2JV6A

Yf ed3 protein nmr structure
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
112
structure length
112
Chain Sequence
MSALTLKGTSYKMCTDKMSFVKNPTDTGHGTVVMQVKVPKGAPCKIPVIVADDLTAAINKGILVTVNPIASTNDDEVLIEVNPPFGDSYIIVGTGDSRLTYQWHKEGSSIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Envelope protein E
publication title Yellow Fever Virus Envelope Protein Domain III: A Convergence of Structure and Phylogenetics
rcsb
source organism Yellow fever virus
total genus 25
structure length 112
sequence length 112
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2jv6A00
4GSXA 2R69A 2V33A 5LBVA 3G7TA 1OK8A 3WE1A 1S6NA 5KVDE 4FFZA 5B1CA 4UT6A 4FG0A 3UYPB 3UZVA 5IZ7A 4UT9A 4UTCA 3N43F 4UTAA 2H0PA 3VTTA 5JHLA 2R29A 2P5PA 5LBSA 5AAMC 2GG1A 5IREA 1Z3RA 2I69A 3UAJA 4L5FE 4AM0Q 4AL8C 3J2PA 4BZ2A 1RERA 1URZA 2ALAA 4X42A 5GZOA 1TG8A 3MUUA 1PJWA 1UZGA 5KVFE 5LCVA 3UZEC 4ALAC 3J27A 2JV6A 4UTBA 5JHMA 1Z66A 4GT0A 5H37A 3N44F 2JQMA 4BZ1A 3N42F 5KVEE 2JSFA 4FFYA 1OKEA 3UZQB 2HG0A 3C5XA 1ZTXE 3N40F 5KVGE 1OANA 3P54A 3IRCA 5AAWC 3C6EA 5GZNA 1SVBA 3N41F
chains in the Genus database with same CATH superfamily
2AZUA 4LDEB 4XPHL 3BQUB 5LGHL 3EYFB 3T08A 1DQML 4OF8A 3HUJA 1KV3A 3QZWG 1AVAA 3TF4A 4I9WD 5DJ8B 3R19A 1TCMA 3UTSE 4BBWA 5FDYA 1S9VA 1JF5A 4MJ6A 5GISH 1GAFH 1Q9LA 5BO0D 2HJFA 2O61B 3KPQA 3NCMA 2YEVB 4FG0A 1QEWB 3CBJB 1PS3A 4QWWC 4RMTA 4M7ZB 3CU1A 2R9HC 5E6RB 3QIWA 2VLKE 2V2WA 3AREB 3FNKA 3SBQA 1KIQA 1SFDA 4PJ5A 2V37A 2IQ9H 4M5TA 3RFZB 3OKLA 4JFFA 4MKTA 1X44A 3GMQB 4H8PA 4V11A 3PWLA 2DM3A 1WFJA 3O2WL 5HDQL 5TF1L 4XC1L 1J8SA 2FEEI 4U6VL 1IGYA 5ECJE 1RULH 3HI6L 4GH7B 4FYRA 3VXPA 4ZMTA 4MQXC 2CE6A 1MJ8L 4KFMA 3UG3A 3VG9C 2I85A 1P4IL 1UEMA 1WAAA 4G8GD 4NQVA 4HGWB 3HNVH 1PKQA 1PY9A 2IFFH 5J9PB 1AS6A 4NI3A 4M43L 1TEFA 4NGHH 3QEUA 3TVMB 1N59A 1FVEB 1CFMA 4EQ2A 3ARBC 4EI5A 3UTTE 1XR8B 3DV6B 4PD4J 1FNEB 3ABKB 4NQDB 5E1AA 2RFXA 2IPKB 1NMBL 1B6DA 2HVKA 2ZCZA 4HZAA 4W6WB 3CFUA 5EBWA 1CLYL 3F7LA 3REVA 3VI3F 5JHBA 3JWNH 5EO0A 2AJVH 1FPTH 4KK8C 1P4UA 3ROOA 1TOXA 2DQEL 2EDLA 2VLRD 4KNQA 1HDMB 4H25B 5E8NB 4YBQC 4CMMB 3HC3L 3SOTA 3ZTCC 5ID1B 4MBOA 4KAQL 3BYYA 3GZQA 1IU1A 2CR6A 1A7RH 1DLHB 4ZMNA 1XGTA 1MNUH 2R23B 4FFYA 5FW8A 5KS9F 3FS9A 5LGKA 1TVBB 3G5XB 5FM4A 4B9KC 3OXSA 2P5WB 4FE9A 4MBRA 3MCKB 2FWSA 4XVUD 4XVTH 4CJ1A 4S0HA 3IJYB 1FZOB 3O2DL 2HZHA 3QUXB 2FQDA 3HBZA 3JWNE 3LH2H 1AFVL 4FQHB 1O7DE 3FB5A 1BEXA 1UZ6F 1BMGA 2XVLA 5BZZA 3STBA 1HILB 2UUDK 4RESB 1PZDA 4P9HL 4XZUB 4PQXA 2YAPA 1SOSA 2ID5A 4GRLA 1H6TA 4TQEH 4Z5RA 4JO4L 4FEIA 1DUZB 2W88A 3QE5A 2VISA 5JW4Q 3RNKA 4AKQA 4K3HA 4FQIL 1OWRM 1IGTB 5F8QC 3BQUC 5LBGA 2ENPA 4DGVL 1NFDE 1W15A 4ESKA 1QWUA 5GRXG 3MJ6A 4NS0A 3WY4A 5I17A 3TBWB 2PCYA 2BW5A 2HLAB 4XWGL 4YO0A 1YY8A 4OCNC 5GGSY 3S3PA 4GO8A 3FU8A 4M7ZC 4PLKD 3ARWA 4L29B 5I9QB 4N8VG 3OQ3B 5FGRA 3IAGC 3GTVA 2GIXA 4HH8A 1IM3B 2BFGA 2BVQB 3UAJA 4G7RB 5AVRB 1UOVA 2AEIT 4XTRC 4HIEA 4WY7L 3H9ZA 1DJWA 2W0FA 3RVTC 4EIBA 4L4TB 3EJPA 3QHZH 5BXFA 5JXAH 1MCBA 2ZX9A 2YXFA 3V5DA 5LWYL 2X38A 3X11A 5BRZB 5I1DA 1MH5B 4WUKH 5AFAA 4HLJA 5DZVA 2EE9A 2XG5A 2F5BL 4PS3A 5ANMB 4F2EA 4YE0A 4N20A 4JPIB 2Y06L 4XVOA 2NW3A 4MNQA 8PAZA 5JQHC 4LF3A 1G7IB 1T03L 5KAQG 3EBHA 2K8MA 2FRGP 4I2XB 3HE6A 1DO6A 3GMLA 2DDQH 3QNXB 5I1IH 1YO4A 1HH6A 2MTPA 5F3BB 2X53A 4P48A 5DJZB 4XP5L 3EO0B 1MI5D 2BCKB 1M9SA 2H41A 2VSDA 1QSED 3IAPA 3RUGF 1VDGA 5HGBA 3N44F 5HI4D 1IAKB 2ZP9A 4G5ZL 4ZT1A 2VIRA 3EH4B 4N2AA 3B8YA 4DEPB 2NNAA 1HE7A 3OB8A 2GJPA 1QR1B 3T6VA 3UADA 5EZJB 5KG9A 3PDOB 3P11H 2ZSWB 2DTMH 2GFBB 3KLSA 2PWEA 4OCXL 1OTTD 2GTQA 5DD1H 5CCHE 4TQPA 1T2JA 4EI0A 2R0WL 5DWPA 3FUIA 2APBA 2Z34A 3H3PL 4FQCL 1NLBL 4P2QD 1QYGH 3TPUA 3NIDE 1YNTA 1DFXA 1GYAA 3P3TA 4PY8J 1J0KA 3AWFA 2X2YA 4XP6H 1PZBA 5KVDH 2FJHB 3P9LB 1PZUB 3RWFB 5CUSL 1JYXA 4JW3A 2IBZY 4BFIB 1HK6A 2XHNA 3K80A 1JGDB 4NZRH 3ZT6A 4LAJH 4Z95L 4HJJL 5AVZB 3RVVC 1CCZA 2VL5A 3WBDA 1XWVA 3MX0A 3US1A 4O2FB 4KK5C 4N0FB 3W82A 5DTFB 5DZAA 4MNGE 1HAUA 4C56E 1WZMA 4YGVA 1K5NB 2W9EL 3CQPA 2RJMA 1GZPA 1FNLA 1Y1UA 4OAWB 4N0UA 1ECZA 5BS0B 3B37A 5C70A 5DHXB 1NCOA 3HMXL 1JNJA 3DECA 5F7DA 4TNFA 3S2AA 4GAGL 2ZX5A 3ZYOA 4PV1C 1QP1A 1KFGA 3KL5A 1BVLA 5CSGA 5JMOC 4CSSA 4ZYKA 5IHBA 3MGOA 3QJOA 1KTBA 3TT1L 2MRYA 5IMKB 1G7MB 2XPYA 1TZHA 1OM9A 1XF4B 5I9QC 2ZUUA 5E51A 3C8KA 4H88H 5TK2A 1RK0A 4OF7A 1VFBB 2QL1A 5BRQA 5IROC 3PV6A 5BZXA 1A2YA 3B9EA 4XH2B 3ETBJ 1T6BX 2H32B 3HJ0A 3PPSA 2C1OA 2NSXA 1WICA 3DROA 1ZHLA 2BNQA 3DHUA 4NZUL 3GXMA 4ZK8A 2EE6A 1KJMB 2FTAA 1CFVL 3T77A 3O11A 3K1DA 1TITA 4LP8A 3V0VB 1UT1A 2AGJH 2AXFA 4JZNB 4PWEA 2ERJB 2BSTA 2EXTA 3MO1B 1E6OL 2IH8A 1DJIA 4J3TA 1G7HA 4ES9A 4TVUA 1ED3B 4ZMQA 1KV7A 3MR9B 3NCJL 2XN0A 1WT5C 4WO4D 4D94A 2JCCB 5AVVB 5F88B 4ONFH 4PSPA 3UYOD 1GYCA 4DW2L 1UJ3A 3MJ9L 5EBLA 3TP4A 5DUPH 4DEPC 1J9RA 3G5YB 1JVKA 4PAZA 4K94C 5FO7B 3BAWA 3CX5K 4NX0A 4G8AC 3OV6A 1O9WA 4F2FA 3GSOB 5D7JA 2A74B 3DMMD 2VYRE 2RMNA 4FL4B 5GGRY 1CG9A 4WEBH 2JH2A 1RZKC 4KXZI 1K4DA 4ZO7A 3RL2B 3RZCD 2C1PA 2NY7L 3L45A 3MV7E 2WXJA 3AT0A 3DI3B 4HX1B 4YN3A 2P49B 3Q05A 3PAZA 3KS0H 1Q8MA 1Y0LA 1SYVA 