL 3LEVH 4I3RL 1F4YH 1CGSL 2X1OA 2HLFC 4RGND 2PXYD 1YZZA 1JN6B 2HJFA 5C0DA 2AV7B 2V17L 1T89A 1H3UA 3HR5A 5EU5A 1Z3GL 2AAVA 4NNPL 4YHZH 3H7LA 4I0CC 1I8KA 2QHLA 1BF2A 2VC2L 4L9DA 4MNGB 1W72B 5TPWL 4HXAH 4MXVE 1FN4B 4RNRB 1JMZA 5A1AA 1RV6X 3ZZ1A 1YY8A 3X13A 4HAFA 5IB5B 3NAAH 1QTYT 5C0AA 2EXYC 5KSBB 1JCKA 1TCMA 4OD1H 1KCRH 4PJ5E 4UB0H 2Y07H 1MRDH 3OX8B 3CMOL 4IDJL 5LAXA 4UOW0 5DJDA 3BN3B 4P4KD 3HI6H 1ZMYA 2ZPKH 3RY6A 4MD4B 1I3VA 4KK8C 3DTXB 1UWGL 3P4OA 3T09A 2AERT 3G5YB 1GGIH 5EA0L 5T5NG 3V52L 4JY6B 4QXGH 1IGFL 4AG4H 2NZIA 4XGZB 1VPOL 1A7QH 4S1RL 2UWEA 3IF1B 5EZIH 4LARL 3IAGC 2ZUUA 2HJKB 4IJ3B 4P9ML 1B2WH 3DUSA 4Z5RA 1JGUL 3MLVL 4PJGB 1GGCH 2ADFL 2Y6SD 3VFWB 3FT2A 1MY5A 4UIMB 3L95A 4QRPA 5E2TL 4I18C 5J06A 3GI9L 1V3MA 1DSFL 3QUYA 4YBQD 4EDXB 1KNOA 3F7YB 4OCXL 3DX6A 3NZ8B 5IV2B 1RZJL 1PZ5B 4XMPL 2XZQL 1OQXA 2FSEB 1A64A 2OLDA 4CMMB 3C5JA 3I2CH 4JR9H 1EAPB 1UB6A 1MF2L 2X9WA 3QO1A 4GRLC 5DS8A 4DAGL 1RUMH 2VXQL 3VGDA 3DGGB 3GM8A 2ZUYA 4XAWL 3MV11 1U91B 3O3UN 4HH9A 3WHXA 3FB7B 3RNQB 1Q1JL 15C8H 1QSED 5IJVA 4BZ2L 5FXCH 1OSPL 1B90A 4D9QE 1ADQL 4AH2B 1YMHB 4G6FD 4LIQH 4KI1A 2VABA 2BFVH 4X6CA 3VW3L 1BVLB 4XPHH 2XTJB 4FXGA 3O4OB 1I3RB 3L9RB 1ZKAA 4UMGA 2ARJQ 2AGJL 2XY1A 3RAJL 3IU4L 1VEPA 4P5KA 5IROC 3C09C 1IC7L 1XIWD 1RUKL 1A9EA 3CPLA 4JG0L 2AV1A 2C1PB 4POZC 3GJFB 1WUNT 2I5YH 4R4FH 5DTFA 4APQC 5L6YH 4LCYB 4FG6C 1KEML 4M5YH 5T3XE 3IDIA 4M5ZL 4HKZA 2E8YA 4FXKA 1XF2B 3ZDYE 2APBA 3T0BA 4IM8A 5HDBF 1LO3L 2GJ6E 1QA9A 3ZE0F 3HR6A 5GGQH 5EUKA 5T1MB 5I73C 1Q9KA 2XZZA 4P5TB 4RGOL 3WN5A 3LQMA 1EGJA 1T3FA 1KFAH 3GMQB 2FECL 1SYVB 3F58L 4DQOL 3LN5B 4IRJA 3O3AB 1ZEAH 4MCYB 1R3IL 1I7UA 3SDAD 4AY0A 2J8OA 4ZPVA 3P77B 5SX4I 3I6GB 5BZWA 2EDBA 3RIAF 5D7KD 4IRSB 2VXTH 5C09E 4NHUA 3UAJC 4H25B 2GK2A 3D2UD 4WO4C 5KN5A 2Y5TA 1HWGB 1UM4L 5H2BA 1KJ2A 4Q0XH 3IJHB 2HRPL 4OKVA 3SJVB 3MZGB 4OJFH 3MRNA 5EBMB 4PFEA 4JAMA 4CDHA 1UJ3A 1N4XL 1CQYA 3GMMA 4Y4KC 2GAZA 4XT1C 4KJQC 4NOFA 3RP1A 1A7BA 1LK2A 3MJ9A 3G6JE 5F7LB 2FZ3B 3OPZH 1RMFL 3ABZA 5HGHA 4WI9A 4YHLL 4XNYL 3LKSA 3QNXB 4Z18A 1DQQB 1DQJB 4DWHA 1KTDA 5M7QA 1J0HA 1KIUA 3OKKA 4F7MB 1MI5A 4PRNA 5DD0H 3O45A 4LNRA 4GKSB 1FBIH 2OP4L 5CGYD 2Q3ZA 1E6OL 4GOSA 4OTXH 4IS6A 3B9KB 2R2EA 5LGHH 4L5FL 1QNZL 2CDGA 1EMTH 4FN0A 5J4MA 3ARWA 1UGNA 4BQ6A 3SGDH 4EIZC 5M94B 4OD3L 4X7SH 5EBWB 1XF5B 4F9PC 3SGEI 2V2WB 4DKFL 2AJUL 5IT2H 1MWAA 2GIYA 1BFTA 3KPLB 1YNTB 4UDUA 1JYNA 4LSPH 4EXKA 1Q9OB 1RU9H 4IIQB 3QA3B 4FQQA 1DQMH 3OAYH 4R4BB 3WL9A 4X5WA 3BKMH 3MV7D 1NGWA 1CBVL 3TIDA 3BMWA 1AC6A 3UYRH 4OLVL 2P8LA 2GTZA 4MS8D 1HH6B 4OLXL 5IFAL 4S0TD 4U7KA 3OKLB 1EZVX 4HJJH 5ECJE 3P30H 3TA3B 1F6AB 3MCLL 4PJIB 3P73A 4RFEA 5DHVH 3PP4H 3KYMB 4Z7WE 5D2LA 2I25N 3X17A 1QFHA 5ICXB 3VXOA 4C56B 2HKFH 2B20A 2VIRA 2A6JB 2OZ4L 3O81A 4PJFA 1A3LL 5DJXB 4XXCA 3AUVA 3C5SA 3GJEB 3T0EC 1A1OA 5HYEA 3MLYH 1SY6L 5E5RB 4ZAKC 3T0EE 4XBGA 4NC0B 4PJXF 4U33A 4KMLB 5B38A 5ISZD 5D8JL 2Z9TA 3QG6B 4FA8A 1HE7A 1X5KA 2WANA 4UBDD 1P7KB 5BS0A 2YUXA 2YPVL 5FUCC 1IAKB 3CCHA 5FUCE 4WIQA 2A74B 3BZFB 1WBXB 5DEZA 1UZ8A 4CN6A 1DE4B 1U8MA 3S34L 2EH7H 2YOCA 1L7IH 2J8UF 5CIPB 4AIZB 2NY2C 1FGVL 5D2NC 3MOAL 4Y2OA 4LF3A 2B0SL 5I8CB 5D2NE 2RJMA 5KS9E 1M7DB 2IH1B 1OAQH 1W0WA 5T3ZL 4OIIH 1RZIB 3TESA 2R1XA 2FJFB 4A6YA 4Y8AA 2KL6A 4DCQA 4PJAA 4D9QD 2ZCKH 1RZGB 3VG9C 1ERNA 4HJGA 1X5GA 2HT4C 4E9LA 3QI9B 4LHUG 1UVQA 2HVJB 2W0LA 1F02I 2XZCL 1MJJA 3SDXA 3FN3A 1XCTB 1A2YA 4NUJA 3IVKA 2QQLL 2D4FA 5C08A 5F9WB 5B3NA 4L8CA 2FO4B 1HIML 4MNHB 1L7TH 1NUDA 2JK5A 3ZYIA 4P3CH 1T5WB 2CUMA 4LSTL 3Q1SH 1FP5A 3CZFA 1IC4H 5F7EL 3WIHA 4QXWA 5CD3B 2EXWD 1QLEH 4MDJA 4OGYL 4XBPB 5CBEB 1NFDB 1TVDA 1P4LA 1W2KT 2YD3A 1OARL 5C92A 1JIBA 1PVHA 1GZQB 1DBAH 3SE8H 1RAMA 2GJ6D 5D1ZB 2JB5L 4FMFA 1J87A 3UTSE 5L2JB 1FE8H 4DN4L 1CK0L 1X44A 2EC9U 4NO0A 5DZOA 3BT2H 5D72L 5T1DL 3TZVC 5IIEB 1GVIA 1G7MA 3JV6B 4NKOA 4H8WL 1ZANH 1PKQE 4L8DA 4RMUA 2YRPA 2BSTB 