4WFEE

Human traak k+ channel in a k+ bound conductive conformation
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
211
Chain Sequence
b'EVQLQQSGPELVKPGASMKTSCKVSGYSFTGYIMNWVKQRHGKNLEWIGLINPNTGYTTYNQKFKGKATLTVDKSSSTAYMELLSLTSEDSAIYYCTRGNYVFDYWGQGTTLTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel subfamily K member 4
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 47
structure length 211
sequence length 217
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wfeE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wfeE02
5D72H 5GRUL 1A3RH 4PJGA 3FQNB 2VQUA 5GS0D 3KWWA 1KTLA 3O3EA 4F2MA 1X3DA 3G08A 5T1LD 2E6QA 1P4BH 3U6RB 1SBBA 3MBEA 2PXYB 3IKCB 3LSOB 5FUOH 4YFDB 5C07A 1M7IB 3MLYL 1B0RB 2VDRL 2JIXB 1KENL 3T2OA 1HINH 5DJ6B 3IXAA 4PGCA 5LGJA 4LSDA 4P9HC 5HD8D 3NN8B 3V8CA 4IRZH 4XP9L 1Z5LA 2PF6A 3PDOB 3W82A 3DXAA 4GJTB 1FZKB 4QRUA 4F7EA 2XZQH 5J11C 2BNRD 4JG0L 1N8ZB 3ARFB 4PTUB 3H3PH 3T0EA 3R0MA 4XPBL 2VC2L 4ZOBA 5D2NE 3P9WB 2DLIA 2DM2A 3VFVA 4LQFH 3T65A 4RGNB 1I8KA 3HZMA 1P1ZA 3SO3B 4JR9L 1H0DB 3DBXB 2J5LC 3DVFA 1V05A 4MQXD 5ITBL 3KPTA 3OX8A 1CFQB 4PRBA 4G8GB 3SGEI 1NKRA 5D7JB 1EO8L 1I9JH 1Q9OA 1PSKH 4CGTA 5GGSY 3WFZA 1NFDB 1BHGA 2N56A 3K2UL 3C6LB 4GMTH 4XP4L 4Y19B 3SN6N 4KV5F 3WE6B 3KPRE 4GAGH 4DOHE 1H5BC 3O6MH 5FM8A 5KSBE 3VXME 4GRLB 3TM6A 4OTXH 3ZKMC 5JUEL 4ZXBA 1T3FA 3AY4A 3KR3L 4I77H 1N64H 1B6DA 4LCIL 4JFFB 3FQXA 5BZDB 2XTLA 3IFOB 4WEBH 5E4EB 5CD5C 3BZ4B 4KDTA 5E1HB 4RRPA 1F6LL 3L1OL 5B4MD 5KVDL 5FECA 4TUJA 5HHPA 1A4KB 3HRZA 3MXWH 3ROLA 2X4OB 3FO2B 3ARGD 1CGSL 1A7OH 3RVXC 1MFCH 4YLQT 1YNTB 4HLZH 4JY4A 2J6EA 1BVLA 4AT6A 3V4UH 1A7PL 3MRDA 4PYHA 4FQQA 4LLVB 1FPTL 1GRWA 1FL5B 4XPTH 3MBED 1LO4L 3SDYL 5F9AC 5C07D 3ULVD 3PWLB 4P5TA 5JDSA 1G6RA 4JLRA 3O45A 1UJ3B 4PRPB 5IEKA 5CP7B 3QUYD 5GGQH 4YXHL 1MAKA 1NL0H 3V6OC 5HYIA 4R97B 3V2AR 3DXAD 1R3IH 4HJ0D 4QWWD 3RWHB 2IPKA 5D2NA 1UGNA 1GC1H 3KYNB 1ZANH 2N4IA 3QR2A 1EMTL 3DRQA 2YD6A 4HUMB 3T0ED 2IANE 4MCYA 4D9RD 3DMMC 3INUL 4QRTB 1XIWA 4G8EB 5D2LB 3FFDA 3MUHL 4HF5H 2ZOKB 1OSZB 2HKFL 2XN9E 4PREA 3IS0X 1JV5A 4OZFB 3P9LA 4XMLH 3B6SA 1IKNC 3FB8B 2PKDA 2ARJB 4HJGA 1QPXA 4P9HH 4AH2A 1I85A 3KPRA 1NMCC 3PL6B 4NM8L 3UDWA 