4LESA 3UBFA 3KPLB 4XXDB 3ESPA 1XSIA 5DFVD 1DBML 2YGVA 3E3QC 4EJ1C 5MP6L 5AALA 4FQPA 2F1BA 4UV7L 4MJ2A 5J56B 5C08A 1C5BL 4OCMC 4JFYB 2V9TA 2C3XA 4L3EB 5SWQB 4ISVB 4XO8A 1I85C 3O6MH 1KCRH 1T21B 3N0AA 5IM7B 4UCFA 3S8GB 5T1KD 3L3HB 4LHUG 3BKML 4BFOA 3KLAB 4A04A 1G1CA 3E8UH 5K1VA 3FB6B 3FUEA 1HQ4B 1Q90A 1XVSA 2FWOB 2R2BA 5FYKU 4LCIH 1SYSA 5BZWA 2NR6A 5CSZA 4G7VH 4ZXBD 4AKPA 1KDIA 2YXMA 1V55B 2J1KA 3L4CA 1NCTA 3T0BA 1JZ8A 4PGDB 15C8L 1Z9SA 2BERA 3UDWA 3FFOA 1H3UA 2N4IA 2V8MA 4G9FB 1YMME 2Q7YB 3RTQD 4UIMA 4PI0A 5DD3L 2X70B 2V17H 1QFWI 4YHLL 2UY6A 4D8PA 4F9LA 2YBGA 3FSVA 4EOWH 1XEDA 4UILH 1CDYA 4P4KD 2A9BA 2AJ3A 2EH8L 1FQ9C 2TAAA 1MHPL 1ZVNA 4Y7MA 4YHZH 3ZMEA 4BSWB 4QXTA 4CU8A 3OPZL 5BV7L 2WXFA 1QRND 3WEXA 2YD3A 4PJAE 1RSYA 4FN0A 2EDEA 3WJLC 2IANB 1JNNL 1MCWM 1DLFH 4I77L 4Q8BA 1OY3B 3OZ9H 3S96B 1QNIA 1J88A 3FQRA 2RGSA 3P4NA 5JHDD 2FX8H 2OXHA 1MCEA 2XV6B 3D3VB 5H37A 1PG7W 3WY1A 4H8QA 2PYED 2ZX8A 4GRMA 4KY2A 4DKTA 1ACCA 2WKGA 2ADIB 3BVNA 4AJ0A 1MCPL 4UQBA 2WWKO 5C0AD 4POUB 3AG3B 4XNYL 3KPMB 1AE6L 4DZ8B 4XN4A 4X5XA 4Y88A 1UTDA 2XZQL 2AK1L 3ILPA 4Z8FL 2X4TA 2JKWA 4DFIA 4X83A 2CDGB 4U3HA 4HVBA 1I7TA 2FEDD 1K2DB 4XAWH 4MZ3A 1RU9H 1YC7A 5DK0B 1AGFA 3UTSA 5HHQA 4HZLA 3V2AR 3PAUA 4HUUB 3PJSA 4D0DA 3Q7JA 3CBKB 4JO5A 2BP5M 1KB5L 3EFDH 1A1OA 3SKMB 5C3LD 3VW3L 4JDEB 3DIDA 3MLTA 4CW1A 2FSEA 4HUVA 1IC4L 2DZEA 2A74C 5J12B 1DFBH 3L5WA 1U3HA 3D85B 3EYUL 2VLKA 1U9KA 1EZUA 1HINL 1ZE3C 1NIAA 4IBTA 3S7GA 2C9AA 3VWKB 1GTNA 4PGEB 3V0DA 4LQFH 4MXQC 3DBSA 5I8EB 5ENWB 4UQ9A 2OW6A 2JF1A 2QADC 3QUZA 1SXBA 4E41D 2HFFA 3EF4A 5E00A 1UVQA 4NKOA 1WTLA 2KERA 4G42A 4JFZL 5DXWA 3AMKA 1DJYA 4PYGA 1QLRA 3DGGA 1T4KA 3AXHA 2XWDA 5ALCH 5E5UB 2EXYC 3TBCA 4AG4H 3BP6B 4TSCL 4YK4C 2QKIA 1G1OA 4PIRF 2Y7SA 5A16A 2NDGA 5AAMC 3LY6A 4FX5A 3PDDA 2CSPA 3UTTA 2ZJSH 5T5FL 1RV6X 1NAKH 3HNSL 4AQEA 4B96A 4FI8A 4WQOA 2NY3B 3RL1A 1N19A 3HC0B 4OFYA 3PY9A 4KO6A 4WWID 4X9YA 5BV7B 4QCIA 5KSAD 4XN7A 3QUGA 1NIFA 1LDPL 3SN6N 3FQYA 3CNKA 4GNKB 4GI9A 4X7FC 1V7NL 1UZGA 2FB4H 4HG4J 1MFNA 2X9WA 4TULH 1E4KC 5E9DB 1UB6B 4PRNA 5IW6B 4WJ5B 3DRQA 1Z2KA 1Y18B 5I73B 1D2OA 4LCWB 3X1NA 3IVKA 1J9CT 4OZ4A 4ADIA 3F04A 2JB6B 3ARDC 4Y16C 5KVGL 1CL7H 3AABA 1C16B 2WTRB 5JDSB 4FHBD 3CSPA 2D03L 4LCVA 5B38B 3CG8A 4JR9L 3VI4E 3U0PA 3T5WA 3AGVA 5JOFB 1OTSD 4M5ZL 4U1JA 4F7PA 4YFDB 2DLIA 3L48A 3FN0H 5D72H 4NIYE 4JG0H 4BQCA 1RUKL 2EIJB 3I6GA 3IKKA 4NUGH 2Q86B 1X5HA 4KUZL 5EUOA 5T1LA 3MRRA 2DI8A 4FXGA 3AT9A 3P4OA 1S9XB 1NCCL 4QLRA 3EG9A 4K3DH 3FU5A 1KZYA 2OTPA 3GB7B 2FLMA 1JI1A 2PF6A 4BE5A 4KHXL 1KB5B 1I1FA 4QRPA 2MNUA 3NIFB 1Y6KR 4YHYB 3PWPD 1OSPL 2CXGA 5GS0C 4LFHG 1GGBL 4BELD 4PG9A 1NUNB 3SKOA 1V27A 3A24A 3NFNA 5BJTB 2YARA 2D2OA 3HZMA 2JCCF 4R96A 1NFDA 5D6CA 1I1AC 1AR1D 4MQSB 2JTYA 5AKVA 5DK2B 3ZDXB 2Y5TB 4LLQA 1XF2B 1A4JB 3MRMB 1V3KA 2Q8BL 4GS7B 4H5SA 1O7SA 1NCHA 4HIIA 5F96L 5FCUL 1T80A 2BZCA 2VLRB 3QISA 4U7MA 4L37A 4Z0BL 1K3ZA 4M5SA 2CCVA 1WGOA 2Q76A 1I31A 1EFXD 4L5FL 4PVBA 1YEFH 2NRDA 3Q06A 5DEZA 2D9CA 1JGIA 3UGEA 3HCVB 1U8MA 2GSGB 2DMKA 3VWKC 3KE0A 1N10A 3C6LD 2L0DA 2FQGA 3BH8B 3TXAA 3VFGH 4X99A 3GIVB 4O4YL 4Y2DD 3UPRB 3HRZA 3FT4B 1ZSDA 3L3GA 1U42A 1OQXA 3PFUA 4BH8B 3EUUA 3UAFA 2WMPB 4M8VA 5K1NA 2MTAA 1UA6L 2NYZA 4G8EB 2K4WA 5KSBA 3CWGA 3NH7L 1EDHA 1FFNB 4OSUL 1RCYA 2VXUH 5F1IB 1C9SA 1DJZA 2Z31C 1TTUA 4K8RC 2KDYA 4ZUUB 5IB1A 5E24E 4B5EA 4E9TA 1TJHH 1A5FH 5GJTH 4HHAB 4QGYA 4KX9A 4HUWB 1OT4A 1BQHA 4ODVH 5JORA 3QHFL 1DBAH 1DEDA 2IC2A 4PM1A 1F3DJ 4KDWA 1ZV5A 3V4UL 3CDGB 1QFWL 1C7TA 1DVFB 5BOJA 2ILLA 3IN2A 1EJOH 1TLMA 1XMEB 1A3RH 5DUBA 4EXKA 1I3VA 5DQDH 1Z7JA 1HZKA 4ICWA 5C0GB 5I1HH 1A7NH 3QEHB 1QLEL 1NM4A 1TQCC 2PYFA 1E50A 4PFEA 2VXQA 3D9AL 5DSCB 3SCMA 3OKOB 3MCLL 4XBMA 1U8PB 5I73C 2WV3A 1GOFA 4GUPA 4WTQA 1P7HL 3T3ME 1QI5A 2GSMB 2JI3A 4U6XA 4JJOA 1QVOB 4HEPA 2WIIB 2G60H 2OMVA 2X1QA 4X8JB 3X12A 4MQ7A 1ZOXA 3RJQB 2VM4A 1W8NA 3EO9L 4B9JA 3D2UA 5HGDA 3VFSB 5IHUL 1HE8A 1KCSH 2FR4B 2EH7L 1RZIA 3ZR6A 8CGTA 4JPWH 4UTAL 1S9VB 3A6CH 1E90A 1KGJA 3BGFC 1AHWC 3X1BA 2DJSA 3QDJE 2A4ZA 5J1SC 2ZWNA 4KDTC 5HHOE 4NFCA 2J8HA 2NY1B 4HS8L 4XCEA 1X3DA 2YBRB 5I28A 2WM0A 1MOEA 3MROB 1QOKA 1D5XB 1LNUB 2J4WH 2YSSA 4C55A 1FJ1B 4Z6AT 5GGTH 4MNGA 1IGIH 4C56A 3V0FA 5C7XL 2V2WB 1R3JA 4B9IA 3EDEA 5GZND 5FKPA 1F56A 1AANA 5DS8B 2ED8A 4UF7C 2X4RA 1Z5HA 1VCBC 1RD6A 5T1JA 4Y2NA 1ZV9A 5ESQA 2QMJA 1EHLL 4LHJB 3RX8A 3ZJAA 3BAEH 3C8HA 3L2LA 4MZIA 4YDIH 3UO1L 2BNRE 1IVTA 1CN4A 5TE6H 1BVNP 2NSMA 3VWJC 2A9DA 3G04A 3R0NA 7TAAA 3WXWH 4FZEL 3ZSTA 1Q72H 4EDXA 5AOMA 3VFWA 2PPEA 4CNIB 1CICA 2P26A 5E7BA 5GSRB 4ALAL 1YEGH 1VZGA 1KFAL 5FS5A 4P2QB 4BUHA 1SUHA 3CMGA 1PY0A 5E1AB 3K6DA 5D1QC 4U0RC 1RMFL 1YYMH 3LKOA 3WEAA 1EHNA 3K2IA 3NJVA 4FKEA 1CLCA 3DHPA 5D5ME 3OXRA 4KKNA 1I1YA 3FU6A 1X4ZA 2ICEA 4R90H 2J55A 2H8PA 3F6IA 2PO6B 4JO3L 5KBKA 1NZRA 2VERN 2QZ5A 3U83A 1QO3A 4TUJA 4ANUA 3DDFA 1I9JL 2OTUB 3TA3C 4APQA 4ZMAT 2F54D 3FQWB 1UH3A 1ZA6A 1UB5A 4JKKA 2HG5A 2BFVH 1Z5LB 1MJUH 2BSRB 3MTRA 3ZKMD 4GMSL 1W0WA 3PREA 4BV1A 1AI1L 2AVFA 5A6IA 1IZKA 1AZCA 1DVFC 2DLHA 3MNZB 3MOBH 4EO5A 3UBXI 1OAKL 5DZNA 2YZ1A 1FFOA 