4Z7UE 4U1JB 3REVA 4XNQB 1MFAL 5LXGH 4FABH 1L0YA 4JJ5A 3QUXC 2W9DL 2ZCHH 4FQLH 3L5IA 4JGUA 4P2YA 4Y16A 4HS3B 3Q6GH 3JV5A 2F53B 4X9FA 4JZOB 1YMMB 3TCXA 1X4YA 1YEEH 5BMFH 2J4WH 1B0WA 4OZHE 2Z31B 4KK5C 1GGYA 3U4EA 3O8XA 4FTVD 3SQBA 2JKXA 4RDQF 4QCIB 5F1NB 2IFFH 4M93C 3I75B 1NC2A 3A0OA 3V8OA 5IW3A 5FA3A 5F7FA 3CNKA 4JREC 1L9MA 4LFHG 4H26B 3MFFA 2FATH 2ITCB 2XZAH 3T0AA 2O5ZH 4PD4K 1KPUA 4PRIE 1YYLL 3QFDA 1ZVYA 3QPQD 3MLTB 3U0PA 1UJTA 3MRRB 1AGEA 2GJZA 3BP7B 1H8OA 4P59H 1G9ML 5B4MC 2BNQE 4WUUE 4HWZB 1QG3A 2B39A 2A1WL 4HX1A 3VFNB 2VE6B 5HHOD 4LEOB 4OCNC 2NPLX 5KZCB 3KG5A 4KPHH 3S37X 2ICWI 3NIFF 4U1NB 2IFGA 4QF1B 5IM7A 1JGVL 3UZVB 3UCRA 2ORBH 4MJIE 5JPMB 1IZKA 4K3JH 4F7CA 4EOWL 3HZVA 1TMCB 4HWUA 2XFXB 1EVTC 1UQSA 3VXSE 1YPZB 3WJLA 2EC9T 1A0QH 2QSVA 2P49B 3FN0H 2DKUA 4J4PC 1I1CA 2LV4A 4ZNEE 4JEGB 3OGCB 4XP1H 4Y4FB 4D9LL 4QHUA 3WFEL 1DLHB 5HGBA 2AEQH 4I3SL 1A6ZA 1T2QL 2P5WB 1FIGL 4MJ6B 3ZL4L 6FABL 4KHXL 4MLIA 1T0MB 4RIRB 3U9UA 5I19H 3AS3A 3FQWA 4X98B 3AS1A 4AMKH 2ENSA 1XGQA 2XG4A 2BVPA 2E27L 1FZMA 2AK4B 4LSUL 4Q74A 1XH3B 3QDJA 4G7YL 4Q6IA 5KSVA 2GTWA 3OBAA 2NNAA 4U1SA 2IAMD 1CIDA 1S9WB 2ZNWA 1AGFA 3DHJA 5F96L 5C6PB 3QQ4B 3FQRB 3TWCH 1VACA 3INUL 4BZ1L 1JJUA 4RCAA 2EEAA 3N85L 2VMFA 4L4TE 4P46B 1OAZL 3MV9B 2LFGA 4V2BA 4NP4L 2XQYK 1I7TB 3QXAB 5HHNB 3EBAA 4MD5A 4YUEL 1UG9A 5TF1L 4FQXA 4Z7NF 1S3KH 3PIQA 4P23B 3LKNB 4JQVC 1RHFA 4M6AA 1WVZA 5DRNB 3D3VD 3VFSA 1HXMB 4MDIA 2X44D 1OY3B 4PP1D 3MBED 4K7PL 3S88H 1W72H 1BJ1H 1PGRB 3FO9B 4KRMB 4N0YH 5DJCB 2BJML 2NY6B 3QNZB 5EO1A 4LKXA 2IWGA 3ZLQC 1FGNL 3MUY1 3PWNB 2UV3A 1NJ9A 3X11A 1GZPA 2FEEL 1U8KA 4QOKB 1YC7A 5JHLL 1AHWB 2E6JA 3RDTB 4RX4A 3PWJB 4HWEH 1FO0B 2N4IA 3IDXH 4HLZG 1UADC 5I1GL 4EN3D 4M7ZC 5D1XC 4RA3A 4HDIA 2VN4A 4HBQA 1GC1H 5JR1L 4K07A 4HF5L 2DI9A 3DUHA 2F54D 3JVGC 3BQUD 4FFVD 2YPLB 1FH5H 1R6VA 1FCGA 5HPMA 4N1CA 5F3HB 4NCC2 5FGBA 4M1DH 5I1IH 5DSCA 5EUOE 3LIZL 3P9MA 3QIUC 1NBZB 3QQ3A 3D87B 5I6XB 2VAAB 4EQ2A 1CGWA 3QP3A 5JW5B 1NC4D 3VFOB 5IHUL 1R3LB 1EGJL 5DD6A 5IVXF 3DVNB 4DGVL 2UVFA 1FNSH 1WBZB 5FV1L 1J12A 3H9SB 5C07D 4ZTOL 4KZDL 2AEIT 4O2FB 5D6CB 4YFEA 3L7FB 1I9IH 2M26A 2E7CA 4G8GB 1U93B 3C60B 1G7IB 5L2KA 4PTTA 1J8HE 3ES6A 2VXUL 1M4KA 1QD0A 5CD5C 5F6IC 1KJ2L 4HMCA 4LLYA 3EOYG 3RPIA 1EHLL 1W0VA 4Y19D 1EUTA 4PJBF 2G60L 1ZTXL 3FONA 1X5IA 4Z0XB 5CGMA 3TNMA 4Q2ZB 2XACC 3PP3H 3VA6A 3CFEA 4OCRL 4WW2B 2VDNH 5E6ZA 2EZ0C 4OFKA 1G9NC 3TBYA 3MUZ1 1J0JA 5FK9B 3DV4B 1RQ5A 4HJ0D 3QIBB 3VE0A 2ADIB 1K6QL 2AI0H 1MCCA 1K5NA 5I1KH 4PJCB 5F3BB 2FGWL 4XP6L 5FB8A 3IDYB 4J2XA 1DBBL 3D0VA 2AJSL 1A1MA 5HYFA 1KCVH 4LHUA 1RZFH 3GZKA 3H9ZA 4J3XA 3CFCH 3C6LB 5HHXH 5D71L 4K71B 1KXTB 3O2DA 3HC0B 1BVKB 2QQNL 3PQYA 1ZLUH 2R69H 1D5BA 1S7SB 2VLRB 4TSCL 3IDNA 5FO9A 1WWWX 1IGIL 3IDJB 1ZAGA 3S35L 1NMBL 1MWAL 4JDVB 3WUWB 4M61B 4WV1B 4LVEA 3DARA 4X4YA 2X4QA 4NYLB 4PY8J 2OI9C 3VFRB 4YX2L 3OWEA 5DFTA 3DXAB 4KROB 3MODL 4Y5XC 1UXSA 3KPRB 4YNYA 2H45A 4PJEB 2VDPH 3MGTB 3MREA 3TO4B 4ZSOE 3X3FL 3U9PH 2P5EA 4GKZB 4K23H 3ILQD 2W9LA 2EEBA 4OGZA 1RK0B 4N8CL 4XPAH 2EH8H 1F3JB 2B1HH 2QSCL 3VXRB 1MRCL 1D5ZA 3WHE1 2DI7A 4YDKH 1VGKB 5SWSA 3MBXH 3RWCA 3WD5H 1LEKA 3HC3H 3TYFB 3W0WA 2UUDK 1E4XH 1F3DJ 3WJJC 3RL2A 5DMKB 5E8DL 4LMQI 1ZVHA 4K8RC 5BXFB 4JFZL 1U6AL 4AT6A 4PJHE 3PWVB 4F9LC 4R9HA 2Y06H 4GRWE 3UP1A 1KULA 3S9DB 4N8VB 2C26A 5E2VL 4KTEL 5I1HH 2W65B 2XTJD 1MCKA 4KRNA 2WBJB 3D5OF 1DL7H 3RFZC 1JI1A 4JRXB 3FTGA 5C0CB 4Z7OE 3FZUC 1F97A 2I24N 4RAVA 3GK8L 1A5FH 5HGAB 4GMSL 4IMLA 2WZPD 4YXHH 3O0RL 1MHEA 1NAMB 3KNBB 5CJOH 1BLNB 5T5FH 1JNNH 3BZ4A 3GO1L 2CKNA 5I2IB 4U0QB 1KLGB 1NBVL 2IANB 4UI2A 3MRJA 1AXTH 4RMRA 2W59A 5CMAB 3LKPB 3VFVB 4OCYH 1TDQA 4R97C 1S78D 1F42A 1M7IB 4ODSH 3GSOB 4I3GA 2IALB 2D31A 3VFGL 3GSNA 3ZHLA 2P8PA 1P4BL 4KTDL 2IH3B 1ZS8A 1V3KA 1CLZL 3IDMB 2DM2A 4DEPB 2XKSA 2YD5A 4N0RA 2MSPA 3MC0A 1CF8L 4DZBB 1YEDA 4IRSD 2ZKHH 3O2WH 1JHKL 3QHZL 1U95B 