3SGKA 4KAQH 3V5KB 1AD9B 5KSBA 5C0FA 3TPKA 3VXMA 4P3DB 5I71B 1BFSA 5J7CC 3VD5A 3IJYA 5HGDA 5EIIA 1YY9D 4NO2B 5L7XL 4FQPA 3O2DA 4ZXBD 2C3VB 4GS7C 5GS1A 5DUBB 5MHSE 3KDMA 3DLQR 1FYTB 5F1IA 5IHUH 1KACB 3JSSA 1DDHB 1JWUA 2EKJA 3FQWA 3VGAB 1EH9A 4D0CA 2DQDH 3LKNA 4JB9H 4YFLI 4WCYL 3SCMC 2FBJH 1IAOA 1JPFA 1HSAA 3L3KB 1N6QH 3REVB 1ZHKB 4X8XA 4YBQD 1HZHL 4KK5C 4M5ZL 2QR0A 3IDUA 3P9MA 3SJVB 5ANME 4I18B 2ICWI 1CICB 5TDPB 3EDEA 4P46B 1SJHB 1AO7B 4R4FH 1G7JA 3G9AB 1D5IH 4R4NC 1NANI 3GSNH 4ELKA 4IMKC 4LHUA 2XQBL 3RHWK 4OZGF 1NEUA 3JZ7A 4XH2B 3U7YH 2VLKA 4CMHB 5D7LB 5E8EB 1U6AH 3UP1A 4RZCA 3MA7B 3MZGB 3CLFH 3CZJA 4Z7NF 2I27N 2IPTH 1B88A 3HMWH 3L3JB 3IDJB 2IBBA 5BZWB 4YX2L 3KLAA 1XIWD 4L1DA 5DEGB 5ACZB 4L4TB 1L7IL 4WVRA 4PV8B 3ARBA 3NGBB 1DUYA 1MRDL 5E2WH 3CFDB 1QO3B 4P5KB 1LEIB 5MENB 3P4OA 1FG9C 4UILH 1F3DH 1RU9H 3W11D 4XMKL 3KPRD 3QWRA 4BSJA 1W2KT 5IGXH 4U1SA 3RA7L 3FFCB 3T3MF 2EYTB 1NAML 3VXMD 1ACZA 3PHOB 3FT3B 4LOUD 1NMAL 1XR8A 2WZPD 1T1WB 5MI0B 3RWCB 3VXRB 3ECBA 4OB5H 1Q9LA 2VJXA 3MLYH 6CGTA 1KENH 3MLZH 1ZLVH 5DMYA 4YDLC 5I1KH 4X6DF 1CBVL 1OTSD 1SY6H 2HWZL 4XP9H 4LSRL 3RL2A 4S0TD 1PKQB 5CSGA 3TT1H 3FOLA 5ERWA 2NW3A 2FX9H 3QIBA 3DYPA 2C3HA 4C57C 3B83A 2R2EA 3WHE0 1BLNA 4EN3A 1KIUA 1XF5B 3EO9L 5L2KA 4RBPK 5C71A 1ZVSA 2CIKA 1K2DA 3P30H 4PYGA 3LQZB 1SBSH 3O9WB 4NNXA 5HYSA 5ITBH 4LIQL 3BPCA 4HH8A 4EQ3A 2B5IB 2YA1A 4DQOH 3ARDC 2EE3A 2IFFL 4MA1B 3RWJA 2R1WB 2GW5A 3K2UH 2Y9RT 5TQ0H 3ZZ1A 1NJ9B 1YECL 5GJSL 1WITA 3DUUB 5EO9A 2F54B 3MRKA 3NCFB 1S7VB 1WT5C 4KJWD 4J3UA 3BPLC 3I9GH 2ATPA 4H25A 3HR5B 1LEKA 3ROOA 4RWYL 1TNNA 2R0ZL 5EH1A 5GZNC 2IAND 1QBLL 3O2WL 1IGIH 3QDGA 2UVEA 4JFQA 3KPPA 3QRFM 3C6SB 2DDQL 3ZE2E 4F8TA 2XN9D 3MV9B 1VHPA 1RJZA 1NCDH 3M17B 4RDQG 3VXNB 3HC0A 4KJPC 4UV7H 2GJ6A 3ARBD 1BBDL 4JGJA 1FYHB 3TGXA 2FLRT 2Q7YB 5J57B 1NC2B 5INDA 3SDDA 1ETZA 1KN2H 3QWRD 4WHYH 3FQTB 5CKGA 3QI9B 5T5FL 1BVKB 4M3JA 4Y88A 4KY1H 3U83A 2YN5A 3C08H 5LBSH 1J7VR 5TE6H 5KW9H 5MHSD 3Q0HA 2EXYC 2YPKB 3SE4A 4EDXB 3TVMD 1AY1L 4PG9B 4PRIE 5C2BH 3QXTA 3H9ZA 3VMPA 3L6FB 2MQCA 4JDTL 3BWUC 4Q7DA 1F13A 5DA4A 3VFGL 3CVHH 1J05B 3CNKA 4C56E 4PJDE 3EYOB 1S5IL 4EN3D 4ZS6C 1U93B 5TFSL 1D5MB 4J23A 3U0WL 4GKNA 4DCQB 