4WFEE

Human traak k+ channel in a k+ bound conductive conformation
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
211
Chain Sequence
EVQLQQSGPELVKPGASMKTSCKVSGYSFTGYIMNWVKQRHGKNLEWIGLINPNTGYTTYNQKFKGKATLTVDKSSSTAYMELLSLTSEDSAIYYCTRGNYVFDYWGQGTTLTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Potassium channel subfamily K member 4
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 211
sequence length 217
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wfeE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wfeE02
3V9FA 3FN3A 4HK3J 4DN3L 3MUHL 2BNRE 5FGCE 1UGNA 3RPIB 4XVUD 4WFHD 4MAYA 5DQ9A 5EN2A 4LARH 2DM4A 4NUGH 4YEFA 1LGVA 4FZ8L 5ISZA 3JWDH 2OTUA 3CLEL 5CINL 1KEGL 4TULH 1DQTA 1FNEB 4HT1L 3QZWA 3OR7A 2R4RL 2VLKD 1SBSH 2Y36H 1T80A 3QG7H 4ZOAA 4XBEH 3GDBA 3RGVC 4E41D 1CXHA 3GMLB 5EO1B 3BQUD 4B5EA 5D2LE 3I6LD 3MRNA 4HV8B 2GYSA 1ZEAL 2NY5H 2XXCB 2QSCL 3V7AG 1A6TA 1V7NH 4HS8H 1KN2L 4KJYA 4U1GC 4Z78B 5KSAB 4UTAL 3QJFB 5EOCJ 4BFIB 3DUHA 4DGIH 3BZFB 5JW4M 4TUJB 2AQ3A 4GLRH 1OQOA 1D5MB 1LE9B 5IMMB 3I3BA 4JY4A 4XNYH 4NRZA 3ARQA 1T20B 2YHGA 3OAZK 3T65A 3UTSA 3E6FB 1MIEL 5EUKA 4GUPA 4XPFH 2HVKA 4IMKA 3BZDA 3CAFA 2EE9A 1CFTB 4NCDA 1Z6JT 3S97C 3DIFA 1CE1H 3FFCA 3CPLA 5I75C 3MJ9A 3V5HA 1B0RA 4WI7A 4WO4C 4I48A 4GBXD 4AZ8A 4TTDC 3PWPD 5HVFB 3GBMH 5FUOL 2IANB 5FYKD 3VI3E 4FQHB 3QUYC 1ZGLP 2P1YA 2DTML 4QTIL 3OKLB 2R1YA 4ZFGL 3OGCB 2IGFH 3VA6A 1ZHKB 4PJ5A 1F90H 3KXFE 5A3ID 2WBJC 4N68A 1A8JH 2X2YA 1KJ2L 1J1OH 4DW2H 2ADGB 3FMGH 1JCKA 4YBLB 3VFMB 3ET9F 4KGLA 3TF7C 5DEZA 2LU7A 4GW4A 2ADJB 3HMWH 2X4QA 2WIIA 5JMRA 1KC5L 3T77A 3KLSA 1CCZA 3RTQD 1FZOB 3MACL 1N8ZB 3OAUH 3RAJL 1D9KD 3HMXL 2EH8H 3U83A 2R2BA 1H3VA 2EKSA 3MRDB 3DOSA 1RJYA 3S6CA 4EOWH 2XFXA 4KMTL 4DUXA 1HHHB 4OIIH 1KGCD 5GZOC 3PJSA 2Y25A 5DWUL 1FNFA 4GAFB 3GO1H 3OJ2C 4N9OB 2QADC 1AO7D 4QRSA 4KK6C 3A6CH 4OZGA 4JFDA 1JNHA 5ERWA 1IM9B 1RJZB 3CC5B 5SWSD 3TBWB 1CU4L 4G6FD 2BC4B 3VFWB 4N0FA 1AFVH 4O5LL 1A1OB 1RZ8A 5DD1L 6FABL 4OUUA 5I8OH 4PJBE 4NQDB 2VDNL 2F9BT 5DJ0B 2KKQA 1MUJA 3DETD 4MYWB 3ZKSD 1R3IH 3RDTB 1T1YB 3ZKND 5I71C 1EERB 1EFXA 3R1GL 2J1KA 3LY6A 2OSLB 5F1IB 1X4YA 3OB8A 1CLCA 4APQA 2ZKHH 2XV6B 1ZGLM 3KPRE 4GKNB 1T7VA 3LN9A 2P5WB 3UTTE 3V4UL 1I3RA 1W0VA 1D6VH 2CK0L 1DLHB 1JV5B 3CFCH 1G7IA 1NC2B 3MLVL 1FO0B 3W0WB 4HC1A 4I1NB 1FZJA 3SEPA 1FL6B 1YEGH 1U58A 4YIQA 4WWKC 2WUCL 5ELIA 1RI8A 4XXCC 4I9WE 1X5GA 4RDQF 2X4PA 1KB5L 4FZ8H 1KEGH 3CJJA 1TZHB 5DSCA 3WNNA 3U0TA 1XGTB 4IM8A 4L8BB 4MNHA 2DQTL 1QRNB 2H9GB 3K8KA 2VDPL 5C7XH 1UXWA 5B39B 1YNTB 5C0DA 3WJLA 3B83A 3FRUB 3NCYP 1ZEAH 5DFTA 1HSAB 2QSCH 4AMKH 1KIQB 3BFOA 4PG9A 1MWAL 5I73C 3NH7H 1HQ4A 4UTAH 2A0LD 1DSFH 1RZJC 3BEWA 3JTTA 3MCLL 4LF3B 4XP9H 4HAGA 3LKOA 4M61B 1BMGA 3DURB 5LXGL 1K9TA 4X6EB 2K9UA 3U1SL 3PP4L 3SDYL 3C8KB 3K2MC 2OTWA 3F7YB 1MIEH 1TIUA 3RI5F 3L5HA 4HLZG 4LCCB 2QJDA 4OZHF 3MZTA 3O8XD 4HXAH 5C0RL 1KB9K 3T1FA 5MEQB 4NO2B 3LKNB 3BXNA 3WLBB 2X9WA 1A0QL 3VGAC 2ZG3A 3LZFL 1IAII 4Y19D 2QQKH 5IBLC 4UB0H 5I15L 4ZUWA 1MOEA 3GJEB 2WINB 2DTMH 4QTIH 2LTQC 3U7YL 2WSKA 4MJ5A 4RGNC 3IVKA 4LLQB 3O3DA 1CLZH 4XCNB 1KJ2H 2J6EL 4MA1C 4WV1C 4Y16A 4RFNC 3BP7B 4XPTL 1VKXB 1TCMA 4CU7A 3FOMB 3RZCD 4PJDE 4PR5B 1TXKA 1E6JL 2FX9H 3DV4A 4KQ4H 2DQFB 1A6ZA 4JQVC 4NZRL 1FH5L 1KC5H 4JM2A 3MR9A 4PRHE 5ESAA 4LLWA 1MQ8A 1JE6A 5BZDB 3HE7D 2CDEA 3HMXH 3OKEB 2CRZA 4NO0B 4EZMA 1IARB 2HN7B 2IBBA 1U93A 2A83A 4AEHH 2PW1A 4WFED 4BELD 3GSNL 5D7JA 1RZJL 2VXSL 2R1WA 1EH9A 3GNML 4KMTH 5J13B 5DWUH 4QY8B 4U05A 1FFNA 5E5MA 1DVFC 2LU3A 4Y2OA 3D39A 3O4LA 5D7SH 3HZMB 4WEBL 5CD5C 1OLZA 2CD0A 3FQUB 4Y1AB 4C4KO 4GXVH 5ETUA 2NR6C 2E5EA 4ELMB 5DD0L 5C09D 6FABH 3MRIA 5FB8A 5BOPA 5DK2B 2Z4QA 3PDOA 4JY5L 1PYWB 3G08B 3OAZH 2J8UF 3VXUA 1NSNL 3WXWL 3BWAB 3PIQB 3V52L 3D85A 1NCDL 3QUKB 3H7BB 2P8PA 4AM0B 4OLVL 2VL4A 4JDTH 2H26B 4QYOA 4X6DE 5C86A 1HEZA 1VGKB 4L9LA 1IEBA 4HFWA 5F6HI 3ZE2E 5LG1A 3RWFA 5D6CB 4XNXH 2G5BA 5KAQG 3MLVH 1QBMH 4G9DB 5EG6C 2PR4H 2FX7L 2EC9U 3JV0A 3LRHA 2FH8A 4KKBD 3V6OC 3B2UD 1K5NA 3JUYA 4X4YA 3L3HB 3SCMB 3KYMA 2XWJB 4UQ3B 1T4KB 3FO0H 3RU8L 5GGVL 2YD6A 3NZ8B 1KB5H 4K3EH 1CN4A 5IQ7L 5AZEH 1U8IA 2ESVB 5FA4B 3RWHB 4G7VH 3HC4L 2Z31A 4OIBA 4FTVB 4F7PB 1S9XA 3MGAA 1I1AA 4XHJC 3OPZH 4PJHF 4NQTA 3FJTA 2BHYA 4LRIC 1KTLB 1HE7A 1PG7X 1Q9KA 2D7NA 4Z7WE 5IHZA 2DRUA 3SDXF 1YEFH 1R5VA 4R9HA 3KNBA 4U1IB 3G5YB 3BPOB 4IOFD 3O6FC 1S5HB 1H8SA 4M62H 2OR9L 4PTUB 2NXYC 4G8IA 1FP5A 1MWAH 3K1DA 7CGTA 1HXMA 3GFUA 5IEHB 5FECB 5D93C 1U95B 3MCLH 4FMFA 2XN9E 2AK4E 4OD3L 3UJIH 1X5ZA 2J7LA 1UWXK 4PB9L 5HJ3A 3U1SH 1J9CT 1BF2A 3PP4H 4I18A 4RAUA 5HGGS 2Q76A 4L8SA 3D0VA 4Z77B 4O02L 3WN5A 1AGEB 1CK0L 2YWZA 1ZWIB 3BZ4A 4U7SA 2FEDC 2FIRT 3RI5K 2AEWA 4UV4H 2M8XA 3LZFH 3LDBC 1WBXA 2MKLC 1Z9LA 4LSQH 2AS5M 1O7SA 1W72L 4S1DD 4R4ND 1AXIB 3LPWA 2XRAL 3U7YH 1NAMA 1Y6NR 4HWBL 1NDGA 1UWEL 3K7UA 4MAYB 1D5IL 1NCWH 4HJ0C 2V2WA 3LN4B 3OJMB 4KRPB 5ISZB 2JB6A 2OTUB 5CGMA 3UZEA 4KJPC 4TSCL 3SE9L 5CEZD 4P49A 3QZWB 1H5BC 1IEAA 3OR7B 1K85A 1E6JH 4WY7L 3QEGL 1HZHL 4IS6A 4ZAKA 5GIRB 5IGXH 4U6VL 5I1AA 2XA3A 1JGDA 