5JLZA 4LOUC 4BH7A 5I74C 2QADB 4ZO7A 5IMMB 5IOPB 4JG1L 2W60A 5CWSB 2R1WB 2ITDB 3MRKB 5CJBA 4P3WA 3GMPA 5K9KB 3SJVD 3ZKMD 4HK0A 3K8MA 4MXVF 2FJHB 3DYOA 2P47B 4JDTL 4CL7A 2ZOKB 4MXQD 1LO4H 2VSCA 4KDTC 3UTZB 5ESAA 2IBGA 2DMKA 1KB5A 4MSWA 2VR9A 1EBPA 5DR5H 25C8L 5JXEC 1TETH 1NSNH 1MJ8L 1EUUA 2ERJB 3T4YA 3PABA 2DQJH 3H3BC 1MCEA 5FYLE 3TVMA 1CLCA 3H9YA 4OLUH 2I07A 3BPCB 2BZDA 1F6FB 2CXKA 2E9IA 2H2PC 1UKTA 5BO1L 1L6XA 3KS0H 4QRRA 1IARB 4PYHA 3N1PC 4KJWD 3K80A 1VA9A 4DZ8A 3FFCD 2C4XA 4AENB 3MA9H 1BBJB 5TFSH 3U46A 3MNWB 2A9NH 4HMEA 1NGPH 2YD7A 3BPOB 4DN3L 5HYQB 3X14A 4DTGH 5IMLB 1PW3A 3ULUH 3BW9A 1F4XH 1FQ9C 4WFFE 2NXZC 4DGYL 4M03A 1TQCC 3RU8H 1ONQB 5EOQL 1GOHA 3MJ8A 4WCYL 5BV7L 5EBLA 1T7ZA 2EE3A 1X5YA 4XHQA 5I16A 3MJ7B 3TPUA 2VRAA 4CW1A 4ZODA 4ZFZB 2ZUQB 4ZOEA 1JRHI 2G5BB 2ZUWA 5CSZA 1DFBH 4KGJA 1I9RL 3E8UH 4C56D 3M07A 5F7NC 3MLZH 3RA7L 1KIRB 3H6JA 5JUEH 3ARBB 2OR8A 2XNAB 4HC1L 3VRIA 4OZFA 3IJYB 5D7JB 3ZKXC 3LB6D 4P2RD 2R0LH 5IFHL 1LDPL 3D9AL 5H94B 2QKIA 2DMBA 2XQYG 1GRWA 5D7IA 3MXVL 1NCBH 4GG8B 1UCBL 1QQDA 4KMTH 1FZKA 5FYKE 4KUZH 2DIBA 4Y5YB 3WFCH 5K9QG 3T1WA 3PWUB 1TENA 4F8TA 4JVWA 4GAYB 5A16A 4G9FA 4JFEB 3VH8G 3CFKB 1BAFL 2O5XL 3P4NA 1OTUC 1DQDH 1DQTA 2BSSB 2CGRH 2XV6B 2AXHA 1JTTA 2R0WH 5DEGA 1MCOL 3VWKA 3AMLA 4E41A 2WV3A 1ZGLP 2GYSA 4KI5D 4LDLB 1CU4L 4JRWA 5IVZB 3BE1L 1HKFA 3RWFB 3HI1B 1A22B 4MAUL 4J7RA 1JFQH 1E4JA 2G9HB 4WWKC 4CMHB 6CGTA 4L9LA 1IGMH 3EKCA 1D9KB 1NGZB 2VDLL 1SMOA 3K4AA 1ZA3A 3QI9D 1RJZB 3B2VL 3MA7B 5ID1A 1MLBB 4GSDH 4WDIA 4YE4H 4AL8L 3QDGB 3D18B 1IC5L 2YC1B 4PRHB 3RWIA 3JZ7A 2K7QA 5IR1B 2H8PB 2NY7L 3U30B 1FYTA 4XWGH 5TDPB 4G6JL 5DGQA 5BOZG 1FNEB 1VGEH 1PG7W 4QXUH 4YJZL 4LSDA 4WHYG 2UZXB 1Y0LB 3OAZH 3SQOH 4WJ5B 2QV2A 3IJSA 4QTIL 5C0JA 3BZEB 4PJDF 4EUPA 5D1ZD 3VD9A 1I8LC 4JFDE 1FYHB 3J8F7 4LCWA 3TN0C 2HMIC 1B0GA 4D0CA 1Q72H 4O9HL 1N0XL 4GFTB 5A2JH 3OKMB 5SWQB 4HPOH 2Q7NA 2V5TA 3GBML 1D6VL 4I0PB 3VI3E 4WWID 2Z0BA 5IWLC 3S37H 4ZD3L 5GZNC 5K59F 3OJ2C 5E1HB 1AD0B 1CGUA 2J8HA 4UINL 4F7EB 2YR3A 4L1HA 4JRYA 3FL7A 4U6VL 1KEGH 2L4OA 3IFOB 2F53D 2R0ZL 3ZKNC 4MA1C 1U58B 1YMMD 1HZHH 2CLVA 5EWIH 2BERA 5GS1A 1WFUA 5EU7C 12E8H 1L4IA 3VXUA 2Z31D 5EU7E 2HJFB 2HKHL 5C0DB 4HIJA 1EEYA 1WLHA 4L4VA 3QCVH 5EU5B 1CICA 1S7XA 5J1SC 1JMXA 4J3VA 3QR2A 1FZOA 4ELME 1SJHA 3HI5L 2FLBT 3UJJH 2D0FA 4YPGB 3X13B 1EERB 5DJYA 5C0AB 3LRGA 3V0VA 1AP2B 1UM5L 3OZ9L 4JFFA 4JFQA 5LAXB 1MFNA 5DJDB 2GITA 3BKYH 1TJGL 4TRPL 5LQBH 3I6LE 3KYKL 4Z7VF 5F7DA 2PXYA 2DBLL 2PW2B 4X7EC 1R3KA 5DXWA 5E56A 2O5YL 3CDFA 3FCTA 4TQEL 3MRBA 4M4PA 2CDFA 4LU5H 4EBQL 3T08A 5HY9A 1YY9D 1VEOA 3PWPB 3L6FB 4AZ8A 4GKOA 4KXZI 2VZTA 4XCNA 4UZGA 1FO0H 2UWEB 4UAOB 1RHHA 1EFXA 1WBYB 3O9WD 2ATPB 5I66A 1LP9B 2K3TA 1A7NH 1NMAL 3OG4B 1X4XA 3UBXG 5E08H 4Z5RB 4P4KA 4LASH 2XTLA 3V4VH 4GLRI 5C8JA 5IVXA 5IEHA 2X7LA 4JPIB 5GRVL 4HIXH 1KIQB 3LEYL 5JIIA 4OZ4A 3WO3B 3O2DL 1R24A 1J5OH 4P5MA 1T4KB 4K7PX 4KKAD 4KQ4L 4Y4FD 3BKCH 1VFMA 3DUUA 2WUCL 3OJMB 1MCJA 5GSRB 5MENE 5C0BA 4I3RH 1KNOB 4PRPA 3GJFK 2P5WD 1HQ4A 1CGSH 2KDGA 1J88A 2GFBA 3DI3B 1T7XA 4YGVA 1WJ3A 5I76A 2V17H 2DQEL 3C5JB 4YZFF 3S98A 4PJBA 3QO1B 3NCEB 1A47A 5DS8B 2GT9A 1Z3GH 3IAPA 5DUBA 4NNPH 2AQ2A 4GAGL 1QSVA 4D3CL 1AGDA 2AK4D 1BIIB 4WI8A 4NQSA 1I1AB 1HH9A 1MEXL 2VC2H 4M7KH 5TPWH 4UUJB 4JO3L 1KN4L 1UWXK 3WHXB 3IU3A 2Z8WC 3SDDC 5IJVB 1O7VA 1GCFA 3NTCL 5FHBL 3CMOH 5EPMB 1IAOA 3BJLA 3MV9D 4X6CB 4Y4HB 1BWWA 5E2JA 4OGXL 1WWBX 4X7TA 4UOW1 5I17A 1HCVA 4OCWL 4P23D 4TVSa 5BRZA 3T2OA 2X89A 3D25A 4ORGB 1CFBA 1F45A 1PD6A 1A9EB 3CPLB 1X9QA 3LS4H 4JHWL 1UWGH 2NY6D 4GW1B 2VOTA 4M1CC 5F9AC 5EA0H 5DTFB 4Z7QE 3Q5YA 3V52H 1IGFH 2DQGL 4QOKD 3SGJA 1VPOH 1GH7A 3IDIB 3WUZA 4HKZB 3RDTD 2W0PA 3KPPB 3WCYA 4S1RH 3TBTB 5DO2D 3RY5A 4LARH 1QSEA 4P9MH 1QA9B 5GGSY 5EUKB 5D5MB 3MRLA 2MFNA 1Q9KB 1JGUH 3MLVH 2QJDA 4X6BA 1LDSA 4KDVA 4IRJB 2W38A 4TNVK 1I7UB 2AQ1A 1XIWA 2CMRL 4K94L 5E2TH 