5E6ZA 2YSSA 2C1PA 1KJ2L 1NGYB 4WI5A 3FT4A 4Z7VE 2X9XA 2YZ8A 4YZFE 3FRUA 5DQ9A 1T2XA 5EOCJ 4G9FE 4KVNL 2AJVL 4L8DB 4WW1B 3LRSA 3FB5B 4XHQA 5C0EA 2A6JA 3D48R 2HJFB 5TE7L 1U2CA 4XCNA 3BAEL 4XBGB 3I02B 3U46B 4DN3L 1JHLL 2HVJB 1CE1L 1SQ2N 4ZNCD 5SX4H 3ULVF 2VO5A 1WIUA 2PCPB 3ZHDA 3QDGD 5JQ6L 4K23L 4FTVB 1MCSA 5IWLC 1UQSB 3NAAL 3ZLQC 3U48A 3GGWB 5E70A 3VWJC 3RDTB 5IMMA 3GIZH 1SEQH 1KTDA 4X7SH 1MFBH 3WIIH 1DQDH 4I3RH 1JGVH 1P4LA 4X99B 5CLWA 3LV3A 5T3ZH 3ES6A 5IR1B 3THMH 3SDDD 1EEYB 3E6HA 4TUOA 3EOAA 4U1HB 5I1GL 1W0VA 4IBLT 4U1MA 1FL3A 3RRQA 3O6FA 5HI3C 1K6QH 1HOCA 4ZFFB 4PRIA 4M8VA 3S36H 1S7QA 3DUHA 1R24A 2XV6B 3TF7C 5KANI 3F65A 3FOMA 3T77B 4JEGB 5KANG 3CH8A 4HUXB 3LPWA 1JFQL 4C56A 4PJDA 1MHHA 2BX5A 2CUIA 2BVQA 1CD1A 2F5BL 1HIML 3WFCH 1T66C 3QJHA 5DO2D 2AABH 5IM7A 3EO1B 5CEZE 3GJFB 3MRGB 3MJ9L 2ATKA 4X4ME 2BSTA 1NBVL 2OP4H 3ELAT 2HTKC 1U92A 1OAZL 1MRDH 3EOBB 3SGDH 3GHEL 5BOZG 5F8RC 1IGFL 4JFZH 1J5OL 1VB9A 3RNKA 1ODAA 4G6AD 4XMKH 1FVDB 3V52L 4GQ9H 5I74C 5IW3A 4W68A 4D9LL 1NAMH 3FN9A 5DTFA 1AGCA 3BIKA 5F7EH 2GCYB 3G6JE 2P5WB 1AHWA 3S35X 3MFFB 2C3XA 1KT2B 2K7PA 3MCLL 3DURB 3FJTA 3QWQB 1BZQK 4NSKB 4P2OC 4FFZL 4XTRC 1MLCA 3BXNB 4CJ0A 1KIPA 3I84A 3QO0A 4PY7A 2H3NB 5BRZA 1MUJB 4OQTL 2VDPH 4QF1B 2XKNA 4HCRH 2NTSP 2FD6L 1KG0B 3MJGX 4XP6H 4TTGA 3GSUB 3ALWA 1T0PB 2AEIT 4YNYA 3CFCH 3CXDH 2V2TA 3JBG7 3IYLW 1DUZA 1FO0A 3ZKXC 3L7EB 3EO9H 3C5ZC 4LLUA 2BHYA 1KCUL 2X4PB 5CJBA 5FYKE 3QUXC 4QHKJ 5C6WH 32C2B 1BM3H 3D85A 3WMSA 1IC5H 4N68A 4UDUB 4F33B 3UC0L 3JV4B 4NJ9L 2WBWB 3O6FD 4KVCL 4ODHL 4KXZI 2BNUB 4PRID 5KSBF 4J1UB 1FHGA 2UY6A 2ERJB 3WIFA 2J1KA 5D93B 5KS9B 5IKCB 1YECH 5GJSH 2LU4A 1F4WH 2BOCA 4C56D 2NY0C 3PWPB 4KK8C 5KZCB 1I1FA 3EZ8A 4X4MA 5ESAA 4O51B 4TVSa 5EUOB 4QRSA 2DDQH 5GGUA 2O5YH 3HE6C 4R6UA 4IS6B 1RVFH 3G5ZB 1IC4L 2CLVB 1D5BA 1D7FA 4G9FD 3IDXL 1QR1A 2X9WA 3A67H 4DUWA 1BBDH 3TH3T 4X4ZA 4NC1C 2X41A 4NRXB 1Z0MA 3VG9B 4UV4H 3BSZH 5T3XL 2YWZA 3MRPA 5C0AA 2B1AL 4IRSB 4MZ3A 4HKXB 4WI6A 3QCUL 4C59B 1LEGA 5HYJA 1ZHLB 4PB9L 5DXWA 4NQDE 2P44B 5TH2A 1JNHA 1Q9WA 4JO1H 2YS4A 3HI6L 4NO0B 2E7LC 4EVNB 2VZ3A 4Z7OE 1NFKA 1JJUA 3QXWA 3MRIA 2P45B 4Z77B 1B9ZA 5IW6A 1GH7A 3UCRA 5K9OB 3L3GB 5CZKA 2PTVA 4KKAD 