4JO3L 5CKAA 5JDSB 3IDNA 5HSFA 5DYOB 4AEEA 1OAZH 4PY7A 1RZJH 4R26L 1TVHA 1A6TB 3IJHB 2A73B 3NBNA 4KJYB 4DTGH 2UWEF 4G6KH 5KSAD 2B7DT 1OAUL 3AXLB 4QGTA 4DZBA 2MPAH 3DVFA 4JY4B 3D5OF 3T65B 3UTSB 4HIEA 4K9EC 5JXAL 3O2VL 3O6LL 5EUKB 1C1EH 1MCOH 1WFTA 4UOW1 2HVKB 1T1XA 3Q6GL 4KDTA 2BVQA 3DIFB 3EO1B 2YA2A 3CPLB 3ZYOA 3SJVA 4LK4A 3WXWH 6CGTA 4I0PC 5FM5M 1NGXB 3REWA 1UC6A 1B0RB 1T1WA 4OZFG 4YHPB 5DMIH 3V52H 4DAGL 1NCDH 1R3JA 4I48B 3QO1B 3EFDL 4PLKC 5ENWB 2PO6B 5E7BA 1UJ3A 2IAND 3VWJC 2OS7A 1FE8L 1AH1A 2R1YB 3BN9C 4PJ5B 4IRSB 4OFYD 1G0YR 3NZHL 1I1CA 1LDSA 2OYPA 3KYOA 3MLYH 4Y5VC 3FRPG 4GW4B 5I30H 3QDAA 1OSPH 2X4QB 3O2WH 2Q20A 2WIIB 4X6CA 3OKKB 3RU8H 3K2UH 5EOQL 2QBWA 3ARYA 5IQ7H 5DURB 1L4IA 4FNLH 3S36X 3LEVL 2Q3AA 3FO1A 3GMPB 3E2HC 1OTSC 3G9VA 1AGCB 1LO0H 5KANI 1RJYB 4LNRA 1F6LL 3REVA 4P2QA 3L5IA 5JOFA 1OGAB 1QO3B 1ACYL 1AR1D 2HFFB 3K80A 4OZGB 5GRZA 4JFDB 2F5AL 4K9EL 3MA9L 1JNHB 5ERWB 2CMRL 1IM9D 4QXTA 4PJEF 3DUSA 3EDEA 1U2HA 4R4FL 4P0DA 1T7WA 5C6TH 1RZ8B 1WCBA 3QPXL 3LS4H 4OUUB 4R97C 4DK6A 3SGJC 3BW9A 1TQCB 4NGHH 4NQDD 5A40E 1FSKB 1IGCH 4BSVB 1E4JA 4AYFA 4FQ1H 2FDBP 3RDTD 3QUZC 1VFOA 4FABH 4ORGA 4N0UB 1I9JH 3UBXG 1GGIL 5FO8A 4P2RA 1X7QA 4O02H 4APQB 2WWMC 4LVHB 3HN3A 2C4FT 4P5KA 4MA3B 3QEQA 4P3DB 4CMHB 2P5WD 4GH7B 2ZP0T 3ARZA 4G7YL 4LP5A 4N5EC 1NC2D 4ESKA 5E56A 3R8QA 3W0WD 4UINH 5I1IL 3B9DA 4JKWA 1KN4H 1U58B 5D9SA 4LLAA 3EOBB 1D5IH 3L3IB 1E27A 5I16A 3ULUF 1I1FA 2X4PB 4HIIA 2LABA 4YWGL 3KVQA 1GZPA 2PNDA 2DICA 3C09B 4OLXL 2E7BA 5EC1A 4TSCH 1YEIL 4G6AC 4LHJB 4PD4K 5IW3A 1RK1B 1RHHA 4Z76A 3L3GA 3QEGH 3EYQC 1AY1L 1QG3A 3O4OC 1ZANH 1HZHH 4MNHB 4QRRA 4LLUA 4QXGH 1QRND 5F6IC 1UXWB 3M17A 5C0DB 3MREB 2XKSA 1BQSA 2NPLX 2OJEA 4HJGA 1OPGH 2VLJE 4R26H 3RZCC 4RGNE 4PG9B 3BP4B 1HQ4B 4W4OC 4PJCF 1OAUH 1PZ5A 2Y23A 3BEWB 2OBGA 3JTTB 2ZPKL 1CF8L 3WFCH 1NCAL 1OW0A 5HHOA 5GQBA 2IPUG 3UXFA 5E8PA 3ZTNL 3MGOA 1IL1A 2D9CA 1G6RA 1UWXH 2OTWB 5JXAH 3O2VH 3O6LH 4HUMB 1YEEH 1G6VK 4NDMA 1GRWA 5EU4A 1UA6L 3KR3L 2DLFL 4WI8A 4PGBB 5F7DA 3TN0C 1IC1A 4OM1L 4DAGH 3D3VA 4BZYA 3U4BH 3CD4A 3PGFL 5B3JF 1UACH 2DDQL 5MERA 3MLRL 4NP4H 4WFFE 1QFHA 3EFDH 3S9DB 1KTKE 5KSUA 3ULVF 4AEFA 1ZS8A 1FE8H 2PKDA 4F3FB 3IVKB 3R0MA 2YEZA 5C1MB 5CAYB 3O3DB 5FYKH 2AJSL 5TJWK 4PRIE 5L8JB 2NY6B 2YPVL 1Z9OA 5C9KA 2EDLA 1OSZB 4Y16B 1IAKA 4QKXB 3H3BC 1Q9OA 2HJKA 4EKXA 5DMGD 4GXUN 4FQ2L 1A6UL 3OJVC 5CILL 4OCRH 1OAKL 4O00A 4KUZL 3G5XA 5ESAB 1E4XI 3FQWA 4WJ5A 4LLWB 1P7KB 4IIQB 5HHME 4H1LG 3CFEB 3MRPA 4FG6D 1H3GA 4NO0D 5H8DA 4JZJC 2DD8L 5CUSL 2PW1B 2BXZA 5EZIL 3IJYB 2BCKA 1Z5LB 3ARBB 8CGTA 1JZ3A 4RFOL 4NM4H 1A7NH 1RUPH 2AQ2A 3Q48A 2YD2A 3KDMA 2BMKA 1NKRA 3MJ6A 3PHQA 4NKDB 1FFNB 4HPOL 5E5MB 4KVNL 1L0YA 3PL6A 1NFDA 3QUML 3D39B 5JOPE 1B6DA 3V6OE 5EBGA 2F5AH 4K9EH 3A67H 2CMRH 4P3CL 4LPYA 2FO4B 3VMNA 4Y1AD 3EBAA 5ETUB 1VACA 5HDOA 5GGRA 3BH9B 4M7JH 1HCFX 3QPXH 5FB8B 4DN4L 2V6HA 2Y1VA 4QRPA 2Z4QB 1UWGH 4D0CB 3QCUL 5FUCE 4Z7OF 1A5FL 4KRMB 3VXUB 4JFQB 2A9NH 4Y4FC 5DVKA 1NEUA 2EC8A 1UZ8A 2P8PB 3UMTA 2DI7A 2P44B 1RV6X 3Q1SL 5JUEL 2JB5L 1IEBB 2DLGA 2HFTA 5FHAL 1J05A 1C08A 1NLDL 1CD0A 4YBQC 2X4SA 4KZDL 3C5ZC 3QCTL 1SBBA 1B4RA 4NKQB 5JZ7C 1AIFA 2ORBL 1IGTA 2P43B 2PXYA 5MENE 3RKPA 4J6RL 1K5NB 4X4YB 2QQNL 3KYMB 3SCMD 3VFNA 3T2OA 1CDIA 5DJ2A 4HKZB 2V5TA 4RMQA 2J5LB 1LO5B 2Z31B 4JEGB 3VDAA 1S9XB 4FTVD 5B21A 1RD6A 1XGRA 1AY1H 1YMHA 2X4RA 1Q9KB 1NGWA 1ORQB 5EU5A 4P9MH 1R5VB 3KNBB 1JWMB 2AW2A 4N1CA 3THMH 1DBBL 3O6KL 1H8OA 3WIHL 4E0RB 4V1DE 4WUKL 2ITCA 2R2HB 5KVFL 1CLYH 3G6AB 3ULUC 1BAFL 3CK0L 4N0CD 4OCWH 4G8IB 4MA8L 3MYJA 5I6XC 3MRBA 4R7NA 1HXMB 5FHBH 1SYVA 1WC7A 2ZPKH 1CF8H 2V2XA 1NCAH 4Q0XL 3ROLA 4WWID 2XZQH 3ES6A 3T0XA 5ANMB 1I8IA 1U8NA 3N1QC 4RAUB 5HYJE 1QA9B 2XI9A 2Q76B 2ZUWA 4L8SB 4S2SA 3HZVA 3BO8B 1EFQA 3WN5B 1RIVH 2O61A 1CFSA 1UA6H 2DLFH 5JXEA 3IETB 4LRNL 3RIFK 4GRLB 4OF6A 3QULA 1KLGA 1ZVHA 4WI9A 4OFDA 3PGFH 1T5XB 5CD3A 1B6UA 1EAPA 3ZDXF 3BMWA 1K3ZA 1UEYA 5E9DA 4LQ1A 1CXIA 2V5SA 3QQ3A 5F44A 1NAMB 1BOGA 1NDGB 3RA7L 3FO2A 3EO9L 4MAYD 3H42L 2UZXB 2WNGA 4MD4A 4PJ7B 4CADA 2AJSH 4KRPD 2YPVH 3VA2C 5ISZD 1VA9A 5E2JA 3WLWD 2B8OT 1YDPA 1IEAB 3H0TB 4TRPH 4JLRA 1NDMB 2HJFA 2N7BA 1OAKH 5IWLA 4WW2F 3ULVC 3ESUF 2BX5A 4QRTA 4JCMA 4RISL 3S96B 1JGDB 3LSOA 3Q6FA 4NQCE 4M6ML 2EO9A 4ZUVA 2FR4B 3W39B 4PY7B 4ZFOA 1TVHB 2QKIB 5I18L 2HG5A 4FXLA 3GB7A 4EVNA 5I0DA 4UI2A 5FOBA 4YXKL 2J8UE 1M1SA 4HPOH 1IGYB 2FBJL 4V2BA 3GJFA 2IWGA 4P2YA 5EPMA 4JPWH 2IPTL 5D72L 4DZBB 1I8KA 5C71A 4JDVA 4P3CH 1AC0A 3CFJA 5BRZA 3MV8E 3RVXD 3SDCB 2J12B 1PZUB 3M1BB 1LMKA 4OJFH 3UTSD 4IRZH 5E03A 5JOEA 1KPVA 1RIHL 5FCUL 2CIKA 3IAQA 3QCUH 2AK1H 3KLHC 4GT7A 2JKXA 1GL4B 3G6JF 3OX8B 5AD0A 3SJVB 4R2GB 1A47A 3REWB 4BA8A 1W8NA 1MAKA 5D1XB 1L6XA 4MA7L 4KK8C 3Q1SH 5JUEH 1UJ3B 2PO6D 4GJTB 3CGTA 5F9WB 3BIKB 1U41A 2LVCA 3V0AC 5FYLL 4M48H 3KLDA 1NLDH 3MOBL 4PJ5D 4IRSD 2W9EL 4PJHE 5F88A 2ORBH 3L3JA 3L95B 3TZVC 3KYOB 4Z7VA 3EYUH 4UIKH 1E6OH 4LPUA 3QDGE 3HUJB 4GXUM 4NFBA 4X6CB 1OAXH 5JW5A 3HPLB 1G0XA 1RJLA 3C60B 4WUUE 3S37L 3PG2A 2X7LB 3DTXB 1NEZA 1QKZL 5DURD 1KLUA 3UC0H 2CO6B 5J3HD 