2JV6A

Yf ed3 protein nmr structure
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
112
structure length
112
Chain Sequence
b'MSALTLKGTSYKMCTDKMSFVKNPTDTGHGTVVMQVKVPKGAPCKIPVIVADDLTAAINKGILVTVNPIASTNDDEVLIEVNPPFGDSYIIVGTGDSRLTYQWHKEGSSIGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Envelope protein E
publication title Yellow Fever Virus Envelope Protein Domain III: A Convergence of Structure and Phylogenetics
rcsb
source organism Yellow fever virus
molecule tags Viral protein
total genus 25
structure length 112
sequence length 112
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2jv6A00
3N44F 3J27A 4ALAC 5JHMA 2H0PA 5LCVA 1PJWA 3C5XA 2GG1A 4AL8C 3MUUA 3UYPB 3IRCA 5IZ7A 1RERA 1S6NA 3J2PA 5LBVA 4FFYA 5KVDE 2ALAA 4UTAA 4AM0Q 3UZVA 4UTCA 3VTTA 5LBSA 3UZQB 1OK8A 2P5PA 1ZTXE 3N40F 4BZ1A 1Z3RA 1Z66A 2JQMA 2HG0A 5AAWC 4FG0A 1OKEA 3C6EA 4UT6A 1UZGA 5H37A 4L5FE 4BZ2A 1URZA 1TG8A 3UAJA 3WE1A 5GZOA 2JV6A 5KVEE 5KVFE 2V33A 5AAMC 4X42A 5IREA 2R69A 5B1CA 3UZEC 3G7TA 2R29A 3N43F 4FFZA 3P54A 4UT9A 5KVGE 4GT0A 5JHLA 2I69A 1OANA 4UTBA 4GSXA 5GZNA 2JSFA 3N42F 3N41F 1SVBA
chains in the Genus database with same CATH superfamily
2WP3O 2OX5B 3LQAH 4G8IA 1U3HD 3QAQA 4CVWA 2XQBL 3ETSA 3CVCA 2VDLH 3QK0A 1C5CH 2G3XA 1CL7L 4LDEB 1XX9C 3MR9A 4JJ5A 4N2MA 3UTSB 3VRIB 4JFXB 2ARJB 5I75C 1KGCE 2ZP0T 5I73B 1QBLL 4WI4A 1MCBA 1NGQH 1UHVA 4QRTB 5DO8A 2HLEB 2X2IA 5KVDE 3GUTB 2PR4H 3N42B 5E2UH 5C0AA 5AAPA 4IHOA 4G7SB 2BP8A 3Q6FA 3VTTA 4OR1A 3W81A 4FLSA 1TIUA 4XZUB 3TLRA 3KG5A 4PBXA 4Z7VF 1MW0A 3RL2B 2LFEA 1DEEB 3RWEB 2EYSA 4KO5A 4ZSOE 1ZTXE 1TNNA 1MQKL 2A77H 5DJDB 3V5HB 2YN3A 1C1EH 4F5CA 5IIEB 3M07A 1CF1A 3VXMB 3GIZL 2R0ZL 4FP8H 3DRTB 3OKEB 4Y2DD 3V0IA 2AVFA 3GSOA 4R7DA 2MKWA 3MV7D 5JPNA 2IV8A 5JW4Q 2CDFA 1CURA 5JHLH 3DMMC 5IT2H 2WBJD 4X5WA 1EDHA 5KYYA 3MOAL 3AACA 4K3JH 5HXMA 1AG6A 3TA3D 1XF4A 4MJ6B 1XGPB 3RGVA 4WTQA 2Q76B 1J9QA 1IKNA 5JW5A 4F93B 1S7XA 3KR3L 5GPRA 5E2WH 3G08A 4K23L 2QGCA 2QQKL 5D9SB 5F6HJ 5IB3A 2YMTA 4HSCX 2DWDA 1EJOL 4QTHA 1E6JH 2XOTA 4GIOA 5KBMA 1VPOH 4LEXH 1ZGLA 4F7CB 1JNLH 3QJZA 3RIKA 1EHLL 1D9KB 5B1CA 2AJYH 4P4KC 2NQDA 3QNXB 1MEXH 5EIIG 4KI5D 1M57B 3JYCA 3BQUC 3GSNB 4ZUVB 1S7VB 3O6FA 1QBBA 1FL5B 1BFSA 4MAUL 5B1AB 3VG0H 2WXJA 5EULV 3RZCC 4YK4B 1QFOA 3EJZC 4FLOA 3F8UB 1DBAH 3GS7A 3QEHA 1CTOA 5AYUL 4JM2C 5AVYB 3JWNC 3SGEI 4UIKH 5BQDA 3S5YA 3VWKD 4DZBB 4TSAH 1CXFA 1AZZC 1K72A 3REVB 2VUOA 3LPWA 5DMYA 5GS0L 4KKAC 4MSWB 1AYOA 2NXZC 2XQYK 4PJCF 5C9JA 2C1PA 1UA7A 1PFOA 2AF2A 2MQCA 1O9ZA 4J3VA 1HSAA 4MYWB 3O3EA 1BJMA 3O9WC 5C0CD 2LU4A 4L8CA 2BLFA 4HWZB 3HZYA 1A9EA 2DKSA 5CBAB 4EZMA 1MCRA 3WIFA 5MEQB 5CZRA 4EDXB 4GINA 5T5FH 5E1HB 4LL1A 2P49B 5CKAA 5DCCA 2AJ3A 5DD6A 1OF2A 5GGRB 4LDOB 3FUJA 4WTWA 2A3TA 5IVXA 3HR5A 5BMFH 4X6DE 2KHAA 1LMKA 3QO1B 5I82A 1BFVH 1P5UC 2JELL 1CR9L 2WANA 1TVHB 1DQQA 3SE9L 1QZNA 3G6DL 3BC9A 2Q8AH 4FZ8L 4NRXB 1IGIL 1VESA 3F83A 2V4LA 3MODL 4LVNC 1XSJA 4LASH 4MNQA 1HINH 3TFKD 2JKRM 1JCVA 3AGWA 3WUWG 1G6VK 5GGSY 5D7KD 4LPYA 1LP9F 4TN9A 2Z0UA 4GAYA 1FNEA 1X5YA 4BELD 2NX5D 3HFML 4ZXBB 4ATTA 5C70A 4PRIA 4BRVA 2FYVA 3HAEB 3DX8B 3GSUA 3EYFA 4QRUB 4JKLA 4QPEA 3KWWB 1WFNA 1EX0A 8PAZA 5LN8A 5B1JA 5KJRH 1XVSA 4RFOH 3D18B 4OCNC 3KLHC 3PV6A 1RK1B 3QEGH 1JZ2A 2A4ZA 4GKNB 1NDGB 1CGVA 2XZAH 3KLDA 3BPLB 4UNUA 3E7JA 1IM3D 2YC1B 2R2HB 2A74A 2XKNB 4MASA 2Z65C 3C08L 3E8UH 2QFRA 4K73A 1AG0A 5DC9B 3KYNA 2H7WA 1FN4A 4ZSOB 2Z4QB 3BE1H 1KJ2A 5EF1A 4DP4X 3VFGL 2CO7B 1SEBA 5D6CA 1C8QA 1JJUA 3FQ4A 4DFIA 5KYUB 3V6OE 4YUEH 1K8IA 4AGQA 1BIIB 1WZLA 2EDKA 3DX2A 3IT8D 2R2BB 4M1DL 1KXHA 4JN2B 5SV3A 3PHOB 5J8OA 1FDLH 1Q1JL 5I6KA 3MLYL 4MS8D 3WXWH 3EH4B 4DKAA 3HS0C 3G5VA 3B9DA 2F53B 2VABB 1ZVNA 3K7UA 2ZXDA 2VZVA 3QJFB 4LAQL 3TNMB 5J13B 1TFHA 2ADFH 4IBYA 3VXPB 3FQNA 2R8SH 1A8JH 2XLLA 1QSFD 3LX9A 2X0UA 4KHTH 4M5YL 4HPHA 1IQWL 2GC7C 4G1MA 5ELIA 4QRRA 2WTRA 4QRPD 4HG4J 2G3ZA 4X7SL 1IEHA 4HPYH 2ZXBA 5DYFA 1ZIBA 2F54E 5GRZA 3LKRB 4Q58C 5LGYA 2VWEC 5IW6A 5AG9A 1TTBA 5G4MA 4V1DA 4ZMOA 2BC4B 3MYJA 4GAGH 5E56A 4AL8C 4YEEA 3TH3T 3ULVC 5IZ7A 2J2ZA 2VM4A 1TPXB 3C5ZD 3ESMA 3JUYA 3FHEA 4NQCD 4PJFF 3L7FA 3QUZB 2X70B 1IM9D 4U3SB 3LXBA 1S6NA 1WGVA 1WWBX 3D0AA 5FF6A 3ZT5A 1A6AB 1RU9H 3EJPA 2A9ML 2GITB 2HT4C 4H8WL 5IK3A 1BEYH 5IJKC 1NWOA 3LXUX 4PWGA 5DURD 5CEZH 5FO8A 2DW5A 5KYWA 1CBVH 4HCGA 5SWZA 1F5WA 1URIA 4OIFA 1BM3L 3HN3A 3VVWA 3EYQD 4LHUA 3DGDA 5MENA 3BSZH 4L3CA 4OVUA 1QLRA 2ZF9A 3DC0A 4CADA 2Z92A 4Z77B 5DMIL 1V7ML 2MHAA 1IGTA 3A6BL 5I1GH 5JHDB 1DQDL 1JI2A 5D4JA 2IDTA 1U8IA 3LNEA 4OLUH 3IPEA 1UWXK 4S1QL 3C09C 5DHXB 1QEWB 2F8IA 3PXHA 1XGUA 1DBML 4GSRA 4X5XB 4YWGH 2NY2C 1S78D 1QX1A 4J4PA 2YA0A 1TG8A 3QFGA 1LE5A 4XN7A 3UZEA 4WO4D 5FWQA 5FGCE 5DT1L 3RTLA 4GI8A 1OSZA 1FNSH 1JZEA 2O5YH 2ADYA 3FTXA 2I9TB 3HZMB 3BPCB 4N22A 5JW4M 5LGHL 2DF3A 1M9SA 1W6LA 4X6DB 4M1CD 4ORGA 4M5ZH 4H8UA 5D4HA 2UXFA 2OSYA 1SDDB 4O2FB 1WZMA 4U33A 4FNPA 2YD2A 2E9WA 4LEOB 2OMXB 5E9DB 4AQZA 4UAOB 5GJTH 3BP7A 1QMUA 4BH8A 5HGHB 4BQ9A 3KLQA 4IDLA 5LXVA 4IBWA 1OE3A 3SQOH 3U2IA 3OAWA 4GXFA 3AG1B 3RL1B 3BAWA 3IMRA 4PJBF 1GJIA 4TQPA 