5GGRB 3MRIA 5BZWB 1F90L 2VLJE 3GI9H 5AD0B 1DSFH 5BJTA 3RTQB 4NHUB 5D70L 3WSQL 4M00A 4OCXH 5KN5B 5KSBF 3RVTC 2Y5TB 1RZJH 4KRPB 3BKJL 4N5UA 4XMPH 4DJMA 5H8DA 2XZQH 5H2BB 1KJ2B 1ZLWK 3CDYA 2APFA 1MF2H 3MRNB 3CMGA 1I1YA 3B2UC 3FB6B 4DAGH 1QFUL 2VXQH 3WEXA 2EDXA 3H9SD 3KDMA 4XAWH 4CADB 3WE6B 3K2UL 2ICWA 4LRNL 3C60D 1VADA 3QAZC 1LK2B 4XAKD 3EO9H 3HB3C 1Q1JH 4BZ2H 5CINL 1ADQH 5DHXB 1NLDL 3PJSA 1BQHG 3VW3H 3LKSB 4P2OB 3D2UA 1KN2H 1KTDB 2AGJH 1HHIA 2E6QA 5IMOA 3RAJH 3OKKB 3IU4H 3T4AA 1IC7H 1MI5B 1RUKH 3DX8A 4G80A 3S35X 4LAJH 2VZOA 4JG0H 4ONOA 4PJGF 1LK3L 1ZLVK 5J3HD 3PE9A 1T04B 4IS6B 3AREC 4M9OA 3TYGL 5E1AA 1KEMH 4NDMA 4R2GB 2OX5A 1LEGA 4M5ZH 3QIBD 4PJ9B 1G84A 2FYYB 1E4KA 5F7UA 3HNTL 1LO3H 1UA6H 3UX9B 1I1FA 1MHPH 1R5VA 5E9DA 3BPLB 4RGOH 5KG9A 4JCLA 1BFVL 3C5ZC 1MWAB 3EOTL 3G9VA 5D7LE 4DQOH 3W82A 2Y72A 1R3IH 3HE7C 3RUGE 3WL9B 4NKIL 4X5WB 3C6LD 4NKMA 3NN8B 3TIDB 1F8TL 5FM5M 3RGHA 3G5VA 2P8LB 4C55A 4YEEA 2VLRD 1UM4H 4F37K 4I77L 3P73B 3DMMB 3QWQB 4JM4L 4RFEB 3IXAA 5ELIA 2HRPH 2JLLA 5D2LB 3VXOB 1QYGL 2VIRB 3WV0A 1N4XH 1N5YL 2R4SH 1A1OB 1H9VA 2KKQA 4ZS6C 5AWNH 3DXAD 4KROD 2IPTH 3KPRD 4MB3A 2NY4B 4YPJA 5I1DA 5B38B 4HUMB 3TO4D 2RCSL 1MREL 2ZUXA 1AQKL 3WIFA 1RMFH 4GW4A 2UYLA 5BS0B 5ID0A 4YHLH 4XNYH 5C0RH 4XZUB 3CCHB 2RHEA 3VXRD 1PAMA 3MV01 5IB4A 3L5XL 4TSBL 1N26A 1H3GA 5MEND 3G5ZB 1U8MB 2L7UA 2OP4H 4FNLL 5EB9A 1E6OH 3LEXA 1H15B 2M2DA 1A9BA 7CGTA 4IRZL 2VO5A 4L5FH 1QNZH 4GXUM 3NCYP 1CZ8L 4QXTA 3VGAB 1KB9J 4OD3H 2V2TA 2ESVB 4PGBB 5D1QD 1B6UA 1NAKL 2GI7A 1L6ZA 3G08A 4KKCD 4OCSL 1Z9MA 4DKFH 2WBJD 2AJUH 2R1XB 2CKBA 4PGJA 4JRXD 1B88A 5C0CD 4UV7L 3MR9A 4A6YB 1CL7I 3V7AG 3VD7A 4DCQB 2CR3A 3H0TB 5GQBA 3CFJB 2DKSA 1ZHKB 2AJ3A 1NKOA 1K4DA 4PBWD 4NNYB 3FRPG 3U7YH 5D6DC 1UVQB 2QHRL 2IQAB 3SGKC 1PQZA 1CBVH 2IAND 1MJJB 4HZLB 4OLVH 4ISVA 1A2YB 4OLXH 5IFAH 3VXNB 3IVKB 5C08B 4L8CB 4MD0B 3MCLH 5E03A 2JK5B 5CJXC 2G75A 3CZFB 2Y4SA 4TNVF 4N90D 4MDJB 1T66C 4DFHA 2OZ4H 3UJTL 1A3LH 1ND0A 5JW4N 3A6OA 3D6GA 3BGMA 1EEZA 1SY6H 3IAQA 1G7JA 3MACL 2BVOA 5C0ND 1VFBA 1H0DB 1KPRB 1WAAE 2M1KA 4GW5A 5F89A 4RISL 5D8JH 2IMMA 1IRAY 4F33B 1MH5A 1CDJA 1UZ6F 2YPVH 4NKOB 2X41A 1M6OA 4L8DB 1OT1A 4NC1C 5IROA 3REVB 2N1KA 1QHOA 2OXHA 5DQDL 2FEDD 3CSBA 4JJ5B 4H1LA 4Y16B 3S34H 4XCEA 4XNUL 4APQA 5IQ7L 4X7CC 1FGVH 1AQDA 5EO0A 2DQCL 1YEHL 3LH2L 2B0SH 4P2QB 1YECL 2G5RA 1I8IA 3MNVB 1TZIA 3RWDA 3AFLA 2GJ6A 3SCMC 3U4EB 3O8XB 4LLWA 3BXNA 5T3ZH 3TT1L 5BW7C 1LE9A 3GBNL 3WBDA 3RZCD 4PJIF 3CIQA 4NJAL 2CLZA 2KQMA 2V5RA 5FA3B 1XGTB 3LRHA 4X4ZA 4ODWA 5C09A 1ZHBA 3IGAB 3V6OC 2XZCH 3C2AL 1CFQA 4RFOL 2OMBA 3V6OE 2FLRT 1KPUB 3QFDB 1A6WL 2QQLH 1WISA 4Q9RL 1HHGA 3U0PB 1NFIA 1HIMH 1V8HA 2GJZB 3QXDA 4LSTH 4FTVA 1XGRB 5F7EH 1NDMA 2R23A 4BFGA 4OGYH 1CE1H 2ADJA 4XI5D 4M6OL 1EHXA 2NLJA 3T3PE 1RZ8A 1K8IB 3UPAA 3G6JA 4HGWB 5KJRL 2JB5H 2DIJA 5KSAB 4DN4H 1CK0H 2VERN 4F37F 5DYOA 2Q7YB 1W8NA 4RFNC 1V3JA 5D72H 5T1DH 5LVEA 3H3KA 1KTLA 1OAXL 4H8WH 1DVFC 1GC1C 1TLKA 1GIGH 1UQSB 3SE4C 1FVEA 1MFAH 4KI5F 5BZDB 3ZDZF 4YDVB 1GOGA 2W9DH 3TEUA 5ITFA 3ARBD 1MFEL 3HG1E 1A1NA 4QHUB 5HGBB 4MX7B 5D7JD 3UC0L 1A6ZB 3D48R 5MP6H 2NY0D 5BVJB 2EIZB 4X0KA 5DJ8A 1CD0A 1K8DA 3A6CL 3U9UB 3FB8A 3O4LE 3FQWB 4XX1E 1BMGA 1M71B 5D7SL 5E2UH 4Y2DD 3EFFA 1XGQB 2GCYA 2BVPB 4U6YA 2EDDA 1FZMB 5IHZA 3QDJB 1PYWA 4H0HB 4Q6IB 5KSVB 4EI5C 3BUTA 2NNAB 4U1SB 4YHNA 4MLSA 4LPXA 4Y1AE 1NFDF 4GKNA 1VACB 2IQ9L 4U1MB 4JFED 2G2RA 1P7HL 2OTUB 4DKEH 1BQHA 1YYLH 4Z7WA 3ARDB 2IPUG 2X4UA 4LK4A 1T1WA 1G9MH 5ESVB 3QNYB 3ULVE 4FQXB 1NLBL 4Z7VA 2A1WH 3WS6C 3VFSB 3E6FA 1MCIA 5HYSG 4C54A 3T0EA 1R5WA 5EO1B 4LKXB 1CT8A 1AJ7L 1D9KD 1RD6A 4WI2A 5EORL 3T77A 1QLFA 3ZDXE 1GZPB 2IAMA 1U8KB 2XTJC 3STLA 3L3HB 2Y7QA 1JGVH 3LMJL 4JPKL 3QDGD 3TP4A 1N6QL 4PRHD 4EOWH 3SO5A 4RQQA 1P4IL 5JORB 1WSST 1E4WL 4PLKC 5FO8A 3ARGB 4HDIB 5FUOH 1RURL 3U36A 4OUUB 3D3VA 3THMH 5AYUH 5IF0A 4CVZA 1VHPA 1S78C 3MLSL 5D2NA 