5GS1A 2A77H 2FYVA 1OE1A 2ITFA 5CZVH 5IQ9A 2E8YA 3M17B 3RIKA 1YEHH 1IFHL 4P5TD 1ODUA 2Z8VC 4X6BA 3EFFA 3NSDA 3OMAB 5GIRB 3T65B 1BPLB 1QKZL 2XWBB 1N0LA 2BIPA 1HHHB 2JKXA 3KL3A 3VD0A 1JVOA 3KWVA 3MV7A 4L4VD 3K71A 2GJJA 1CE1H 1W8OA 2EIEA 2L3BA 5DJYB 1ETJA 4GAYB 3E6HA 3IM1A 1JGUL 4M7JH 4OFPA 4G1EB 5C09E 3HZ3A 2HMIC 1N0XL 4HF5H 1V10A 1WBYA 2BY1A 2IPUK 3MUGA 1BYOA 1Z6JT 3LRKA 5I24A 3KPPB 2R69A 4OLWL 5CLYA 1OCZB 1BIIB 5DUML 1TYRA 1GH7A 3Q5YA 4E42A 2AHIA 4HJTA 2QTEA 1F1AA 3C2AL 1X5YA 2ROYA 4IOSA 2NY1C 1FE8H 1SXCA 3QXUA 4BK8A 2WN2A 3NABH 2EYSA 3NIFF 4CVZB 4HCRL 1S2EA 2JK5B 4ZO6A 4G71B 1A3LL 3QIWC 1B4LA 5DF0A 1OTUD 4Q2ZB 3VQ1C 5LO7A 3SPGA 3QG7H 4W4OA 4XRCA 5DR5H 3RZWA 3GM8A 4TM9A 4WO4B 3ZDXF 4ZSOE 2VSMB 1IEBA 2GVYA 1XBRA 4HIEB 4S1SH 2HT2C 1HSAA 2BRRL 3VH8G 4M6OH 3LQAH 2IEPA 4AC4A 3V5DB 4F5CE 3X11B 1MDTA 4J1UA 1QUNA 1T0OA 1BFOA 1GSMA 2APVA 4FTVE 1S7VA 4XB3A 1D9KA 3RNQB 2CO4A 1MWOA 5FYJU 3V0GA 4Y19A 2XIIA 3DX1A 3D2TA 3QS2A 3F83A 4YDKL 3TJEH 4MNQB 4X8CA 5D96C 3VD2A 1N64L 3AFLA 2WINB 3X14A 3RZCB 1P69B 1HH6B 4EI5C 3LX9A 3EOYG 1QPXA 3V95A 4LARL 1HHJA 4YXLL 3OG6B 5FWRA 1JNHA 1FRGH 2N1KA 4TTGA 1LMKA 2VIRB 3E9TA 1GIGH 1P7QD 2NXYD 3UCQA 2EABA 1HH9A 2PO6C 4KTDH 3VTMA 5KG9B 5SWZD 3DUSA 4ICXA 5INCA 2OYLA 1ORQB 1J8RA 5IR1A 3A6OA 3VSQA 4NN7C 2OMXA 1QBMH 3CZFB 1CGSH 1T5WA 1UH2A 3EDFA 4UQIM 2DY2A 5FPIA 3L3JA 1L0PA 2VZVA 2K45A 2M83A 2Z91B 3OJ2C 4FFWC 3QCUL 5FGCE 4ZXBB 2W95A 5FOBA 3TPUB 5GRJH 1EBAA 1KLUA 4QHMA 2YD1A 1EXHA 3N41B 3D87B 3DV4B 3DX7B 3N5AA 4PV8B 1CYXA 1V5JA 2APTA 4RZCA 4PLJD 4W9ZA 5DC9B 2PNDA 3HI1B 1G1KA 3GRWH 2CR3A 1XL4A 1PF3A 4KJWC 1MCKA 4OLXH 2J88L 1KPRA 2ZXBA 1QW9A 3O3BA 4GBXD 5I2IA 2MOGA 3L9BA 2G3ZA 2LVCA 4XMWA 3G08A 1CLZL 5IGXH 4OKVA 4J3OG 4OIFA 4S0SD 4GRLC 5LBSL 4DEWA 3MX0B 1ZMYA 3J07A 5IK3B 4IRSA 3QJRB 4FLRA 4HEME 3W9EA 1W16A 4YHNB 1YJDC 2O5NA 1QRNB 3DOIA 3RX9A 1E5BA 4DP1X 4PIBA 1RAMA 3WIHL 5E08L 2IDUA 1T0NA 1TVHB 1N67A 3ILEA 3CZGA 1F1DA 2P8LA 3W0WD 3S8FB 5JHDB 1JZ3A 5ALBH 2E7DA 5ISZE 4N5ED 1AD9B 1BJMA 1T66C 3F58H 4WTZA 3L5JA 3TO2B 3MACH 4LLUA 3N85H 3V0JA 5CD5C 3K2MC 4E36A 5KYYA 3MGOB 1YC8A 3P4MB 4WK4B 5C0AB 3IJEA 2GJ6D 1MFVA 3MRJA 4IJTA 4DOHB 1NCDL 4DKEH 1TZHB 3GO1L 5AQ0A 1ZHNB 3EJJX 1EK3A 3C8KB 4M1GL 3EGXB 4DETA 4PB9H 1BX2B 5FB8A 2Y72A 1UWFA 4UIKH 3UAJC 1IAII 2GQHA 2JXMA 3O81A 4IU3A 5DDHB 5E2VH 4MFHA 1TMCB 3NFPA 2QVFB 4J6RL 4NNPH 5L8JB 1J11A 1HWWA 2HWZH 2WQWA 2NX5E 1FLRL 3MBED 4ZX5A 2B08A 2J44A 5FF6B 3B3IA 5LCVH 4QHKJ 2O5XH 1IFRA 4LQ1A 1CFNB 1NQBA 2COQA 1YLBB 1WAAF 2H2SC 3T77B 5C0IA 1EGJH 4AEHL 4GEIA 3B9KD 5I71B 4GXVH 2YIHA 4FNQA 3FSOA 1A9EB 2AI0L 3VG0L 4TSBL 5CJQL 3HE6C 2MCPL 4OJFL 3VI4A 1B2WH 4YPGB 5IQ7H 2YAMA 1TVDA 5CGMA 4DTGL 1YPZE 4E41B 2XVKA 3IDNB 3PABA 1UJ3B 4G6KH 1OGPA 2XQBL 1YMMD 2ORBH 4QHNB 1NCWH 2GSIB 4FXLA 3S4SG 1HKLH 2NOYA 1UUNA 4AY0A 4DK5A 1IBZA 1KEGH 2D8KA 2GAZB 1Q9WA 4LASL 3B9AA 1S5HB 1YMHB 3PHQA 4MXVE 4OU3A 5B3SB 4TRPL 4KKPA 1JSYA 1M6OA 5MHSE 5DA0B 4NHUB 2D7OA 2FZ3A 3D0LA 4ENZA 1LE5A 4M7LH 4OB5H 5ICZB 4NNXA 5DFWH 3BKCL 1EAQA 5F6HI 4GQRA 2WW8A 1YQ2A 4XP9L 4D9QE 1KG0B 3K2KA 4X5WB 3JWDL 4XP4H 3QNZA 3FHAA 2NYKA 3WEOA 4OI7A 1S46A 3H4FA 4Y4KA 1JPSH 5LXGL 4M6ML 3RX7A 4NJ9L 5G2NA 2G9HA 2RACA 1CD9B 3WE1A 2XZCH 2Q0ZX 4XNXL 1A64A 3P77B 1E7UA 5AVTB 5FUOH 4KROC 4K5MA 4WVRA 1JWMB 1SY6L 3TCXA 2A9MH 1GA2A 2IV8A 4EI6A 2WXKA 5KYUB 3QYCA 5AWNH 1CBVH 4M48H 3MOQA 2CRZA 4AENB 1SNRA 4AWJC 1ASPA 1GAFL 2WNGA 4LNRB 1ZK5A 4UQ2A 1CTOA 1FAKT 5D6DA 4UM8A 1MRFH 4JFQA 1FL5B 3GI9L 3O8XD 1Z9NA 1WAEA 3V8CA 1FGVL 2PWDA 4KZEH 3MV01 4IBQA 4PJFE 1KPUB 4DQAA 4G43B 7CGTA 3AMLA 4XHJD 3PWPB 1O7VA 2IQ9L 3R1GH 4MWFB 5CXPA 4AL8C 4IM8A 2A99A 4YWGL 3VD1A 3DX3A 4J28A 3SDCA 5DRNA 2FEDC 2F0CA 4O02L 2OMWA 3OMZA 4FKHA 1AR1B 3QUHA 5C7ZA 4KC3B 4ZUSA 5IIEA 4WWKD 4JY5H 2HFGL 4I7ZC 4FJYA 2H26B 5E4OA 3MA7A 1RULL 4PBWD 4M00A 2Y2YA 3NRFA 3FQRB 2AK4D 4WCYH 2OXHB 4F80A 4QJ5B 2ZX7A 2RQ8A 3HNVL 4PJXE 4G8GA 1EFXB 4S1DD 1U8NA 2UZIH 2WZ5A 5I71C 3PIQB 1SJVA 5HHPB 1SJHA 2Y7QA 4X5XB 4CUCA 1BAFL 4BCZA 3C6LB 4LHUD 1NDTA 2HTKD 5F1SA 3FBKA 5JO5B 3D07A 2F7RA 2BP0A 2A9NH 1ZKAA 2YPVH 1MREL 1I7TB 1I7ZA 3LRSB 4YSDA 3TBYB 1Z3GH 2AJVL 1FPTL 2W0PA 2ZWZA 3IMUA 2EDRA 2G3MA 4WNQA 4K3JH 3UTSB 2IOIA 3H1ZA 4HZLB 5HHQB 3K8MA 2A6KA 1UJ3C 2BJML 4D0DB 2Z93A 4LDOB 3VXRD 2E7CA 2WCSA 2PW2B 4K5NA 3MLTB 2YD6A 5HHOA 2J71A 2H1PH 3G6DL 1DUYA 4YSAA 4GG6E 2CUHA 2GTZB 4HT1L 5D7JC 3OX8A 3GYRA 1DQJA 1WZKA 1CC3A 1U3HB 2YEQA 1NC4B 2SEBB 2PPCA 5F7FA 1RZJH 4U6HB 3OPUA 4Y5YB 1UA3A 1A3ZA 3VD9A 3WFDH 1G9NH 4HIJA 5FDWB 1BBJB 1EHAA 4IEFA 2DEYX 3QI9A 4XVTL 3MZTA 4TUOA 3UO8B 2ZKYA 3N41F 4Z0XB 3AT8A 3QUZB 3KR3H 5C0BE 4C59B 1XXFC 1UVQB 2BS71 2ZSVA 4NKOB 2YD5A 2BNRA 5TQ0H 4A7SA 5DS2A 2G2PA 2JJTA 1NCBL 4JO1L 1T1ZA 1QEXA 3ULUC 5KSUA 3FK3A 2J72A 3TX4A 1DBKL 2J21A 5I18L 2QKIB 3P1VA 4X5LA 4M56A 5A16B 2PCXA 2AXGA 2WQ8A 2L04A 3LNGA 4IBWA 1FL3A 3GSUB 5LAXA 4NO3B 2ZX6A 2WXQA 1WD9A 1XQ4A 2WCGA 3U4BH 4M5YL 4FLHA 4IMLA 2CHXA 5GGTA 5CBAA 3IGAA 4GKSB 3K2UH 4JQIH 1VAHA 1ITCA 4W6XB 3OAZH 1HNGA 2NR6C 4G8IA 5D5MA 2ATKB 3NQKA 4EUPB 1P0SE 3AS3A 2DQCL 1HXMA 2VDKH 3QCVH 4QCIB 