4LPCA 2WNKA 4HXAL 1WC7A 5IHWA 4UT9A 5HJDA 3FRPA 1CPUA 3C2SA 3KWVA 2WIIB 1DJSA 3ALPA 1QA9B 3H42H 1Q38A 3UDWC 3GEFA 1CT8B 3DURA 3U6XS 1DDHB 5AW0B 2YPLE 1N7ML 1B4TA 1FA4A 1OO2A 4MD0B 1T6WA 4FMKA 3CFDB 1XGYL 4L3AA 4DGIH 4CILA 3LZFL 2X1QA 3LKOB 1C9SA 3BSGA 4B0MM 1E8YA 3RVXC 3L9EA 2MRYA 5BS0D 1VCAA 2YAEA 1GIGH 1ND0B 3T04D 3KYMA 4JKPH 1BQHG 2FX9L 4ODUA 1HZHL 4MAYA 3ARSA 2FIRT 3EO0B 2AQQA 3X1NA 3QUGA 4LRIA 1JV2B 4ZQKB 1MHEA 4GYBA 4IBSA 3S3JA 4QIRA 4YHKH 4AC2A 4UCFA 1Z9NA 3DMMD 1ZV5A 4RZCB 1FWXA 3NCEB 1H5BC 3KBHE 4M7LT 1SGKA 4OLVL 4RFEA 1AH1A 4AQAB 4HCIA 1FVEB 4G83A 1NEZG 3LD8B 1AOHA 4BFOA 4MQXC 2AAVA 3H1ZA 4OJEH 1XCTA 2KT6A 3NACH 2R29L 4DKTA 4WWKD 1GAFH 2UVFA 2MCMA 4S0SD 4DKFH 1XR8A 4K5PA 2KL6A 2A83A 2CGYA 2F54B 3HPLB 3GB7B 3JV5A 3VRIA 3ZL4L 2CBQA 3EYVB 4J3OH 1HDMB 2OQJB 4DN4H 4WLCA 1G7HB 3FK3A 4P4KD 3GUTA 5CLZA 1RULH 4YLBA 3NQKA 4UTBH 2UWEA 2V0AA 2R39A 3BQUD 3NA9L 3C6LB 1KTJA 1DSWA 4W9GC 4XZUA 4BZYA 3D09A 4A2FA 1A6ZB 3F05A 3RL2A 4PBWD 1LDPL 2UY7B 3V5HA 5DJDA 3UO1H 4MB5A 4OGXH 3EJZD 5TFSH 3S88L 2CA3A 3VXMA 2CKBL 4BGLA 5CR8A 4Y2LA 3WFDH 4MB1A 3DRTA 3ZE0F 1QUNB 3RX5A 4XHJC 1CTMA 1QFUH 2L7JA 4ODHL 4PLJC 4XNDA 4OT1H 3MBWB 3O2DA 3OKOB 4FMVA 1ZHLB 2PN5A 1YMMA 4KROC 4N2CA 4JFQB 4KKAD 2NXZD 2R4RH 3O3AB 4U05A 3HNSH 4BK4A 5I16A 3ZTNH 4MJ6A 1XGPA 3FB8B 3O9WD 5I74B 3FQ2A 4P46B 5I1LA 1OZUA 4P59H 4EN3C 4XMUA 5EDXA 3BYYA 3OSKA 4JEGB 2GBTA 2PW2B 5D9SA 2IQ9L 4HUUB 4QHMB 3VGHA 1M71B 2B15A 3PQYD 1AXTH 5FGCB 3FTGB 1GC1H 1XV8A 5HTSA 1M53A 2ZE0A 4F7CA 3C2AH 4NDMB 4K5LA 1QFHA 3E2HC 3NDYE 4MCZA 5FV1L 4DCQB 3LKSA 1ET5A 3BRGC 4K5MA 2V9UA 3HI5L 5C3IA 4GG8B 5DJZA 2HJLB 3GSNA 4ZUVA 3ETBF 1S7VA 1T2XA 2DWEB 3L4YA 1BJ1H 1FL5A 4MXVE 1MHPH 4XNMA 4NO2B 1E27A 4WK4B 1EEYB 1GTFA 2DQUH 1I53A 1P7QD 4X6FB 5B38G 4IBUA 1XBRA 4XVUC 1U21A 2NCMA 1DJIA 4DZBA 4JFFB 2XXGA 3BUQA 2CJSA 4Z7UE 1SDYA 4XNQB 2P3YA 3NBNA 4IRJC 3MCLL 1WFMA 5AZ2H 4MSWA 4ZTPL 1G9NL 1RQ5A 5BO1L 1CL7I 5IHUL 3I9IA 2APXA 2VH5L 3OPZH 4FYQA 4YAQB 2HFGH 3U9PH 3BUPA 3EO1A 4NNYB 5GISH 4TNVF 2VXUL 3QGVA 2V3FA 5AVSB 4DZ8B 5DJ8B 2EDDA 2YS4A 2BNQE 3CU1A 5CBAA 2FATL 4OF8A 5MEQA 3D69A 2AEOA 3Q5OA 3C6SB 4AENB 2CGRL 2F7PA 4QYAA 1XH0A 1BLNB 3BJLA 3NJVA 4FTVD 1J5HA 1V55B 1USQA 4EOWL 2J88L 4NQTA 4S1RL 4Y4FA 3MNWB 5DA4A 4ZMYA 4NZDA 2VDML 1GZPB 2I07A 3BPNC 3QO1A 5T33H 4Z7WB 4KZEH 1P9MC 3RWGA 3KPPB 1EDQA 2JVUA 3L9BA 1T22B 3KVQA 4D9LL 1B0IA 1QSED 5T3ZD 4QI3A 4PS4L 2ZOKB 2F8VA 2LQRA 3WN5A 4WU5A 2R27A 1KCVH 3D0LB 3VFOB 3WTYA 4PJGA 3JWOC 1EGJA 3CLEH 2E6QA 3WHXB 3C8HA 4HK3N 2C9XA 3OKLB 4KI1A 2VUYA 3FCUB 4FG6C 4JO2L 2Q3ZA 3HAEA 3DX8A 2VDOH 3QJVB 4N24A 4RFNC 4QRUA 5GGVH 4ELDA 2WXPA 2VO5A 3KWWA 3OLIA 3CZLA 4XCCH 2X4NB 2ZWSA 4EQ3A 3UPRA 2QT6A 2DLHA 4GP8B 1V3LA 2QQLL 1RK1A 3SSGA 3UC0H 3HZVB 3OB0H 4Z9KB 3RJOA 4GKNA 1NDGA 5KBNC 5IMMA 1N70A 3INOA 1QTSA 2EC9U 3ULVD 4ONFH 5FWRA 1Q72L 2R2HA 2XKNA 3ECQA 4WEUD 4AQ1B 3B2DC 2VZTA 5EZIL 2QQNH 3SDYL 4PJIF 3UJTH 3FT3B 4N68A 1X5GA 4XXCC 2Z4QA 5CJQL 3VQMA 1DQIA 4Y5VC 4KQ4L 5CBEB 2CO7A 3EOAB 4GQRA 1DCEA 2Y36L 5KYUA 3OAZK 1IX2A 4FXKC 4B0MB 1J0JA 2OK0L 1I85C 2ZAHA 1BIIA 4LNVA 4Y9EA 4N6QA 1ACYL 3WEMA 2R2BA 4JN2A 5IESL 4R7VA 4UBDC 3PHOA 1EAPB 2FH6A 4OF5A 1D7CA 4YXKH 1J1PL 3AB0B 1JXDA 3KGSA 5EOQL 5IBTH 2H0EA 5IQNA 2Y1YA 4QXGL 3X11A 2IIJA 2X1WL 3TNMA 3QJFA 4WNJA 1ILUA 3IN0A 1FHNA 3VXPA 5KSAB 3C87A 4LVOC 2KLSA 3O8XA 5E95B 1X5MA 3HE7A 3KLLA 5AW2B 1MFEH 1DBJH 4M8RA 1TJXA 1F4XL 4OZFB 1CFVH 5FO9A 1KBBA 1RUAH 3LKRA 2H32B 3CSBA 3R06B 3L4ZA 4QWWC 2OCCB 1IC4H 4I1RA 5I1HL 5B1KA 3CC5A 3ZQWA 1UJ3A 3K91A 3SJVE 5HDBB 2BC4A 3CDFA 2GYSA 3T2PA 3V10A 2LU3A 3QUZA 2X70A 4U3SA 1OALA 1OKEA 3UJJL 1JPTH 1RL1A 4E41D 1A6AA 4IBZA 4OBSA 2GITA 4NO0A 1OAUL 1NCOA 2K6ZA 3QIUB 4W4NA 3V7AE 2BFVH 3BKML 3KM1A 2EIEA 4I48A 4PG9A 4P99A 4Z7UB 5IJCC 1LO2H 2NNAB 2FD6L 2N1TE 3DO7A 3P4OB 5G55A 2Q6WB 1T03H 2AVGA 1TJIH 4KO9A 5FCUH 2IG2H 5JMOC 4Z77A 1G7QB 4NN7C 5H4ZA 5H35B 4N6RA 1AZNA 3IM1A 1XH3A 1DQLH 1T1ZB 2DWSA 2EE6A 4Z95H 4OZIE 2BRRH 1DVFB 1EBAA 2BNQB 5CGBA 4X5XA 4NKOB 3RVXD 2B39A 1S3RA 3ZT7A 4KRPC 3HB3C 4YBQD 3H3PH 4FQXC 1RIHH 1EO5A 1BD2D 4OW6A 1B6UA 2B20A 1UB5B 2C9RA 3L3DA 3HZMA 3I2CL 3GZPA 3RDTB 5I30H 4X6DA 5MEPB 1S7SB 1VZGA 3TCTA 1ODAA 3O2VL 3CN1A 3UAEA 1OPGL 1YEJL 5JUEL 3VO0A 1EAQA 4JPKH 1KWGA 5JPMA 1SDDA 1T4WA 5L2JB 2BW4A 4O2FA 2NY3C 2OMXA 2OTUB 5F3HB 5CILL 1OLLA 3IWVA 2CHDA 3D7PA 4DO6A 4LSQL 1EFQA 3MRLB 1UZ6F 5CZVL 4HQQH 3MLPA 1UTDA 4MQXD 3PP3K 5ITBL 3RL1A 4GPVA 3V5DB 1VADA 2V8MA 3RU8H 4CN6A 3HRZC 4NCC2 1HHKA 1H9DA 1KTLA 3O81A 2W0KA 2WIIA 9PCYA 1EHAA 4Y88A 4ZAKB 5D6DA 3CK0L 4FHKA 2ZG3A 4MD0A 4XNYL 7CGTA 1HX0A 2EE2A 3CFDA 5BZZA 1OCCB 2A6DB 2HRLA 5D72H 3HZKB 2B4CL 4WHYG 5HJBA 2AQ3A 3AT9A 3TH4T 1N12A 1KJ2H 2XWCA 1ND0A 5D96B 2EXTA 4DGYL 4F8PA 1FGVH 3ARFC 3FUHA 1L0YA 4JQVA 5CJOL 1J86A 3V6OA 3T6ZA 4PLJD 3EOTL 1X9QA 1LILA 3PWJA 1OAQH 3B3IB 1IVLA 1MXGA 5INCB 4KROD 4G8GE 5HYSA 3NJXA 5I6PA 2H47C 4HLEA 1JNHB 2IH3B 3TT1H 5HHQB 3S9DB 4AQAA 2V5YA 5DDHB 1H15B 2NY6C 3PDGA 3LS5H 3BN3B 2DLFL 2JMRA 4KY1H 2LAGB 4U49A 2DI8A 1JNNL 1FE8L 3LJ3A 1CGUA 1MREH 4LLAA 2YIHA 3FN0L 2HB0A 3WDJA 4HFUL 2VMDA 