3MBEA 5KS9A 3BMVA 2A0LD 1CFTB 3BZDA 3BJ91 4D9LH 3WFEH 5HPMB 4I3SH 5T33L 5TGBA 2VLKB 5GXBB 2X70B 3LVEA 1FIGH 5DSCB 4P5TC 4W6YB 6FABH 1U2CA 4KHXH 5JZ7C 4OD1L 3BRDA 4Y8DC 1MRDL 1SJXA 4HS8L 5DD6B 2KZ1B 3IRPX 4PUBL 3HI6L 2E27H 4HHAA 4LSUH 3Q6FA 4G7YH 3BN9D 4J1UA 5L2KB 5ILTL 4PTTB 2R9HD 3BYTA 3ES6B 4LGPB 2F54A 3BQUA 3Q3GA 1OAZH 4OFDA 1GGIL 5F6HJ 2GK0A 4QXGL 4NP4H 5GGVY 2CRIA 4LLYB 4NHCL 3RPIB 3V0AC 4NPYA 4UT6L 2VQUA 1NC4A 1G1CA 3GUTA 4K7PH 4L3EB 3TNMB 1BX2A 3AXLA 2BJMH 1YPZF 3K3QA 1YUHB 2EDWA 4HKBB 1FGNH 3CFEB 1D5MA 2GW5A 3TBYB 5C0AD 1CDGA 2EYTA 3MRQB 1C7TA 3BGFB 5JHLH 5IBLC 3WDIA 2C9AA 5DVKA 3VE0B 3K8LA 2XN9B 2EDFA 3EYQC 1K4CA 3LPGA 3QO0B 2DMCA 1K5NB 4Z7UA 2NW3B 4TVPD 2KQNA 5I1GH 2YMXL 5FB8B 2ZJSL 5DZNA 1HEZA 5DRXA 3B9KC 2AV7A 4I4WA 4WFGE 2ED7A 4Y19A 5JR1H 3NVQA 4HF5H 2QEJA 1OCWL 3NOIA 4KTYA 4LHUB 3SKOA 3RBSA 3FQNB 4OZHA 1CDCA 3BDYL 3E2HC 1FFNB 5CEZE 1TQBB 3PQYB 3PWPD 3MLRL 4RNRA 1D5BB 4BA8A 3LIZH 5IB5A 2EKSB 2E3VA 5KSBA 1T83A 2IG2L 5FO9B 15C8L 2YBRA 4ZS7L 2CUHA 4U1IA 5IHUH 4KU1A 2V5MA 1EGJH 4DGVH 2VDKL 2X4QB 4ZTOH 3KPSB 1N64L 1MJ7L 3FFDA 2NZ9D 4KZDH 2HRLA 4JHAL 3O6FD 1WZKA 1UXSB 2BX5A 3TA3C 4PRIA 3QXUA 2NX5E 2WSKA 2VXUH 5CS7A 2P5EB 3QDME 3UPRA 2F8XC 3G5YA 4JY6A 1KJ2H 1FSKC 4XGZA 1MAKA 4DVBA 1EHLH 3NIGE 1D5ZB 2G60H 3LN4A 1QUNA 5SWSB 2YZ1A 3RWCB 2OM5A 1LEKB 3WKNA 3TNNA 1LD9B 3HS0A 4PJGA 1I1AD 3BHBA 2BCKA 3LPFA 4OCRH 1OP3K 1GGTA 3QZWA 4AT6B 1FFPB 4S1DC 4QRQB 2X1QA 3SOBL 3VMPA 4P4RA 1K6QH 2J6EA 2F8VA 4Y4HD 3VXSA 2LAGB 3F7YA 3UTPE 2VN7A 2JTDA 4UILL 3NZ8A 4XP6H 5SV4A 3FTGB 5F1KC 1DBBH 3LV3A 4PB0L 4RAVB 3U48A 4BSWA 3L3JB 2AJSH 4IMLB 1I7ZB 4ZNEA 4J4PA 3EYUL 3OAYK 4OJFL 4U6HA 3BZ4B 4JO4H 5E8OA 5D71H 3ULVD 4G3YL 2DS4A 4CU7A 4Q9QL 2QQNH 4MGXA 1NUGA 1TJIH 1WIPA 1BFOA 4TSCH 4DVRH 4XMLL 2XRAL 3RNQA 4R4ND 2CKBL 3EW3B 1IGIH 4OF3A 3S35H 4AH2A 3DX9A 3GSNB 1GAFL 1MWAH 1NMBH 1ZV5A 3DYPA 3MSPA 4TTDD 1BVLA 5MI0C 3CXHK 1EEQA 2P8PB 3ULUC 1HHJB 1ZS8B 3ULUE 3W9EB 1FV1B 4IRJD 4XNZC 4W6XB 5MEQB 3QQ9D 3MODH 4L4TA 5DD0L 3W11D 3UTTE 5ITBL 5IEKA 1NFKA 1HWHB 1YEDB 2C1PA 3GJFA 4JFOA 4WW2F 5GGUA 3RTQD 1Y6MR 5JLZB 3ZTJH 3I50L 5ENWA 4LAQL 3QHFL 2W60B 4N8CH 4KRPD 1DBJL 4GBXB 4P48A 2QSCH 3GMPB 4JQVA 3WLWC 1MRCH 5C6TL 1JUFA 1YA5A 4LPCA 3HMXL 3D0LA 4HK0B 2IEPA 4PJCF 3PL6C 1QACA 1HINL 3KWWA 1Q9LA 3T2NL 1A7RL 4LSVL 2YRZA 3GNMH 3IS0X 3QIWC 1WGOA 5HHVL 1SYVA 3NGBB 3LN5A 5ESAB 3O3AA 4MCYA 1KB5B 1U6AH 2MQCA 4JFZH 2J3SA 3MNZA 1DQML 4LSRL 3BKML 4FZEL 4OM1H 5HVHB 5E2VH 4KTEH 4C4KT 3FJTA 4P2OD 1KLFA 3PABB 4CGTA 1F11A 1LO5B 5H37H 2MCPH 5E6ID 2NYYC 2ICCA 3GK8H 3TVMB 3EYOB 1MI5D 1RIUL 1W8OA 3IJHA 4GMSH 3ZSTA 5BVPH 3O0RH 3SJVA 5T3XL 3JVGA 3QT2A 2KPNA 1CCZA 5E8NA 3BFOA 5BCAA 1JWMA 5EUOA 4R6UA 1NBVH 3HA0A 4LHJB 1HSBB 3MYZA 3MLYL 3QIUA 4PJEF 4PRAA 3L5JA 4PJ9D 1P9MC 4HUXA 2AKRA 2VDML 4HUKB 3VFGH 3VRJA 2BY2A 2FZ3A 4KK6D 1ZT1B 2EDYA 5HYSA 1P4BH 4KTDH 1HNFA 2F9BT 1CLZH 1QLRB 1DQQA 4NQCB 5GGRY 3KLHC 3BW9B 1KLUB 1J8HA 1CF8H 3IDGA 4WI6A 1X4ZA 3MJ8B 4HK3N 1JHKH 3QHZH 1MCWW 1P2CA 3TPUB 4JG1H 1PEWA 3C6SB 4QEGA 3CX5J 4D8PA 5FGCB 3MCKA 3DMMD 5JMRA 3IYLW 5CJ8A 3FFCA 4OIIL 1XF5A 4JDTH 1S9XA 4CJ0A 1QSFD 3QEHA 1A6AA 5E5MB 4OZFB 5EU6B 3QEQB 5E4EC 2NY4D 5C2UB 4Z8FL 4X80L 4IIQA 4MMZC 3QA3A 5B39A 2QKIB 1FNHA 5DD5L 5AAWA 25C8H 3SHSA 4KY1L 5D7IB 5HHPA 4YDLC 5C0EA 2EE6A 1MJ8H 1B3JA 3OKLA 1QQDB 5DRWA 3SKMA 2XXCB 2AJZB 4UT9L 4WI3A 2EDQA 1QP1A 5A16B 3I9GL 2VYRE 4N0CD 3MV8E 1NKRA 5BO1H 3GJEA 2QR0A 2FWOA 4XVUD 5F9OL 1KENL 3SO3C 3P4NB 4XMKL 4P2RA 3VWKB 5GIRB 2ESVD 4E41B 5TH2B 4KMQA 2YWZA 3W81A 3T3ME 1IAKA 4EQ3A 4WTWA 1KPVA 1OAYL 4DN3H 4CNIA 2XY2A 1ZA6A 5L0QB 4JFHE 4L9LB 4P46C 2D2OA 4Y5XA 3EGSA 4UQ3B 3ARZA 1ZA3B 1DE4A 3TIEA 4DGYH 2D0GA 1OTTD 5ID1B 5EOQH 5BV7H 4WCYH 2X1WL 4JKWA 1CFVL 4WDIB 3O41B 1WIUA 5HI4C 4OGAC 3MOBL 3LKOA 2EDKA 1K3ZA 1M7DA 5BMFL 2MKLC 1FYTB 1H3XA 2IPKA 2AJYH 1I9RH 5I71B 2DQUL 1A21A 2CQVA 2NXYC 3WIIL 