1HHKA 4LNRB 4UQ2A 3REVB 4BFBD 1I3VA 4RAVB 5JOFB 1C7TA 2WLZA 4UT6L 2R2EA 4CAGA 4Z95H 5JHDA 2NW2B 1MFDL 4JHWL 1DBBH 1OGAD 2VXTL 1KJ3L 5DQDH 5IB4A 5KVFH 4EDWL 4JFDD 1BAFH 2Q86A 3CK0H 4XCEA 4FXGB 1JWUB 3HS0B 4QXTB 2BOCA 4H26A 3T4YA 3VG9C 5K9QG 3DUSB 1AXSA 3BW9B 4LCIH 4Q0XH 4TNVK 3JVGC 1OM3H 4X8XA 5GZND 3MLUH 3QIUC 2OQJA 1GHFL 3DX6A 2NY4C 1X7QB 4APQD 1BJ1J 4NO5A 2JK5A 3D69A 1JF5A 3O0RL 4P5KB 3QEQB 2OL3L 4FN0A 3TFKD 4QT5B 1TZGL 4LRNH 3HNSH 5SWZA 3RVUD 4YGVA 4YK4C 2VZSA 2HVJB 4HGKC 2QR0A 2XZAH 1J86A 1F4AA 4OV5A 5GGRY 2YD4A 5FYJD 4LCWA 4NZTL 4GFTB 4XNZC 3BKML 2C4FU 4LCCC 4OGAC 1FFRA 2D7PA 3JV4A 2BNRA 4KKAC 5FM4A 3RA7H 2LV4A 3T0EB 3EO9H 4KHTL 4OGYL 1I1FB 3H42H 5I16B 4N0RA 4CVZA 4NN5C 1GZPB 3UTQA 5AG9A 4YPGB 4ODHH 5EC1B 3U9UA 4G8EB 1RHHB 3V5KB 3L3GB 3VDCA 2O5YH 3AROA 1Q94A 15C8L 4QRRB 5BW7C 3ULUH 4KRLB 4RISH 4KJWD 1LVEA 1YNKL 4U6YA 2X09A 5D2LA 3BDXA 1MI5B 1PD6A 2C3VB 1JK8A 2P8LB 3OGOE 4QHNB 4YXKH 4OFKA 1HHIA 1PZ5B 5IFHL 4HUKB 4EUPH 3EOTL 2PTVA 3FN0H 3HRPA 4MVBC 5HHOB 2IPTH 4WW2C 1MFCH 5E8PB 2D4FA 4LDEB 3MGOB 1IL1B 3NCBB 1U8QA 1G6RB 5SV3A 2MCG1 3MV11 5FCUH 4DVRL 4NDMB 1AXTL 5DFVD 4JG1L 1XGUA 5GRYA 3F7VA 2AXFA 3GBNL 3NACL 3STLA 1IGML 5F7DB 2DL2A 2X40A 5FK9A 3D3VB 3F5WA 1S3KH 5MERB 2PYEA 3ZT7A 4MA7H 4F80A 4N8CH 5KZCB 1YQVL 1ZS8B 2AJUL 1FZMA 4OQ1A 4LGSB 5EUOE 4MNGA 1RZKC 3MOBH 5IJVA 2NMSA 2EDQA 3MO1B 1N0LA 5B8CC 2EXWD 1D6EB 4PLNC 3U0PA 4LCUA 1DQML 2NY6D 2DKUA 4C55A 1IAKB 3BKYH 4Y16D 3KWWA 3ULVH 1L7IL 3ARGA 1X4ZA 1PGRB 3TVMC 4KMQA 4XCFH 1JYXA 1F3JA 2IFGA 5E99L 5EU6E 2CSPA 4F9LA 3FQWB 1S7UA 2VDLL 4XVSL 3SGDH 3GSWA 3MRPB 4PJEE 3BAEL 1G7QB 3UYRL 2ZSVA 1H3WM 4NM8H 4XNUL 1ES0A 5EOTB 1C5CL 3ARBD 4EDXA 4E5XA 3QRGH 4KTEL 3V95A 4UT6H 3BISA 3GGWA 4YAQB 5D8JL 1EJOH 2BMKB 3PHQB 2KZWA 3FQRA 2X4OA 5TDOA 1NFDB 5GS1C 2C4XA 4ZS7L 4EDWH 3D39D 2GUOA 3W9EA 3VFUA 4L4TE 1OQXA 5L7XL 1MHEA 4JO4L 1AKJA 1VACB 3WNLA 5GGRB 4GMSL 1A21A 4PLJD 4CVUA 4JFFE 1DR9A 4PJAF 4R96A 3B5HA 3ZKMC 2R29L 5DO2D 5KN5B 4PJBA 4QRPB 1CYGA 5HPMA 4TVPD 2B4CC 3BGAA 3U30B 3E8UH 2XNAA 3VXUD 2WWKT 1O5DT 1WFUA 4ZNEE 5C0IA 4HEPG 4GG6F 4ZSOE 1UZ8B 3K46A 2CRMA 1OCWH 2AEQH 5HD8C 2DTSA 3OZ9L 3KPRA 4Y5YC 3O0RH 2AERT 1N4XL 4P4KB 1NJ9B 1BLNB 3ULUE 2DWDA 4LEOA 4HUNB 1E4WL 1TZGH 1PG7W 4C56A 3G5VB 4ZOCA 1MAJA 1J05B 3MLSH 5L0QC 5AWNH 4OD2B 1C08B 3ZSSA 1DFBH 4HH8A 3P40A 1AIFB 3P9WB 3EYOA 2VH5L 2FYYA 1IGTB 1WIPA 1ZSDB 3OKMA 3BKMH 1FFQA 2H6PA 3BGMA 4ZPVA 1MPAH 2HJLB 2YD9A 3CX2A 2DM3A 4EQ3A 3IXTA 4Z7UF 5DJ2B 1TETL 3LHPH 3RJQB 1J11A 5JIKA 4LSPL 4FHBD 4HLJA 5AYQA 4PJXA 2Z31D 3MODH 3P77A 5D5MA 4DGYL 2C3GA 4PJCE 4KKCC 1BFOA 3FT2B 1VFBA 1YMHB 4JKPL 4OI7A 15C8H 1NGWB 3FRPA 4P2OC 4YC2B 5EOCL 1YNKH 1BWWA 4PGCA 3T2NH 4TNWF 2RAMA 1WTGT 1AGBA 4LOUD 3LKPA 1UH4A 3CDGA 3QXUA 3MYJB 5ID0A 4R7NB 1WK0A 4HUVB 2MCPL 1SYVB 1WC7B 2V2XB 2X89A 1QVOA 3VWKB 4M1GH 5IJKA 5B3JE 4WI3A 3L3DA 2V5MA 1I8IB 5E4IA 2QHRH 5FO9B 3AGVA 3ULVE 2BVPA 3O3AA 4S2SB 2YBRA 3KPQA 2O61B 2IAMB 4I77L 3WBDA 1CFSB 4B53A 1IBGL 3NACH 3GBNH 1SJHA 5C6WH 1KF9B 4MZ3A 4RFEA 1EVUA 3QULB 2OI9B 4GRLD 2PUQT 4X4MA 1NMCB 2HTLD 2GSGB 1A1NA 3QIBA 4XCYA 3MV01 1EAPB 3BSZL 3DGCR 3IGAB 4YH6A 3UBXA 1F11A 2DI9A 3M8OH 2AJUH 2F8OA 3P3YA 1F13A 2Y06H 4DGVH 1GJIA 3FO2B 4YHYB 4Y4HB 4MD4B 5JA8B 2F53E 3G6DL 2HT2D 4CADB 3HZYA 4UZGA 4E42A 1DQMH 5GXBB 1L7IH 4KI5D 5F21B 1MLBA 1YDPB 1MFBH 3TWCL 3VU2A 2EDDA 4XRCB 4XI5C 2HJFB 4GKZA 4WU5A 2BRRL 1HIML 1MCWW 4ZAKD 3FB5A 4PRHA 4QRTB 5I8KH 3TJHD 3WXVH 3Q6FB 3QO0A 1XMWA 3BAEH 3UYRH 1NGPL 1NUFA 2Q8BL 2HG5B 3GB7B 2GK0A 4KTEH 2OXGA 2FWOB 2PETA 5D8JH 4Z7OE 1GC1L 4D0BA 1GGCH 1GYAA 2IH1A 1R3HB 1ITBB 3GJFB 4OLYL 4C57C 1KV3A 1MFAL 1F4XL 1I8KB 4EN3C 3CFJB 5BRZB 3CIQA 2YK1L 1SY6L 2FGWL 1NMAL 3EOAA 5IEKB 2E27H 2GT9A 4M7LH 5GS2H 1KPVB 2CIKB 4MHHI 5D96B 1CDHA 3I6GA 1YY9D 4GQPH 3CFBA 3Q0HA 4PJIB 5AD0B 5L2KE 1NGQH 3SJVD 4NUJB 4R2GD 1MCJA 5EZJA 2OXHA 1UB5A 1FFOA 2MQCA 1RZKH 1X9QA 3HNTL 5D1XD 3VW3L 1F8TL 5CP7A 4ZO8A 4ZQKA 4X6DA 1K8IA 3GKWL 1LP9B 3LAFA 3IF1A 3KPTA 1FSKC 3FQXA 3MGTA 1QSFA 1F4WH 3B9EA 4XAWL 3DHJA 4EI5A 4LASL 3L3JB 1P4LA 1SM3L 1SQ2N 4FOMA 4Z7VB 2P4AB 3H9HB 5HXMA 3KPSB 1YC8A 1JGUL 4X0KA 5JW5B 3TA3A 1RJLB 5M7QA 3C60D 1LD9A 4S0TD 2PTTA 2BSSA 5LGHL 1NEZB 2XPGA 2DQJL 4LSPH 3P30L 1KLUB 3RHWF 4DKDC 4K7PH 1U0QA 1A6AA 1HHKB 3BYYA 2EDNA 4XX1E 1A9BB 4UQ2B 3HG1A 5ALBH 1EO5A 3NA9L 4GSDL 4BYHA 2R2EB 5JHDB 2HP4A 3QSKB 3VGDA 4ODVL 1CGUA 4G43B 3DYMA 2MNUA 1CFNA 2E7LA 3PHSA 2P49B 4XCEB 2BVOA 3DMMB 1O0VA 2BOCB 3MLTA 3RY5A 2B4CH 3S5LA 3TT1L 3ECBA 2OK0L 1E0OB 4JAMB 1WBYA 3MRLB 3P9MA 4LKXA 3KPMB 2R4SH 4KJWC 5DMJB 1T89C 4GS7C 3CZJA 3SE3C 1KJ2A 4NBYB 3ZDXE 2IBGA 3DX6B 4JRXA 3RGVA 4I8DA 1I4FA 4IMLA 5IHBA 1BWMA 1MHCB 3D69B 1IBGH 1P2CA 3QEQD 5IW1B 4PFEA 4YGVB 3HMXA 1JHKH 2O5XL 4HK0B 2QR0B 1DLFH 2QEJA 3ZKXC 5CZXD 4OV5B 5C9JB 1MCPH 2VQUA 3BSZH 4LCWB 4TPRL 3BN3B 5JW4Q 2A2QT 5I2IB 1FDLL 4L3EA 4YFDB 3RL1A 3JV4B 2BNRB 5FGCB 2VABA 1XAUA 5TE4L 4CVZB 4KI5F 3UTQB 4RNRA 4X7TB 3ELAT 4MQXD 2H2PC 3U9UB 3TM6A 3QQ9D 1JIBA 3HE6B 1G9NC 1T2XA 3TWCH 3I9GL 5CJOL 2M1KA 5CEYA 1HIMH 4N1EA 4QRRD 4DCQA 3NIDF 