1GGBL 2AERT 2F54A 3BAIA 4QF1B 3BYTA 2P44B 5HGDA 5AW7B 1PZ3A 1YYLL 3EYVA 1CF8L 1HDMA 3QUXB 3ECBB 4ODSH 5I1KL 2PPAA 1KYUA 4RGNE 3SDCC 2WGXA 5DO2C 4FNLL 3SJVB 3X3GL 3D85A 2KPNA 3U1SL 3C6LA 3SGJA 3JUZA 4NGHL 4C56A 1A6ZA 2QEJA 4KJPC 1NMCC 5E4EB 2UY7A 5DUBB 3WIHA 1UWYA 1QLEB 2IGFL 2WYZA 2OR8A 4XVUD 1VERA 3ESOA 4L9DA 3OKNB 1THAA 2C3GA 2WBWB 3MBWA 2NNXA 2GJPA 3OKOA 2BXYA 2NY5C 1NMBL 3GBNL 3HC3H 4IRJD 3U9UB 4QRSB 4JFQA 2D4FA 3W39B 3QJOA 2BVEA 5D1QC 3UROR 4E0RA 4G59C 2O4EA 1B4LA 4OZIB 2W0PA 1KJMB 3T3PF 2ADJB 1L9PA 4P46A 2DYPB 4QCIA 4QXVA 4ZT1A 2Y7NA 1RSYA 2Z31A 4HUUA 2V7HB 8FABB 4DUVA 2X6MA 1BMWA 5L88H 4LBAA 2FHFA 3FO9B 4YXHL 5ITFA 3FTGA 3WKYA 3ZYIA 2ORBL 5J06A 2OMTB 4NDMA 1ET7A 3ZHFA 3LV3A 3RY4A 5INDA 1IMHC 4PGDA 1XCXA 3T8XA 3M17A 2VXVL 1WJ3A 2RBLA 4F24A 4JN1L 4FQLL 3TWYA 4WK2B 1C16B 2GEQA 3F7YB 4GG8A 4YBLC 3K6NA 1A7QH 4K3GA 4E9RA 2VSKB 2LAAA 1IRAY 4PV8A 1AXIB 4PRNB 5C09B 4HMDA 2WZ5A 2OCJA 4NC1E 4ES8A 1LDSA 2DQJL 5CP7B 2ESVE 1EEYA 5EC1B 2YBGA 4X6FA 2WNGA 4M8QB 5EBMB 3KMDA 2LOEA 1CZ8H 4HCRL 1W0VA 2FJFA 4FG6D 1F97A 4BFIB 4UT9H 6CGTA 2ERJC 3IMWA 4ZNEE 2FBRA 5T1KA 4XNQA 5F6IB 4XP1L 1I7ZB 3L08A 5BUPA 2YPLA 3T0XA 4YAQA 2O6CA 3MLXH 3B9KC 4Q6KA 4Y5YB 3SE8L 3AXLA 5G4NA 3WUWB 4HUWB 1SHXA 3GMNA 4XN2A 4B5ZA 3BCDA 3I6SA 4R7LA 4XODA 1J05A 3C6SA 2Z7WA 1KFGA 2VZ1A 4IOFC 1RZKC 4OTXH 1BLNA 5EN3A 2J4WL 3ISYA 1A1OA 2WTPA 1IAIH 5FXCH 3BRFA 1QNZL 4XMLL 1NOAA 3CN0A 3MNWA 5GZOD 5DJYB 3M45A 3INUL 2X9WA 2WAHA 1GZPA 4Y7MA 2ENSA 5AKTA 2C7UB 3KPPA 3NCXA 4GRLB 3UBXI 2FSDA 4G8GB 4UBDD 4PJHE 2WUBH 2EEFA 4FFZA 1H3WM 2ZOKA 3RY6A 3VFOA 3D0LA 4IBLT 4DAGH 5IHZB 5TD4A 4HUKB 2B59B 1CIDA 5IB1B 4G5ZH 1OAYH 3U7YH 4R5XA 3QQ3B 2YAMA 1DJZA 2D2CC 2WCSA 3Q6GL 3CX2A 4NFDA 2K6WA 4TQIA 2XYBA 3BKCL 3MRQB 2X4NA 4PJ7F 4QOKE 3SBWA 2WSDA 4JVUA 3GS4A 3TN0B 1FNGB 4QWWD 3HZVA 4KBPA 4OFVA 4RGNB 2E8YA 5DUML 2JIXA 2AQTA 1IV8A 4EXKA 3GWJA 1TVBA 1VEMA 1KOAA 2DKUA 4K7PY 3WMQA 1MCHA 5GRJL 4Z3FA 3ARBB 1U6AH 2VAJA 3TV3L 2PCFA 5DI8A 4L1SA 5K69A 4M48L 4NZTH 1TEYA 4RQQA 5DFTA 5T1JA 2AS5M 4N8VB 1CE1H 5B39B 4FQIH 4NLAA 3GZKA 3O2DH 3QNYB 4LOVA 5BVJB 2OJEB 5F7BA 4YE4H 3WFEH 2MEJB 2CA4A 1HT6A 3UYRL 4Y4HB 5FDWB 3V4UH 1EAPA 2WZPA 1Q0EA 5GGSB 2VERN 1KB5B 2TSAA 1HAWA 4ZD3H 5I0YA 1QW9A 2JQMA 1OOWA 3D5OF 3RUGE 3X3FL 4MD5A 1JDCA 1EZLA 2F61A 5KSAA 5IM7B 2I60L 3EXJA 3BWAB 4FQCH 4KRPD 3VTAA 3HB3D 1M7UA 3Q7JA 2FB4H 2J1ZA 4FQXD 1GOGA 5T1DH 3T0EC 2DLTA 4YSRA 4OZFA 1A5FH 2DIJA 2DLIA 5FYJU 4F9LA 1JI1A 2H32A 1B9ZA 3R06A 5E8OB 1T66C 3II3A 1ZS8B 2NY7H 2PW1B 4UZSA 1UYWH 2GJ6D 3JTTB 4MD4B 1KPVA 3OKDB 3GSNH 3ZHLA 2NY3D 1R3LA 1WSST 3TEUA 5D2LF 3R19A 5A2JH 5BV7H 3E6FA 4UM8A 2GTWA 3GJFB 1WFTA 2ESVB 4FX5A 3ZSSA 3ZDYB 4ELME 2P7TA 2WSKA 3G5XB 3C5JA 4R3SB 3V0VB 5FX3A 5EDSA 1GTNA 3CXDL 4V11A 3MCKB 4OD1L 2BP5M 2J5LB 3CX5K 5AZUA 2WVSA 2VR8A 2QKSA 3SE3C 2NNAA 2VYRE 2RJMA 3P4OA 3LDBC 5AOLA 1IL1B 1RUKH 2ZOTA 2FVNA 2V9RA 5JNYB 2QLVB 1G7QA 4F58H 2W65B 5H35A 1WFOA 1A4CA 3EFOB 1JGLL 2QADB 5F97E 2XIIA 5FB8B 1WQVT 2K0RA 5IROC 3VFWB 4KO6A 3FZUC 2BNQA 4JM4H 4K3HA 3T4AC 4XPFL 4NPYB 4NKOA 1MVFA 3VAEA 5GGUB 4J2QA 3MCYA 1AGFB 2EILB 4M43H 4RAVB 4W9FC 4WV1B 2QKIB 2ED9A 2GPZA 1MPAL 3ARFD 3D25B 3QR2A 1A2YA 4LLDB 4MX7B 4HFWB 1JTPA 2FL5B 4N5UA 5EZLB 3RDTA 1S9WB 4BIKA 5JHMA 5MEPA 1S7SA 3BIKB 4WFEE 5JZ7C 3HG3A 5HGGS 1G94A 1S9VA 2A9NL 2WYIA 3L4WA 3P4NA 3WFHB 5GHWH 4L1LA 2GK0A 1RPQA 5L2JA 2MOQA 5AOZA 2YUWA 3M6DA 5KUMA 5I6XB 1OGAD 2OTUA 1GRWA 3VH8G 3MRIA 4RA3A 1EGJH 2Q8BL 3RWDB 1GXEA 3MRLA 2NY6D 1E8ZA 1V3JA 3LNDA 4LSTH 4UQAA 4N0FB 1ZT4A 2OMZA 4FFVC 3BZ4B 4ZX4A 1SY6L 3QO0B 3WE6B 3HAEH 3V5DA 1SOKA 2BNRE 3ZVVA 5ILTL 1F6LL 2EO7A 5TE7L 3U4BH 4HEME 2YJLA 4CSSA 1TSHA 2V5MA 1HEJC 3E1ZA 1T7VA 4GH7B 4H4NA 3A3YB 4Y2OA 4ZAKA 2JI3A 5A1AA 2BP0A 4OBRA 3QZPA 4DGWC 3LEVH 4N2LA 1X7QA 2J55A 3DI2B 4LCCB 1G0DA 3SDCD 3VSQA 4AEHL 1KFAL 1RUMH 2P1YA 3II2A 1EBPA 4POYA 3LMJH 4G9FB 2A6DA 4X99A 4JG0L 3G6JF 3WS6A 1V10A 1FCCA 4GAJL 2UUDH 3DUUB 3VFUB 3NJKA 2ZAIA 3WKMH 4TPRH 4WNQA 5KS9F 1GYUA 1ZTXH 4KWUA 4KJPD 3L5IA 3VD9A 3VVVA 2VLRA 4PJEE 5K1VA 1DJHA 4JBSA 4NP9A 3PWPB 3S4SB 3MLSH 4N90E 1MRDH 1BOYA 4J3OF 4I13B 3RILA 2BVYA 2L04A 4XMZA 3S6CA 4PWIA 3SCMA 5INCA 1VENA 1YPZF 3ZZ1A 1XWVA 5K33A 2JJUA 4IMLB 3S48A 1E7VA 5F7UA 5D1QD 1JNHA 1MH5A 3T2LA 3GLDA 5HHQA 2CG9X 3VCLB 4XWGL 2AAAA 5DDHA 4DW2L 3LN5B 2YOCA 3LCYA 4OB5H 3RUGB 4JHWL 1R0AL 1H6FA 1RLBA 4EI5B 4QXTB 4Y8DC 1NCHA 1J5DA 1MIEH 4GQ9L 3WLBB 2F19H 2QQQA 3WOVA 4A7GA 3TFBA 1MQ8A 1EZVX 1FNFA 2X4PB 3CAFA 3MUJA 3N9GH 2WWKT 3QORA 4BBWA 3ECBA 3ZE2F 2A9CA 4BQ8A 2Y2TA 2EDTA 2XQYG 4JHVA 2KC0A 3VQ1C 2JKJA 2Z8WC 4N8CL 3L9YA 3LIUA 1ZV9A 3N41F 4JRFA 5FYJH 2ZZUT 5LQBL 1BXUA 3F7VA 5T3XL 1S7UA 5CD5C 1IGFL 2L0DA 4WTXA 5BRZD 2EIBA 4D0CB 4ECNA 4N1CA 4ONGL 4PI2A 1HYSC 4RBPH 4ELMB 3C8DA 2NQCA 5DUBA 5DVKA 3V8OA 4A67A 1X9LA 3NSDA 3T71A 1AC0A 1J0IA 2APVA 3M1BB 4LCUB 5F1IB 3SOBH 3F00A 3OKNA 4KUCF 5GZNC 3IDGB 4QTFA 5A3IC 1DL7H 1FNHA 5GIRA 3MV9E 4H8HA 3ZZLA 4QEGA 4OIBA 5T3ZL 4DP1X 2E7BA 1ZT1B 3EOBB 3IXTB 1HEHC 1Z0MA 2Z1PA 3MRCB 4FFYA 4FQ1H 4WI8A 3DUSB 5ISZD 3MNZA 2ZG2A 1WLHA 1AZVA 5DHVB 3LHPL 3OLDA 2GBVA 