3RKPA 2OR7A 5E8NA 4JPKL 5FKPB 5CD3A 5ICZB 5GS3A 4NRZA 2DIJA 3DX7B 1VA9A 3DHMA 4NKQB 1DVFC 4LAQL 3T1FA 4Z7WA 4WI2A 2M2DA 4YPGB 3FCTA 1R5IB 1NEZB 3GMPA 4Y2DA 3NFSL 1HILB 4R90L 1JNJA 3KPSB 1QRNA 3IRPX 3L5IA 5JNYB 2VWEE 1YN7A 4MCZA 2VABA 4PJBB 5DRZB 5JW4R 5IB4B 1OL0A 4LLDB 1JZ3A 4NRYB 1UCTA 3PP3H 3NACL 3Q6GH 1I4FB 4HG4J 3BN9D 3HZKB 2GK0A 1EX0A 4Y4FB 1PX3A 3FONB 1LO5B 4F80A 1Z6JT 3X17A 4FN0A 1H3XA 4DN3H 1RJYA 3GUTA 1KTKE 3X12B 5T1KB 2CJUL 5CEZD 5C3TA 1Z2KA 3RX5A 3FQNA 3RBGA 5C8JA 3RUGE 4IOSD 2CKBL 3RGHA 2WINA 4K23H 5I2IA 3LSOA 2PXYA 3DVGB 3IKCA 5C3LD 5DWUL 1JP5A 4AZ8A 1B0RA 5DJ6A 5H2BB 4NP4L 2FECI 2E27H 2WWMD 3NN8A 1M4KA 3WLBB 4HH9B 1OT2A 5A2LH 3WL9B 1ZMYA 4HWNA 4L8CB 4O2CB 3OKLB 4NQDA 2CDEB 3OXRA 2KZWA 4M6MH 3GSWA 1N8ZA 3ARFA 2H8PB 4PTUA 5CJOL 4GRWH 3GMRB 3LHPL 3AM8A 3FRPA 1GAFL 1TZGH 2OL3L 3WJLA 1LE9B 1U58B 2HN7B 3DBXA 4NKOA 4OD1L 4LSQL 3NFPA 3MR9A 3LVEA 4G8GA 4NQCB 3FT2A 4NWUH 4F7TB 1H3TA 5D7IE 1A5FL 5JTWA 5DYOB 5GGSB 3BDYH 5FK9B 5D7JA 3UROR 1CU4L 1JFQH 2AXGB 2XWBB 3N1MC 2F5BH 4LVNC 4Y19A 4IIQB 4HK0B 3KPOB 1SEBB 5DJDA 5FYKD 1H3GA 4JN2B 2NY3D 1UVQB 1A3LH 1LO3L 4Y2DD 2QHRH 2CRZA 1NBVH 2DWEA 1QRND 1A7BA 2ZJSL 5HYQB 5FUCE 1QR4A 4U0RB 2JCCB 2YRLA 3QFJB 5EBLB 1CD9B 3OR6B 2JJTA 1Y0LB 1A6PA 2H2SD 2OS7A 5DJZB 5L9DH 5I15H 2XY1A 1IKFH 1RHHA 3HPJB 2Q7NA 4J3OC 5I76A 5J9PA 3ARPA 3CVIH 2HH0L 2KDGA 1YNTA 4NIKB 4YK4C 3SQOH 1CLZH 3H9SB 4OD2B 4MXQC 3ZMRA 3RUGA 3TO4C 1I1RA 2P5EE 2IQ9H 3SOBL 3B9AA 2RR3A 1LQSR 2HRPH 4J6RL 5B38G 3CUPB 1LE5B 4G42B 1W72A 2WWKO 3DX9B 3CZFB 5GXBB 4RFOL 2AEPH 3SKOB 2I25N 4TRPH 2CLZA 1FQ9C 1UJ3A 4PRPA 4LCCA 1A14L 4OCRH 2GJZB 2R15A 1BFTA 3BZEB 4BZYA 1ACYH 1RULL 4NQDD 5L6YH 1RAMA 3KYNA 3F7QA 5E7BA 2VXSH 3ARFD 2P49B 1T04B 2WLYA 4FZ8H 1YNLH 2D2OA 2PW1B 1O0VA 2DLTA 2OI9B 5D2LA 4MMXC 3KYMB 3GKZA 3HNVH 4M4PA 1JK8B 2EIZA 4L4JA 4QGYA 5LCVL 4L4TE 1DQJA 1EXUA 4KRPB 3B9EA 3ESUF 1UKTA 3WLWD 4TOYH 5DS8A 5D7JD 3HKFA 4YDJA 4UB0L 4YAQA 2QQLL 3QDJB 1U3JA 3BMVA 5CZVL 3V5KA 1JTTA 3F7YB 5M7QA 3ZE2F 3F7VA 4P3DA 2R1YB 4HWBH 4NO2A 3FO1B 1UB5B 3D25B 5F3HB 3NABH 2B7DT 5I1EH 2HAZA 3HMXL 4AEIL 3WS3B 5CEXA 3J7HA 5E2TH 2LQRA 5IB3B 3D69B 1QZ1A 5EC1A 4NN5B 1IL1B 3L7FB 4TPRL 3X11B 2XWTB 3TCXA 3KHQA 