4HC1H 1JTOA 3OAUL 5C0JB 4EUPB 4DUVA 1V7NL 1B0GB 4QYOA 4D0CB 5IK3A 1JHTA 3I85A 5IFHH 3D9AH 4L8BA 4M7LT 4XPFL 2XZAL 5ICZB 1H3TA 3FAXA 3MXVH 3VDBA 4GG6E 1XCTA 1MHHB 3NA9L 5IJKA 2HVKA 3HUJE 2B4CL 4MNHA 4XC3L 5JHDE 1T5WA 1NEZG 2X4NA 4PY8I 5E70A 4Y16D 2Z8SA 3HC4L 4JRYB 3AB0B 4XBPA 5CBEA 2PYED 5FYJE 1CXHA 2V9TA 2B7DT 4ZYKA 2YUWA 2CLVB 1I85A 1BAFH 4FQHB 4P2QD 2O5XH 1GZQA 5GS1B 2AJVH 4ELKA 1YDPA 5D1ZA 3VXUB 5DMGC 1QRNE 1MCOH 3O8XD 3L5HA 5ACLA 1EEYB 2W92A 4CN4A 4R90H 1CU4H 5IIEA 5SX5K 3BE1H 3CK0L 3JV6A 3JTSA 1VFOA 4MAUH 5DHYB 1PX3A 1CWVA 1FZOB 5SWZB 1SJHB 4XNQA 4FXLA 2MCG1 3RKPA 2VDLH 5DJYB 8FABA 2BP3A 3O6LL 3B2VH 3V0VB 1UB5A 4JFFB 3MUGB 3CH8A 4Y5VC 1LQSR 2F53A 2OQJA 3QJHB 4AL8H 1LMKA 5TDNA 1IC5H 5IW6A 4JZOA 1JRHL 2H1PL 1CFSB 5EU3B 2NY7H 4WGWB 3O11A 5DK3A 3RVWD 4C83A 2Z31A 5HDLA 4G6JH 3KPQA 4M8VA 1R3KB 4LDOB 4QCIA 2HFTA 3CFDA 5K9OA 3QWRA 3MRBB 3DX7A 3OTTA 4JM2C 4QTIH 2CDFB 3NZHL 1XGYL 4M3JA 2Z92B 1MCRA 1JWSB 4MAYC 5KSAD 2HTKC 4H26A 4O9HH 3WDHA 3F12B 3B83A 3G9AB 1N0XH 5JXEA 2DTML 2ZG2A 1FL6A 1RHHB 1EFXB 3GBMH 1D6VH 3MRRA 4RWYL 4ZD3H 3BP7A 5C8JB 2HLAA 5IVXB 5IEHB 2X7LB 1Y6NR 5JPNA 2BXYA 4BFIA 4HWZA 4UINH 3OR6B 4OZ4B 3VFNA 4OF5A 4U6VH 1R24B 1D5IL 2R0ZH 4LEOA 3DUUB 1RZJC 3V4UL 5C0BB 4PRPB 1NGYA 5DUML 3E6HB 3B5TA 2HKHH 5ICYA 5I76B 4LVHB 5JXAL 1UEYA 4YHPB 2W91A 2AK1L 3ALPA 3O9WA 3S4SG 3SBWC 5DUBB 3O3BB 5D96B 3AGVA 3NIDF 1MLCA 1BPVA 1AGDB 1MVFA 2EIEA 3VFPA 3KLDA 3QDJD 2ENYA 4W81A 3HI5H 1IT9L 1HH9B 5GGSA 1ZT7B 2CSPA 3L3DA 1JZ7A 3S3SA 5H35A 3IU3B 1IKNC 2BC4B 3P0VL 1UM5H 2EIBA 3OZ9H 2UZYB 2X4OB 3QCUL 5MHSE 5HDOA 1IAOB 3ARDD 4TRPH 2EECA 3ZE1F 2HTLC 3KYKH 5J13B 4X7TB 4FQXD 5I17B 1T0MA 1Q8MA 2DBLH 5BRZB 1XT5A 2DWDA 1FZJA 2NY1B 4HULB 2O5YH 4TQEH 1P6AB 4NO3A 4QWWC 4KKBC 4YC2C 3WNLA 1OF2A 3BP6A 1ROWA 2J2ZA 4RRPA 2EICA 4S1QL 5I8EA 1LEIA 4LCCC 4EBQH 1JHLH 2VISA 4KZEL 1JZ4A 2I26N 4GQPH 4G8EB 4PP2B 5CILH 4JKMA 5BOPA 1N5AB 3MRLB 1BJ8A 3ARGD 4LBEA 4D2NA 5JIKA 4X6BB 1INEH 3UDWC 5A43C 1T21A 4PG2C 3LEYH 2FJGA 1NEUA 1HXMA 3O2DH 4KQ4H 3VXQA 5BJTB 2WUCH 2BY0A 5CLTA 1BOGB 2VLKD 3E3QC 3GGWB 2KZWA 1TVHB 2BDNL 3E3QE 4NGHH 4QOKA 4JANA 3S3PA 1AHWA 1LNUA 2VL5A 3QSKB 4V1DE 4PJ8C 3SY0A 1MRFL 2DQEH 2OMNA 2OTPA 1I1YB 3P9WB 4WWKA 4GAGH 5C70A 4WFED 1WCBB 1MEXH 3EFDL 4JO3H 2ICWB 2QADC 1KN4H 5L2KD 5D4QA 1TFHA 1VADB 4U3XA 2X42A 2HJLB 1JZ2A 3NTCH 5ACMA 4RWHA 3PJSB 4HZAA 5FHBH 4BSVA 2E7LA 3I3EA 1MHCB 5DK2A 1JNJA 2DAVA 1J11A 2OR7A 4OGXH 2UWEF 3V9FA 1Q94B 4WEBL 1HHIB 5IMOB 4OCWH 2VAAA 3T4AB 5JOPE 1LP9F 1Y6KR 4G80B 1MAJA 4L3ED 4JHWH 3DVNA 1IFHL 1QRND 3H9SA 2V7NB 1I8LA 3GI8L 1QR1A 1A3RL 2DQGH 2LU4A 4NDMB 4O2FA 5D6CA 5CLWA 4N0UE 2AXJA 2XN9D 3AS2A 1AR1D 5SV3A 4MHHI 3GMLB 1FLTX 1ITCA 4P49A 1I1FB 4HBCL 1UWEL 4K3DL 5IWLA 1R5VB 3MLXL 1V05A 5E9DB 5CSGA 5KG9B 3TJHC 1MFBL 4XPAL 4KVCL 1OTSC 3SKUD 4FP8L 4YBHA 2ATKB 3VWJD 1RIHL 2YUVA 4X5XA 4LHUD 2CMRH 4K94H 4LPVA 2EDEA 2UZIL 3GSXA 3KLAA 4P9HL 1F90H 2EIDA 1JNHA 5D70H 3HMWL 3KJ6L 3WSQH 3PQYD 4OLYL 4WW2A 5CBAA 5KVFL 2BXZA 2W9EL 3BKJH 5FK9A 3QIBA 5HI5D 4TUOA 1IAIM 1GHFH 3IXAB 3P0GB 4JO2L 4X6CF 5HYIA 4ELMA 3DECA 1MPAL 1DL7L 3EJZC 3KPSD 3CD4A 3K2UH 1OW0A 1A5FL 4PJ5B 4LRNH 4YXHL 1II4E 5I1DB 3BIKA 2B2XL 2P5ED 3C6LA 5CINH 1NLDH 3ULVF 1EAJA 2UYLB 4OLEA 3RWGA 5FOBB 4PLJC 2EDOA 4J3OC 2HFFB 4I2XE 4NZUL 2Q6WA 4I1NB 1NCWL 2PUQT 4HKJA 4ODSL 3VXME 3OKOA 4NIKB 4NCC1 1NEZA 3VG0L 5D5MF 2CO7B 2A83A 4JDVA 3WUWA 3F7QA 1LK3H 4WV1A 3TPKA 4KQ3L 5CEYA 3LEXB 1UENA 1A9BB 4X7FC 3TYGH 1VFUA 3DI2B 4NWTH 3DXAA 4QXTB 3HPLA 3NFNB 4EIGB 3CGTA 5MEPA 5T3ZE 2AEWA 3AU1B 3RVUC 2V2TB 2HWZL 3EYSL 3TO4A 5CEXB 3HNTH 3G08B 4G5ZL 4GKZA 4U05A 4XC1L 2CKBB 4Z95L 1RK0A 2R2HB 3EOTH 3RIFF 3DURB 4LFHD 5LCVL 4EDWH 1VGKA 1HI6A 1K4DB 3QXTA 4I18B 5MENA 2Z35A 4NKIH 3TYFA 1SEBA 1PQZB 1S9VA 1BWMA 1F8TH 4ISVB 4S0SD 5DMKA 4OF7A 4UV4L 4LCUB 2YS4A 1BOYA 1G0DA 3PWVA 4I77H 1L0XA 4JM4H 3S7GA 1FNGA 2G75B 4HXBL 4N8VA 