5D2LB 3Q5YA 5I1CL 3BGFB 5HBBA 4U3HA 3GMOA 5IVXA 1NGPH 5KSVA 2Q8BH 1JK8B 5FYKU 2A1WL 3UAJC 1T0MB 1BZ7A 2WBJA 5IOPA 3G6JE 4MZ2A 3AFLA 4BUGA 1IAOB 4L1HA 1WWAX 4NHUA 5HHOD 4IIQC 5EULV 1MFAH 3N9GL 5C0FA 3MX0A 4U1JA 3HI5L 2YK1H 2FGWH 3BDYL 1Z9SA 1RUQH 1U8QB 1YEDA 3ARBC 7FABL 2NXZB 1QNZH 1T66C 4N0YL 1OF2B 1DQLL 4PRAA 2FJFA 1QHPA 1N6QH 1INQA 4L1DA 2VITA 3IDMA 4PG2C 3CVHL 1KB5A 3F7VB 3FCTA 4ENED 4IOIA 3STLB 5C07E 2HLFD 3HFMH 3QHFL 4OLWL 5GRUL 3ZKQD 1TQBB 5FK9B 4MXQD 5GGTL 4L29A 4D9QD 3F5WB 3D3VD 3DX9A 1NBYA 4KVCL 3A6BL 1S9YA 3TO4C 1BQLL 1BBDL 3FB8A 3SKNA 3HNTH 1OL0A 1YNLL 1IILE 1F8TH 1BD2E 1IE5A 1BM3H 3AREB 5KZCD 1VGEH 3SDAB 1HI6B 3T0DA 3P11L 5TE6H 4MNGB 3V8OA 3FHAA 1SEBB 2XTLA 5CBEB 3KXFB 3MTRA 3U0PB 2YD1A 4LASH 4AIZA 1MWAA 1LK3L 4ORZC 3ARGB 1DDHA 1X6LA 1JGUH 4D2NA 1F3JB 5KTEL 3MLWL 2IQ9L 1IKNC 1C12A 2AJZA 1S7UB 2NY0B 5MEOA 4YFLI 2DQJH 3GSWB 1A4JB 2R69H 2ZSVB 4K23H 2BNQE 3HLAA 1BEYH 3B6SA 3IFPB 3WO4C 1BFTA 5BS0A 3V0VA 1ES0B 1S7RB 4P57A 4JPVL 4ODWA 5DRWA 4E5XB 3NA9H 4GSDH 3RHWK 4L5FL 3GGWB 4OCMC 3RWDB 2X4OB 1FGNL 4FMKA 5TDOB 2D31A 1LDPL 4B0MM 2P5EE 5HY9A 5JHLL 5CJXA 3C8DA 3NPSC 2BRQA 2GUOB 4WEMB 2YKLH 4QHLA 4WWKA 1MHEB 4M5YL 1AKJB 4POZC 4XXCA 5IVZB 4BSJA 4GKSA 2Y7QB 4B7LA 4F7EA 4PJBB 5T5FL 5HPMB 4QRPD 2HT3D 5DJ8B 3VRIB 1KCSH 5FM8A 1HK6A 1S9WB 5CBAA 5C0IB 35C8L 3MRQA 2EXYC 4NN7C 3NABH 4EEEA 5MI0C 1ADQL 3KPRB 3K3QA 2DWDB 2VWEC 4LEOB 1YY8A 3UTTB 1SVZA 1GPOH 1CFVL 3HB3D 1MLCA 4YDIH 5E00A 4X7CC 3EYOB 4HWZB 2FYYB 1A7OL 3VFGL 2W38A 1FDLH 1BGXL 2GW5A 3F6LA 5BO1L 3QNZB 2I24N 3UO1L 1N59A 5TE4H 3RNKA 3OKDA 4GRLC 1K8DA 4BZ1H 1DL7L 1OAYL 2R39A 1PVHA 1I8MA 1P4BL 5D5MB 1RZIB 5DRZA 1J1PL 1BFOB 3I9GH 1VFBB 4JO2L 3WL9B 3UPRA 3BZEA 2FB4H 3SHSA 1T04A 4PRBB 5DC9B 2B20A 1B9ZA 1IAIH 5F7YC 5I1CH 5E6IA 1Z0NA 2VDKH 2RFXA 2VLJA 1XIWA 1F00I 2VE6B 4KI5C 1EDQA 1GIGH 1EO8L 3CDGB 5ID0B 3G5ZA 3SKJL 2ATPA 2R0ZL 1IKFL 3OKYA 5DHVB 5F9JB 3TH4T 1MCWM 2EDXA 5C08E 1J7VR 1FGVL 4WV1A 2BP3A 3ZYJA 3GSOA 3VWKD 2X05A 3ARDC 4JG0L 4JQVA 3BDYH 3CMOH 4IEFB 7FABH 3O3AB 4N0YH 4KQ3H 4Z9KB 3VD4A 3WIFA 5ESVB 2IAMD 3CVHH 1RURL 2XICA 5JXED 1EHNA 5B39G 4HKJA 3SDCC 1BQLH 1DVFA 1YQ2A 4LGPB 4I3GA 1F11B 4YR6A 2I5YL 5AZ2H 4H0HB 1VPOL 1UM6L 1EA9C 2ZWLT 1RUAL 5HDLA 1XGPA 3IJSA 4DJMA 2VZ3A 1G9NH 3WUZA 2ICWI 3MBEA 4LKCA 1JZ7A 3RVVC 3HZYB 4PRIA 1Z3GL 4E42B 1LK3H 1CL7L 1R24A 3KYAA 5BVJA 5GS0C 3HR6A 4JKKA 5D1XC 1F6FB 1MLBB 4PJDB 3WS3A 1NBVL 4NHCL 1A4KA 4NO3B 3MLWH 2IQ9H 3FB5B 4PRHB 2B39A 3JTSA 1J0HA 3HPJA 1I9RH 3SDDB 4PJAE 4RMRA 1HILA 4IRJC 1K4DA 3UZVB 2VLRE 5D1QB 3VRLE 5ITFB 5F7EH 1IT9H 1NMBL 2X1XR 4PJ8C 4TN9A 4D0BB 2IH1B 5JHLH 3FKUS 3V6OA 4GG6E 3QT2A 3E6HA 4HH9B 5BRZD 3EOAB 4M5YH 3IDYC 5BQ7A 4OCSL 3HNVH 5JNYB 1WICA 4QRQA 1NUDA 2GT9B 1FN4B 3K8MA 4G8FA 1MVUA 3E3QC 3GSRA 2OR7A 1AGDB 4LRIA 4XP6L 2FEEL 5EZJB 1T2QH 1HKLL 4XH2B 1UB5B 5BZWB 3PNWA 3AM8C 3HAEB 2DAVA 1SYSA 5T1MA 5CP7B 3VMPA 4X6DB 5ICXB 1K8IB 4Z7UE 3W9DA 1H9VA 1Q0XH 3IF1B 4XC1L 3BD3A 4U3XA 1YYML 1CFVH 2MFNA 3MGTB 2VLKA 5GS0L 4OIAA 1CVRA 2ADFL 4NNYA 5FV1L 4E41A 4WTZA 1JNLL 1UT9A 4EI5B 1FBIL 1P4LB 3BQUA 5T3ZD 1A7OH 3P0GB 5DUPL 5HYIA 4ZS6C 1JFQL 1PW3A 3VXSA 3PGCA 3KPSD 4PPTA 5DJZA 3UO1H 3S8WA 1HHGA 3BP6A 3VG0L 3PDDA 5AAWA 4K8RC 3FONA 4XVJH 1A6AB 4HCRL 1UEMA 2GCYB 4JO2H 3B9VA 3ILQD 5EIQA 2C9AA 4XMPL 5JHDD 3QIWC 3T0EC 1SJXA 3M45A 2IQAA 2JTDA 1PKQE 4LAJH 4V1DA 3CMGA 4NCC1 4L4VE 3T0WA 2BVOB 3H6JA 4HUXB 1EO8H 3DMMD 3NTCL 3S5LB 3SKJH 4OZHA 4JFZL 4JPKH 3BJLA 3KPLA 1DBAL 4FXKA 4WHTB 1WBYB 3P9MB 2XN9B 2AK4B 4LKXB 5F89A 5IF0B 1A1MA 5F3HB 1H5BA 3WE6A 2GSIB 3CUPA 1KJ2B 3DBXA 3NFSH 3RGVB 3IU4H 2J2ZA 5ADOH 2APVA 3W2DL 4KUCF 5IIEA 32C2A 5IB3A 1P2CB 2HWZL 4MDJA 5SWZD 2Q6WA 3AS0A 4U1GB 1N6UA 5FXCH 2XA8L 2XKUA 2AJ3A 2VXVH 1JMXA 2DBLL 4LCWD 5JO5B 4WI4A 2R23A 2AXJA 1QFWM 1CI5A 1K3IA 2I5YH 3CH8A 4K8RL 2VB5A 4QRUB 2D7TL 3RL1B 2HLFC 4GAJH 2BNRD 1RUAH 4LLMA 4U6XA 5L6YL 4MXQC 1BBJB 4OFVA 2A6DA 4M6AA 1QR4A 4RNRB 3IDGA 4HPYL 1NBVH 3MMEA 1OTUC 5I75B 4I0PA 3BH8A 1AO7E 2P48B 4WO4B 5C0AE 3G04B 4DCQB 3BPLC 5FGRA 4NQCA 1ZMYA 1UYWL 2QQLL 3QUXB 4P99A 1V3MA 3OG4B 3QUYB 1N7ML 5KSVB 5GSVA 5CEZL 4OV6F 3RRQA 5JPNA 4TSAL 1TLKA 3VE0A 4L3CA 1BZ7B 1UXSB 2WBJB 3P9LB 2J8UA 4WW1B 5IOPB 2PCPB 4LVNC 4Y5VA 2YC1B 4U1JB 2EE6A 2QSVA 2VAJA 4OCSH 5I74C 5HPOA 2AJXH 1YEDB 2ZCLH 2OZ4L 2NXZD 1S8DB 4PRAB 2FJFB 1INQB 4O51A 5F70A 4U1MB 3QZWG 5KVGH 1KB5B 2YRLA 2JJSC 4XP6H 4L29B 4XVTL 3PXHA 1A2YB 1CXEA 2EEDA 3DX9B 1S9YB 2YSSB 1A9EB 3SKNB 5I9QC 2E6JA 1LP9F 5I1LA 1KJMA 1JHLL 2OP4H 3ARED 3FZUC 1RZGA 1MHHB 3SDAD 1A6VL 1KACB 2ZUTA 5GS0H 2JIXA 2OJZL 2ADFH 5DLMH 3KXFD 5AAMA 4EXPX 5TQ2H 3SGJA 1I7RA 4ZXBC 1JNLH 4AIZB 5BXFB 2BHZA 2DMKA 1MWAB 3RVTD 3LH2L 2MQ3A 5J0BA 1JFQH 3ARGD 3SDXA 4ALAH 4CW1A 3DSNA 3GHBL 2IC2A 3QUZA 4P4KC 4WNQB 1ETZB 5GGVY 3QDGA 2YMXH 3OB0K 1C12B 5KJRL 3VG0H 2AJZB 2VC2L 3WNMA 2NY0D 4F15C 1CS6A 1NAKL 4R3SA 1AR2A 2CLVB 4YZFF 4Z0XB 2VWEE 5IK3B 3HLAB 4KROC 3B6SB 5J4MA 5J8OA 4HCRH 5C70A 3V0VB 4MJ6B 4OCYH 1UCBL 5DRWB 3EYSL 1SJEA 5HGDB 5LCVH 2D2OA 3CH1A 2D31B 3LRSB 4WFGE 1AGFA 4HWEL 5JIPA 3GKZA 3U6RA 4K3DH 