4BKLB 2LVCA 5FHAL 1K4DB 1OM3H 5JPMB 2RCSH 4E5XB 3GK8H 4LP4A 4LSSH 3MRMB 4XPAL 2P5EA 4AMKH 4YR6B 3L3KA 4QY8B 3REVA 1ZHKA 3N1PC 3U30B 1TMCB 5HHOB 4NZTL 3JV0A 3DWTA 1KJ3H 2KH2B 4HK3N 5DUPL 4EUPB 4KDWA 5DRXA 4P46A 8FABA 5EIVA 1FFNB 4PJDF 4LARH 4DZ8B 3CDFA 1U3ZA 1NGXB 1HWGB 5JLZB 2R0LL 1BF2A 4XH2A 3HA0A 5DZLA 2VERN 1PZ5B 4N0FB 1OWRM 4NHUB 3JVGA 4Z7VF 4YZFF 3MA7A 3NFSH 4R90H 1X5XA 3WKNA 2BVUA 4PV9B 4G7VL 3RY5A 1CFBA 4GW5B 3HE7C 1U8QB 1FL6B 3U4BH 2F5AH 5DMJB 5F6IB 4Z7UE 1E28B 2MOVA 5E08L 1XCTA 1MIMH 4L4TA 2CD0A 5KSAA 3MNZA 1RJCA 4PV8A 4R8WL 2WK2A 1T89C 5FO8B 1HYRC 2FBOJ 2FEDC 3ORJA 4HIEA 1QO3A 1S9YB 3UXFA 1LEIA 5D5MB 1WAAE 2BDNL 3WO4C 2VDQH 4PGDB 1GGBL 4M02A 1J0YA 5IJVB 4GLRI 1UWGL 3C09B 5LXGL 2J8HA 1NC4D 3D3VE 4Y5YC 5DK3A 2EYTA 1TLKA 3MUJA 4KRLB 3PHOA 2R4RL 1YYML 1T1WA 3P4LA 5FUZL 4JQVA 4WWKD 1CWVA 1GJIA 2A9NL 3OKDA 4I3SL 2FLBT 5E56A 4HFWB 5HHNB 5E2VL 4AIXA 5D1XC 5EDXA 3VE0B 2ZUQB 3MNWB 3VFOB 4MAUH 1MCOL 4ZFGL 4V2BA 3MRNB 1MY5A 1Q0YH 2GEEA 2Z4QA 4OD3L 1U8KA 3LHPH 5HHMB 1WIOA 2DQGH 2P5ED 3WUWA 4ONFH 1ORSA 3VDAA 5CUSH 3MO1B 3IT8D 3O9WA 2XG4A 3IDGB 4OD1H 3GSRB 3VMNA 3EGSB 1WCBB 5DFVD 2HG5B 1A5FH 2A73B 5JOFA 1RIUH 4P46D 3ARTA 3QIUA 5IVXF 3SY0A 1GYAA 3I6GA 3QBTB 4HG4K 1ZEAL 4JGMA 3TZVC 1BQHA 2R1WA 1A7NL 1L0QA 3S97C 4OLWH 4X6EB 3HHRB 2D7QA 2Y5TB 4QHLA 1KCSL 1S78C 3U7WL 2E9WA 5F7HA 1LO3H 5EU5B 3MZTA 5IV2B 4WHCA 4Z7UA 1BJMA 4H8WC 1P4IL 1KN4L 3C6SA 3U9PH 4OM1L 4L4TD 5KSAD 1I3RB 1KXVC 3M17A 4O4YH 3VXNA 1EEQA 3EJYD 4ZUSB 3T2NL 2Z8RA 1J0IA 4KDVA 3BP4A 3G6JF 5DRWB 2NY1D 3EHBC 2VQTA 1F58H 1QFUL 2P48B 1VENA 4KKBC 4LMQI 5CMAA 2PYEE 2BHZA 4X4XA 3D3VA 2QKIB 4JZJB 4Z8FH 1XF2B 4L8BA 2X10A 4JM2A 5SWZE 3FQTA 3O3BB 3QI9A 5BCAA 1IM9B 1BVKA 4Y5XA 1GZPB 1D6VL 1WFOA 2AV1B 3CK0L 3G04B 3LH2H 1XZ0B 2JTDA 1EK3A 4EDXA 1LK3H 5TF1L 1QBML 2R23A 1A64A 1J11A 5JR1L 3QEHB 3Q5YA 2FIRT 1F4HA 5F3BB 4X0KB 3L6FA 1B4RA 1BEYH 3DOSA 1J05A 1EO5A 2R0KH 4Y5VA 4JRWA 5CJQL 3TJHD 3VXTB 1U93A 5DJCA 1HH9A 4MXWH 1D5MA 5J12C 1FJ1B 3D18A 1EJ6A 4S2SA 1REIA 3S4SG 1QFWL 1NGYA 3U2SA 4UT7L 1HQRB 4N9GB 1TZHB 3BGMB 2GTWB 2IF7A 3LKPB 4UIMB 3WFDH 4PJ7E 4L8DA 3FB5A 3QIUD 3IDMA 4NCDA 5CZVH 1DBBL 3X14B 4XVTL 4MJ5A 5IT2H 1T1YA 3RQ3A 5F72S 3CXHJ 