1OGSA 2FT8A 5JR1L 3EGDB 4OZIA 1KJMA 3B9KD 4AC4A 1MF2H 2ADJA 2DYPA 3DXAD 4MHHI 4M6NL 2CCVA 4Q6YA 3ZDXF 2H2PC 3BXNB 4D3CH 1KCWA 4AMKH 5B38B 2MQ0A 4NZJA 2IQAB 4FJZA 1RVFL 4IOFD 5D7JB 3FO9A 4YPJA 2DLGA 1CICB 4P2AA 2ZOLA 4KMLB 5HYJE 3HBZA 5T1LD 5D93B 1MFAL 3BJ91 1EFXD 3JVFC 4AL8L 3ULVL 4PJ5E 3ZJAA 3ARDC 2PNDA 1C16A 1KJ3H 1ZK5A 2R0WL 3JZ7A 1MWAL 2ADGA 3PV7A 3IFPB 1F3JB 1JNJA 5AZEL 3VB9A 4L8SA 1JHLH 4YFLI 4XPHH 3VA2C 1VGEH 5EC1A 4TKWA 3WELA 2VO8A 3GXUB 3A47A 4M8QA 4WGWB 4XNXH 5EBMA 5I0XA 5DD3H 3BEWA 4QHUB 1FV1A 2BNRB 2GI7A 4UQ2A 3WO4C 3GHPA 4WFHE 2COQA 2FEJA 4L8BB 4CJ1A 1JYWA 2P8PB 1I7ZA 4U6XA 4WI9A 5FUZH 3E6HB 3LH2H 3MFGB 3O45B 1GKOA 4F1SA 2Q87A 2NNRA 3RG1C 3JQOB 4JFSA 4HHGA 4QJ4B 1JRHL 2VUKA 1OTTC 4G6AC 2CBPA 1KCSH 4N25A 4Y5YA 1GZHA 3V6FB 1HNYA 2CKBB 4G42B 4HUWA 1JTOA 2WLZA 4OQ1A 4Q9RL 2FEDC 3L7EB 1DDTA 3MRRB 3M46A 5HDQH 4Z7OF 2GSMB 4PJEB 2PWHA 1FO0B 3RLSA 1OCOB 1J5OL 1EHXA 2UXTA 5LN4A 2N7BA 3NJJA 1EV2E 1HESA 4NJ9H 2KYIA 1KV3A 2A5UA 5DJYA 4C4KO 1N9PA 1S7RB 5J6HB 2C7UA 4GRLA 2M8XA 4G8GA 2PP9A 3JV6B 4YMPA 1OLZA 4M61B 1PBYA 3DKHA 3EYOB 4ZDHB 1AOZA 2UXGA 4QNPF 3I6GB 2E46A 2IEPA 5KG9B 5FV2A 2E47A 4MBOA 5IB1A 5J9PA 1XL4A 3GK8L 4P9HH 3VRLE 1AHMA 4WIQA 1Q9OA 3DV6B 2W88A 5TDNB 5AAWA 4Z3EA 1NFDB 3T0ED 1NFKA 1PIFA 2ZJSL 2CIIB 3VDAA 3MRQA 3MACH 2XX1A 3TN0A 4JG1L 1FNGA 1I9JL 3GXIA 1T66D 3KXFE 4YLCA 4OLXH 1LE9A 4NSKB 1Y0LA 2J8UE 1BVLB 4NBYB 1MFDH 4RA0C 2QHRL 2BWDA 4L4VE 3ARBA 1E3FA 5FA3B 3MJ7B 5FKAB 1AQDA 4KTYA 3WIHH 3QW9A 2WXNA 1NIEA 2DMHA 4JDTL 4B9KC 5SX4I 4ALAH 1OV8A 1ZRUA 4AKPA 4ZFGL 3AFLA 4KKRA 2JB5H 4C58B 5B39A 2DTML 4R4BA 3P0YL 5EEXA 3OKYA 5HHXH 3GLAA 4Y1AA 2Y1VA 3HVNA 3MV9B 3ZT6A 5LXGL 1ZLWH 1PCSA 1G1KA 4Y4HA 5FDWA 3ESPA 1BVKB 3P2BA 1KB5A 2E76C 3IJYB 2D03H 1UM4L 3D07A 4LMQE 1MUJB 5KSBE 1YEGL 1ZLSH 5KVFE 3QJHB 2QJDA 3GI8H 2EAEA 5C0DB 5IROD 2YEZB 1CU4L 2BMKB 3RWFB 1X6NA 2UX7A 5CLTA 5D2NE 1VJSA 1FCGA 5IM7A 3AS1A 1IZKA 3GXDA 4C4UA 3BWAA 3H7BB 4NQUA 5AFAA 1F3DJ 1TETH 1QASA 4HKJA 3SPHA 5L6YH 3G5ZB 4PY8I 5HYJB 2GAZA 2GY7B 1CLYH 2PW1A 3IDMB 4U6VL 4HF5H 4HOWA 5EEWA 5JZ7D 3SE4A 1D6VH 4MD4A 2AITA 5E70A 2R56L 2PUQT 3OKDA 1PZSA 2ZXEB 4QRQA 2DJSA 4YHZL 3M7OA 1NCDL 3HHSB 2XA8H 1D9KC 3LQMA 4OAWB 3TONA 1HCYA 3BLKA 3MV7E 3B43A 5BZXA 4CN4A 2IMNA 3WL9B 2PR4L 4GUOA 3GJFA 2ESVA 3FU0A 3HG4A 3G5XA 4QHPA 3V0VA 1USZA 1KIQB 3MCKA 1TF4A 4FFVD 4I87A 3DHUA 3UG5A 2G2PA 5IVXF 3BDXA 1FJ1B 4PIBA 1PX8A 4WSGA 5H94B 2IMMA 2D7PA 1PW3A 1AIZA 2X1PA 3LKPB 4K0OA 4ZNEA 4G7RB 4YK4C 4KX7A 4LBEA 5AOJA 3MLZL 2EVJA 1INQA 3B8YA 5EA0H 1PD1A 6TAAA 1IL1A 1J87A 3B9VA 3FU9A 4HJIA 4Q52A 3VFMB 4L23A 1PJWA 2W65A 1JVLA 1NGPH 3EFOA 5EWIH 5JHLL 5IT2L 2YGPA 3BEVB 2OFQA 1XB6A 5DGRA 4PG2C 3DPBB 1HHIA 1MJ8L 4NPYA 2GVYA 2W07B 3QUHA 1CIUA 2X05A 1KZQA 1AGFA 3KPRD 1U8MB 5H37G 4WV1A 2QKIA 3ARVA 1BHGA 3K2UL 5D7IE 1C12B 4LLDA 3VFNB 3UZQB 3W1ZA 4ZFOL 2JJVA 2FL5A 3M86A 3TO4A 2YR3A 2Y7LA 4NKIL 3BIKA 2VE6B 4KXDA 1VPOL 4OSUH 5E94B 2PPEA 2I26N 3WTXA 4FFZH 4PJHA 3SGKC 5J7CC 1IGML 3PDOB 1XEUA 4FQJL 4XPTH 1XD0A 1FRGL 4TNVK 3MJGX 2X1OA 2ZP9A 4JZNB 4P2OC 2C3XA 1XB3A 4O02B 1UC6A 1SHMA 5E6IA 2QGEA 1K5WA 2HLAB 3BZ4A 3QO0A 1TLMA 4XMPL 3LRSB 3VG0L 4BCZA 3UIZA 4YX2L 4KZDL 4GKZA 4QR7A 5C0CE 4AYMC 1QNIA 3HE6A 2BY3A 4QOKA 3SODB 4DFHA 1VZHA 2HFTA 1DVYA 3BP6A 4LCCA 4YHMH 3S34H 1KJVB 2JJTA 1ZA3A 2ZXCA 3H9YA 4HWEL 2NNFA 2J8UB 4HJJH 2PO6C 3CZKA 5C08A 3SDXE 5CD5D 2WXFA 2L7QA 1AS7A 3VFUA 1A6PA 4FNSA 4E42B 1TJHL 1HYSD 1ORSB 3SB3A 4L4JA 4N85A 3BPLC 3AAZB 3L3KA 4BFNA 6PCYA 3W38A 2YO3A 2XWTB 3KPSA 1G9MH 2O30A 2Z7YA 3S4SA 1NOFA 3ZN6A 3GHEH 1OT1A 2MIZA 2OAAA 5GZND 5A3ID 4MMZB 5D7KE 3TL5A 2I69A 2NSQA 1U3HB 5D5ME 3CBRA 3EJSA 4KK6C 2NX5E 1KBGL 3QCUH 2ZAGA 3CTTA 5DEFB 1BYPA 3DRQB 3FPYA 5IF0B 5LAPA 3NJMA 3VCLA 4FEIA 3MOQA 3BZEA 4JCWA 3RUGA 3HIZA 4KJYB 3DIFA 4FOMA 2BWQA 2EEBA 3US0A 4EI5A 4QXTA 4JRYA 2H2PD 2IPUK 4HD9A 3E38A 4AIXA 2M1KA 3TYFB 4F80A 4CMMB 3WXVH 1AJ7H 4OZFH 4WWOA 4I5BB 3UYPA 2H32H 1WD9A 2X4PA 1BQLH 1Z32X 2H26B 4A2HA 2WLJA 2DQIH 1I4FB 3I74A 2VDNB 3B7RL 3ARDD 4ZYKB 6PAZA 5KJRL 5D7LB 1D2OA 3UTQA 1JGUL 3D39D 4RGMB 3QEGL 1GYAA 1TYEB 4JO1L 3MV7B 3D0VA 1ERNA 4D0CA 1E50A 4YXLH 1WTLA 3IE9A 4IRZL 3H2QA 5IHHA 3FQTB 1P1VA 1TPXC 5EBWB 1YUHB 1E90A 4HXBH 4LCUA 4GG6E 3TA3B 4P3DA 3NIGB 4XPGH 3IDGA 5EU7E 1WEJH 2W94A 1FVDA 2WJ5A 3H53A 3PE9A 4AGNA 1TZAA 1ZT1A 4LSRH 4PJDF 4Y4KA 3BGFB 1QSFE 4JGNA 1GCFA 1UWFA 4R26L 3U0PB 4Z3IA 4QRPE 2B1HL 2YMXH 4S10A 4AVHA 3EGDA 1OTTD 5FUOL 4G6AD 5HY9B 5L4JA 2J8OA 5DJ0A 4LNRA 5E2TH 1HCZA 3CSGA 3VFSB 3WXWL 1YYML 2VMEA 3BXNA 4HSAC 2AMGA 4ANXA 2IQAA 1IJNA 3GMRB 3OAUH 4XN9A 1FFNA 5D7JA 5DVLA 3T2NH 5JORA 4NQCE 5D7IB 2R8SL 4ZO9A 2OYKA 3AXIA 3BH8A 4JB9L 3S8FB 2RALA 3VG9C 3BN9C 1DBBH 2J73A 4L48A 2FEEL 2C9VA 2V8LA 5DJXB 2LVCA 2HSIA 2C1OB 3IFPA 1F3JA 5HDRA 2UXVA 3CDZB 1PKOA 2G75B 4KFMA 4X4ME 2R29A 5DK0A 2N7SA 1LQBC 4KX9A 5DHMC 1FVCB 1MAKA 4BXVA 3MBXL 3VMNA 2AJVL 3A4EA 3DX0A 4JPVL 2ZONA 2Z8RA 4WI6A 3WNMA 5AWNL 1FFPB 4HULB 4UAOC 4FZEL 1RU9L 4QHUA 5LDUA 2BNRA 2EIDA 5C0CB 3LQAC 2ENYA 2VMCA 3T1FB 1OAZH 2V17H 4XVJL 3S7GA 3RIAF 5CEZL 4L8BA 4HEMA 4WTZG 2P8PA 