4QIRA 4CMHB 3DX8A 3UH8A 3ZDZE 5AVUB 3PWNA 3GLDA 4K2UH 4NO0D 2NXZD 4Y5VA 3PP3K 5ECGA 3RHWF 1F97A 3UDWC 5KZCD 3B2MA 3BAYA 4U3SA 2JKJA 1YNKH 3KYNB 3C87A 2XKUA 2P28B 3A4FA 3FOMB 4FMFA 4CN6A 2HFEA 4FG4A 2HPOA 5MEND 3D4YA 3VFPA 4F9LC 3MPCA 4NC1C 3CH1B 4GW1A 4B9GA 4QR7A 2WOBA 3DBXB 3IVKB 4B3VA 1UOKA 1UOWA 4OZ4B 5EORL 1E4JA 5B3JF 3SGJA 4WK2B 2H9GB 1NC2D 3KDMA 2J6WA 4M8QB 4OUUB 1EMTH 3LN5A 4LRIA 1A6TA 1EANA 2NY2D 3QEGH 4YS4A 1AP2A 3TA4D 5K9QG 3ZTJH 4XPGL 2SODB 3KPRA 2DKMA 1PDKA 1DYZA 2R4RH 3AS2A 2EECA 2R1XB 5F21B 4HOMA 2L7QA 4OZFB 3OR7B 4P57A 2OZ4H 5EFIA 2F58L 3DURA 1UD3A 2R7EB 2PR4H 2ZG1A 4XCFH 3MRRB 5T1LB 3P4OB 5EC2A 4XNMA 3GT6A 4V2BA 1KB3A 5EN3A 1ICTA 4S2SA 4N2FA 3IJHB 4XNQA 2QV4A 1KENH 3MV11 2IH1A 3BKYL 5AKTA 2NLJA 2RIKA 1EXUA 2MEJB 2WYZA 3H0TB 2CK0H 4I0PD 1Z9PA 4OV6F 1R47A 3HZKB 3QC5X 2WZ0A 3NFNB 2Z3FA 3VYNA 4EN3D 5C09A 4Q9QH 4PWJA 1NFDB 4QF1A 5D6CB 3RGVA 4F58H 1ID5I 3SHSA 5JMRA 4YHOL 2OX5A 1JFHA 3NSYA 4ANKA 4JCWA 1KC5L 2IAMD 4ZAKD 1PZAA 5C86A 3Q8FA 4HIIB 3T2NL 3PG2A 1MCLA 5E6ID 4YXKL 1L6XA 3FL7A 1HC1A 3PXLA 4M1DH 1RJLA 1U3HC 4PS4H 3ZK0A 1TQBB 4FAAB 5IFJA 2F54B 4BCYA 4JGNA 3WCYA 5E4IA 4ZW7A 3CV5A 5KN5A 2W65A 4LPVA 1OGTA 4L9DA 1UEYA 4ZSOA 1FFRA 3JWOL 3BSZL 5LN8A 4X99B 5D7KE 1J5OH 1RZQA 4IIZA 5L8KB 3MFFA 1FVDB 3C9NB 3QUZC 4OW6A 4WV1B 3V0HA 5ITFB 2WZPD 1TZOA 2MKWA 4GKZA 4FTVA 4P46A 2HFTA 2HKHH 3QDJD 1IC5H 3B6SA 4HJ0C 4P5TB 3BJ91 1A6UL 3WYRA 3OKKA 3MUZ1 3C12A 5IB1B 1C8QA 1KPVB 5AB2A 3GJEB 2QKIC 3O2VL 3ULSA 5EUKA 3MRQA 1I7RA 3AWGA 1CDCA 5TJWK 1T0MB 3KLLA 3KS0J 5I0XA 4LFHD 2CDEB 5GGSA 2DQUH 1K3IA 3NESA 3MHZA 4K5PA 5TE4L 3HFMH 3P2DA 4ABQA 4AM0Q 1YEJH 3PGDB 1R75A 4CMHC 4JHWH 3EJTA 3SGKA 2ZE0A 4XP1H 5C0CE 4LGPB 4IJ3B 4PLOB 3SE3A 2VMDA 2EEAA 5HYFA 1M71A 4LSPH 4PJ8A 3S35X 2PP9A 1T04A 4JN2B 3WN6A 5E2JA 2H6PA 1T22A 3UYRH 1NGQH 4EPSA 3C5ZD 2UZPA 2OXGA 2ZCHH 1HL8A 3JUZA 5EEVA 1LMIA 1C5DB 2HB0A 3NIDB 3RQ3A 5IMMA 3M1BA 4MQ7B 2DQDH 2ZOKB 4I3GA 5J6HB 1E9OA 4KMTH 5HVHC 1ZLSL 4DP9X 1AIZA 3ATAA 2WOYA 4RGOL 1D5ZB 2EICA 1VCAA 4FXGC 4MJID 2QTVA 2AGJL 5EO9B 4PRPE 4XO5A 2AAAA 3BH4A 2LTQC 4LU5H 5IHZB 3MA9H 1FHGA 1WS8A 3CFCH 1IAIH 4A6YL 1IL1A 3I2CL 1JZIA 1BEYL 2A0LD 2D0FA 2Z8SA 1YNLH 2ADFH 4HEMA 3WUWG 1A14H 1R3HB 2YSSB 2GBTA 5F9WB 5T33H 3X1FA 2VLLB 1QNZH 2PP8A 3KXFD 3QWOA 1THCA 4BSVA 2XG4A 2Y3AA 4BGDA 2V7NB 3ULVH 3V4VH 4ONFL 2CH8A 5F8RC 3ZYIA 3HTLX 3CCHA 1SQMA 2CIIB 4KJPD 3WUZA 1A02N 3AU0A 1P7QB 3FUKA 2NXYB 3FTZA 5JHAA 2Z0UA 4RX4A 3GRWA 4IMKA 1OALA 5LBVA 1OB1A 3KL0A 5J6SA 4XCNA 3U2JA 1XCWA 4I3RH 1XF1A 5DJDA 3BAIA 5I0ZA 5J7CC 5HBBA 1AY1H 1Q4NX 3EOTH 3F12B 3DYPA 3L3DA 5DMGD 4YSQA 1TQBC 3G9VA 4HDIB 4NN5B 1AGCB 1G84A 4EDXB 4N8VB 4NRYA 3VFWB 1HOEA 1J12A 4PW9A 5HGAA 4PP2B 1WZLA 9CGTA 3IWVA 2H7WA 5CGTA 3HRZC 1TZGH 3ULVE 1NGWB 2D7TH 3LKOB 3F5WA 5EBGA 3BWAA 2R0LL 2Z6FA 2HTLD 1YN6A 4QAWA 1WVZA 4Z9KB 1MAML 1WCBA 3L5IA 5CZRA 5JQ6L 5JXED 1NCIA 4HWUA 1IBGH 1GPOH 1E5CA 4GBXB 3Q2NA 3WIFB 2F7IA 5DCCA 1IBFA 1H9VA 7FABH 5IUSA 1NJ9A 4PSRA 2JVUA 2PCPA 2P8MA 3EYSL 5IHWA 4QOKE 2NT0A 5C1MB 3UJIL 2A2QT 3BIBX 4LCIL 3ZXAC 3APDA 5F3BA 1XT5A 4KX7A 4ZS6C 4J2XA 3HHSA 4MHHG 1YPZA 4NFDA 5IVXE 1MAKA 2DYPA 2ZIDA 5AOIA 2ZZUT 3UBGA 3W0WB 5KSVA 1A66A 3HLAA 3U4KA 2X1PA 3VGDA 1MLBA 2DWDA 4P8QA 1T0PB 3L6FB 4IJ3C 4PJGA 1MPAH 3WHXA 5IQ9B 3RTQA 3DO7B 2QR0A 2BOBA 5LCVA 2L7UA 2R0KL 2X2UA 4DT2A 3QO0A 4X80H 5KTEH 1EGJA 2XZAL 1ZLUK 2GJ6B 4NZJA 3GMPA 1HX0A 4JCLA 3QQDB 3TFBA 5JHMA 4ZO9A 5C97A 4L05A 5LUMA 5IOPB 2ZYSA 1LO2H 4WFGD 4KI5C 5EOTB 1W6WA 4A6YB 4XOEA 5TDNB 3P9MA 1ES0B 4G80A 4KTEH 1T20A 3W57A 4LPXA 1FYTD 4WRLA 3MBEB 5IFAH 1VADB 2V5SA 4UBDD 1WBYB 1QATA 1RHHA 1THAA 5T8IA 3WN5A 1IAIM 3NEOA 4CN1A 5J3HD 1HZLA 2CM5A 1UG9A 1F11B 1NMCB 4GW5B 4OGAD 3RVXD 3UP1A 3KCWA 3B9KB 4JKPH 4N1EA 3W39B 3DLQR 1HTYA 2R27A 4MD5A 5F9WC 2IBZX 4LB8A 4XCYB 4ECNA 3RI5K 1RU9L 1T1YA 1NFDF 3LDBB 3I50H 5F7LB 1AGBA 4B5ZA 5GGRA 3WXVL 4F91B 4XX5A 1AMYA 3F85A 1SHWA 1AS8A 3KYOB 1YMMB 1PCXA 4J1UB 3GUTB 2BXZA 5ITBH 4PJFA 5IBLC 5L9DH 3UZVA 2H3NA 3MRHA 3VO0A 1DANT 1ILUA 2WNWA 2WYHA 5DD0L 4HQQH 1T5XA 4QRUA 5D1XE 3I75B 3KMDA 1BW8A 1CICC 4PJAB 1UT9A 4HETA 3UCRA 4KGJA 1B9KA 2AJSL 1H15B 2G2NA 3MYJB 3AXLA 4WJG3 1HHJB 1JHLH 1R4XA 4KGLA 5CHNA 3IDUA 4NQSB 2FX7H 2YKLH 1G9ML 5ISZD 1RSFA 1FNFA 1IILE 2QMKA 4LGRB 4MCZA 4UINL 5EZLB 3RB5A 2ICEC 3OMIB 1BD2D 2JTDA 3O3AB 4WU7A 3V9EA 5JOPD 3KLKA 3INUL 3MAWA 2VWEC 2VJ0A 2H3KA 2ZXAA 4L1SA 4PU2A 1ZLDA 2VZTA 2IBGA 3POCA 3U0TA 1E42A 4XMPH 1X5FA 1DJSA 4Y5XA 3MC0A 4APQC 1TJIL 2ZCKH 4AUYA 1T5WB 5EU5B 1F3JA 1W72H 3L3JB 1J0YA 4PCKA 2LU3A 3C75A 1KCVL 5KVFE 5IEKA 1I8KA 4BH7A 5DHMC 1EEUA 2NX5D 5GZOD 5MI0C 1G6RH 1KLUB 2EO7A 4K7FA 4PRHD 4ODXB 5JNYA 1BF5A 1A7OH 1I3GL 2IH9A 1GHFH 1JZ4A 3MJ8B 3L8QA 5EIQA 2OK0H 1KYFA 2O5ZH 1LEGB 2Z35A 3QDMD 4O58H 2Z4QB 1NBCA 2JE8A 1KELL 3HR5B 4P2AA 3WLBA 5CEZH 3V4LA 3ROLB 3RI5F 1CL7L 3D08A 3N1FC 5AB0A 2ADGB 3D4ZA 3NIDF 1ACZA 3MU3A 4IRSB 1KTRL 3QORD 3OAYK 1KGCE 3LEYL 2NUTA 5CD3A 3F6JA 4YSCA 4UOZA 5D72L 2BP8A 2YPVA 4G6FD 1WA2X 4R4NC 4JG0L 4WWKB 3FT3B 4G6MH 4M3JA 4N0RA 4S10A 5C0BA 3VXTB 4XWOC 4NUGL 4DUWA 1R24A 4MA7H 2P8LB 