4UIKL 5D1QA 1HOCA 1N2RA 3G6AA 2ZCLL 1FPTL 1N5YH 1ND0B 3TGXA 3BGMB 4S10A 1DEEA 3PHOB 2BVOB 3MRCA 1VFBB 4LPTA 1TPXC 3M17A 5F89B 2RCSH 1MREH 3MZTA 1NL0L 4ZTPL 2HT3D 4H8WC 1AQKH 5DI8A 1MH5B 5C9JA 3UBXB 2AJXL 5HGGS 4IOIB 1Z9LA 3LKPA 4GBXD 4DK3A 3RKDD 1HK6A 3C09B 1M7IA 2HFGL 5GPRA 4ODBD 1XF3A 3L5XH 5FGRA 5E8PB 4C4KO 4MA8L 1BVZA 3BD5A 1JL8A 5C2BL 4OZFH 1C1EL 3VXTA 3NA4A 4FNLH 4APQB 2XG5A 1RZKL 5EO0B 1T1ZA 1CZ8H 1I8IB 1TZIB 3OR7A 3RWDB 4I0PC 4NN7C 2GJ6B 3I6KA 3K81A 2H2SD 4U1GC 3RU8L 3QEUA 3ZE2E 4LLWB 4U6TA 3BXNB 1LE9B 1A3QA 1U95A 5I73B 4X9IA 2YD4A 4OCSH 3ARFC 3TM6A 2Y1VA 3DVFA 4UV7H 1KBGL 3MRKA 2CLZB 3TVMD 4BQ8A 5K9KA 5SX4H 3E8UL 5C09B 4AYFA 1ZHBB 2H26A 2WWMC 4HEME 2QHRH 2ZOKA 1CFQB 4WO4B 1R0AL 1DCLA 1PFCA 1G9MC 1T89C 5K93A 5JOPD 5DQ9A 4LL9A 4HEPG 1S7TB 5D93C 3HAEA 1HHGB 2UVEA 1NFIB 4XX1G 4YXLL 3QXDB 2FCBA 4NQVB 3GSRA 4ZQKA 4QNPF 2XKUA 4JLRA 1NDMB 2R23B 3DVIA 1NCBL 3LQZA 1X6NA 3G6DL 2ADJB 4Y4KB 1HNGA 3UJTH 2NLJB 3RZCA 4NQCD 5MEOB 4EI6A 1BM3L 4F57L 1RZ8B 3M1BA 4D9RE 5B3JF 3EYVB 3G6JB 1FHGA 3MACH 3P4MA 4M62H 3ROLB 1IM9B 4M6MH 5GS0D 5GRJH 1OHQA 4RISH 3RY6C 4FQJL 4PYGA 2IGFL 1NCNA 4M48L 1ZK9A 2VR4A 4KUCD 2YD2A 4M7JL 1DQDL 1UACL 4FQ1L 4L29A 3TFKC 5DQDH 3C2SA 2EDHA 3JBG7 4J3WA 4YBLC 4ZPTA 5ITFB 4XNUH 5C0GA 3QWOA 4EUPH 1A1NB 1G7PA 2XI9A 5EU6D 5HYQA 3QEQD 4RGMC 5IMLA 1QFOA 2DQCH 1YEHH 4OFVA 3KJ4C 1IKFL 3LH2H 1TITA 1WICA 2A6DB 4X0KB 5DJ8B 4UOJA 2CK0L 5FYLL 3SGEH 1K8DB 3FB8B 3S8WA 2H9GA 2BVUA 1NBQA 4KAQL 4XP9L 3GBNH 3C5ZA 3EFFB 5D7LA 1CL7L 1FFOB 1PY9A 2GCYB 4QRPE 4JPWL 3PF2A 4NJAH 3QUYC 3HE7A 1T6VN 1XGPA 1PYWB 5HYJE 4YHNB 3EYFA 3U79A 4GKNB 3DHMA 4KRLB 1FAKT 1J8KA 4YIQB 2G2RB 3CH1A 4RFOH 2XNAA 1PEZA 1BQHB 1JV5B 2J88L 2W0KA 1A6WH 3D39E 1YYML 4Z7WB 5D7JA 3JV4B 4Q9RH 1T1WB 1AIFA 5DWUL 5H94A 3DV6B 4ESKA 4GAJL 2D7QA 3E6FB 1HILB 5I1EL 4Y2DA 2X1PA 3T0EB 1R5WB 4ZAKB 3TT3L 4MXWL 3WS3A 1FFRA 4M8QB 3T77B 1QLFB 5KJRH 2IAMB 3STLB 4L8SA 1C5CL 3OXRA 2QSTA 2Y7QB 3C8DA 5HGDA 5JO5B 5JDSB 3BRGC 4N5EC 1VESA 3CFKA 1OAXH 3HCVB 4LHQB 2XICA 1OGAD 1FYTD 1KSRA 5FO8B 1JP5A 5EZOL 3ARSA 4CVWA 5EIQA 1PKOA 3STBA 3U36B 3DOSA 2FD6L 4N0FB 3RWFA 2NY2B 4CVZB 1MFEH 5D2NB 3HI1A 5KS9B 2G9HA 5E6YA 1MFCL 3UC0H 1AFVL 5TGBB 1D9KA 3WN5C 5E95B 3MA7A 4OFIA 4F8QA 3A6CH 3AM8A 5D7SH 2HG5A 2YC1A 3D18A 3BKYL 1L0QA 1JZ8A 5IR1A 2H8PA 4HHAB 3Q6FB 4ORZC 1FNEA 1ED3A 2OJEA 4JRYD 4WI5A 4J1UB 3SGKA 2IQ9H 1R3JB 1Y0LA 2F54B 4WJ5A 1U3YA 4LSQL 3Q3GB 2GK0B 4U0RC 3V79C 1YN6A 1UJ3C 4WVRA 3LCYA 3FRUA 1T0PB 4NPYB 3VMOA 1WF5A 1NLBH 3QRGL 4WEUD 3F6LA 1QHPA 1U8PA 4LLVA 4OZGE 5F1IB 1INQB 3GUTB 3OHXA 5GS3A 1F13A 1BX2B 3AXLB 5EZLA 5SWZD 3UTSB 3C9NA 1D5MB 1AJ7H 5EORH 1AE6L 1AD0A 2PTVA 4HIXL 1T7WA 5I0DA 3JWNC 4JFFD 4PR5B 3TZVB 4FFWC 3IFOA 3LMJH 1PKQB 4JPKH 2JIXD 2JJVA 4WNQA 1N6QH 1U58A 4G6AC 4Z7UB 4ZXBC 1F4WL 4HCRA 1P4IH 5TDOA 1E4WH 3QUXB 1HEZB 5DRXB 4I4WB 1RURH 4Y19B 3VFMA 1BEYL 2F74A 4R2GC 1G7LA 1RUQL 4MZ2A 3SKOB 3MLSH 4PV9A 4OZHB 5FF6B 1X5HA 5T33H 4L3CA 2IF7A 4M7KL 4YPGA 2MQ3A 3BPLC 3UTOA 3LKRA 4H88L 1TZGH 1GGBL 1AP2A 2YBRB 1EFXD 4U1IB 4BQBA 4HS8H 2Q76A 3DETC 4PUBH 3B4NA 2VDOL 2YWYA 4XCYA 5HD8D 3FFDB 1SYSA 2PW2A 2BHUA 4QLRA 3VI4E 5ILTH 1KG0A 3LS4L 4PRIB 1EJ6A 2E7MA 5C0BD 4PRPD 3EJYC 4DOHE 3UPRB 2BNQB 4WUUB 1IAII 3PWPA 3L6FA 4NHCH 4DVBB 5FV2A 1KB9K 2NR6C 1J0ZA 4XXCC 1MJUL 2PO6D 5AEAA 4UT6H 4PJFE 3LN4B 5HSFA 1J9CT 1BHGA 3ME0A 4E0RB 5IB2A 1WBYA 2XKNA 2Z91A 2ATPA 1LP9A 1JWUB 3TNNB 3HS0B 2EDJA 4R96A 4XTRC 3F62A 3BHBB 3E0GA 2BCKB 4JPIA 4KVNL 4YHOL 3QZWB 4PJ7E 4MJIB 1KIQA 3JXAA 3O6FA 5F7MC 1PZUB 5EC2A 1AO7E 1T4KA 4P4RB 2J5LC 4F7PB 3BISA 2BVEA 5GSRA 1DVFA 3VXSB 2E7BA 2YMXH 3KPMA 1DR9A 5CP3A 2ZJSH 5DDHB 3KPOA 5BRZD 3LV3B 3ZKSD 4BSWB 5FHAL 5LKNA 2X89D 3BESR 2NY1D 4CU8A 1AKJA 1OCWH 4U6HB 3RVXC 2AABL 3VGAC 4J23A 2VXSL 4N9GA 4OT1L 5E8OB 1BIIA 1A4KB 3BDYH 1I1AA 3KYOA 3O6ML 3MLRH 4UUJA 4NZRL 3QUZC 1BFOB 1OGTA 1SEQL 3LQAL 5HI3D 3EO9L 