1CBVL 3E6HA 1OGPA 2A0LC 2H2SC 2Z34A 3MA9L 3O45A 2ZWNA 4V2CB 4PS8A 4GUPB 3LN4A 3NJHA 3UTSD 1SUHA 3P02A 3IU3A 2AXGA 2VDRB 3R7RA 3QZNA 3SDXB 5ID0A 2CKBA 2E75C 4KTEH 3CDYA 4M7LL 3W9DB 5I1GL 3KPLB 3BMVA 2PXYB 4U1HB 1OCRB 3IGLA 2BDNH 5I76B 1UUNA 3L7EA 3UBXA 2XXMB 4UOQA 3CMOL 4R96B 4UQEA 4PJEA 3QULB 4JHAH 4XO9A 1FO0A 5GS2H 2X3CA 2EEXA 1PG7H 1JK9B 2FZ3B 4Z7AA 3VI3E 1Q0XH 3DYOA 3MREB 4MCMA 4ZMPA 1KG0B 1GMEA 4UTAA 4IMKA 2Y24A 5J6HA 4M00A 4M7KH 3PPEA 3HI1B 4RIRB 2EE0A 5D5MB 1RP9A 2O5YL 2UWEF 3MCG1 3FFCD 2E27L 4F9PA 4LL4A 3TWCH 4G72B 3OGCB 2NW3B 3I6GA 2AEQH 2FUTA 1FFOA 4KQ3H 4F2ME 4XP9L 4IIQB 4CSTA 4NHUB 5DVOA 1GGYA 3MGOA 4B96A 1XF2B 2Q86A 2YD9A 5E8DL 5F9WB 4TS6A 3U6RA 3IRPX 1N64L 1A47A 1INDL 3LD8C 5TDNA 1IM3B 4WW2F 2ZF8A 3OKKB 4HKBB 2ATPA 5AUMB 4Z6AT 4PD4J 4BZ2A 3IFOB 3BUYB 3ABZA 3EDKA 3WTTA 1IUZA 5BS0E 2ZXGA 3R8QA 3WBDA 3ZR6A 3O11B 2IBBA 1AHWB 3BVDB 4PYHA 5IHLB 1IT9L 1BVLA 1T6VN 4HHAB 4UT7H 4YN3A 1IKOP 3B2VL 4M8UA 4GI6A 2O61A 3MJ7A 5FKAA 4BFEA 1QLEH 4FJ6A 1FPTL 3NN8A 4U1JB 3NCMA 4YSPA 1NBVH 4GMTH 4OV5B 4GG6B 3CHSA 1T2QH 3D2TA 1Z7JA 1V3MA 1S3KH 4DVRH 5F9DC 4JKPL 1SEQL 3MV9A 2V7NB 5JQHC 3Q3GB 1K4CB 5K9OB 5MERA 3KCPB 3G6AB 4FFYH 4G1EB 1QSFB 3N43F 3V4PB 5C3LD 2AK4A 4PB9H 2MPVA 3IJYA 2XY2A 2YD3A 4NUQA 4JO3H 1MUJA 1MCLA 2XUWA 2Y4SA 4KOCA 4NWTH 3QJHA 3W3BA 5C0DA 1ZV2A 1EZUA 2EIMB 2BMKA 3NK3A 5GQBA 3STLB 3U7WL 4ENEC 1AXSB 3T4YB 4GRMB 2FRGP 2R0KH 1JRHI 4PS3A 3VXQB 2CUMA 2ZKMX 3H7BA 5DRNB 3ZUNC 5ID1A 1ZWIB 3U1QA 1JF6A 4F57L 4EVNA 3C5ZB 4NQCB 3G5ZA 3MZTA 4RMTA 1IM9B 3NCCB 3WDIA 5HYJA 1GAFL 1LO4H 2A7BA 3IDMA 4P04A 1FZKB 4PJ5A 4L9LB 4JFDB 1EMTL 3RRQA 5DURB 1NICA 4YZFF 4DO5A 1A25A 2M2DA 3S36X 2YXVA 3JWNE 2XQBH 4OAWA 5EUOE 3MUUA 4Q74A 6FABL 4X4YA 2FO4B 2Q9OA 3L3OA 1EXGA 3NESA 1CL7H 2WLHA 3GPSA 4P2OD 4UTBL 1ETJA 3UBGA 1KIQA 5I1CL 1ZLUH 4JY5H 1JZ8A 1M7DB 4WEMB 1KN4L 1FJ1A 2F1AA 4CRPA 1A9BA 1T5WB 3H2PA 2NY5L 5H94A 3LKPA 3DETD 5TFSL 3N5AA 1BP3B 1SN5A 2EO9A 4N2HA 4R84A 2ZXQA 4NO5B 2OMWB 1SLUA 4E5XB 3NZHL 4IS6A 4WI0A 5AVWB 3VFMA 1WT5A 4OT1L 1LL1A 2O6FA 2N1KA 5AKRA 1ACZA 4KXCA 4LSSH 4PJGF 1EHNA 1UOLA 3PQYE 4WO4B 5EOTB 2PO6D 3BEVA 3GIZH 3P3RA 4HT1H 4IGBA 3HNSL 4HPOL 1ZY9A 2J21A 4WI2A 2W07A 1U4EA 1PAMA 2ZUYA 4I18C 4XRCA 2KZKA 4JO5A 5E8PA 2P80A 3SDAC 3D3VD 1BZ8A 3I75B 2XTLA 3MOAH 4LVHC 2EDLA 4P59L 4R97B 1C12A 5HVWA 3H54A 2ZPKL 5DEGA 1UKSA 2LFGA 2FYYB 2E7HA 2RACA 3AU1B 4GOSA 1I1YB 4HIHA 3VI3B 2OYLA 5L8LB 2VE6A 5EUKA 1AXTL 1WIPA 4DO4A 1GC1L 3AITA 1GGCL 3KR3H 4KK6D 5AB1A 4CVZA 5TH2B 1BZOA 4NYLB 5EZOL 4K23H 2QQKH 1HHGB 3ZE1F 1BPLB 3TTYA 1UD3A 1EJOH 4N2OA 1NZRA 2YFNA 4JZNA 1A1NB 2ED6A 1ED3B 4O02A 1W0WB 1ZHNA 2CE6A 3GZQA 3QDGD 3WYRA 1EHLH 1FH2A 2OW7A 2B8OT 4S11A 1V8HA 3O6LL 3L54A 1SXNA 3AY4C 1MHPL 4BINA 2NLJB 2F53D 1BLIA 2QFPA 3R18A 2N59A 4MKMA 2AP2A 1F2XK 2LABA 2JKWA 5EBLB 2DQDL 2JI2A 4P5TD 5KVGE 3QCTL 2CBMA 1TTRA 5BS0B 3KXFA 3FAXA 3MRMB 4PIRF 4MAUH 3F5WB 3K5SA 2CK0H 1XCWA 3QISA 1H6TA 4OZGE 1TU2B 1WWAX 1KENL 2A6JB 4PN6A 4FTVE 3D08A 3G5YB 4BQBA 4ODTL 1R5WB 4L4VA 1CFQB 3B7TA 1K4DA 3U9PL 4E42A 3U1PA 1BWMA 3O41A 2ZCHL 3AAZA 2YLKA 4TUJB 5D70L 5GS0H 2ZWLT 5DFWH 3P9MB 2V9QA 4AQ1C 1QSEE 3J27A 3W37A 5T3ZE 1C5BL 1XEDA 3F7QA 3E3QC 1NPUA 2P8MB 1J8HA 1RK0B 4MMZA 2P28B 5HYQB 1F3DH 3ZDZE 4M7ZB 1T83C 1KB5H 4HJGA 1D5ZB 4WWKB 1A0QH 5T33L 1ZSHA 5DEFA 4JY4B 1F45A 4PMFA 2NUTA 5KSBA 3MRKA 3HC4L 4YO0A 1OB0A 1E43A 2PPFA 1QTPA 4FQ2H 2VWEE 5D2NA 1U93B 2ZX8A 1ZD6A 4KH9A 1G1CA 1ZSDB 1KCVL 2O5NA 5JHDD 3MLWL 4G43B 2K7QA 3POCA 2JELH 3SE9H 2TRHA 4CMMA 4PJ9B 4PJXE 3ULVE 2NTSP 1T3FB 4I5BA 3TZVD 1IGIH 1NMAL 3MN8A 3MODH 4DESA 3P0GB 4XHQA 1Z66A 5MEOB 1XXFC 3EZ8A 4XCCL 4ZYKA 3HFMH 3UC0L 4Y2NA 1RZJC 4Y2DA 5EUOB 2HTLC 3MV7A 3GJFH 1JZ4A 4LCVA 1MW1A 2G9HA 3UAJA 1WAPA 2XWJA 2WBJA 3FQTA 4GBXB 2DD8H 1K5NB 1MCIA 2NXZB 4CU6A 2XC8A 3HG5A 1YUHA 1FSKC 2QQNL 3TA3A 1J1OL 1JSYA 5J3HD 3NT0A 1J8KA 2P8LB 2KDGA 3O9WB 1I8LC 1BGXL 3MI6A 2JJSA 1SFDA 5AAMC 3PWUA 2V3DA 3T0DA 4XVTL 4YH6A 2BHYA 3QIUC 2A0LD 5FM8A 1T1YB 2MCG1 4DPBX 2OV0A 5HY9A 1IGYB 2XN2A 3K8KA 5KZCD 3VFSA 3IDNB 1IKFH 1QWNA 4MJ5B 5JYMA 2VN4A 5IBTL 4GKOA 1P5UB 3T1WA 2O26U 4MMXA 4CUCA 3GMRA 4M1DH 2F68X 1INEL 1DVFC 2N7AA 5D7IA 2Y72A 3P2TA 4LVNB 1Q1JH 2D0HA 2DQTL 3HUJB 3MLYH 1OHQA 4ABQA 4MQ7A 4PREB 4E9VA 4E41E 1DBJL 3H0TB 2IWEA 1P7QB 4LAQH 3LZQA 2BNUB 1OP3K 4M5YH 4CNIB 3VWKA 1P6WA 2MQ3A 2Y25A 1KDIA 2G75A 3FKUS 4IOSA 5ABZA 1SMDA 2A9AA 3RB5A 3ZTCC 4XP5H 4X7SH 2IXQB 3PABB 4EJ1C 1O9WA 1CQYA 1F41A 3FQXB 4FHJA 4N0YH 1BDYA 5AOMA 3CBKB 2VITA 3P3YA 1ES0A 1FFPA 2W92A 3VE0B 3CFKB 3IRCA 3Q2NA 1QPPA 3V5KB 2WC7A 7FABL 4AYDC 1CYGA 4ODVL 3THML 1BZ7B 4G6JL 1NBCA 2BFVL 3ECWA 4BK5C 4RMUA 1MZYA 1EEZA 1WISA 2GIMA 4OF3A 1CLZL 2A9MH 4GUPA 4H8WH 4OZGB 3O4LA 4MCNA 1OE1A 1BD2E 4FTVB 4WI5A 1TJIL 2R51A 3HEIB 1MZZA 5AW5B 3SDXA 3SKMB 2IG2L 4I0PA 4XTRC 2B77A 3T6XA 1VFUA 3WJJC 4Z3JA 3KPLA 4K94C 3DX9B 4U1HA 3ZHKA 5I76A 4QYOB 1G0XA 4HK0B 2CO3A 4R96A 1OSYA 3QULA 2HG0A 5DMKA 4FLQA 3MMEA 4KOBA 1HWHB 3BD3A 5DMIH 1V7MH 3A6BH 7PCYA 2R0LL 5KVEL 1DQDH 3HS0B 1PX3A 5I66B 1QHOA 2FIKB 5EEYA 3KPTA 1FORL 1KXVA 4GO8A 1M1SA 1TMQA 3FSWA 4RIRA 