4MRBA 4LLYB 4DNLA 5CEXB 4ZFOL 1WJ3A 2J43A 2X40A 1PPIA 3DVFA 1HHKB 3ATFA 3MGAA 4FFZH 4G8FA 1AYRA 3D0AA 2EEBA 2WJ7A 4HIHB 8FABA 4MS8D 4A67A 5FA3B 2NCMA 4JHUA 4DPBX 4E0RA 1KBWA 1B0GB 3THML 4AH2B 2DQFB 4Z7WE 2QPFA 4AYBA 4DSYA 5CEZE 1RZ8A 3FZUD 4LHUB 4BUQA 1AQKH 2BC4A 1SOKA 3MV8E 2YMTA 4ZPTB 2VR7A 4W4OC 1RUAL 2IGFL 3IAQA 3LDBC 5FB8B 1OD7A 1F4HA 2PTVA 3NFSH 4NQCA 2JXMB 3GINA 1S7XB 3SGEI 3NDYE 5HHXH 2NCEA 2YXVA 3VA6A 3TONA 4D9QD 3GGWA 1U21A 2JCWA 2G75B 3VXRB 2F5AH 5CGYC 5CP7B 3BZEA 4P3DA 5INDA 4O5LH 2VW7A 4I48B 3T04D 4YDJB 4HH9A 3NJFA 1DBJH 1LO4L 3LN4B 4DWHA 4OCLC 3EZJB 4BSJA 4Q9RH 1JGVL 1ZHKB 3BZ4B 3IETB 3AAZA 4HMEA 3ZR5A 1M57B 4X0KA 3ZYJA 2ZT9C 4A7UA 2CJUH 1WS7A 3VI4B 4CDGC 2EVIA 2VW4A 4APXA 4JQIA 3IK2A 5F3HB 2VN6A 5ILTH 4GT7A 1JF1A 3DUHA 3D7PA 1URZA 4Q9CA 2VJ8A 5TPWH 4GLRI 2NZIA 1YYLH 3P40A 3TLRA 4XPTL 1SN2A 3UIZA 1BZ7B 1AOZA 2IGLA 1A5FL 4I0KA 4Z7UE 4ODVL 2RB8A 4Z78A 2WBJA 4AKOA 1Q9WB 3AQXA 1T3FA 3CLFH 3PHQB 2YPLE 2IDCA 3JV0A 3QQ9D 1VGEH 5AVYB 3TT3L 3I74A 1X5LA 4F20A 4ZJ9A 5I1AA 3ENEA 2EDWA 2CKBL 3EJUA 3GSNH 5I1HL 2RQEA 2NXZB 1L3WA 1SXZA 1P4BL 2GJZA 3RWJA 5KZCB 2VN5A 2JELL 4NIKB 2OZ4A 1Z5YD 2YN5A 1UXSA 4RMRA 1ADWA 1AQMA 3K6NA 3WHE0 5MENB 1ZLVH 4ZFOB 1J0ZA 3OHMB 3BHBA 4R5VA 3EBIA 3C6SB 4WSGA 2ZCLL 1GR7A 4ELMB 1NC2B 3FQXA 4IRSC 3HMWH 2CBQA 5F89A 4X4YA 1H6FA 3UL4A 1KCSL 4JBSA 2NY2B 3LVTA 1WWAX 3LNDA 5IVOA 1EAPB 5ETUB 4JG5A 3M8OL 4FA8A 1XAUA 3GBLA 1YQVL 3GI8H 3N06B 3ZTNH 2D4FA 1REIA 4H8WL 5T3XH 3VCLA 5CR1A 1RFDL 2AVGA 2VDRL 3FRPB 3BLBA 2I26N 3F7YB 4KZDL 1ILSA 4XBGA 2FL5B 2WBXA 3MRDB 1OAQH 4I0PB 5IZ7A 1CFBA 3F7VB 4LL9A 4F33A 2HH0L 5BQ7B 5L2KE 1N6QH 3SDCB 5DRNB 4EN3B 1RIUH 2J2ZB 3SBRA 5L4FA 5C6WH 4XI5D 4BZ2H 1FZKA 3IDGB 5IIEB 1GGCH 5C0CA 2XWTB 4EXPX 2E27L 2IAMB 1SXAA 2KUTA 4OT1H 3ESNA 4P49A 4ZAKB 3DVGA 1RJYA 1WWWX 2C5DC 1IQWH 5E6IB 2BPBA 2Z1PA 1HVXA 1JRHH 3AY2A 5B39G 1TTAA 3WXWL 2I9LB 3LN9A 1KIPA 2WLHA 4IGBD 4J8RB 1KBBA 4U6YA 1B0RB 3T3MB 3ZMNA 5T3XE 1YEGL 5I8CB 3IDYC 1KXTB 3FCTB 4PJAF 4TVPH 3S37H 2CIKB 2QGCA 4MXWH 1CT8A 1F13A 3EW3B 3G5ZA 3ES6A 3MUUA 4PJHB 1N5AA 3VNZA 1I7ZB 4QHUA 1PJWA 1UADC 5FO9A 4L2LA 4ETQB 2I5YH 1I9RH 3O4LD 3S35L 2I27N 3WMPA 4F9PA 1J5CA 2VL4A 5IMOB 2Z93B 3QDJB 4WI0B 3B2PA 1CXLA 4PRPA 4RBPK 4GEJA 5E8EA 3BJLA 2CKBB 1U93A 5HHOB 5I1CH 3TH4T 1UWEL 4NRXB 1QTYT 3NCBB 4MJ5B 1QI3A 1R3LA 1KLFA 2NUPA 35C8H 4NLHA 4GUOA 1YEEH 5IEHB 4D9RE 1GYUA 1M05A 2NY4C 2MOQA 4JQXA 4LLWA 4TVPE 2ITCA 4RDBA 5KANI 3L4YA 4NQED 2R51A 2A77L 3U1QA 4JLRA 3F00A 4DVRL 1UWYA 4HFUH 5JZ7D 3ZE0B 2WYIA 3DJRA 1MEXH 2BNRB 2W5PA 3V5KA 1K6QH 5TDPB 3H3BC 4KKRA 2YWZA 3LEVL 4I4WA 4HC1H 4PG2A 3CHXA 1FG2A 1OARH 4ODSH 2B59B 2XN2A 2G0LA 2GBAA 2J5LC 4A7GA 4Y4KC 3C5ZB 5JW5A 3CFMA 3VYOA 3RLSA 1P7KB 3O6FD 2VQ4A 4ES8A 2AXGB 4HJGA 3I6KA 3JV6B 4PRIA 3T0XA 1NOLA 4KHTH 4L4VA 5LAXB 4M4PA 3AQDA 3VXUE 3CVCA 2VDRB 4IMLB 5CBEA 3QA3B 3NQIA 1A1NA 1S7QA 2EIBA 3Q2LA 4X50A 3BOVA 4OF6A 5CO1A 5BVJA 3V4VA 1QACA 5IT2H 3QUKB 5HYSA 3LRLA 5D5MB 4UI2A 3V4PL 1L4IA 1UXLA 3DX8B 2EUXA 4G6AC 2FBRA 4KK9C 4Y5VB 1NAMH 5D6DC 2I60L 1SEQL 2Y36H 5D4HA 4U3SB 1FO0H 3FQTA 3G6AA 4N1HB 1RH8A 1S9WB 1ADQH 4GFTB 5KYWA 3MRBB 1V7MH 2FGZA 3BMWA 5IVXA 3SDCC 1KZQA 3KDMB 3L4ZA 3NK4A 3WS6A 3KPNA 2OL3L 4DGWC 3LQAL 3MLXH 2O6FA 4G11A 4N6RA 1A4BA 1CDGA 1U3YA 1U4EA 1L6PA 2VITB 1R34A 4AIOA 3SYOA 1H3TA 5B1KA 2WXHA 1NCUA 2OQJB 5C0JB 3N1MC 4YQXL 1LWJA 3QQNA 3SDDA 1S9YA 1BP3B 1CB4A 1VFOA 5IF0A 4BKTC 3S36X 3ARGD 4S2SB 4UU9B 4YUEH 5EZOL 3AW5A 2ZUQB 4JRYE 2IH1B 1PNCA 4YX2L 3WJMA 2D2CC 3DXAE 4PPTA 3VI4F 2D31A 2QPDB 1IQDA 1R5IA 2D7PA 2J73A 4GO9A 1JP5A 3TBVA 4NHCL 1PQZB 1QWNA 2J6EL 2EILB 4OGXH 2G3NA 1FRGL 1SJXA 2YPKA 4Y7OC 4P2CG 4ZMWA 2OJ1A 1GIGL 4P5KA 1QHOA 4FA7B 2PW1A 4PJ7B 4N2MA 4OF0A 2OX5B 4DGIH 1L7IH 4I3SH 4UOW0 1VJSA 3VFMB 5DRWA 3RDJA 5SWZA 1SMAA 4LVNC 1FBIH 1ZWIA 4W9IC 2CO7B 1QBML 3P2BA 2OTWB 4X6FA 1J1OH 1CGSL 1IM9A 2ZXGA 5F1NA 3IGKA 2UY7A 5C0ND 2H6OA 4GKOA 1KN4L 4HYTB 3N1PC 4J7RA 5IUCA 5DGRA 1Y7VA 1XCTB 3DSFH 2P8PB 4P9ML 3D09A 1DN2A 4H8UA 3QI9C 1QBBA 1A22B 4PW4A 1OXYA 3WO4C 4U6TA 1P84K 5EPMA 5JR1H 2EIKB 3SD5A 2R29L 1E3FA 1NDGA 7PAZA 3CJJA 3CXFA 1CGYA 4OLXL 3MLZL 4GKZB 3WLWC 3M45A 2JJTC 2YS4A 2WXMA 4ABWA 1KYAA 1AR2A 1RQ5A 4P99A 3OKKB 4MMZB 4XOAA 5IGXL 1OK8A 4KK6C 5FYKH 4PWGA 2AMGA 5I0YA 5HHME 5J13C 4MCYA 4ELMF 5EUKB 2APXA 1A47A 1YY9C 3MRQB 3QG6A 1YA5A 3CDZA 4MD0B 3WL9A 3F64A 3GXIA 1E4HA 2I32A 1J9TA 1PFCA 3K8KA 2JLLA 4N24A 3NZSA 3R7QA 1AIFA 2W60B 4KKBC 2FX9H 4ZMXA 1IKFH 3CZUB 4HWBL 3A23A 4Z3TA 1GZHA 4DN4H 4F8TA 5L88L 5HVFB 1J5HA 4BINA 2B14A 3BVUA 4KRPD 3QNYA 5E2WH 2OL3B 1OSZA 4WW1A 4Y5VC 4PB0H 2BRQA 4NM8L 2H47C 3ETTA 1NMAH 1DDHA 4L9LB 4PJ8B 5HJBA 5I5IA 3MLSL 4KXDA 1BWMA 4LLMB 5LN4A 4Z77A 1D5IL 2G5RA 1FIGH 2OXGB 5FYKE 4HIPA 1MY5A 3F7PC 3T4AB 4UIKL 4HK0A 4FQ2H 4YNYB 5FGCB 3SGJC 4D3CH 4UDTA 1FNSH 3FB8A 3M1BB 1CE6A 4X5RA 4LRIC 3ULVD 1MNNA 1NSNH 2CG9X 4BWUA 1Y6NR 1DE4A 4NB7A 2WUBL 3G5VA 1J1PH 3ZL4L 1XZ0A 3MQIA 4A2HA 1E4XI 2AJZA 4H1LH 4P5RA 3OLEA 4MMYA 4O2CA 1FG9C 2EP6A 1TETL 4NCC1 4OIIL 5I74B 1NDMB 1CD1A 3T3MF 2ESVD 2O4EA 1S3KH 1EEZB 4DUXA 3DPDA 4PJ9A 4QOKD 