3STZB 3AMKA 4G5ZH 4NBXB 4QHLB 5HGHA 4WWKB 2ZUYA 4MMXC 1AKJD 3NTCH 4GKSB 4HUWB 1TZIB 1KIRB 1DBAH 3CVIL 1FZKA 4PREA 4F7EB 1IC4L 4Z0BL 1RK0A 4JFEE 2FD6H 1RUML 4MD0B 5E94A 5FKPB 1KCVL 3VXQB 1FVDA 1F6AB 4ZMAT 1U8JA 5D6DC 3MRQB 1GXEA 3QHZH 2FNBA 2GAZA 4HKXA 4UT9L 3SKOA 2AEPL 3KPRD 1IC5L 1W8OA 1YY8B 3UTTD 5C8JB 3RZCA 5D7IF 3L5JA 1JPGB 5I73B 1FV1A 1WZMA 4W4OA 3S35L 1MLCB 1EEUA 3GSNB 5E00B 4UMGA 2ZCKL 5SV4A 3GEWB 43CAA 5ICYA 1ZA6B 4EBQL 1NPUA 2IAMC 4K8RH 1EGJL 2D7TH 3NIDE 2J88L 4KFZC 2ICES 3RNKB 5L2JA 2WMPA 1K8DB 4I9WD 3SE4A 2A6IB 4HXBL 5L6YH 1K2DB 3QEHB 1D5BA 5I1JL 2LFGA 4WHYG 3FQTA 2UWEA 3P0VL 5DRZB 5EA0L 4Z8FL 3TN0A 3BZEB 4EIZC 3F58L 1F3RB 1HDMA 1EHXA 1M7DA 1G0DA 4MLIA 3VGAB 2UUDK 4QHUB 1H0DB 5C0GB 4Y4HC 3PABB 3SQBA 2ICWB 4Q9CA 5KSBF 1D7FA 5C09E 2RFXB 3I2CH 2F54E 3HR5B 2VLJB 2LTQB 3DWTA 1B90A 3KS0J 3LKSB 4RGNB 4JKMA 4TSAH 1MFEL 1OB1A 2ATPB 3WKMH 3P4MA 4YNYA 4PGZA 4NOBA 4M1DL 2X89D 4MA1B 4WV1B 1NCBL 3GSOB 4NWTL 3C6SA 2DJ4A 3DX8A 2AXGA 1E4XH 1QSEE 3CX5J 4HEME 1HYRC 2N7AA 4JZJA 1CDUA 2PYFB 3PWJA 3RIAF 4GAGL 4HBQA 1T3FB 2NTFA 2XY1A 4HKJB 3LEXA 1DVFB 2KUTA 4L8DB 4PBXA 3WUWA 4I0CC 3KYNA 4NQEE 4YR6B 5DMKA 5D96C 2GITA 5BJTA 1DZBA 4G9FE 1T7ZA 1XGPB 3IJSB 1Y18A 2LQRA 1UQSB 4PRIB 1ZKAA 5CJQH 1R24B 5BVJB 4P48A 1QFUL 1YA5A 3WS3B 1EZVX 3C5SA 3N85H 4WHCA 4NFCA 4J8RA 4Y4FA 3MXWL 3P73B 3JTSB 4PRHD 2VC2H 1DBJH 3HPJB 2VIRA 3MRGB 5HHMB 1F45A 1WLHA 4PJEA 3F7QA 3DV6A 3ZT6A 3SDDD 1QSVA 1KT2B 1REIA 2ADIB 3QB7C 1IC7L 1T1ZB 2D7MA 4AL8L 1UCBH 1K4DB 2ZOLB 3QJHA 4OQTL 2O5ZH 3C5ZA 4OF3A 1ZLSH 3KHQA 4JRYE 5I66B 5IBTL 4HWEH 4O2CA 4OZIE 2FSEA 3MRRA 3HI6L 2DIJA 2UZIH 3HC0A 3ILPA 4HJJH 3TYFA 3E6HB 3OKNA 1CFQB 5D1ZC 3U48A 3GMNA 4LLVA 1ZT1B 3X3FH 1KG0B 4G8FB 3AU1B 5EBLB 3GSRB 2EIEA 4KKLC 1MREL 1RUMH 1AQKL 5F7NC 1KCVH 1U92B 1XR9A 2KDGA 1E4KC 1UVQB 4YHLL 4L4JA 4LLYB 3DMMC 3RPIA 1L9MA 3PNWB 4ZSOA 2IALB 4UT9H 3MLPA 3O6FB 4G42A 5T1MB 4NQXB 4P59L 2BOBB 3QYCA 2YPLE 1U8LB 4N9GA 3W9DB 2NXYB 1FNEA 5KVEL 3T3MF 1I1RA 2HKHL 3UJTL 1QSFD 3S35H 1CBVH 2R9HC 5D93B 1F42A 3TLRA 4A2MA 4EI5D 2P45B 4EBQH 3IRZA 2C7UA 4M4RA 4OGXL 1GGBL 5MENB 5GRVK 1MF2H 2CXKA 1P5VA 4LPXA 4MJ4A 4EUPA 3B9KC 3ARFC 2XQYG 5DJZB 1HHGB 1PEWA 2IBZX 3A0OA 5K9OA 3D2UA 3GMMA 3BP6B 4KK5C 2F5BH 5D7LE 3RWEA 1XF3B 3FONB 5D4QA 4BFIA 4TUOA 3SQOL 3MV7E 3OB0H 4PJCA 3MYZA 3QQ4B 2CGRH 5C2BH 1P6AB 1J0ZA 1BFSA 2ICCA 3BX7C 1QPPA 4KZEL 1XH3B 5IMMA 1D5XB 1MJUH 1T20A 1N5AB 3Q3GB 4KTDH 2D03L 3LDBB 4R7DB 1YUHA 2I07A 4XT1C 5ACMA 2IQAB 2VAAA 3E6FA 4V1DB 1JZ6A 4NKMA 3HE6C 1AE6H 4U1NA 3DVGB 3VXPA 4TUKL 4NKIL 3EJJX 2XN9D 2AK4D 1NCBH 4LSSL 1RMFH 5F89B 3TNMA 3WYRA 2P24B 1A1MB 3S4SB 1H5BB 2IANA 3CUPB 3BRGC 1WCQA 3DBXB 4UV7L 5DJAA 5HYJB 3GRWL 3FAXA 3RGVD 3CLFL 1ZHKA 4UAOC 4OFYA 1OLLA 32C2B 1VCAA 4GAGH 1XGYL 1CICB 2ADGA 1L6ZA 4XWGL 5HDBF 5HYFA 4WCYL 1J12A 3QXTA 3JWOL 3QWRD 2Q6WB 4N5UA 4JFPA 4QHKI 5LBSL 3RIAK 4C83B 4YQXL 2AJ3B 2WLYA 2G60H 4YEEA 1RY7B 3AMLA 1V8HA 4S10A 4YGAB 1GCFA 2FCBA 4I4WA 4LLMB 2F53A 1X4XA 4ZTOH 3ARWA 1ORSB 2W59A 4XP4H 3BD4A 1MVFA 1QFUH 5GGQL 1OAQL 1OD9A 2FATH 1QTYT 3U7AA 2EEBA 4I0PB 3AREC 5IP4A 1RJZA 2X9XA 2ZG1A 4JM2F 4WO4D 2NCMA 2ARJA 1WIUA 4TTDD 2Y6SC 4NQCB 1A1OA 1J0IA 2EIBA 2F58L 3QUXD 2C26A 2GFBA 3KJ4C 3VWJB 3QUYD 3RVTC 2UUDH 1IC7H 1JVKA 1N64H 3BE1L 3ZDZE 4YO0B 4AL8H 3OQ3B 1T1YA 3RDTA 2BY3A 1T7YA 2FH6A 1INEL 1JGLH 1S9VA 3CFDA 5DJYB 4L3CB 4J12A 2A6JA 2J8UB 2WBJD 2OSLA 4ONFH 3WSQL 1QLEL 3TZVA 2XXMB 2NY0C 3T0VA 4TSBL 4ZD3L 3SGDI 4Y5VB 2FLRT 4GKNA 2Y5EA 1LE5B 2P5WA 3MV8B 5F7MC 3P4OB 1FIGL 1CGSL 3MCG1 1JV5A 5EIIA 5K59E 4OBSA 4LU5L 1NC2A 3QAZB 1N6VA 2C3HA 1MREH 1SMAA 5TE7L 3E2HB 1VDGA 4PYGA 5L2KA 4YHLH 1FL6A 4ODUA 3PGDA 2HMID 1KSRA 4K2UL 3KHOA 3KGRA 4OGZA 5CJ8A 1DE4B 1FORL 4KK6D 1QBAA 3ZE2F 4HK3N 1CT8B 4X7SL 1TZHA 2ZNXA 5E2VH 5EIVA 4NRYB 2HKHH 2CLZA 2JIXB 3MJ9L 3K8LA 1I7RB 2H9GA 4PJHB 2B2XL 3JVGA 4AEIL 1GGBH 3MLZH 3QIUA 4CW1B 5KANG 1NANI 1HSAA 4UBDD 1HSBB 3QDGB 2R0LL 1F4HA 3F8UB 3LKRA 1I7TA 1ZVSB 4WUUB 2HA1A 3FB6A 5GISL 5E08H 4R3SB 3MRHA 4OB5L 1EX0A 4LF3A 5I1EL 3P0YH 1MSPA 3DRQB 1MCEA 4KY1H 3DURA 5EWIL 5FIEA 4Z7WF 1V7ML 1SJEB 2N56A 5JPMB 3CH1B 2D03H 4ZNCD 1YEKH 2FX8L 3C8KA 3F7YA 1DBML 5DJCA 3U6RB 3H3KA 4QXUL 5FYJU 5T1DH 3UYOD 3O2DH 4LCCA 5HGHB 4WWKD 2EDTA 3D87B 1ONQA 1S7VA 5MEQA 4OI9A 4NO2A 3LKNA 3D9AH 1FZKB 3UPCA 4TUKH 5ICZA 3W5MA 3FT4A 3P2TA 3U79A 5CLTA 3AVEA 4R90L 3GSVA 4M02A 4NWUL 1U8JB 3GRWH 1LWRA 5BW7A 2VXUH 5F6IB 2GAZB 4HKXB 3SKOB 2NTSP 2A77H 1EBPA 1KYOJ 1U3HC 4NIKB 4WCYH 1VKXA 1FV1B 2R0WL 1DUYA 4DOHE 4PRPE 2DQFA 2B1AL 5DUMH 43CAB 5I1HL 5BZDA 2EDJA 1JPST 5DDHB 3OKEA 5EZOH 3CXHK 1EUTA 4JY6A 4O58H 1D5BB 4YHKL 2UVEA 1JRHL 1QR1A 4LNVA 5FYJL 3FQTB 1KPUA 4O4YL 4Q9BA 1OAQH 4JFHE 5TFSL 3HZMA 5IHUL 4OT1L 4RMWA 1HDMB 5DT1L 1M7DB 1I75A 5B4MC 1OY3B 1NLBH 4YHNB 3ARXA 1YJDL 5IR1A 1U6AL 5IBLD 5DK2A 3H7LA 3EGSB 1PYWA 2WIMA 3G08A 1A6PA 2VLJD 2RCSH 1JJUA 4S1RH 4R8WL 1INEH 4RAHA 1JWSA 2WUBL 4RGND 1OB1B 2YZ8A 4PGEB 2GY7B 3QWQB 3P4MB 4K7FB 4YNYB 3G6JA 3PIQA 3H7BA 4GKOA 2EC9T 2I9TB 3C6SB 2H26A 4JM2C 4PJGF 2F19H 3TVMA 1VGKA 2Y07L 2B1HH 1DEEB 