5D5MA 5FW8A 4UANA 3ZDZB 4QRAA 3WEXB 2NX5A 4LESA 1YVLA 3BGMB 3MRHB 5ECJE 3LPFA 3D50A 4ZZFA 4LQFL 3OGCA 2NW3A 1RP8A 5EBGA 4TSBL 1SBSH 1KC5H 3T6VA 3VXNB 5DT1H 3BP5A 4XP4L 2EXWD 4JLRB 3NH7L 1Q9WA 4NHUA 5LGHH 1FL3B 3WNOA 3PNWB 1O6TA 2OA9A 3WGUB 1DQKA 4F7EB 5E6UB 3L48A 4GRWE 1MJUL 2E59A 4HQQL 4PP2B 4HKBA 4P9ML 1E8WA 2YBRB 2VL5B 4GW5A 4JFHD 4LPTA 1T89A 1RZIA 3MA7B 5I17A 3B1UA 1AHWA 3LEXA 1L9OA 1P84J 3OGOE 3QI9B 3WAKA 1Z5HA 3QWQB 4UUJA 5C97A 3L9RB 1QFWL 3KYKL 1AGEB 3L4XA 3QUXC 4YHNB 4HCRA 5CJXC 5F9JB 2FEEI 4HXAH 4CAGA 1KEGH 5FHBL 5B1BB 1RUQL 2LT9A 2PP7A 4U1JA 1JF1B 3ES6B 4PAZA 1HFUA 2V2XB 5FA4B 1N7MH 3IEAA 1KJ2L 1EVUA 2CXKA 1FGVL 4LPUA 3Q3GA 1K4CA 3RNKA 5K9OA 3LZFH 5FM5M 1QSFA 3NSCA 2H0FA 2MH4A 3Q5TA 4JFFD 2WZ6A 5AVXB 2I32A 1YEEL 2P42B 4KFZC 2BVQB 4QRPA 2VDPL 2FLMA 2FX9H 2YQ2A 1HZHH 1U8CB 5D1XB 1MJJB 3OJ2C 3STLA 4JG9A 3T4YA 3O6KH 1VFOA 3NGBC 1WCBA 4AK2A 3NFPA 5DRNA 4F8OA 3RAJL 3TNNB 1ZWIA 3N3EA 3UPAA 3SDAD 2EUZA 1J5CA 4OGYL 3VFVA 4PVBA 4NQCA 5KAQF 4HS6B 1AVAA 2GEEA 1G7JA 4PY8J 4U1IB 4GEJA 4YL9A 1NC4A 4E41B 1S8DB 1GOFA 4L9LA 1IO4C 1VEPA 2TSBA 3PUCA 1MNUL 2WVUA 3PXJA 2R29H 2B3IA 3GXNA 4AGMA 1N5AB 4X4MA 2LTQB 2FO4A 4WJ5B 3GINA 3R4RA 2EIZA 3QH3A 3D2UD 5IW3A 4ZFZB 5DF0A 5TF0A 3ZL4H 3FN3A 3NCYS 4NPKA 5HHPB 5IJDC 3PDDA 2Y5TB 4F8LA 4PCSA 2EEDA 3U46B 1T5WA 1WBZA 2HH0H 3CHXA 3CVHL 3N1QC 3CZFB 4HK3J 3NA9H 4NO5A 4E5XA 3RPIB 5ALBH 3VD5A 3VI4F 5BCAA 4MCYA 5C6PB 3N06B 2X40A 4JFPB 5EMYA 3UMNA 4WO4A 4LGSB 4TLSA 2IPTL 3S88H 1BD2B 4HJ0C 2CKBH 5J56B 3ULUC 2JNZA 1RZGB 2HT3C 4NBZB 4P05A 3HS8A 3RTQA 4ODHH 2ROXA 3V6BR 4D8PB 5SX5H 4BFFA 5CIPB 4HLZH 2DL9A 2AQNA 4KV5F 1MFVA 1FO0H 1FZMA 5EOCL 3I75A 2WO3B 3OQRA 4LSPL 2XVGA 1H5BB 2FYYA 3VI3A 4DWHA 4UTAH 3TV8A 2AXHA 4M62L 2IBGA 3KL5A 1ZE3H 4NQVB 5EHFA 1TZOA 5JW4R 5DFVC 2NY0C 2JQZA 4XMXA 1V3KA 1CTNA 5PAZA 5HI4C 4NYLA 4XPBL 1HHGA 5AW3B 1J18A 2IQ9H 1PG7X 1CJYA 5IB2A 2XJKA 4AEEA 4X8JB 4LXFA 1B4RA 1U3YA 1BPVA 2EDBA 4F2MA 1A1NA 1A7QL 1NCWL 4G3YH 4PRHB 3DX6A 3U0WH 1CGXA 3NP3A 3ZTDC 5J12B 3WFBL 3VRJB 5AQ0A 4GRWB 4Z0XB 2HKAA 3AROA 4I0CC 4XNUL 1YNLL 3HI5H 3ZKMD 3BP4B 2CHXA 4BZ2H 5EBLA 4FI7A 2O6EA 3ILPB 1OY3B 1PQZB 2B1AL 1HL5A 3PL6D 3QZBA 4AITA 2PWGA 1PJ9A 4J7RA 4AKQA 5CLYA 5A2KH 1PEZA 2A6JA 2ADIB 3G5YA 1EWHA 2OZNA 1R5WA 1CFQA 2HTLD 3BDYL 3TH2T 4HC1A 2ZUUA 3QQDB 2XWBA 4DTGL 2KDYA 3T8VA 4A7VA 4JS7A 3DMMA 2X42A 2FK9A 3MLXL 4JUTA 2YLHA 4KROB 4TUJA 2VLKD 2R15A 3P9MA 2IH9A 3HCVB 2XV6B 1G9NH 5FECB 5DZNA 4EN2A 1CXEA 5IHUH 2HWZL 4BGDA 2VH5H 1CGTA 1RURH 4NKDA 4L0PB 2P8MA 2VXUH 3MOBL 4CJ0A 1L6PA 1G6RL 3QIUD 4IJTA 1KEMH 2FATH 1D5ZA 4N20A 4EF3A 2VRQA 1E4XL 5ICUA 4MXVF 4BKTC 4JDEB 4JY4A 4X9IA 1T21A 3GGWB 4JZJB 4K8RC 5CP3A 1HC1A 4IU3B 2ZTBA 3EDJA 4EOWH 2J88H 4FNTA 1U93A 2H1XA 4S1RH 3SO3B 4HOZA 2XWDA 1BA9A 3QPKA 4Q2ZA 1T80A 1ZSDA 3ECVA 2VDMH 3N1PC 3OLGA 4G43A 4P4KA 2OR9L 1NC2A 1KPUB 3A67L 1Q94A 1DVFD 1T3FA 4D9LH 2WP3T 5KBDA 3BQUA 5CR1A 1N6VA 4PS4H 3VD1A 1LTXA 2KPWA 5CEXB 1YDPB 4UILL 3IGAB 3RZCA 1MCPL 3UGXA 4X42A 4FF9A 5ECGA 2DH2A 1DR9A 1XGRB 4XO8A 1WDAA 2E7DA 4JM2A 4JPQA 4ZFQA 3US9A 4QAMB 5EUOA 4FE9A 4JO2H 4YHYB 3K6IA 1SY6A 1T0MA 2EDNA 5LAXA 4BE6A 3FQYA 5DLML 2HP4A 1ZPLA 4G5AA 3W11C 4IRJB 2F08A 3OG6B 3RBGA 1K5NA 4FG2A 2JCCF 3IDXL 2G9KA 1XCQB 2QQLH 3DK0A 3L5XL 1BWWA 2P8LA 1ID5I 1E4KC 3O9WA 2APFA 1S46A 3GXMA 3KJ6L 5J57B 1Q72H 4DF9A 3EFDL 4WWNA 2XFXB 1TO5A 1R3JA 2J5LC 3OAYK 2AQ1A 1LEGB 3AC0A 5EZIH 5I8EB 2IOMA 1NINA 2WQWA 3SDYH 1RK7A 4P57B 1T1YA 5K39B 3PQYA 4PCKA 4B3VA 5LBGA 3ENEA 4KQ4H 5B8CB 5C07A 1IGYA 4XTRD 1JGDB 1FC2D 1N4XH 3W57A 2OK0H 3IF1A 2QGBA 3KEDA 1P5UA 1RZQA 2QADC 1FZOB 1RH8A 1ACYH 1QUPA 2XBDA 4ZD3L 4YSUA 2GJ6E 5IWLC 4MAZA 2VZ3A 2Q2LA 2G5BA 1WAEA 2J1KA 5EOQH 5F3BA 3IDIB 4PREA 4PGBB 5IVNA 2F6AA 2BNUA 1MCCA 1A5FL 1GGIL 1VACB 1ZVYA 2BHZA 5BOZG 2MSPA 4PJAA 4AM0Q 5B3SB 2NY7L 4XPAH 3II1A 4XBGB 1AZUA 4BH7B 4RFNB 5C0BA 4EIZC 3WNIA 2DM3A 1L3NA 3HFFA 3OJDB 2IXQA 3PABA 2YGVA 2YJQA 4O02H 2MCPL 3FQXA 2D8KA 3GSNL 1CD8A 4NM4L 1B0GB 4QGTA 3IBOA 5EPMB 4AG4H 3R1GH 1NAKH 4DP8X 3GFUA 2EZ0D 1N0XL 4UDUB 5I6XC 5E6YA 4OCSH 3CFKA 1S9XA 1UA6L 3VE0A 4MJID 3V5KA 2MPAL 2BCKB 3UPCA 2AQ2A 2X9YA 3KPOB 5DQ9B 3UJJH 3HS9A 4HA1A 4P2RD 4OCWL 2NNCA 3L5WB 1OAUH 3EJYC 4XBMA 3DX4A 2OSXA 3FCSA 4FTVA 1RUKL 5EO1B 4HIIB 3SKMA 2R1YA 4ZO7A 3QUXD 4HAGA 3UTPD 4F58L 1OM9A 2WXKA 2WINB 3DX9A 2MMXA 2NYZA 4ZPVA 4LOFA 4HK0A 3ILEA 2K9FB 3FRUB 1CD1B 3QJUB 1QSEA 3DDFA 1ETA1 4JM4L 4Z78A 3MUY1 3JWDC 4HJTA 1OGAE 3HS0A 1QI4A 1JFHA 3IDJB 4PV9A 5I66A 4HG4K 4C83B 4HKXA 3GNML 5HGAB 1I7RA 4LVOB 3WEXA 4H1LG 3T3ME 4D0DB 3BGMA 3DA0A 1A1MB 2Y2YA 5KVFH 1UUSA 4EUPG 3CFNA 3WY1A 3IVKB 3RKDC 1R19A 4NQSB 4JLRA 3TEXA 5JW4N 2CR3A 3I2CH 4JGJA 1OANA 1JGEB 4NNPL 1FL3A 4NCC1 1OPGH 1YEJH 2CRMA 4PJXA 3MGAA 3L2MA 4PP2A 4TVPD 5IJVA 5IV2B 5JUEH 4LSTL 5F0MB 2NT1A 2VL5A 1A22B 3FXIC 5AEAA 4NKQB 3MBEB 5LKNA 4NI6A 4ZUWB 4M8VA 3CG8A 3MA7A 5CZVH 3HW7A 5IJKA 2HTKC 1IGJB 3BVWA 4JFYB 1E9PB 3L9RA 3ZL1A 1KBKA 3QHTC 2YRPA 5TGBA 1B2YA 2VB5A 3FBQA 3IJHB 4PR5A 1C5DA 1ETZA 4XR8C 1HXYA 2RAMA 3ES6A 2WKGA 3MRFB 2V2XA 5D1QE 3TBVB 4NN7B 5C09D 1ZTXL 3N55A 5DUPH 3CK0H 