4F27A 3V6ZA 4I1NB 3GUFA 1YSOA 5I66B 2NTFB 3KCPA 1FGNL 1M7IA 3TFKC 4PJHF 3QWOB 1W72A 2Z64C 4X9BA 2F1EA 1QPPA 5ESAA 4PYHA 3RGVC 5T3ZH 2JKTM 2R2HB 3CCHB 3HI5H 4G6KL 5DVPA 4OJCA 1G6RA 5ISZB 2E7HA 1O75A 3HBGA 2ORBL 2VUYA 3S2CA 1W91A 3AS1A 1NCWL 4FG6D 3VFTA 1ESOA 2JKRM 4M7KH 3MRGA 1HI6A 1WEJL 3PU7A 43CAA 2XV3A 2WLJA 4Z7WA 4JM4L 2E7LA 1OP9A 3L5XH 5KJ7E 4LSRH 2LQRA 4ZQKB 5HPMB 3MV8A 2BNUA 4FZ8H 4G72B 5JHLL 3HC4H 4M7LL 2NMSA 3ABZA 4GLRH 5HGAB 2R2EB 3IRZA 2E75C 4GRWB 4N0CC 2QSCH 4NQXA 1TYJA 3O4OB 4HV8A 5D7EA 2CBPA 2XFGB 2XZZA 5I19L 2NX5B 4JQVA 3MRPB 3ZE0F 3B9VA 4PRHB 3F5WB 4JMXA 1IGJA 5AOJA 4UANA 3S48A 3HG0A 1YEDB 4QD2E 4B9CA 1YN6B 5T3ZE 4AVKA 4P46C 5BZDB 2F53E 2Y6SD 3QAZB 3QDMB 5JW4N 1MELA 2EIDA 4FFZA 1RPUA 2JLPA 1AJ7L 5B1CA 2FQEA 3GIZH 3V52H 4XNDA 1TU2A 3PL6D 4KOCA 1DVSA 2P44B 5FUOL 1F4WH 3T0EE 3C60D 4JGUA 1EQWA 2PCPB 1A6WH 2P8MB 3JTSB 4RFOH 1AACA 4WUUA 3IN0A 2FGWL 1XBDA 3QORB 3QW9A 4PP1C 2JQAA 1IZJA 4GAAA 4QTIH 4CKQA 1CBVL 1AS7A 2H0JA 4G6FB 5D5MF 5SV4A 3BSGA 1LK2A 4RRPG 3FDWA 5GHWL 5D9SB 1K8IB 1AXTL 1WISA 4WKXA 3SGKC 3LQAC 2B1OA 5F0PB 4TSAL 4AIZA 3SE3C 1E28A 4Z7UA 4KZEL 3L9RA 2QR0B 3NK3A 1M4KA 3U6RB 3WIAA 4PJ8C 3E38A 4L8SB 4I5BA 3R1GL 4WKZA 1LEKA 3SIKA 5EF0A 5HJDA 2CD0A 3EDDA 5D1XD 3CVIH 2VLJE 3CBRA 1EERB 2CXKA 3FUMA 4PMEA 3T3PE 4Q14A 1E7VA 4JY4A 3FXIC 1RZKH 4LAQL 4YOKA 2AK4A 1IARB 2HP4A 1JZ2A 2PWHA 3QK0A 1KCUH 4R0LA 5L6YL 4GT0A 1WQVT 32C2B 5LHDA 4FFVC 2KC0A 4LOUD 3B2DC 4RA3A 4HBCH 5MEQA 1XF3A 3H4HA 3PPEA 1CR9H 4IIQB 3FN3A 1W2KT 5DT1H 3WFHA 1NUFA 1FVCA 1UQSB 2B20A 3CN1A 3P0YH 5EZIL 3U0WL 4YFLI 2O26U 4CKVX 4K3JL 3QPKA 4X4ME 3SDAD 3WELA 4DHLA 1AOHA 1MUJA 3FTGB 3S88L 4PJ7F 2HJLB 1BV8A 4GKNB 1L9NA 1A7QH 3NTCH 4X9HA 2QZQA 1I9IH 3SOBH 3GSNA 2GK2A 4F7EB 2XBTA 4PREA 3K74B 4UV4L 4ZTPL 5CCKL 1A1MB 4IMKC 3FB7A 5FHBH 2D0HA 1E9PA 4ORGB 5I6NA 3UZVB 2CLRB 4P23A 1U6AL 3Q8EA 4OD1H 3WFDL 1KJ3H 2XQ0A 4R5XA 4HSQA 3VXSD 5L2KA 4R4BA 2VE6A 4K7PY 4QRUB 1AXSB 4Z7NE 2AJYH 4FEMA 3VXNB 2BY3A 3UJJL 3O4OC 5IG7B 3KR3L 1E6JH 4NO2A 1O9ZA 5CIPH 4NUJB 3MNVA 3VGBA 2BIHA 1C7SA 1ND0A 1YN7B 3RVWD 5EU6E 2Y7LA 3AJ7A 3BEVB 3MV9E 2AEQL 4MCZB 4Q0XL 4PJXB 3BPOB 4HS3A 1G9HA 2XDHA 3KNBA 4FHJA 3ZHNA 5HJ3B 3V7AG 2XFXA 5E56A 25C8L 3UOAB 3REWB 1OB0A 3SJVD 1KJ2L 4ZD3H 2HKFL 3IXAB 5CEZD 4Y1AE 3QH3A 2Z8WC 1UASA 2XVBA 4IRJD 5J6GB 4PWHA 3WD5H 3MDJA 2IDTA 1SRDA 2WJ5A 3ALPA 3ISWA 4JY6B 4PTTA 1OPOA 1I8KB 2WO2B 1H6EA 4XB8A 1UC6A 1XH3A 4BH7B 4BZ2A 4JFHE 5KVEH 1H5BA 1QAWA 1F4XH 1FNHA 4LMQI 4NO0A 4RMQA 4J3BA 1ASQA 3K72A 4UTBH 4X9GA 5CGBA 5IKCA 2DQIH 3PUCA 3V0EA 1CD0A 4GG6B 4ZQTA 2AV1A 3B3BA 3L4XA 1MW3A 4U1HA 3WKMH 3EJZC 2BMKA 4F37K 3RVUD 3CK0H 4PJIA 3CXHJ 2AQ3A 3IJSA 4AQOA 1UM4L 4RMSA 3NJKA 4U1NA 4Z7OB 3FCSA 4WWPA 5D7LD 5T1DH 3MFGB 3MSPA 1CK0L 3EGSA 1HEHC 3FN9A 1UM6H 4V1DA 5GGUA 2HVJB 3V6OE 4DKFH 3MBXH 1NGYA 4N2DA 2X0WA 1PYWA 5C0BB 3IDXH 4XCFL 3KPOB 3NJGA 4XVSH 3I9AA 4YSTA 5D1ZI 2IMMA 5E1QA 5KVEE 1T2QH 4GMTH 1MFEL 1WBXB 2GCYA 3WN5C 2WO3B 8FABB 4QTHA 1ZAGA 4IK6A 4JDZB 4IGBB 1QFUH 2JIXA 3A5VA 3CLWA 2OSWA 1WIPA 2IG2L 3IE4A 2YPLD 1W0VB 4UNVA 2XKNB 4HUNB 1FCCA 4Q9QL 1JAEA 3EYQD 3QRGL 5ID0B 1IE4A 4F58L 2C9SA 1DANU 1MN4A 4RFNB 4N90E 1GRWA 2O5YH 2EVHA 2DH2A 1RIHL 1U36A 3O4LB 4OGYH 2XRAH 3ZDZB 2R15A 2V2TB 2WBKA 4MSWA 2F7OA 4R7DA 3BZEB 3EHBD 1I8AA 3HAEH 1S6NA 5FM8A 4HC1A 1CVRA 4HH9B 1N9PA 2VR5A 3FRUA 4UZGA 2FBJH 1ZGLM 5JLZA 2BZDA 3LMJH 4X6CE 5CSBA 3W2DL 2CHZA 2JQZA 3TO4A 3FONB 3O3EA 3OLDA 4W9DC 2XVGA 5PCYA 4GRWF 2VDPL 3PLYA 1NBQA 3TZVA 1J8HD 4OCRL 3ABGA 4S1RH 5E8PB 2NQ3A 3BE1H 2Q3AA 4W1TA 2VJXA 4NQEB 4APXB 3LEXA 5K39A 4A7VA 5E7FA 3LRHA 5L0QB 1HESA 1LGVA 1JK9A 4BRVA 2X28A 1KEMH 4KKZA 1T1WA 1UACL 4F37F 4KVNH 3LXUX 1S5IL 1SLWA 2W80C 1NAMA 3BFOA 4LVHB 5E03A 3CFDA 3ZDWA 5L7XL 1FO0A 1TNMA 4C4KT 4JRYA 5E5MA 3TBSA 5I0WA 3O6FB 3L1OH 3FQUB 4JFDE 3DXAA 4N2CA 3ASNB 2WLKA 1ADQA 3RDTD 1MFBH 5IW1B 1I1RA 1X9RA 3VX0A 4WU5B 2BS8A 4U0QB 1JPGB 4HSAC 2A6DA 4B9ZA 5EU4A 4Y89A 2VMCA 3U2SA 4OLEA 4OZHB 2OR9L 5I1AB 1ET5A 1N12A 4FG2A 1ML0A 3UBHA 5GS0H 4LSPL 3GMOB 4ZPVB 3RWJB 4PV9B 1RVFH 1MLCB 1XF5B 4OZIB 3UYRL 1IVLA 1NGQL 1UXSB 2E5EA 4ODTH 5AUMA 1JZHA 3MRNA 3KYAA 2DJMA 5FC9A 5G4MA 3VXME 1CYWA 3AUVA 5T3XD 5F6HJ 1VFMA 1BXVA 3PQYE 4TXVB 4ACPA 4BQ6A 4AMKL 2DQDL 4GW4B 2VDQH 1PZ3A 3B7TA 3CHRA 4X4YB 2J12B 3KD4A 3S5LG 3EJRA 2ZP8A 4PJCA 2OMYA 2E6PA 1QLFB 5FGSA 2VDLH 4DVBA 3M1OA 4ZFFB 5B4MC 3U2IA 3KYMB 3OGCA 4AGQA 1QSFA 1JXDA 3SKNA 1JV5B 4KKAC 4FI7A 1H8LA 2VR3A 4XX1G 1KTLA 2YXWA 4HUMB 2GEQA 3FTUA 3AY4A 3QT2A 3FFCD 2ADJB 3FTYA 3W5MA 3ARGB 1A14L 1UD8A 1TZAA 1FDLH 2YD0A 4PJ6A 2DKSA 1BZQK 1QNZL 2EDMA 2XWJB 3ULVL 1OAYH 1PFOA 4NWTH 4OJYA 3TNMB 4ZTOL 1RZJC 4S1QH 5AYQA 4P4RB 4L8CA 4N8PA 1G9NC 4W6YB 4LKCA 3PP4H 3OHXA 5GGQL 4XVJH 5EEUA 5FYJH 1YDPA 3HE7D 5MERB 1IJNA 1F86A 2GUOA 3SQOL 3SPVA 4G1MB 4F2MA 1TQSA 4I3RL 4OLUH 5IWLA 2AQQA 4R9HA 3KLHC 4J4PA 3BZFB 4JPQA 4U1MB 3AG2B 1HZHL 2ZONA 1BFVL 3ZE1E 5EBMA 1VFAA 1HXYB 4HULB 1J7VR 4XMTA 3HBQA 3MUJA 1IEHA 1AGEB 5J0BA 1AO7E 2P5EA 2R59A 4PJDE 5F7BA 5FCSH 2MPVA 3VXUD 2RCSL 1AGDA 2GTWB 1PG7H 1TZGL 4MZ2A 5EA0L 2D7TL 1ONQB 5IQNA 3G5ZB 