1LEKB 1U3ZA 2FBOJ 4HIXL 4WGVB 2WBKA 5D1QC 3QDJE 5BVPH 1JPFA 3IS1X 1KEMH 4DQOL 3PWJB 3U0WL 3BT2L 5E6ZA 1V5JA 1AQDA 2NTFB 4UQ3A 3LEXB 4FQQB 4K2UH 3WUWB 5GS1A 1DVFD 4KXZH 3NZ8A 2ZOKA 4WFFD 3ZZ1A 5J6GA 2ESVA 3KYNB 3VXME 1BD2A 3GSXB 5E2WH 3BIAX 5CD5D 4S1QH 1FLTX 4X7SH 5JDJA 2GITB 3ETBF 1QLRA 1F4YL 2NR6D 5EUOB 4YZFE 4DUWA 1NCUA 1DP0A 4QLRA 2HH0L 1Y18B 1NL0H 3QDME 4PRID 4U1IA 3G5YA 4HQQL 5DQJA 2BVEA 4AEIH 1W0WA 4J3VA 1S5HA 3EJYC 4MJIE 2NX5E 3LRGA 3UTZB 3QP3A 4PTUA 4Y4FB 2R0LH 3IDJA 2ZUVA 4JZNB 5JW3L 3O11B 5HGAA 4F8QA 3VXOA 4U6HB 4Y5YA 2ED7A 4PJEB 2ZZUT 5HHMD 1WTLA 1U95A 2DQDL 3DV6B 5DJ6A 2BNQA 4ODTL 5DHYB 1HOCA 3QR2A 3RUGF 1ZK9A 5CGYC 12E8H 1V7MH 5DEGA 4AG4H 4G6JL 3WD5L 4Z7NF 4XMKL 2XWBB 4XP1L 3C5ZB 4LVOC 1FNHA 1T6VN 4O2CB 4Z77A 4QOKE 5JOPD 2FSEB 3MRRB 4RMUA 1AGEA 2AEIT 3TBVA 3HC0B 3PE9A 4NN6B 4L4TB 2QSQA 3SBWC 4XBPB 2PN5A 3QNYB 2Z91A 3GMNB 3LB6C 4JFFB 3AY4C 5D7IE 3S3JA 1RULH 1VADA 4XPHH 1MY7A 2AKRB 4XHJD 5C0NC 1XR9B 5FDWB 1WEJL 3LMJH 2RR3A 1EAJA 4P2OA 1UM5L 3BD5A 4KHXL 4ZSOB 4U33A 4MXWH 4M3JA 4G42B 3LN4A 1RAMA 3O6FD 1IFHL 1G7JB 1YECH 4N9GB 2L0DA 2HLAB 5CP3H 2NXYD 2X4NA 1S7WB 2L4OA 1MJ8L 2R0WH 1H15B 5I6XB 1I9IL 4CJ1A 1FRGH 5IT2H 3HC3L 5GIRA 4U2YA 5I1HH 3NIFE 3OAYK 2C7UB 4Q58C 5JDSA 1FVCB 4EUPB 5E8DH 5DYOA 1TPXC 5IBUB 3VXSD 4LIQL 3DXAE 1A7BA 2JCCF 2G75B 3IJHA 5KSBE 2CDGA 5K9OB 3D2UB 3GMMB 2A73A 5CS7A 1CGWA 3WFBH 4F37F 1IQWH 3QXDA 3RWEB 3F12B 2DLTA 3AXLA 3VH8B 4Q9RL 4TUOB 2FEDD 2W0FA 2ZUQC 4PJCB 5KOVC 2BY2A 3L7FB 5KW9L 3LCYA 1W0YT 2DN7A 3ZDYF 2E9BA 5DT1H 4D94A 1MRDL 4MDIA 1YUHB 2I07B 2VAAB 3IAPA 4V1DD 3SO5A 3TBSA 2GHWB 4Q74A 4FQCL 4NKMB 1OARL 5FCSH 2M2DA 2YN3A 3EO1A 4NOFA 5I19L 4HS6A 3U7WH 2WUBH 2AGJL 5IKCB 4HD9A 1I1YA 4HJ0D 1NGXA 3TO2B 2EZ0D 4YHPA 3L3OB 4U1NB 3FFCE 2V5YA 3VXPB 4OI8A 4WVRA 3DYPA 3QO1A 3TNMB 4KJPD 1BOYA 2EYTB 5ENWA 2PO6A 3QUXC 4LSVL 4G6MH 2IF7A 3K4DA 2CJUL 1IZKA 1MJJB 4Y5XB 4XWOC 5DHVH 5DJAB 5HYJD 2K7PA 2DMBA 4IRSA 2VKWA 3IDUA 4DQOH 2YUXA 4LSTH 3AS3A 3H2WA 1H3UA 3U0WH 3BT2H 5ILTH 1J87A 4EQ2A 4JB9L 1N5YH 4JFPB 3NCJH 4M5ZL 5T33H 3ULSA 4W4NA 1T03L 3BP5A 4ERSH 4YDLC 1PG7L 3OKKA 3I02A 1P5UA 3GHEL 3AAZA 4EN3A 3PQYE 4WDIA 1EO7A 1HYSC 3GMPA 1AGCA 4I4WB 2EYSA 3WFDL 2F53B 2HH0H 2HMIC 2AABH 3KJ6L 2DQHL 4HQQH 2I25N 1OGAA 1QO3A 3NFPA 2HFFA 5E0QA 2ZJSL 3V4VL 1S78C 2CK2A 4I0PD 2I9LA 4C4KT 4OZGE 5JW3H 1J8HE 2ARJB 3L6FB 2GJZB 1B0GB 2VMFA 1QEWB 4P5MA 4NQCD 4PLKD 2DQDH 5DD3L 1HNFA 3AC0A 4ODTH 2GFBB 3VWJD 4JVWA 4BSVA 3SE8L 1X5HA 3BN9D 2D0HA 4G6JH 1S9VB 3CFDB 4XMKH 4UBDC 1BQHA 2A6JB 2Z9TA 4N0UA 2EE2A 1BECA 4E9LA 4W6XB 3TZVB 3KG5A 5CSBA 5J6HB 1PJ9A 3VD3A 4GG6A 4MA3A 4P3DA 3MV8D 1P4IL 5JR1L 1CDGA 5EIIB 5GRJL 3T3ME 1Q1JL 2ICWJ 3ESVF 3GMQB 4JR9L 1I3GH 2FZ3B 1KB9J 1OTSD 5L2KB 1JYVA 3EDJA 4ODUB 4DN3H 3N1GC 3PGDB 1MQKL 1UM5H 3EOBA 5KVDL 3L3IA 4KHXH 3RWGA 2V7HA 5TPWL 4RZCB 1NGYB 4G80B 3CLEH 5CINH 5C0BE 4X5LA 4Z7UA 4BUHA 1VEMA 4HT1H 3VG9B 1RK1A 4WENB 3RFZC 2R4RH 2CLZB 3HAEH 3STBA 3RY6C 2JIXD 4X7DC 4LEXL 4ELKB 3HC3H 2HT4D 3SE3A 1MJ7L 3DX7B 3MREA 3QIUB 4MNQE 4DZ8B 3UJJL 3QUZD 4LIQH 1OGTB 3JUZA 3LKRB 3QDGD 4KV5F 2NY4B 1I7TB 1KN2H 3BP4A 1WGOA 3FB6B 4WUUD 2VOTA 1LO3L 2WWMD 1FFPA 2H2SC 4K7PY 2FIKB 3MRHB 3KPNB 5IW6A 4YDVB 5EO9B 3TT3L 3O3BA 5EORL 2BXYA 2GTWA 5KW9H 4F37K 4YK4B 3TCXA 3S34L 2OMNA 5L9DL 3CVHA 1GAFL 1MRDH 4N5ED 5F1KC 3DUUA 4PUBL 4A6YL 4P3WA 4F9PA 4XNZB 5DJCB 4M8VA 3I6KB 4L4VA 4NNPL 1T5WB 5TF0A 4XTRC 4R4BB 2AGJH 4DVBB 1ONQB 1S7VB 4PGBA 3IS0X 4IOSD 4NN5B 5HDBE 1LK2B 3BUYA 5DS8A 1CG9B 5ICZB 2AXHA 5MHSE 3FT4B 4G6AD 3I50L 2COQA 3BUTA 5FUOH 4LSVH 3GSVB 3EYQD 3V0WL 2CJUH 1QQDB 3RVWC 1EHLL 1NEZG 4ZFGH 4F3FA 1HCVA 2X9YA 4LSUL 2MMXA 4OFPA 5T1KB 1P69B 4RGMC 5E1HB 3S36L 1L7TL 1OSZA 1NUNB 5DA0B 3CU7A 3S7GA 1DUYB 4WTWA 5E4EB 2H3NA 1OW0C 4CDHA 4UDUA 3MACH 3RAJH 1OT1A 3GHEH 4YHML 1P7KA 4IIQA 4PJ9C 4WW2B 5TH2A 3CFEA 4Y0GA 4Y4KC 1Q9LA 5CWSA 4X9GA 3IJYA 4H25A 1Z5LA 3ARBA 3X3GL 3OAYH 3EKCA 4JY6B 1BZQK 2Y72A 5F9OL 3ISWA 3GM0A 4NKDA 2DQHH 1QR1B 4LQFL 1YZZA 4PG2A 1KPUB 3N06B 4BQ9A 2ZJSH 3OR6B 3TN0D 3LV3B 1CU4H 2FO4A 3O4LE 3TO4A 4U49A 3BH9A 4O5LH 5IR1B 5JLZB 3PWLA 5DD1H 3ZTJG 2YA1A 1IGFL 2VDNH 3QI9C 2DYPA 2EH7L 3ROOA 4D0CA 2H1PL 1MRFL 3SE8H 4JFQA 1JWSB 5B8CB 1CGXA 1G7LB 3VJ6A 3R1GH 3G6JB 1KULA 1FNAA 5TDNB 5FA3B 3PV7A 4ETQB 5IG7B 3TVMB 1HINL 2DL9A 3V4UH 1P4IH 3UX9B 2CK0H 5JR1H 4HIJB 4LIQE 1FAIL 1JPFB 5T3XL 1KBGL 1O7VA 4ODBD 2E9WA 4JR9H 5C07B 4RA3A 1A3RL 1AQDB 5K9JL 4XC3L 4P46C 2WUCH 5GS1B 3DO7A 4HKZA 2ZOKB 5J6GB 4YDJB 1LO5A 1BD2B 2X41A 3C6LC 3IAGC 2EIZA 1QLRB 3GUTA 3DGGB 5FUCC 4Y89A 5TDPB 2P7TB 4LEXH 3VGEA 3QFDA 2DQTH 1ORQA 5E5RB 3JV6B 1JWMA 1IZJA 5DQJB 2VDPH 4EI6A 1JGEB 1W0WB 4E0RA 1U91B 3SOBL 2R2HA 4KRNA 4MS8C 3G6AA 4S0SD 4PB0L 4M9OA 5E8EB 3SGEI 5KS9F 1ZA3A 4Y4FD 3IDJB 4PV8A 5HGAB 3VXOB 4Y5YB 1F58L 1CGYA 5DJ6B 2BNQB 3MFGB 4LDLB 1HOCB 4FP8L 1QP1A 5DGRA 2YN5A 5L0QB 2Z35B 4CVXB 5LXGH 5DEGB 1LO2L 5ANMA 4YBQD 3SDYH 4YHZL 1X44A 1KTDB 1QA9A 2PXYC 3C5ZD 1BPVA 1VEOA 5HDQL 2IMMA 4RRPA 2V7NA 5JZ7D 3DVIA 3MNVA 3BO8A 5DD5L 2P5EB 4M1CC 4A6YH 3NFNA 4I2XE 3TBVB 5BMFL 3V4PL 4FRWA 5C0RH 