2P5ED 1BBDL 3F7PC 4XNYH 4PRPB 2B9BA 4FL4C 4W9HC 4ETQA 4TTDC 3ZGHA 4C47A 4AYFB 2H5UA 4R6UA 2YPKB 2B4CH 3MLSL 1MRDL 1IAOA 4DHLA 4KKBD 4JMXA 2CHWA 4KRPB 3HB3B 3VXUD 4LGPB 4LLMB 2C3VA 3MGTA 3MJ6A 1NGZB 4K5NA 4DGYH 4B9PA 1U8CA 1N6UA 2ZKWA 4HJ0D 5KBKA 5CJOH 3S5LG 2C34A 2HT3D 2WN2A 1K85A 2H3NB 3CZJA 4AE0A 3EOTH 1SYSB 5C0AD 3DX7B 1QBML 5CEYA 3TNNA 5EU3B 4UT6A 4WY7H 2GJ6B 1OD9A 7PAZA 2P5WA 5D4QA 1CVRA 1E3ZA 1WBYB 3IDUA 4ELKB 1URZA 4HS6A 3WJMB 3UABA 1UXSA 5BRZE 4U1IA 4AOFA 4R4NC 3ATEA 2J1XA 1S8DA 4JR9L 1MHCB 4X9HA 2DLFH 2NY0D 1JWUB 3IETB 5HI4D 1JNNH 1FE8H 4JKWA 5D93C 9CGTA 5K9KA 5LCVL 3QHFL 1S5HB 4KKNA 1XF3A 1V5JA 3LZPA 2Y1AA 3KVDD 5LGJB 4MLSA 4EZJA 4HFUH 3HRZB 1GGBH 5ETUB 4ZFZA 2VJ8A 5ISZE 1NGXB 1KCUH 1YYLH 2HFFB 1CF8H 1OWWA 2VLMD 3UDWA 5I1KH 1D7FA 1TQWA 4AT6B 1VKXA 3FTUA 5L4FA 2Y5TA 3U46A 3PAVA 4XO5A 2Y7MA 3X3GH 3CZFA 4DEUA 3U1SH 1PNDA 3DXAE 5B3JE 5I26A 4NGHH 3K2MC 3OXSB 2F74B 4BKSC 5IKCB 2DL2A 3ARFB 5HHOD 1BD2A 2XIDA 4MJHA 3GXFA 4NRZB 5DYOB 3SD5A 4ZQTA 3QZLA 3W82A 2CRIA 2Z93B 5IW1B 4D8PA 5KTEL 1QFWI 1NMBH 2IPUG 1CB4A 2H41A 3GBNH 1MF2L 4GFTB 4Z5RB 3F64A 1RJZA 2BRQA 2IAND 3PJLA 5HVHC 3FQRA 2GHWB 1H5BA 1KLGB 1SVBA 4G80A 4MMYA 2ICWB 1L9TA 2HUEA 4GLRH 3CH1B 4N86A 5JDSA 3AABA 3RIAK 3RPBA 5E0FA 1XTLA 1LXMA 3S36L 2Q3AA 1O6VA 3QZWB 3T3MB 1JUFA 1KELH 2EKSB 3QA3A 3PS6A 3CQQA 4RMSA 4WW2C 1D2PA 1RY7B 4U7MA 4HKZB 4UM9D 4PLOB 1U36A 4X8JA 1ZT7B 1E5CA 5FYLD 3CN3A 2ORBH 4MWFB 4S2SB 1WA2X 1IGCL 2MOGA 4Z7VE 4MZ3A 2LR4A 2D3VA 3VU1A 4Z7NE 1I3GL 3OZLA 4AY0A 5A43C 2RA1A 5DD5L 4XPHL 2VXVH 1VGEL 3L1OH 3VRJA 4Z0XA 4JN1H 4Z7QE 1ROWA 3BP4A 2IGLA 1YEWA 3F7KA 5D7SH 2Y3NA 2MWCA 4PLKC 5SX4H 4AW7A 4XT1C 4ZW6A 1NMCB 1OCWL 1UGKA 2DQJH 5DC4B 4JANB 5DJAB 1W15A 1JZ3A 2G5RA 2IPKB 3ML9A 2X89D 2A6IA 1TCRA 4HCRH 2ADIA 3ESVF 3KNBA 4KITB 1YUKB 1WICA 3CSYB 2VC2B 3NOIA 1TQBB 1ZLEA 2GT9B 4XP1H 1KCSL 1JHKL 3IPFA 3W11D 3I02B 3SDDC 3PU7A 5GRYA 5IMLB 3UFIA 1A3LL 3N40P 3GSRB 3P3UA 5HDQL 2GTQA 2GABA 1E5BA 3EUUA 4OZHF 4ICWA 3SE8H 2WLNA 3KPNB 12E8H 4EN3A 1YNTB 3RYMA 4LEBA 4G8FB 2BSCA 4K3EH 5JOFB 3JTSB 4AMXA 2JB6B 2ICEA 35C8L 1AHKA 2L7UA 2PYFB 1I8KB 4J6RL 3GGWA 3T0EE 2J4WH 3EDEA 5IMOB 1WIUA 4OUUB 1AKJA 1QNZH 4UQIM 5AD0B 3QR0A 3INUH 4I8DA 4ZFOA 1Y1UA 1N8ZB 3IS1X 3TIEA 2C4XA 4P9HL 1BEXA 1T0NB 2WIMA 4Y0GA 1UXWA 3E0GA 3BRDA 3IXAA 4NKMB 5BRZB 4BFGA 5CEXA 3QEQB 4F7TB 4RRPA 3IGAA 4PJCE 2YAOA 4H13C 4L1DA 1IAMA 3E9TA 3MO1B 4BKLB 2DPKA 1DANT 2IH1A 3WN6A 4HISA 3Q6GH 2GJZB 2WWOA 4IRJA 1MFDL 2AJSL 3BKCH 3N44B 5ISZB 1U2YA 2YGOA 5IQ9B 3P2DA 2XIBA 4JRXA 5DUMH 5EC2B 3OZ9L 2OYPA 4QHKI 3IKCB 1B90A 3LQZB 3B9KB 2ZCKL 4ALAL 4QRRD 1AACA 3Q2WA 2XFXA 4PJHF 3DI3B 2BS71 3DXAB 5IBUG 2N0MA 4TQHA 1LEGA 3SPCA 5I8EA 1JPSH 2VN3A 1MI5D 4WQOA 3TV3H 4P57A 1LGVA 1MAJA 2FTAA 4N1EA 1A02N 4M48H 4R4FL 3CVDA 5K39A 3UERA 4MZIA 2HJFB 3EJYD 4ZMAT 2QR0B 4OFPA 1KLFB 2E9JA 5EORL 3TBCA 2VLJD 1O6SB 3O0LA 3MTRA 5CFAA 1JGDA 4V1DD 2X53A 3CFCL 4A1RA 4K5OA 1P9MA 1SQMA 4G9FD 1MN4A 4QRFA 3UYRH 1JZGA 3NCJL 1IC0A 4YSOA 5F89B 3Q0HA 1G0YR 3IDIA 1T4KA 5LLIC 3A6CL 2J3SA 3X3FH 4JCMA 1H3PL 3PWPD 1F58H 2I60H 3N85L 3OR6B 4MA3B 5MEND 2HVJB 1MRCH 4G7VL 4BH7A 4E9QA 5DJ6B 3P4MB 1OEZW 2PKDA 3OJDA 2APTA 3WHE1 1H3UA 1E4XI 4P5MA 3RKDD 1B0GA 4RDBA 2YA1A 2UZYA 1SNRA 2XJLA 4RSYA 4Z7VB 5F1KC 4Z7NB 4L3EA 4UDUA 2CDGB 4U3XA 5DC0A 2Y3AA 5D1ZC 3CFJA 1UG9A 3KPOA 3WENA 2UY6B 4ZS7L 1CXIA 1MHHA 3EGXB 3JT0A 3BWZA 3MNMA 4NN6B 4XXCA 3U2SA 4Q9BA 4C54A 4Y5VA 3KPRE 2AJZB 2HUHA 4G71B 2BW5A 4IRZA 2CGZA 2ZYIA 4OD2B 3CXDH 4J8RB 4OD1H 4HIIA 2NXYC 5E8NA 1NGWB 1GH7A 1KYAA 4HC1H 4FXKA 1UJ3C 3AG3B 4PVMA 3SYOA 5EWIL 1I85A 1IE4A 2K8MA 2Y2WA 3FRUA 2DZEA 3PY9A 4HIJB 4IKIA 1PMYA 4NENA 1F4YH 3UAFA 4FRWA 4KXAA 3IDJA 1RPUA 1JGLH 3OMZA 1BVOA 1SMAA 5HGAA 4IBTA 4JFZL 1M56B 4XPFH 1Y07A 4NRYB 3CFQA 4P0DA 1NBZA 5CP3H 4BE5A 1CO1A 4OSUL 2UZPA 4PJFE 1U3HC 3C8KB 2P48B 4MNHB 4ZW3A 5JA9A 4HAKA 3I85A 3EOYG 1MPAH 4B9JA 1U8LA 4NQSA 1EPFA 4HZ1A 3NIFF 1OE2A 3PCYA 5CU9A 4GS7B 1BQKA 4KTDH 4LLYB 1J1XL 4LVEA 2R9HC 3QCVL 5F8QC 5GS1C 3KM2A 3AS0A 4AGLA 4EBQH 5FFLA 5IV2A 2VR9A 2ZOWA 4R7NB 3ORJA 1OSPL 4JCLA 1I1FB 1JV5B 2CRYA 2D31B 2WLKA 4KXZH 4R4ND 4DT2A 4WHTA 4ZUWA 2Q8BH 2BINA 4PJCB 2YFOA 4YSCA 4XN8A 1IGJA 4JFYA 1PZ5A 1CFSA 3FB7A 1F1AA 1C7SA 1SBBA 1SY6H 2P5PA 3TVMB 1IB5A 4Q4EA 3S34L 3IJHA 2XICA 4RBPK 5C0GB 1MIML 3N2JA 3RWHB 4ZX6A 4HBCH 3TO2B 5ILTH 5TE7H 2ED8A 1ONQA 5E00B 3JV0A 3AWFA 4RGMC 4AM0B 4AEHH 4K3DL 3GXTA 5M94B 4E9TA 1KFAH 5CJ5A 3E1F1 4EKXA 3S8GB 4FQHA 4KZCA 2AV1B 4L29A 4IDJL 4JG0H 1BMGA 1J12A 1C08B 4GAJH 2PMZA 2XPGA 2YPKA 4PBDA 5A6MA 4NOFA 4XCNB 4Y1TA 3V4LA 2CDEB 4O9HH 3VQ2C 1F6AB 4JK0D 3CZEA 4FQXA 4POZD 4XC3L 4YPGA 5D6DC 4YGVB 1NGYB 2H3NA 1LP9B 3FYEB 2EADA 1MLCB 4OFIA 2Y1ZA 3DX7A 4BCYA 5EU3A 2GJ6A 1WPCA 4PJBE 2CKNA 1QPXA 2MNUA 3D39E 3BUBA 4ELKA 5J4MA 2NCEA 3WJMA 4EO5A 4XB3A 5CGYC 4OY9A 3WXVL 2ICES 4DW2H 1R0AH 4KI5C 2BSBA 4YVUA 1MHCA 3FONA 4AIOA 1EAJA 1L7TH 5BXFB 5JLZB 1RZJL 1BQLL 1JWUA 5C0NC 3IETA 1M3JA 5C0IB 4M6ML 1FL6B 1YAZA 4HLJA 1S5HA 3NRPA 3ROOA 4GQ9H 1SJXA 2SODB 3C5SB 3HRZA 5ETUA 2VM3A 4ZBJA 1XT5A 3MLUL 2YUVA 5IFJB 2HFFA 5I1EH 