3EXJA 2TRHA 3BH9A 5L0QC 3D0VA 1HYSC 1S7RA 4QWWD 4Z3EA 3RA7H 2B1AH 3ECQA 2IFGA 4AYID 1INDH 2R9HD 4FMVA 4HALA 4PJXF 3L95A 3T8XB 2BLFA 4Y4HA 1JD9A 1XB8A 2J8UE 1GPOL 3LVEA 4LIQH 5FYJE 3UXFA 3IFLH 5FWQA 3BO8B 1JOIA 3BZ5A 3K5RA 4OLYH 2YGQA 3OSVA 2YKKA 3STZA 2ZF9A 5FYLH 4DZBA 4QRBA 5CJOH 2VH5H 1FAIL 5F9JB 3SE6A 3U4EB 2E9GA 2ZUVA 2WBJC 4HPOL 1NBVH 2GITA 1R3LB 4HUKB 1UM5L 1ROCA 1O0VA 3QVAA 1L9QA 4M1CC 4UDUA 4MQXD 5HI5C 1XSJA 1ORSA 3GSWA 1OP3H 4P2RE 4CVXA 5ACZA 3FJTA 2WXIA 4XO3A 1MPAL 3BPCB 4WENB 3W37A 3FPXA 4O51B 3BP5A 3WJJA 1U8IA 4JM0A 2EKSB 4X80L 3V5KB 1KUMA 4BDVB 3CVHL 4PRBA 4GG6F 1MVUA 2ETWA 1P1ZB 1WUZA 2DQTH 3NZ8B 3QXDA 2A6IB 3BVTA 3ARBD 4JFXA 3UEQA 1ZT4B 4H1LA 3H9HA 3QEQE 5GSVB 4LIQE 2EC9T 4Z7OF 1RUQH 2DIEA 3ECBA 4QKXB 2PCFA 3FQ4A 5FYLE 5ADOH 5JW5B 4JANA 4Q6IB 2ATAA 3PGCB 1LO2L 4FTDA 2UYLB 2FUQA 4EVNB 1XGRB 4OM1H 3DPBA 2V9RA 1CFQA 2CAKA 4MAUH 5GJSH 2MKLC 1HCVA 4YBQD 5C3TA 4XB7A 1CXIA 3NUKA 4G7QB 1F2XK 4WW2A 1H3PL 2OBGA 4H26B 3TBTB 1BG1A 4UT7H 1IBBA 1Q9OA 4TVSa 2F53A 3WENA 2W07A 3IU4H 3QJZA 5DWUL 1P5UB 5E2TH 3QO1A 4JKPL 3AITA 4N5UA 3FQTB 3LAFA 2ESVB 3T0EA 5CJXA 4Y4FA 4HHGA 4NKIL 4X8XA 1YEIH 4QOKB 1O9VA 2EDXA 2P43B 5HHNB 2R8SH 4ONHA 1GC1H 3ORJA 1AMXA 3P30L 12E8H 1J86A 1BFSA 3UAEA 5TFSH 3VGGA 5TTRA 1B4RA 1NEPA 1KJVB 2X6UA 3GBNH 3ZDZF 1SEBB 1INEL 1CU4L 3IU3A 1DQDH 1LP9E 2W81C 3ULAB 2JB5L 2N56A 4LKXB 3WNJA 3P9WB 1ZT1A 3FCUB 3AWEA 4A38A 1MJJB 6FABL 1KF9B 3NA9H 1MCWW 2BOCB 3L7EA 4ODBD 3AACA 1B6UA 1GVIA 4HJUA 3QR0A 3T2LA 2DLTA 3GXFA 4HXBH 5AZ2H 3OTTA 3TTSA 3BQUD 3CFEA 3O41A 4JRLA 1WHPA 2Y7MA 4KU1A 5D1QE 4TPRH 5KVFL 2LLNA 2I69A 5DZJA 2VLJA 5E8DH 3A4EA 3EGDA 3IT8D 4LSTL 5GRUL 4YIQA 4YEEA 1TR7A 3M6DA 1BQSA 1XGYH 1FFPA 4R26L 1JHLL 2VUKA 3MRKB 1KB9K 1RERA 2BZ7A 2FYYA 3P3YA 2YKLL 4MTMA 4OQTH 3KPTA 5TH2B 2YPKB 2WXRA 4TNEA 3N50A 2A9AA 1KYUA 3QXAB 1TTBA 4KNTA 5AW7B 4F9PC 1YEKL 3NOIA 1P4LA 1U3JA 2IDSA 3E6FA 4JFEA 3L3IA 1J5DA 1MCOL 5HYQB 1M7DB 4KVPA 4D0BA 1A6AB 1PNDA 4XTRD 3PL6B 4Z7VE 3CVHB 3U7WL 4UZSA 3C60B 2CCWA 3MNDA 1BLNA 3RVTD 3U30C 1LM8V 2ZYIA 3TJHC 3WUWB 4QJ4B 4JRXD 4NUPA 2FT8A 5FO8B 5I1GL 2QQLL 4X4MA 4Y1SA 4JQXC 5JUEH 1JPTH 3RTLA 1QG3A 3CQFA 3IBEA 5EPMB 3JVFC 2HRGA 3FQNA 3VH8A 5K9KA 1BGXL 1X5XA 1YEWA 1HWGB 3H55A 2X9XA 3JQOB 4OZIF 1H3VA 4HIXH 3NCCB 3OAUH 2VQ1A 1C08A 5CEZL 4WSJA 4AIEA 4PG2C 1Q0EA 3B7RL 4NO5A 1MCJA 4WGVB 3PJLA 3WKPA 4MCYB 1JDAA 2WLIA 5D1XB 5EC1A 3CMOL 3FO9A 4MMXB 2K9UA 1BQUA 2DMGA 4JKLA 4DPRA 1IKOP 1WLHA 2F19L 1M42A 2B2XH 1TENA 4NFBA 4PH8A 3QNYB 2EIZA 4WW1B 1FI8C 2YSTA 3C5SB 2DBLH 1F8TH 2GBUA 2OSLA 4IBZA 4LOFA 4DCQA 2BWDA 2A1WH 4N2KA 4PJ5E 4Y1AA 2P5WD 4JFFE 5KJRH 3TEXA 4GP8B 1V05A 2UWEA 4IS6A 4X7EC 4YDLB 3PWVA 1CQKA 2DQGH 3EBGA 2E4FA 5JPMA 1ZGLA 3PYCA 3NFSL 3CFJA 1RURL 5HHXL 1FZMA 3SDAB 3WS6C 3E1ZA 4NKDA 1KGUA 3KJ6H 4AM0B 4TMPA 1PKOA 1NLDL 4LEXH 4LSQL 5DC0A 4JZJB 1C12B 1W0YT 2H2PC 3RVVD 2JKNA 1WDAA 5CWSB 4AQAB 1UYWH 3WFBH 4QYOB 5DVOA 4KK5D 2APFA 4N2EA 3FPYA 3SDDC 2AJZB 2R56H 3QJSB 2XN9A 2E9BA 2OJEB 1G4RA 2QVKA 5IHHA 2P42B 4YMPA 2YMOA 4D2NA 3VXSB 1SHSA 2CJUL 4OV5A 2A73A 2XTJE 3I9GH 3V6OA 2EDNA 2VDNH 3BEWB 1M7IB 4XBPA 4B7LA 4HWZA 5IVZA 3VFNA 5KYXB 1UXMA 3WIIH 3MKKA 4M93C 5LNDA 1EEYB 3PWUB 5ESAB 2LR4A 4F57H 2FECL 1EZSA 3BVWA 3U1SL 3BWUF 2IOOA 4K07A 3LS4H 3B1TA 5AKRA 1FFQA 3MRCB 1INQB 2B1HH 4UTBA 5DLML 5D70L 3UGXA 1LK3H 3D06A 5IROD 2W1NA 3N2JA 4OLZL 4OI8A 4ZUVA 4OCYL 4DQOH 3GHBH 2YAQA 4XCCL 2MNJB 1L9OA 1VGEL 4G6JH 4XT1C 4DK3A 4EDWL 4FXKA 3BRGC 1ZVSB 1F6AA 2IPTL 3BP4A 3OLGA 5I6XB 3DNKA 3LV3A 1XGPA 2ZNWA 4N9OB 1I1CA 4IRJB 3VTAA 2PKDA 5JQIB 1PLAA 2ZUSA 2A5UA 4LVOB 1OKEA 4HV8B 5A7EA 4PY7A 5FM5O 1F0LA 1Z0NA 3FAWA 4HD5A 1F41A 5DJ2A 2I07B 4PJBA 3QPQC 3OKMA 1TTGA 5F7KC 3CUPA 1WP6A 1NKRA 2GABA 3Q8AA 4HKBB 1JZ6A 4F8PA 3NSJA 5DEJA 5AD0A 3F2LA 2F1AA 4KQ4L 4X6CA 4A7GF 2C4FT 3NG5A 4HSCX 3BPNB 5A2IH 4ODHH 1I8UA 2I9TA 4JREB 1JGEA 4UT9H 2Y2TA 2CBMA 3VD7A 1WA0X 1S7WB 5CZKA 4GAJL 1I3RB 1N6UA 3MBWB 4JFPB 4JAMA 3LSOB 5C92A 3ULVF 5ICYA 3FW6A 4A63A 5CFHA 3GNMH 4IRZA 3ZTNL 1V54B 2ADYA 2YMXH 3LZLA 4F8QA 4F7KA 2BSDA 4QDGA 3X1EA 1ZHBA 4X4XA 3UYPB 1UD5A 2B5IC 3D18A 3BP7A 5T3XL 1MW2A 5IB4B 4Z1PA 3T4YB 4XXWA 5ELIA 1HU8A 3HAEA 4QI3A 3GSQA 3S4SA 5FK9A 4JFDA 2OI9C 3QDGE 2H0EA 1UATA 1BOGB 1F58H 1ETB1 4I5BB 3T2OA 2YPLB 1PLGH 1E5UI 1JXJA 1N6QL 3EOAA 2X4PA 3OJDB 2YGPA 1NBYB 1N2RA 2C7UB 3GHPA 3LKPA 2P9RA 1WYJA 1PZ5B 1AD0B 1UD4A 2AW2A 4IOFC 2ATPA 4UYQA 5DO2C 4BZ1L 1CO1A 1EX0A 3C08H 4JY4B 5A2BA 3D51A 4JZJC 4WJKB 1EH9A 5EU6D 3SPCA 3EYVA 5H2BB 3MV9D 2X4OA 1JRHL 4X42A 3EHBB 3IDJB 3UTZA 1KMGA 2K6ZA 3RU8L 3KYKH 3WTYA 4IBUA 1MVYA 2AJUL 1P5VB 3VXMA 3Q9PA 1XH0A 4ZW5A 2DS4A 1R0AL 2O30A 3PQYA 1ZTXH 1DN0A 4LCCA 1YECH 4PJ9C 4AVIA 3O3UN 1L7TL 3FUJA 4UM9D 1V8HA 4I18A 4WFED 1Q0YL 3SE9H 1FVCB 2BDNH 4PW3A 3LIZA 4N2BA 4RAUA 4TQ8A 3BDYH 5DZPA 5FHAH 2Q8AH 1E2VA 1TDQA 4FQ1L 4WDIA 3HS0B 1MCQA 4AYGA 4L1BA 3L9EA 3TU6A 1A6ZB 4NZ8A 5IBUG 1YUHA 3LQZA 3E7JA 4G7YL 4BFNA 1D5BA 5GSRA 1U0QA 1TJGH 2YUVA 3MCG1 4NDMB 4X4ZA 3GSVA 5CMAA 4X2UA 3BT2H 3RWIA 3MRLA 4FQLH 1YEEL 3LNHA 4WGKA 3FT2B 2E7LC 3SGDI 5I76B 2ZD0A 5B7EA 3RDTB 