2IG2H 4HUNB 4ZS7H 3DX9B 3OQ3B 5EPMA 4PJAE 3OB0K 4Y4HA 2VDKH 5DMJB 1KN2L 2W1NA 4Y1AA 4AEIH 4EI5A 3MROB 1N64H 1MJ7H 3EO1B 5TJWK 4M43L 4YHKH 4O02L 4LLDA 3SDXE 4ORGA 3ARRA 4JHAH 4L4TB 3U0TA 5IEKB 4F7TA 3I02A 4JFOB 2NY5L 4GW1A 5ANME 2D03L 5GGUB 4NQEE 4OF6A 4MQXC 1ZVSB 4AEEA 2BNRE 2Y23A 4O51B 5ENWB 1MFDL 4I9WE 4OQTA 3FT4B 5K33A 3KPPA 1BECA 4HUUB 1C12B 3TBTA 3HE6C 1JUFB 3D0LB 3DGCR 1UA6L 1MHPL 5D5MA 3KWWB 1Q9LB 4XPGL 1H3WM 1BQLH 4ZG1A 3GIZL 1NAML 4NO2A 1NGXB 1YC8A 3GBLA 3MGOA 3RJQB 5GGRA 3MNZB 3SOBH 5AD0A 1RJCA 1I3GL 4UTBL 4RMQA 3RTQA 2DLEA 5KW9H 4M7ZB 4OZIE 4F2MB 5D1XB 4UILH 2GY5A 4F3FA 2M8XA 1F11B 3HZYA 2QL1A 1S5IL 4PB0H 4QO1A 4XB7A 2IC2A 5IUSA 3K1DA 2X09A 5J6HB 3EYUH 5IBUB 3FB6A 1EXUA 5E8NB 3V5HA 4P57A 1JWMB 3MJ6A 5EUOB 1ORSA 4K7PY 3KHQA 3KR3L 2R4SL 4G3YH 4CADA 4FQIH 3V6ZB 4Q9QH 3WE6A 5ALBL 1NBYA 5AWNL 4D0BB 3QIUB 4KFZC 4PRAB 3N0PB 2IPTL 3CUPB 5J89A 4KKLC 1U3HD 4XMLH 2XRAH 5FM4A 4HUXB 4OAWA 2AKRB 3VRJB 2DKMA 2CKBH 5LJYH 1GAFH 5E9DD 2A2QT 5HYSB 4QKXB 3Q5OA 3FN9A 4P2OA 5C0RL 2H32A 4HPYL 3RBGA 1KUMA 1J8HB 5E6IA 4ODTL 5BV7C 4H0IA 4W68A 5ITBH 2D4DA 3IDGB 4YAQA 2C3VA 2P42B 2X4TA 4O4YL 3BUYA 4H5SB 1T04A 4HKXB 1C08A 2HLFD 1P2CB 3I50H 4XCCL 1OP5K 1HN1A 4LAQH 4ZO9A 3QHFH 2P8MA 1DBJH 4D8PB 2J7LA 3MCKB 4PJ9A 5C6TH 3WLBA 2FYYA 2WP3O 3GKZA 3FFCB 3HMXH 3UEZA 2XWTA 1S9XB 1HINH 1T2JA 1WWCA 1A7RH 2DLIA 4LSVH 4ONGL 3T2NH 4PS4L 2VLME 3QEHB 1A6AB 4MCZB 5HHVH 2EXYD 4PJ5D 3VXPA 3PV6A 3ZYJA 5E94A 4ENEC 3TH3T 3F65A 1YNLL 1YJDL 4ZFOA 3U7YL 5B39B 1UYWL 4LSRH 4FZEH 1P53A 3NN8A 3WJLC 5HHPB 3STZA 5C0EB 2UUDH 4WU7B 5DRWB 4H1LH 3SKMB 4KK8D 5I8OL 5FDWB 4X8JA 5I75C 3DMMA 2FIRT 1RIUH 4NQDE 3BP5A 3N1MC 5T3XH 3PDOB 4KK9C 2QR0B 2FWOB 1QSFA 5DF0A 2EYRA 4HV8B 1QEWA 2DJ4A 1BIHA 5F6HI 2X5PA 2VUOA 2DB8A 4P2RB 4JKKA 2VDMH 1SVCP 5DT1H 2YXMA 4Q6IC 3H9HA 2BRQA 1GOFA 1IAMA 4XZUA 1FCCA 1KPVB 5DLML 4CNIB 3HNSL 3QCTH 1ZA6B 3GHEL 1NUNB 4Y5XB 3SDCA 3W39B 4DW2L 3EGSB 1S7RA 1ZOXA 5ESQA 3TBVB 1C16A 3G5ZA 3TIEB 3QDMA 2DM7A 5DEFB 5F88A 2UY6A 3B8SA 1D7FA 2OL3A 1H15A 4R26L 4BKLA 4ERSL 5IFJA 3LKOB 3K2MC 5DRZA 1I9EA 4CDGC 4OB5L 4GRLD 2IPKB 3KPNA 5FKAA 2ESVA 4PGBA 4ZUWA 1F2QA 2X05A 2COQA 3C8HA 1BFSA 1IEAB 4PJHB 1X6LA 2DWEA 1KJ3L 4GRWB 3H0TA 4Z8FH 3CFJA 3IFNL 1ZHKA 4QYOB 4X80H 5IK3B 4NNYA 1JHTB 5HHME 4L8BB 5HVWA 1IE5A 2IQAA 5DD5H 1ZT4B 3RHWK 5GZOC 3ALWA 4KY1H 2R15A 3RVVC 4HZLA 3HRPA 5CJ5A 2QLVB 2HH0L 3DROB 3VXNA 5C86A 2HVKB 3MRGA 5GGVL 1S8DB 4MD0A 1T7YA 2X4NB 1AD9B 4POZD 2XIDA 4WI7A 5FGBC 4UT9H 3RWEB 4J3UA 1CE1L 1YEFL 3I9GH 4APQD 5T3XD 3HPJB 4FG6D 4MWFA 4ZYKB 1RUAH 5F9OH 1KENH 4R97B 5AAMA 4L4JA 3SE3A 4ELKB 1YDPB 4XMKH 4JFYA 3TJEL 1H0DA 1KPRA 4NO5A 2OCFD 3HLAA 4J3SA 4JPVL 4KUCF 2Q8BL 4F33A 3EHBC 2C7UB 2DJUA 3CXHJ 3JTSB 1GIGL 1OAYH 2X4RA 2DQIL 3UTTA 3M8OL 5GGTA 2FNBA 5ABDE 1QKZL 1A4JB 5C09D 5D9SA 8FABB 3V7AE 3UAJD 1UB5B 5I74B 4R8WL 4WO4D 1CFVH 2PYEA 3PHSA 2OQJB 4LSSL 5IW6B 5TDNB 3MOBH 4P2QA 3MNVA 5MP6L 3O11B 4C83B 3UO1L 5D7IF 3PL6A 3KPQB 2DQUH 4CU6A 4X6DE 3P0YH 4GRMB 3CFDB 5E2UL 2Y36L 4FHBD 4Y4KD 3QIWA 5K9OB 2C3WA 3WIIH 1ZHNA 3DX7B 4KJQD 4UNTA 4Y7MA 1JPGA 1UXWA 3OAUH 1VENA 2YD8A 1U92B 1XGTA 4IHOB 4TUJB 1IM9D 1V7NH 3IGAA 4XPFH 5HDBE 3ZE0E 3H3PL 3VRLF 1FL6B 2IJ0C 4DKEL 3NA9H 3CXDL 2B4CH 2HLAB 2XPGA 4XC3H 5JPNB 2FDBP 5C0IA 3AS0A 4HQQH 4BFIB 1XGRA 3HC4H 1NCCL 4TTGA 1O7SA 4J6RH 3T0WA 1PSKL 2ZNXA 1K8IA 1NGYB 1P9MA 4HGWA 2LU3A 2VITB 1C8PA 5KSAA 5E4IA 5ICYB 1CD1A 2Q7YA 3MUJA 4TVPL 1IM3B 1EO5A 3AC0A 3CK0H 3O9WB 1KCUH 1MLCB 1S7UA 2I9TA 4OV5A 1KGCE 3VFPB 4AJ0A 1P6FA 5FUOL 5GGSB 2NXZB 5BZDA 3L3DB 3EO0A 1TQCB 4YDVA 5K9QI 3WMSA 1U0QA 2RFXB 5H35B 3WNKA 3O6LH 3THML 5AYUL 3EAKA 3WKML 1BP3B 2X9XA 1A02N 1JRHH 2H1PH 4RBPK 4MX7A 4WEMB 3N1FC 5SWSE 5BVJA 1I7RB 3TV3L 2EIZA 3L1OH 3W0WE 3G5XA 3ZT7A 3RGVC 2DWDB 1QBLL 2ED8A 1FZJB 3JWOL 3RL1A 1M71A 3T0ED 4NO3B 4ZAKD 1OF2B 3BP6B 1MY7A 1CDUA 5I8EB 1LEIB 3NZHH 1XGYH 1T5XA 1YQ2A