1S8DB 1ZSDB 5A1AA 4R7DA 5GS0L 4YIQB 1AD0B 2HVJA 4M43H 1ZVHA 2H32H 4I0PB 4M62H 1T2QH 3W0WB 3QIWB 5EU3A 3MV8B 4TVPH 2X4SB 25C8L 2D7TH 3CFJB 3LN4B 2A1WL 3MV7E 4PRNB 1TJGH 1MFNA 4FTVA 2ICWB 2EH8H 5INCB 3GGWA 4LCYB 2G9HB 3RDTA 3UTTE 4DK6A 4XCCL 3BVNB 3TBYA 3DX8A 4DKEH 1QHPA 4OGZA 3GMOB 2A9MH 2EKSA 3VH8G 3RPKA 2PYEA 1S7WB 2FHCA 2VXTH 4JKPH 5DMKB 5I18L 1JZ5A 4Z7OF 3WO3B 3D9AL 3HUJB 1RZ7L 5SWZA 5IR1A 3D3VD 2IG2L 1QFOA 4I8DA 4CU8A 1YMME 5I8KL 4JM2D 1RURL 3TC9A 4NZTH 4HPYL 3QI9D 5KVGL 1WIPA 3M45A 3QPXH 5HSFA 2NNAB 2P1YA 4LKCB 3SDXB 4H8WH 3MGTB 4DGVH 1OAKL 2L7UA 3QJFA 1AKJB 2JLLA 2JELH 2YXMA 1CE6B 4K2UH 1MREL 5CJ8A 4H1LG 4HUXA 5T5NF 4O2EB 3VRLE 4DN4L 2W91A 3PXHA 5ILTL 1F00I 4KQ4L 5A43C 3OJ2C 5E1AA 3MLWL 4XMPL 1MJUL 1YMHB 4P23C 4ODUB 4R8WH 4EDWL 4CN1A 5IB1B 3EOBA 4WENB 1HNGA 4XBEH 3GFUA 5EU7E 2E9BA 5JPNB 4XP5L 3RUGF 3AS0A 2B1HH 2QADB 1TQCC 3UZQA 1UWGH 5GPRA 1NCCH 3ULUC 1CDCA 2B0SH 1FZOA 3OR7A 2FIKB 2AKRA 2E5EA 5FUZH 3X3GH 2MTPA 4ISVA 3DVNB 5DD3L 4ODWB 4ZFOB 4H0IA 1FNFA 1X5HA 2NY6B 4QRPE 3BKJL 4X80H 4K07A 3ULVL 3TT3L 2XQYK 1QPPA 4ZSOB 1YQVH 3VFUB 3T0AA 2H3NA 1MUJA 4ZFGH 4UQ2B 4KRNA 1T20B 1KG0A 3BQUA 4FXLA 2FX7L 5K9KB 4F9LA 3GSUA 5IF0B 5GS0C 4KUZL 3EIFA 4KK9C 3T2PA 1YEEL 4MNGE 4OF3A 2PYED 1KCKA 4LNRB 5C2UB 3K8LA 4OD3H 4HJJH 4IRJB 4U7KA 4DZBB 4QHUB 2X4PA 5SWZD 1VGEH 2AXJA 2XACC 5ETUA 4AEHH 4UTAH 3KS0H 3NIDF 5D7IF 1FVCA 5HD8C 3MLUH 4U7SA 1S5HA 3O4LB 5I8OH 4GRMB 4PFEA 1VFAB 3Q3GA 1AGBB 3G5XB 4JHBA 4RGOL 2DLFL 1HXYA 5D1ZB 5DDHB 2ESVE 4TNWF 4U1LB 4ONGH 4WHTB 4GKOA 3CAFA 4OGAC 5GRVK 3U82B 2VNCA 5DC9B 5IKCA 4JRYB 4PJAE 5C0BB 1MY7A 2ZOLA 1BF8A 3U7WH 2IAMB 2VLJB 1QFWM 1Q9KB 4MQXC 4XP1L 3PWPA 4XWGL 1S7UB 4MQSB 4LEOA 5KG9B 4XNZC 4KRMB 4I48B 3HFMH 5IJKA 4G8IB 4BH7B 5EOCL 4M1CD 3ZE0E 3DUSA 1D5XA 1CFVL 4O2FB 3MACH 4WJ5B 3RZCB 1K3ZA 4OUUB 4WUUB 1FE8L 4IS6A 3MQIA 2AJUH 2CLVA 5JHDB 3T2NH 5J4MA 1KYOJ 5I1HH 3EJZD 1DQLL 4NQEE 1MFAL 4OZ4A 4PGJA 1QFUH 1H3PL 2VIRA 4NRXA 4LRIA 4LVOC 3QDMB 5F93C 2J6EL 2LAGB 1A1OB 4Y8AA 2EIBA 4HDIB 1E6OL 1FIGH 3CC5B 2I24N 1D6VH 4FXGA 3QO1A 5B4MC 4HC1A 1AXSA 3CU1A 1AE6H 1H3VA 3GO1H 3B9KB 4Q0XH 4NO0A 4S1SH 3ARGC 1H15B 5TE4L 3HNSL 1CK0H 4ZS7H 4EI5D 1T80A 2E9JA 3K4AA 5FO7B 3F7RA 