1G7PB 4YE4L 5EBMA 3IETA 3VD7A 2Z91B 5MEPA 4GRLA 5E8NA 1A0QH 2Z93A 4JFFD 1T5XA 2J8HA 1VADB 5SWQA 3I50H 1SJVA 4JFEA 1KNOA 2F15A 1FLRL 4LL9A 5I15H 1QFWL 4H88L 4NC1C 4P2OB 5J06A 5C0EA 4ODSL 4PJ7A 4BQ8A 4DUVA 2EZ0C 4JDZB 1NGZA 1RUKL 2J6EH 4OKVA 3ULUD 4JFOA 4XPTH 1WZ1L 4JHZA 1PQZB 2X4NB 1R0AL 4J4PC 5GJSL 3H0TA 3TCLA 1NDMA 4NZRH 1FH5H 1LQSR 3MQIA 1T21A 3S96A 1ZLUK 5FKAB 3KYKL 4M6OL 4PBVC 4YBHA 5IM7A 2FR4A 3W39A 3B5GA 1CICC 3GSNH 3TC9A 5D2NC 2VXSH 2QKIA 3D48R 3GNMH 2CDGB 1ZGLB 5F9OH 1A7QL 3D2UD 3QXDB 4NJ9L 1IGYA 1H3TA 1R5IA 2W0FB 2VR5A 4WEBH 5J1SC 4ZODA 3PHOB 3SDCA 4MDIB 5DD0H 4PJGE 2MQ0A 4X9FA 2VDRL 3M1BA 3JWNC 2FJHB 2MJWA 3TBSB 1IGFH 2DQCL 1CD1A 4JY5H 4QWWC 4BFGA 1CL7I 2F74A 5EB9A 2EH7H 3OSKA 2F54A 1MRFH 4Z6AT 1NSNH 3OX8A 4HS6B 1I1YB 3QXVA 3WFHB 2G2RA 2GJJA 1AD0A 4OLVH 5D1XA 1OD7A 5J1AA 3B4NA 1DQJA 3BIKA 2EO1A 4GQ9L 2FL5B 3ULVD 1QSEA 1GOHA 1FAIH 3MJ8B 2BSED 4JN1L 5T3XH 2FX7H 1WSST 3EZ8A 3L95A 4O9HL 3F6IA 1A3RH 1JGVL 3V5DA 1HH9A 4IRJA 5K9JH 2OR8A 4L9DA 4XC3H 1CIDA 3ULSB 2Y5TA 3VXNA 4NZUL 3BP5B 1B4JL 4LLDB 4C59B 3HUJA 1M6OA 4PJ8A 3HPLA 1ZHLA 3I02B 5GGVH 3C60A 4X80L 1M71A 3OXSA 1DJSA 2X7LA 3DTXA 3AAZB 1JTTA 4NRXA 5EUOF 3HC4H 3QAZC 4X6CE 4EN3B 1ACZA 1NBZB 4BQBA 4WDIB 3ZHDA 2KL6A 2E6QA 2EYSB 2E7MA 1J8KA 4RAVA 2FEEI 3RUGE 2F53D 2NW2A 3LQMA 1BFVL 2DI8A 2WK2A 3NFPB 4P2QE 5DF0A 4D8PB 3O81A 4Z7NE 3KLHD 4PD4J 1FNSL 5I1DA 5CCKL 3NGBC 2OR9H 4PB0H 1FG2A 2I9LB 3IFLL 5CSZA 4FXGA 1JWUA 3HS0A 4G3YL 1GH7A 2NY1C 3AM8A 4P5MB 1F58H 4KK8D 2VXQL 2HT4C 4OD3H 4OLUL 4PJAB 4FP8H 1ROWA 4OUOA 4PB9H 2C3WA 1LO2H 2VLRB 4KJQC 5ECJE 4LSRL 4YHZH 1BQHB 1NCCL 1Q9WA 4JRYA 4LDOB 5DD5H 4MHHG 3TZVD 1CK0H 2H32H 4GG6B 2WQ8A 4P2RE 3IKCB 1KJVB 4QT5A 4ZFOL 2LAGB 2HVJA 1N0XL 1H3XA 4FZEL 4D9LL 1N3NB 5EU3B 4NKOB 2E8ZA 1VERA 1FLRH 1W72H 2QLVB 5HHXL 1TJGL 2KZ1B 4H88H 5L2KD 4MB3A 3CNKA 2XRAH 5CMAB 4HWBH 1UWEH 3H9SA 3QIWA 4JE4B 5J12C 3T0EA 1VFMA 1TVDA 3RWGB 4ODSH 2V7HB 3VGBA 2JCCE 5AYUL 4BSWB 1INDL 2YPLA 4YPGA 4Z7UB 3SE9H 4G8EA 1WZ1H 1R0AH 2A9ML 3V5KA 1GZQB 2WAHA 4WY7H 5CZVL 1DBKL 4U6VH 3ZDYE 3WV0A 4JO3H 4GS7B 5LAXB 3KYKH 1KELL 2W9LA 3QIUD 2DBJA 1MI5A 1EEQA 4OF7A 2C3VA 2P8LA 2NY4D 4QHNA 1BP3B 2AV1A 3J8F7 3ZE1E 1FFPB 5D7LA 5IW6B 1YEHL 4NJ9H 2EDKA 1J1XL 3O3BB 2G9HA 5T3ZL 2GTWB 5T3XE 3VCLB 4GW1A 1CXKA 4U1SB 3ZKXB 3CVHB 2X1WL 3HAEG 2XACC 1PKQB 3DUUB 1YN6B 4P5TC 3X11B 3LN5A 3Q6GH 4L4VB 4JANA 4FQIL 4OGAD 5HHVL 4KKAD 2AI0L 2BFVL 2NW3A 2CUMA 3IKKA 3BUYB 5DS8B 1RFDL 3BHBB 1WQVT 4X5XB 4P23C 4OBRA 4HFUL 1IEHA 4LGRB 2MHAB 4OTXL 1YPZF 3MO1A 5DEFB 1X6NA 4JRWA 4JN1H 1D6EA 3NZHH 4TYUA 5I8CA 5T1KD 3TPUA 3GIZL 1AD9A 1JGVH 4UDTA 4CN6A 3BRFA 5ABDE 3BOVA 2H3NB 1B4JH 1CZ8L 5EOQH 3QG6A 4UDUB 2OX5A 5ADPL 4KU1A 1RHFA 4MVBD 5TH2B 3LEVH 1G7QA 1Q9LB 5CWSB 4X4XA 3RTQB 3S5LG 1U8OA 2JELL 4H25B 5EOTA 4CN1A 1ZLUH 3MPCA 2ZNWA 1DCLA 4YAQA 1IGJA 1BFVH 3QCVL 1ACYH 4F7MA 4U0QB 25C8L 1FNSH 1HH6B 2XOTA 4HUUA 5GS2D 1CDJA 3MA9H 2JJSA 4NC2B 1AO7B 3WNPA 2ZUSA 1CXFA 5C0AB 3TO4B 2KQNA 4R4FH 3PWLB 1RU9L 4G6FB 2YR3A 4OF8A 2ENYA 5IFAL 5KN5A 2NZIA 2DYPB 3ROOB 3SKMB 4ZYKA 3OF6A 5KOMC 3V7AE 3GI9L 4RGOL 1YN7B 1YYLL 4LSRH 3VFPA 3VJ6B 4ZXBA 1GGIH 5B38B 4UU9B 5BV7C 4QHKJ 2C1OB 2DLIA 3UDWC 2W65A 4P4KA 1NJ9A 1BLNA 1JF1B 3TVMD 2DQUL 3HRZA 3FFDA 1PAMA 3G5VA 1G1CA 3PV6A 4G7YH 4OD2A 3T3PE 1DANT 1N0XH 2IFFL 4K71B 4CNIA 1UZ6F 1P9MC 4D9LH 4H20L 1I7UB 3WO4B 1ZSDA 5DC0A 5K33A 5C07D 4GMTL 5I1IH 2XQBL 4NN6C 2HJLA 4XP5L 3DO7B 4JN2A 5CLWA 4X6FB 4YWGH 5AYUH 1INDH 3NPSB 4KV5E 2ESVD 4OLXH 5ESQA 1BD2D 1M4KA 2FHBA 2EIZB 1YEIH 3GUTB 1DN0A 1ZXQA 3FT2A 5EZLB 2UY7A 3QFDB 3ZKMD 4EI6B 4KAQL 3H3PL 4X98A 1QRKA 1ZTXL 3DHMA 3OTTA 4NJAL 4OD1L 4NC1E 4ZPTB 3T4AA 1J88A 4GAYA 5D6DA 1QUNA 43C9B 1ZA3B 4HLZH 2X4UA 4PV8B 3ALXA 4QTHB 1MCDA 4NN7B 2VDML 2VZUA 5MI0B 1WBZB 5HD8D 4HUVA 5IMOA 3UP1A 5IMLA 2VUYA 2BNQD 4M03A 3VWKA 4BK5A 2NY5C 4B41A 2GKIA 5BV7L 3ZHKA 3ZTNH 5FO9A 1JMZA 3VXRE 4TOYL 2V7NB 3MNVB 2WM0A 4XPAL 2BDNL 1U3JA 3NFNB 2P5ED 4YHOL 1JYNA 2IAMA 4FQIH 2Q7NA 3KR3H 4F8TA 3MOAL 5D2NE 5EBMB 5HHVH 4C58B 1D5ZA 2AI0H 3GK8L 1CR9L 2FLBT 5MEPB 1Q72L 5E8NB 4AENA 4KH2A 4OM1H 2Z93B 5F7HA 1RFDH 3RL2A 2GSGA 2DDQH 3MLRH 3U9PL 5SWQB 3IGAA 4JFEB 4KKCD 1KNOB 5IVNA 5INCA 1FL5B 3SO3C 1QBLL 2Z8RA 3DSFL 2EDOA 2FECL 2NLJA 4P2OD 4OTXH 5E9DE 4YX2L 5C0EB 3OWEA 4Y4HA 5DI8B 3PWUB 1NGZB 4X99A 4OKVB 3GIZH 1QSZA 4JFOB 1JUFA 2M26A 4YXHL 4JZOA 4NUGL 4FQ2H 1A6UH 3TCLB 3W11C 4XRCA 4PRPA 5CILH 1CZ8H 4Y5XC 1Q0YL 4KUZH 2UV3A 4POUB 1T21B 3GIVA 5JQ6L 4OLZL 1SBSL 1R6VA 2Y36L 3QG7L 3NCYS 2DD8H 5IM7B 4NZJA 3V6FB 5CUSH 3ARDB 2GEEA 1NCNA 3HA0A 5EZIH 1FJ1B 4PS4L 4RFOH 2FWOA 4UUJA 2NY5L 3MCKA 3IDXL 4KVNH 5F8RC 5DVMA 3QUMH 4HS8L 1R5IB 1R3HA 1VHPA 3AB0C 3QIBC 4DGIL 1GOGA 5IEKA 3W5NA 4HW6A 3U36A 1A7RL 1L0XA 4RQQB 2RQ8A 1RU9H 4DN4H 4XNYL 4XGZA 1CD1B 1UB6B 2IMNA 2F74B 1BREA 2F54B 3GI9H 4RGOH 2IADB 4PJIA 1A5FH 1YYLH 4XPFL 4NUJA 5DXWA 3WCYA 4I5BA 4FFYL 1CE1L 2G2RB 2R8SL 2V9RA 1AD0B 4NYLA 4Z7QF 2D9QB 4NQVA 5J1AB 2JB5H 2FRGP 2DQUH 1DQJB 4UIMB 4KK9C 4XI5D 1LP9A 5FHAH 4D9RE 3QPQC 4FQXB 2OLDA 1QSEB 4KZDH 4F33B 3QCTH 3QDJA 4NPYB 