1A4BA 3QS2A 4JGUA 4ZO6A 4AT6A 4OJFL 2WM0A 4LCYB 2QSVA 2ZSVB 4N8CH 2DB8A 3QRLA 3QHZL 1D5RA 2EDYA 5T3XH 4XO3A 5LQBH 1IGFH 3VACA 4XPGL 3KH3A 3K6FA 3MVSA 1H3TA 1ACXA 4ODWA 4ONHB 4PLKD 2OI9C 3OXSA 3PGDB 2HLFC 3KPRB 5HJGA 3KGTA 2GG1A 1PVHA 3ARFA 5IKCA 4LSRL 1TEGA 2Z91B 4ZMQA 3GTNA 3K4ZA 3QFJB 4M6AA 1X5XA 2Z93A 5IW1A 1M2VB 2YMXL 2VQUA 2B14A 2Q1EA 4NI3A 4H25B 5EN2A 3HN5A 2A9DA 3SDDD 3BDBA 5T3ZH 5E2TL 1KPRB 2Y23A 2XDHA 5CU5A 2PXYC 4UTCA 4ZTOL 4KMQA 1OGAA 3CH1A 3B6SB 5I19H 5JIIA 3DHJA 1N68A 3OAUL 1AY1L 2P52A 2UYLB 1G7MB 1NBQA 3LOWA 3QZWA 1XQ4A 3MRPA 1U8JB 4M6NH 3K6SB 1JZHA 1KB3A 2XCMC 4IBQA 1QI5A 4WUKL 5F3FA 1OB1A 1E6OL 4HKZA 4PJFB 1RVFH 1M6UA 4P23C 1KIUB 1GYWA 3K0YA 4LF3B 4MWFA 2K3HA 4S2SA 2J6EL 1JXGA 3FUMA 2YRBA 3OC8A 1MFAH 3JV4B 3SDCA 4AL8H 3ULVH 2QPFA 4PVNA 3UJIL 3B5GA 4IIQC 4WFFD 3UTSE 2R0WH 3DBXB 1XD1A 5ESAB 3JT2A 3MFFA 4NQDD 4OLZL 4UDTB 4W9JC 5AZEH 4HX1A 3SGDI 4WUUB 1X4XA 3QUMB 2V17L 4JANA 4K2UL 4HAFA 4POUB 5E51A 5DLLA 2IPKA 4Y4FD 3GUFA 3RGHA 5AB0A 2CMRL 3A4DA 4H88L 2FJHB 4QKXB 1EJ6A 4B7LA 3CC1A 3O4OC 1TOXA 2GFBB 4UIMB 5F8RC 3ZDWA 3GIVA 1VFAB 3CVHB 2FWUA 2GKIA 3FFCE 2DM2A 4LHQB 5D1QA 3FOLB 3KJ4C 1TKWB 4YDJB 4ZMVA 1PZ2A 3GSRA 3GI9L 3L81A 1ZLWK 1JRHH 1PYWB 3BAEL 4DH2A 3WO3B 3V6ZB 5BUAA 1Q9KB 3NIDF 4MA7L 1FLTX 2H9GB 3HNTL 4KMTL 1YNTA 4G8FA 3T2OA 8CGTA 5JOFA 3MV8D 4Q9RH 3GDCA 4N4YB 5DRWA 1LO5A 2PYFA 5C0JB 1I8KA 3ZHDA 4J8QA 3FMGH 3P77B 4JDZB 1U8KB 2TRYA 1YN6B 5HGBB 2OJZL 4OUUA 1J5OH 2C3WA 1NBYB 5KYXA 2ARWA 3NZ8B 4O5LL 2AZUA 1KIRB 3K74B 4NZFA 4PU2A 5AOIA 3V95A 1N8ZA 1ZDSA 2IDCA 1UCBL 4YZWA 3TF7C 2V6HA 4G6FD 1E65A 3AQDA 3FCBA 4PJBB 1T0NA 3D39B 1NDMB 1RJLA 4NKMA 3GKZA 5BRZA 1HEZB 1H9VA 5LG1A 4KRMB 4F7TA 4P8QA 4XMWA 2I7OA 3PAUA 1W0YT 3WY2A 3C5ZC 5C92A 1EEUA 3JVGC 3GK8H 1WAAA 1HILB 3H55A 4P5RA 4WDIB 4BKLA 5IEKB 2BSSB 1JPFB 2NY1D 3WO4B 1YHPA 4RMVA 2GJZA 2NYYC 4QO1B 2ZJSH 1R46A 4OI7A 3KLSA 4UT7L 5LG6A 5ISZA 1DE4B 4JG1H 4MDJB 3RWIB 1I9JH 2AJXH 1BAGA 1YQ2A 4AQEB 5JXAL 3EYQC 4GEIA 1HJCA 4GAFB 5D1ZD 3QFDA 3CMGA 4JPIB 5J1SC 1YMHA 4OM0L 3GF8A 3B9KA 1NBVL 4GMTL 4TXVB 1N26A 2QHRH 1T2QL 3DXAA 2HG5B 3MLRL 2W1NA 4B9ZA 3HPJB 3H3KA 2DTSA 3CE1A 4FG4A 2F5BH 5C8JB 2ETWA 2CLVB 2HJFA 4FFYL 1JZ6A 1UM6L 3FSOA 1MFCL 3KL0A 3STZA 4X5QA 4ZFGH 1JGVL 2NXYD 2Q5BA 5B4MC 1O6SA 4A2DA 3FDWA 3P0YH 5T1LA 3V52L 5BW7C 1C8PA 1EFXA 3NZUA 4WO0A 2DQFA 3BUIA 3FO1A 5LXGH 4M93B 4NWTL 2ZUTA 5FYJD 4TL4A 3BKJL 3EBGA 1P2CB 4I4WA 2WXMA 4FQQA 1G6RB 4R90L 3TEWA 5ICYB 4J3OG 1U41A 3MV01 1UM4H 2B7DT 3TEZA 4X0NA 1CN4A 1YEGH 4OUOA 2FNWA 1JFQL 5A2CA 4QKTA 4U1SB 1CU4H 3B56A 4XI5C 1GHFL 3EDFA 3LRGA 3QG7H 1NUNB 2CLRA 4XMKL 3OR6A 4MA3A 4YHIB 2HVJA 1DZ0A 3H9SB 1Q9LA 5DJ6A 1V05A 1IBHA 3DTXB 4AJVA 4OZ4B 2QPEB 1T5KA 3CV5A 4OFKA 3GSVA 4PJIE 5I71C 2VMJA 5DQJB 3QDHA 4GRWH 4HWUA 4U6VH 2R9HD 3ZRSA 3BAKA 5HPOA 4JO4L 3BZFB 3ZE0B 1LEIB 4M9OA 2R56H 4X6CF 4YHZH 5I8KL 4JY5L 1NCDH 5F7YC 1J0HA 4K71B 5KSBF 1BW8A 4H1LB 3D3VE 3ULUL 1LEKB 3T0VA 3S2CA 4OD2A 4AZ8A 3MRNA 3V0EA 5L4MA 2WHVA 2ENJA 5DZ9A 4OQTA 1NGWA 3T6QC 3PGFL 2IWGA 4NQXB 4EUPB 3VJ6A 5CF3A 4LSSL 2ITEA 5TDPA 3MLZH 1F4WL 2OSLB 5D7LD 4HT1L 5KN5B 3T77B 3FFCB 4U1KB 3ZMEA 4F37F 4NC0B 1O7VA 2O6PA 4U3CA 3LN9A 3AREC 4XX1G 3CHQA 3ARYA 2V2WA 2KLTA 2VXTL 3QDGE 4XE0A 5JO5B 2ZYHA 1MJ8H 1DEDA 2GUOB 4R83A 3ARTA 4NRYA 4JAMB 4CVUA 5AENA 2F53E 1XZ0A 4I3RL 1YEIL 3GRGA 3T0EA 5HYFA 4MNHA 5CJ8A 3K2UH 2WXQA 1Z9SB 4M7ZC 4PI0A 3MROA 4WWKC 1JZ5A 4S1SL 1UWGH 2YD7A 2DWTA 4LLYA 4NKIH 4ZMWA 1AR2A 3CN2A 4OCLC 3FSAA 4H20L 2X1XR 4YJZL 2W5PA 5K9JL 1A65A 3F2LA 3SD2A 1IGMH 3IS0X 4CSPA 2IADB 4FQJH 3DBSA 3REWA 1TSRA 1I1FA 1JV5A 1FRGH 3L5HA 4IKKA 4IU2B 5CGYD 4D8OA 4PJ9C 4PJCA 1UXMA 2BSDA 1Z1WA 3TF4A 3FS9A 5C0ND 1BFTA 2IV9A 1A3RL 4XMPH 4DGUA 1DQJB 1U4FA 2YQGA 1HL9A 2CK0L 4X9GA 1GYVA 4YX2H 4K7PX 3SE3A 4KZDH 2WKOA 5C0GA 3S5LB 4OI8A 1BOGB 2R4SL 3RWHA 4IOIB 4XH2A 4KPHL 4QY8B 5TE4H 2EUXA 3MUZ1 5ESQB 4K9EC 4U1MB 5GRVK 1A7RL 4HHWA 3HC0B 1QLFB 3OHXB 4YGAB 5IOPB 3CLWA 3DARA 4HWEH 4GBXC 5IROA 5ICZB 4RAUA 25C8H 3T4AA 3G7TA 2Z3FA 1R1CA 4XCNA 5JHDE 2CDEA 1MCQA 1HSBA 5EF2A 1TJHH 4NM8L 4K8RL 5FYLL 2HLFD 1BQSA 3HMXL 4HJ1A 2X6BA 4M5SA 3MNDA 3MUGB 1KB5L 3A4FA 4YGVA 5HVGB 2IALA 1A0QL 1NGYA 2DIEA 3LVTA 1UZ6E 1MLCA 2SEBB 2VLLB 3OX8B 3NFNB 4FQ2L 4I9WD 1AGCB 3OAZH 1KBGH 4C56D 4OCXL 4G9DB 2PXYD 2DV6A 2J57A 4JG5A 3JWOH 4LARL 2WXLA 1SRDA 4P2OB 4HGWB 4XNAA 3FCGA 2E9GA 3CSPA 5HHNB 4XC1H 5CCKL 1G4RA 4PWKA 5E03A 3DX1A 5F88A 5E9DE 2AKRB 4GAAA 3BZDA 2P45B 4MKTA 1QACA 4JFTA 1AZBA 4CC0A 5I8OL 4P23D 3FN9A 1FIEA 2YD4A 4PJIB 5IFJA 2QV4A 3QIWC 4PPTA 4W6WB 1QWHA 2ZSVA 1A6WL 1QVOA 2DD8L 5DHDA 1ADWA 2PO6B 4P3CL 1JGUH 3QWRA 3M1OA 1SXSA 4JO1H 1A4JA 3H3BC 3DVIA 4X80L 3PGDA 4IRZH 3X13A 3D3VB 4OU3A 4JRWA 1Z3RA 2VW6A 1P7BA 2B3RA 4OGQC 1CLOL 3V9FA 1HWWA 4PY7B 4H25A 4UQDA 1PSKL 4U1NB 4LSVL 1NSNH 1KPRA 4DVBB 1JMZA 3OR7B 1IKFL 4A2EA 4R26H 1A4AA 1FQ9C 3VGFA 4OKVB 1NA8A 4P5KA 3RWJB 2B1HH 1XR9B 4PRDA 3AADB 1QWUA 5FUOH 2H8PB 2ZUXA 1JK8A 2UYLA 3FU7A 3GPEA 3F12A 3QDGB 5CJBA 2YAHA 2Y7OA 1B4JL 5J1TC 3V9EA 4QAWA 4U1GB 1YYMH 2HX7A 5C1MB 4WGVB 4PJFA 4BSWA 1KIUA 4LF3A 5DXWA 4HOXA 4P5TB