4M8QA 2NY4B 1QBMH 5IOPA 5DVMA 4KMLB 3KPLB 5K9OA 1G6RL 3UTTD 1LNUA 4NQCE 1DBAH 4O9HL 5ESVA 4OZHB 3IJHA 2AK1L 1B4JL 4MNGA 1IAMA 3MOBH 2DRUA 1HDMB 3BQUD 5FKPA 4H88H 2WAHA 5CBEA 5ICZA 2FGWL 3VI3E 1WWWX 2XKSA 1NQBA 3QNZB 4JFYB 1BGXH 2WIIB 1JZ6A 3MBEC 4YPGA 1YMMD 1ZGLB 4GKZA 1HILA 3MRQB 4OLUL 4GAJL 3ULUH 3JV6A 3NPSC 3P40A 5JNYA 2R69H 2BY3A 2QSVA 4PJBA 12E8L 5F88B 4Q9QH 3QUYC 4K94L 5H8DA 3DROA 1AGDA 2ESVA 1N7ML 3EKCA 4PJEB 4HJ0C 4QWWC 2Y23A 4YHML 5I1IL 1MPAL 3A6BL 3FONA 2NY7L 4NNYA 3T0EC 4XCFH 2Q86B 4YHYC 2Q76B 3IU3B 3Q2CA 4MJIB 1CL7L 1CDYA 4JO2L 1OVZA 1FLRL 3D0LB 3X12A 5T1KA 4M7LL 2Y7QA 3LQAL 3OG4B 5FXCH 4LLYA 4NKDA 3O0RL 3QUMH 3AB0C 3O2DL 4WWID 1UWXH 5IVZB 3RAJL 2CXKA 4UTBH 3GSNA 3HC4L 5C0IB 4CMMA 3WEXB 4NUGL 4XC1L 3DVGA 3LD8B 4NQEA 3R4DA 2B20A 1MCWW 5HVWA 1V7MH 1ZLWH 1KIRB 3VA6A 3ULSB 1OP9A 4XB8A 1K4CB 5CGMA 1PLGL 5I18H 4HH9A 4NJAL 4H20H 1YY9C 3D9AH 2E6JA 4ZXBC 1RZ7H 3AY4C 2XOTA 4HD9A 2IH3A 3LOWA 4JJHA 2MQ3A 4EOWH 2ZCKL 4LF3B 5HJ3A 5ACMA 3OKLA 1BVZA 2CDEA 1VACA 3I6KB 4Y16D 4YO0B 5GS2H 1F90L 2H8PA 4KDTC 4YXLH 3GMRA 4PJHB 4MA7L 4QRPD 4XCYA 5FGBC 4Y89A 4DVBB 4BZ1L 1U58A 1Z9SA 4XPGH 1FBIL 4NQCA 4JM4L 4F7TA 4W70A 3SPVA 3GRWH 2DQUL 4L4VE 2DQTL 4X8JB 4YBQC 2YK1H 2HJLA 5DJ2B 2QJDA 2AXGA 2DBLL 4PJXE 1MQ8A 2XWBA 4Z7UF 5IROA 4IIQA 1CF8L 4L8SB 1SEBA 1QSEB 1WC7A 4F58L 1BFOB 1I9EA 3CXHK 4FQXA 4AG4H 1LO2H 5C0CE 1UVQA 1KELL 1R0AL 1BD2B 4P5TC 3LZFL 5F7WC 4XI5D 1WAAF 5F9OL 1FH5L 1XGTA 2X4UA 2HKHL 1ZA3B 4S1QL 2GJJA 2ESVD 5FB8A 3HI5L 3OR6A 3ARSA 4G7YH 4GAYB 4A6YB 4XP5H 1AXIB 1Y0LA 5D2NC 4JM2F 5DJZA 5BV7L 3T0XA 3HPJA 5KTEL 4U1GC 4DTGH 2Q20A 2V2XB 2F53B 1P2CA 4HUKB 4ETQB 4JZNA 4R9HA 1XIWC 3MMEB 4O58H 4QHMA 1HKFA 5SV4A 3H9SA 1XGUA 1OGTA 1HHIB 1X5LA 4K94C 3S5LG 3BKJH 1NFIB 4OFIA 5CD5D 5ADOH 3W11C 1I85C 3MSPA 3T4YB 4YDIL 1ZWIB 4NQED 3TWCL 3UDWC 3SGKC 4ELME 4H0GA 3S88H 4G42A 2JK5B 3KJ4B 3E1F1 1YEEH 5ALCH 1YDPB 2YD3A 4LOUC 4Y4HD 2VDKL 4URTB 2X4QA 1ND0A 2Z31A 2ZUYA 3LQAC 2Q6WB 4CW1B 4BH8B 2GJZA 2W07A 4KK6D 4G43B 5IMOB 3BZEA 5GS1C 4KROB 3TLRA 1OTSC 3EYSH 3ARUA 1P5UA 2DQIH 1LDPL 2HJKB 4TNWK 4H5SB 2SEBB 2DLFH 4YHOH 5GSVA 3BUYB 3KYMA 1MFEL 3LAFA 4X6BB 3IRZA 2XA8H 1OARL 3MGAA 4L4VA 4N0UB 3L5JA 1CDGA 2Y36L 