2BSRA 4H20H 2DM2A 3EDDA 3V5DB 5EC2B 4HG4J 1HH9B 4IRJB 2XQBH 4J6RH 3H9HA 3KPSA 2Y5TB 1J1OL 2QQNH 3VXNB 3O9WC 3FMGL 5C0JB 1M6OB 4PJ8B 1ZHLB 4M7ZC 1M71B 3OXSB 5KS9E 2XTJC 5A2FA 4NRXB 3ABZA 4NQEB 3VXMA 4EN3D 1RQ5A 5HYSB 3IDYB 5D1ZA 4DFHA 1YMME 4RX4A 1P84K 1A9BA 4G9FB 3U4EA 2EH8L 3O2DA 4KAQH 3O6KH 4G43A 4MCYA 3WIHH 4EOWL 5DRXA 1ZTXH 4WUKH 4S11A 1VFUA 4OIIL 3MXVL 4MJIA 5I1DB 4KMLB 1E4KA 1FG2B 4UT7L 5CSZB 2IG2L 2VQTA 3DMMA 4MA8H 4W6WB 3A6CL 1B2WL 3DPBA 2YXMA 3GRWA 2ATKA 4JAMA 3MRLA 2J4WL 3KPMA 1CE6A 1T83C 1EK3A 5BV7H 5I8OL 2VLRD 1Q9WB 1R3IL 4JRYB 5AEAA 2WP3O 2BDNH 4XPAH 4OZIB 4BH7B 4QOKA 1MHCA 4LMQE 3B9KA 3GK8H 4HG4K 5IW1A 2ZKHL 5AG8A 1FHGA 4HK0A 3RKDD 4U6TA 2Z92A 5SWZE 4PGDB 3U9PH 5C9JA 1D6VL 3BKCL 3CFCL 5DVLA 1QBLH 3C5JA 3GMRB 5CSGA 5I2IA 3H9SB 3QIWB 4YX2H 2NYYC 5JTWA 1XF4A 2X4TB 4RIRB 1YEGL 5CJ5A 4X7TA 2YPLB 3PDGA 1FC2D 1YEJL 3DRTA 1J18A 4YXHH 3HE6A 2UY6A 3VFRA 1Q0YH 2IEPA 5JQ6H 3R0NA 4OLZH 3TPKA 4M6MH 2YA0A 5C0CE 3MRKB 1LO4L 4HZAA 3DXAA 5C7XL 5I18H 4PS4H 5KSBA 3L3KB 5FDYA 2VZTA 2AV1B 5E4EC 1T0MA 3IDXH 5D7LB 5I1GL 4AMKL 2FBJH 4M4PA 2DQIL 2G9HB 4OZFH 3MV7B 4PP2B 1IAOA 3NH7L 5E2TL 5D72H 4GW1B 3FL7A 4O2FB 1DSFL 4XP9L 3N50A 4RSVA 1R3LA 2HTKC 4LAQL 2BK8A 1A7RH 2A74A 1OF2A 4RDQG 5DUBA 2GIYA 1S5IL 1RIHH 1S9KC 3LN5B 4JANB 3ZHLA 4L4VD 1KCRL 4JO1L 1CDYA 5I76B 2NW3B 4WTZG 5IB2B 2JJTC 3QHTC 2Q7YB 4FFYH 5KG9B 4HXAL 2R8SH 3ZYZA 4XNMA 2H2PD 2VISB 1BJMA 1MCRA 2R56L 4ZUSA 2QV2A 3AREA 2PYEE 3SDAA 2DIAA 5IB1A 1HI6A 5FYLH 2QQKL 2Y4SA 3BPLB 3WDJA 3WFEL 1SEBA 1NH6A 4UB0L 5CBEA 1BHGA 2W9EH 3KXFA 4Y2DB 5I8CB 4MNGE 3TPUB 1AD9B 3VRJA 4UDTB 1CLZL 3MJGX 3UAJD 4N90E 5L88L 3QG6B 4LVNB 3FOLB 3S37H 4ONGL 2FX9L 4KQ4L 1QKZH 1A4JA 4WU7A 3PQYA 4X4XB 5DZOA 3RWJB 1U8OB 1NFIB 5I74B 3IFPA 1T6WA 1S7RA 1G1YA 4JFYA 4UTBL 1T66D 5E24E 4AEHL 3C9NA 3RWDA 1MFDH 4JHWH 3S4SG 1IGJB 2VXTH 1KJ3H 4F7MB 4KXZI 3MXVH 4HUUB 4L3AA 2GY5A 2VLMD 4JCLA 4UT7H 4CL7A 1V05A 4QNPF 2ID5A 2IG2H 2KH2B 5ACLA 5C0AD 1J8HA 5D7SL 3TO4D 5IVZA 5I9QB 1B2WH 2EDYA 1U36A 2Y7QA 2ED9A 4GXVL 5EDXA 2J4WH 2X70B 4ZOEA 4ZYKB 3VRLF 3AS2A 2DYPD 5DJ8A 3EAKA 3VRIA 1TDQA 1ULVA 3UTPE 1S9WA 1GHFH 3VFPB 1R5WA 4ZXBB 1QBBA 3O45A 5CP3A 4AIXA 3ZLQC 3HCVB 3MNWA 2FGZA 2W65B 4PRDA 5IHLB 1P7QB 2CLRA 2OL3H 1NANH 3UTTA 5D70L 3HRZB 1G9EA 3FFDB 2Q8AL 1XR8A 3PV6B 4JDTL 1OVZA 3HI1B 3L5WB 4U7KA 4CNIB 4F15B 1KIUA 5I0ZA 4C56E 4HKBA 5LJYH 3H9ZA 2I60L 2EYRA 3BKCH 4KROB 4HWZA 4NZTH 4XNXL 1XF5A 1HQRB 4IJ3C 1QBML 1TENA 2PR4L 4JJHA 4HGWA 1F97A 1MHPL 3QNZA 3LIZL 4MSWA 5CJXC 4KHTH 4OGYH 3T0BA 1DANU 1QLFA 1U8PB 4JN2B 2RHEA 1HXYB 5E8OA 5ESQB 4K55A 1KTRL 3BPCB 3FO0L 5C0BA 3U2SB 1YEJH 1DN0B 1RZIA 3EJZC 2P47B 1FNLA 4K3EL 4POZD 5AZEL 3WL9A 4G7VL 4PJXE 5D5ME 4ZUUB 1Z0MA 2L7UA 4PRBA 3ZL4L 1V3KA 3OPZL 5CZKA 4X98B 2GJ6E 2XKNB 4MNQA 1LO4H 1YEFL 3T4AB 4GAYB 2VE6A 2X4UB 3KPOA 2X44D 3T8XA 3WHXA 2EXYD 4M62L 1IAMA 4URTB 5I1GH 5I17A 5IFHH 2P42B 1XGQA 5DHVA 5F9JA 5FYLE 3EOTH 5IMOB 2DQIH 5IMLB 1U3HA 1QHOA 1K4CB 5E2TH 5INDA 5HI5C 1Q38A 4JVPA 1GC1C 3D0LA 1T22B 3BDBA 3UJIL 3NCCB 4LAQH 4WFGD 4HULB 1S5IH 3BPNC 4QO1A 4DVRH 1JRHI 1AXTH 5ESVA 1YPZE 2VJXA 1AJ7L 4JG1H 1KCRH 1MCCA 4FFVC 3VI4F 4JO1H 4LHUA 1D5ZB 1IGMH 5FUZL 4WGWB 4AENB 1U2CA 5EFIB 3RL2B 1M7IA 3MRJB 1QACA 4X4ME 4UV4L 4JFED 2R56H 5INCB 3TIEB 1YQVH 5H37H 4H1LH 4N8VA 1B3JA 2NLJB 5E6IC 3WFEH 4LSQL 4S1SL 4C54A 2Z0BA 1I8LC 4X99B 1XIWC 1ZT7A 4M43L 3ZMRA 1NCWL 1JUFB 1DN2A 3R4DA 4JZOB 1JNNL 4PJDA 4CU6A 5L88H 4DOHB 4PRPB 5DJDA 4NO3A 5E99H 1H3PL 4B50A 1DQQB 3GIVB 4QEGA 4ONGH 2VDLH 4XVSH 1UJTA 1KCKA 3SDDA 4XBGA 4XNUH 5IGXL 3ARDD 5D7KE 5HI4C 1C5CH 4UTBH 5D1QA 2E9IA 4ONHA 4UUJB 4MQTB 3MCKB 1OAZL 5ITFA 5FFLA 4ZS7H 1XT5A 5ID1B 3K74B 4DTGL 3BWUC 4G6KL 4GRWF 3IFOA 4HH9A 5L7XH 4JO4H 1JYWA 4M8QB 3S88L 4GMSH 3SDCD 3U36B 5JNYA 1U8HB 2MPAL 4U1KA 3X12B 1FN4A 2XTJE 2R29H 5DVNA 2ICEA 4XGZB 5LWYL 1IAIM 1Q8MA 3EYFB 5IV2A 1PY9A 2F54D 1UZ6E 3MBEC 1C1EL 1MCOL 4HGMA 1SVCP 1AGDA 2W60B 3H9YA 5H35B 4I5BB 1QD0A 3RVVD 1IQDA 4XH2A 5BZWA 3HAEA 3B9AA 5GS0D 3O3EA 4NYLB 3OZ9H 1N4XH 5DMIL 4NQVB 2CUIA 1OWWA 5ICXA 5D70H 1E4WH 4K07A 1OTTD 2Q8AH 3SY0A 1F3DJ 5DZNA 4FQXD 2Z8SA 3ARUA 1JPTL 1QSED 3QDJB 5FOJA 3T2PA 2I60H 4NCC2 2BSRB 2VH5H 1QSFE 4J3TA 3QFJE 4IRJD 1TVBA 3ZSTA 3OL2A 1MHPH 1ZVYA 3LIZH 2IJ0C 3MLYL 5H94B 4JGUA 4PJ8D 5I30L 1AC6A 1S7QB 1TETH 5DTFB 1OSPL 3RKDC 2XG5A 5IMKB 3O2WL 1TTUA 3PUCA 3VXMB 3CFIC 4NQED 3K2UL 4DGYH 2CDFA 2DJSA 2NY3C 3SBWA 5D1ZB 4Q6IB 2GCYA 4JKPH 3U4EB 4G9FD 4FNLL 4J3WA 3AY4A 3ZL4H 4Z7WA 3QDMB 1LO0L 3HG1E 4MCYB 5EOCH 5DRXB 4MJIB 4OSUL 2NX5B 4XVUC 2KQMA 5L8KB 2K3TA 4HUXA 1JZ5A 3VXTA 5E70A 2BVUA 5F6HJ 3ZE0E 4TNWK 1MFNA 2MCPH 2ATKB 4AQOA 4WHTA 2XN9A 1PBYA 2AK4A 1ZT4A 1CE6B 1AHWB 5C6TL 5IF0A 3LS4L 2NNAA 5F3HA 2V2TA 2R0KL 2GSIA 4NGHL 3WUWG 3BQUC 1IGCL 4FQ1L 4JRYD 4FABL 2QTEA 4I2XA 4QOKB 2GK2A 4JRXE 1I9JL 4I77H 4ZS6D 1AJ7H 4GRMA 3B9KB 3ARFB 4HIHA 5H2BB 2D7QA 3QWRA 5FUZH 1GGYA 1WF5A 4R0LC 1NUGA 3DLQR 4K8RD 5D7IB 2Z92B 1LEGB 1VB9A 5JO5A 5GGUB 3C5JB 3RP1A 4QRUA 3B3IB 4S1SH 3H9SD 1UADC 3QIWD 3T0ED 1BVKA 1XF4B 4UINL 1I85C 3G6DH 4L3EE 1KN4L 4CKVX