1WBZA 1ZTXE 1R5VA 1VPOL 4IQHA 2VE6B 1RXLA 2P80A 2B39A 4GJTB 4LVOC 4NNYA 3SO3C 4HFUL 5JW3L 2XNAB 2CPUA 4U1IB 5EDSA 4K7PH 4JQVC 1RZ7L 1ND0B 3GJFK 4AEIH 5EEWA 4PWIA 4K71C 4J3WA 4FD0A 4ODSL 1KXVC 4HS3B 3O45B 4U1KB 4W81A 4JM2A 3LZQA 3TV3H 3H9SE 4JN1H 2LU4A 4LZKA 1AO7A 3B2VL 4PJDA 5LJYH 3CLEH 1UUSA 3CFBA 2EEFA 1MFDL 4N0UE 3CSFA 3OVUB 4TN9A 2N0MA 1E8ZA 3I3EA 2Q3XA 3JBG7 1UWXH 3M07A 5ESVB 4QRRD 4WEMB 3WFCL 2WLNA 4PUBH 4D9LL 1FC2D 3GK8L 3TV8A 1JWSA 1D6VL 2J8UA 4OCWH 1IGFH 2VABA 3BVDB 1OE3A 4WFFD 2FHCA 2XY1A 2XA8L 4ZMVA 5IKCB 1E8WA 4MXQD 1M3JA 3MXWH 1KYOJ 1EO8H 2X7LA 2XTLA 5DYOA 5DS1A 5GRWA 2QADD 5SX5H 2CBOA 1ZVYA 4JKMA 4JEGB 2CO2A 3VGAC 2Z7UA 4X98B 3EOBA 1JPEA 2V7HA 3EYOA 3CC5B 3LNIA 4QO1A 4YHIB 3S3JA 1KCBA 4ABVA 3MLXL 3GPSA 4P2RA 4OTXH 1DBBH 4LSUH 2EXYD 1DQLH 2XUWA 3Q3GB 5I6MA 2K0RA 1EHKB 4LLVB 1N8ZA 1U95A 5SWSE 5I1LB 3ZHKA 4L8BA 3HE7B 5KWYC 2WCPA 3WV0A 3BIAX 4OM0H 3SPHA 3LB6C 4NZDA 2GK0A 4PS8A 5FLVA 2GCYB 4R0LC 2OKMA 5E99L 3QJHA 3GBMH 5CZXC 2E7MA 4M7LT 5DC2A 4K9EH 3TOPA 5DRZA 3EZ8A 3LHPH 5AZEH 3OKNA 2FIKA 3VXUB 1EPFA 3V0WH 4LBAA 3Q5TA 4OGXL 2Z0BA 3WNIA 3S9DB 5E8OB 2Q6WA 2WNXA 3R06B 2XQYA 3PNWB 4B41A 1HT6A 1HOCB 2R4SH 3FUHA 4I3SL 2ZPKL 3BCFA 5LDSA 4H20H 4XPAH 1NKGA 3DSNB 1BQRA 4ODWA 2D4DA 5HHVL 4N4YB 4TV3A 3EJQA 4HKXA 3ARDD 4Y16D 4KO9A 4ZDHA 4LCUB 3N40F 4ZW8A 3T6ZA 1OANA 3LZFH 2BHUA 3SYPA 3IRCA 3SQBA 2UZYB 4HWEH 5JLZB 1HSBB 1SJEA 2ITDA 4P23C 1LEIB 4N2NA 5DLLA 3BGMA 3D39D 4JFOA 5HD8C 1D5MB 2E9WA 1N7ML 2HYMA 1C5CH 3D3VD 5D8JH 5BMFL 4FQXA 3D25B 3HC2A 5JR1L 1N6VA 4YGAB 3VG9B 2Z7WA 4I8DA 3CC1A 1KNOB 3LEXB 5K39B 3LZOA 4YPJA 3MNMA 2G2RA 1IBHA 2BP3A 1X7TA 3W56A 5LGJA 5L4MA 1T1WB 2HRPL 2HN7B 2EDTA 5HYJA 2BXYA 1WHOA 4KUCF 4Q74A 5GS0D 4ZO8A 3ARBB 4YJZL 1S7SB 2HJKA 4H40A 2DL2A 3HZVA 3DHMA 4GO6B 4KOBA 3KPSD 3CFDB 3O0LA 2XWXA 2D7MA 1PX3A 1I1AD 3H3KA 5KS9E 3S3BB 3B34A 1NGXB 4RGNE 4CC0A 4LSVH 2YC1B 3DXAB 1N3NB 4QNPE 2WVVB 5H37H 4TNVF 2FX9L 2OYKA 1MIMH 3IFNH 4JL1A 3UP6A 5IMLB 3CDCA 4DN4L 3TNNA 3EJCA 3MLUH 3TCTA 2XPGA 3TWCL 3CZEA 3RPBA 5LQBH 3SDXE 5E2WL 1YCSA 2HSIA 3A4DA 4HPYL 1UJTA 3D85D 3QNFA 4KRNA 1LD9A 1H5BC 1NMAL 1MQKL 3FO0H 1NANH 5J11C 1RZFL 3QJTB 4NC1E 5KJ4A 2V2XA 1SF3A 2WLMA 4Z7UF 5K9JH 1FN4A 2VAJA 5GRZA 3DVNB 4BKSC 4YBLC 1OAUH 4OZGE 4NKQB 4NJAL 1BA9A 4POZC 1FNGB 2K7QA 1BZ9A 4XBEL 5MEOA 4XC3L 5DHVA 3D69B 1GYVA 2UXTA 3JWNG 1IAOA 4JO2L 1CZ8H 2ARJB 4YHPB 2Z31D 4K8RD 2VRQA 3L9YA 4K4KA 5ADPH 4Q6YA 4Z23A 1JGLL 2P24B 1F5WA 4OQTA 2PP7A 3VVWA 2YD7A 4XN5A 3W81A 1MHCA 4E5XA 1J1PL 2E74C 5I1EH 3U6XA 4N68A 3TYFB 1KIUB 5TGBA 1PEZA 3VSUA 1ZANH 2ZOWA 2EUZA 1GSKA 4JE0A 2Y07H 5D2LA 3TPKA 4OI9A 2ZXWB 4KJYB 3QSKB 4XMLH 3CDYA 3DYMA 4W9JC 4LBEB 5HHMB 1Z1WA 3O9WA 2JSFA 3UC0H 1XV8A 2FJGB 3QUMH 4WI6A 4WFHE 4NN6B 2AFNA 2X6BA 1BQLH 3TCLB 5GXBB 2EE3A 4YE4L 2UUDH 3UZQB 5FAAA 2AKRA 4HKJA 1TO4A 5E9DD 4FNLL 1DP0A 1FP5A 3DO3A 3HZYB 1ZLWK 1SXNA 2MOVA 4LCWD 3H53A 4QRTA 1YDPB 2X9YA 4LSSL 1H0DB 1MWAA 3MLWH 3ZW3A 1WC7A 5CJ8A 2OP4L 1CGWA 3FU7B 3L5XL 3QEQD 4NCC2 1OM3H 1NL0L 3CX2A 4PTUB 3GMMA 4HFWB 4QRQB 2MHAB 3ARXA 3NJIA 3TO4C 3FFDA 3KWWA 1R3IH 3U36A 1GOHA 1CF8L 2OR7A 1IEAA 4JRXB 3WDHA 2F74A 4NENA 3TZVC 2E6JA 3I6LD 4K5OA 4U1GC 4IDJH 1XGUB 3CPLA 3MRFA 2FJFB 1RUMH 3HKZA 3W11C 5C0DA 2X6CA 3K0WA 3B83A 3NMEA 3QQ3B 4P2OB 1QBLH 2C4XA 2YA0A 4AYDC 2YD9A 3VXQA 3KBFA 4BKLA 3L95B 1SBSH 3AADB 3GIZL 5I8OH 3TYGH 3EFOA 3B43A 1N4XL 4LP4A 2Y2WA 3ABMB 4LLDA 1JN6B 3WAKA 4J39A 2Y22A 2EXWC 1A6WL 1LLAA 5JIKA 3HIZA 1E43A 2C7FA 5F6IC 1G9EA 1ETZA 1NM9A 4N2OA 5E6UB 1WWCA 5IREA 1JFQL 1OL0A 1SVZA 5B7MA 2WKOA 1LO0L 1HQRA 4GQQA 4CSZA 1NUDA 4UQ3B 1A4KA 3QPXL 3RPKA 4A2FA 5D1ZA 4E9SA 4PJEA 3VWJD 2IWGA 3GS0A 4YSPA 1OF2B 4TUKH 3WSQH 5JPNA 2O72A 2JJVA 4PRAA 4PY8I 3WS3A 1GW6A 3LHAA 1MF2H 3IGLA 2GPZA 3PWJB 2NNCA 2E7BA 3MREA 4OH2A 4HEPG 1MVUB 3SDYH 5FECB 1Q0XH 1TCRA 2AEWA 2FNBA 4OKDA 1NGPH 3SKJL 1U8OB 5C07D 3GMNB 4K94L 1PIFA 4R84A 4UUJB 4RISH 5D1QD 1ID2A 4NP9A 4JL2A 2BHFA 2GKIA 4FJZA 1GS7A 2E3VA 2AABL 3DX9B 4D7BA 2GT9B 4ONGH 4U1LA 4JG1H 3U9WA 1P2CA 3P73B 5F70A 3UG4A 1FZJB 2IQAA 1ITBB 5EUOE 3V6FA 1E3ZA 1K8DA 1RZKL 2KZ1B 1QQDB 3O6KH 5CEYA 3FUDA 3Q6GL 3S34H 2NYYC 4RETB 4MA3A 4WW2B 1A4AA 1KCUL 3UTPE 5KVMC 5LXVA 3TA3D 4QRPE 1N8OE 2WZ6A 1XIWA 3VRIA 4UT6L 5GQBA 4M62H 3IDMA 5LB1A 3VGFA 4XPFH 5GRYA 1LXMA 3AY4C 1SOQA 1CR9L 1SM3H 3U7YH 5DT1L 1GZQB 2XIBA 5HGHB 1DVFD 4HUXA 4NN6C 2JKLA 2P48B 1MIEH 1ZEAL 5DVKA 1TEGA 3BPLC 2EACA 3HG1A 4PVNA 3VM5A 6PAZA 1R3KB 1BZDA 3QXVA 1G0YR 3DUUB 2Z65C 3VDAA 1J05A 1JVLA 2DIBA 3NPSB 5D55A 3LS5H 3OHXC 4KKCC 3QWNA 1PSKL 4GSXA 3VE0A 3VMOA 1DVTA 3SYAA 3HVNA 4L0YA 2QQKL 2K6WA 1F6FB 1IGCH 1JJUA 2ICWB 3M86A 4YDVA 1JPFA 4E9QA 3ZQXA 1OK0A 4ZOCA 3D4CA 1D6EB 2PWFA 1QA9A 2VLMD 4JX0A 5IWLC 3QDGA 1GJWA 3ME0A 1CGXA 4J4PC 4M61A 5EOCH 3I02A 2WQVA 3P0VH 5FKAA 5EU7E 3UEZA 4NQDE 4ZS7H 3CFEB 2ZUTA 1ZS8A 3S3SA 4XPHH 1URIA 3NJNA 2HMID 1HCYA 1JHTB 5LGHH 2AJYL 4UT9A 4ZFZB 4TKWA 1DQMH 4XO9A 5KSBE 4L8DA 4XMKL 1E6JL 2PTTA 4GB9A 1BG9A 3Q1SL 4YIQB 3RWGA 3GZOA 3B5HA 1FL6B 3RWEB 3VFOB 3T3PB 3QULA 4RFEB 2VXQH 3GJFA 2FYYB 4QTFA 5C3IA 4FNRA 1XX9C 4D0CA 2NY1D