4NQCD 1TTGA 3HZVB 3QUZB 3UYRH 5T3ZE 1C1EH 3T0BA 4PJXA 5TJWK 5KJRH 3QQ4A 4DKFH 4TSCH 4FFWD 2HLFD 5E0QA 2AP2A 3QAZC 3MLPA 1AR1D 3ZDZE 1NGZB 3F7YA 3EUUA 3KJ6H 5J6GA 5C0CA 5F7YC 1RUML 5BXFB 4FQXD 5ENWA 3BPNB 3FO1A 4D2NA 2ZCHL 1UB5A 5F3HA 1O5DT 4OJFH 4J7RA 4JRXE 5JDJA 1HH6B 1MCEA 3RIFF 4D8PA 1N5YL 1A6VL 1J88A 4EQ2A 2Y06L 1BBJA 3WHE1 4KJWC 3MLTB 1VFBB 5I1JL 3F8UB 1CS6A 1PY4A 1BREA 5IB3A 5A3ID 4WO4A 4JHWL 1Q1JH 3L7FA 3PF2A 5DI8A 4N8VG 2FH6A 1IGCL 2BK8A 2WLZA 4FP8L 1K4DA 1S7SB 5JPMA 4E5XA 5I1AB 3MRMA 5L8KB 1KOAA 3VXSE 3KPNB 3HAEG 3LQMA 4QY8A 4NM4L 5D7KE 1HEZB 3ARBC 3V0VA 5JMRA 5ADPH 4ELMA 5J1AB 3ZO0A 3ARWA 5BV7C 2DB8A 3I3EA 4AQOA 5CLTA 3H3BC 1V7NL 4DZ8A 5JIHA 4KUCF 1NGXA 5JLZA 4GXVL 3L5XL 5EWIL 2Z31D 5HDQH 1EUTA 1T0MB 1ADQL 3SCMD 4NHUA 1MWAB 3WKMH 3GHBH 5I30L 3N1FC 1VKXB 5C9JA 5I73C 4WEUD 4UMGA 4PV9A 4PJ7F 3C87A 1G7IB 1P7QA 3QT2A 1EUUA 2NTFB 5EBGA 3UJTH 1Y18B 4GW5A 1U8QA 2WIMA 1E28A 4GBXB 1RFDL 2I5YH 1I7UB 2UUDH 5FO8A 4V1DE 4L4VD 3OKEB 4EN3C 1KYOK 4GUPB 1S9YA 1IAKA 2D0FA 1CL7H 2PNDA 1PEZA 4CDHA 1A0QL 4OLXL 4PGDA 3V8OA 2UZIH 1AIFB 3SKMA 4HT1H 5SV3A 2D9CA 5C0CD 4Y0GA 5I0DA 5JW3L 5ACLA 1M6OA 1J1OL 4YE4L 4JRXA 2CO7B 2XFXB 2HVKB 5ICXB 2EE6A 2MQ0A 2P24B 1FNSL 2GYSA 3VE0A 2G2RA 3MNWA 3T2QA 4Y2OA 3VFOA 2XI9A 2VDMH 2CMRH 5JMOC 1CIDA 1C16B 3N50A 4WO4D 3MRNA 1FN4B 1OTUD 4UDTB 1VFMA 5EB9A 3VXSA 3U9UB 3RWDB 1INDH 3TIEB 5SWSB 1CDIA 3RNQB 4OLVL 1AR2A 4NQTA 2QQKH 4HMEA 1NDGB 2WSKA 4BYHA 2I9TB 3GSRA 3VRLF 1HHHB 4JM4H 5J11B 2HG5A 4I2XB 2A73A 2G5BB 3AMLA 2DQTH 4KQ3L 3SDDC 1K8DA 1X5ZA 4HIHA 3NH7L 4M7JH 5DGQA 2J5LB 4TQEH 1FVEB 2Y5EA 4X6EA 2LAAA 2EE9A 2FYYA 3EYUL 4U1KB 2ZZUT 3TNNB 1I8LA 5DD5H 1KB5B 1CI5A 3SE4C 1NPUA 3LZFH 4G8FB 2R2BB 4HWEH 3S3PA 3FB7B 1FH5H 1G7HB 1P7QD 4HCRA 3IDNB 3QXVA 2HKHH 5B38B 3MGOA 5DMGD 1H5BB 2H6PA 3D2UB 4M9PA 1I3RA 1SYVA 2V9TA 5DO2C 3DVIA 1MJJB 5BJTB 4NQXB 5T3ZD 3JWDH 1MCRA 3GKWH 1P6AB 2WM0A 4ZD3H 1TZIB 4HIXL 5FF6B 4Y4KD 4JZJA 2QKIA 3NCCB 1XF2A 1G9ML 2AK4E 2FJGA 2ZKHH 3O3BA 4P59H 4P3CH 5ID0B 2W60A 1JPTL 4UT6H 4G5ZL 2H45A 3V0WH 4JRXD 4G6AC 5K9JL 2AV1A 3UZVB 3G04A 4NO5B 4O5LL 2V7NA 4RFNC 2HMID 1GZQB 1UKQA 3RI5F 3QEHA 4Z78B 4Z76A 1I3VA 3IFLH 1F3DJ 5I75C 5JHLL 4PJ9A 1FO0L 4JREB 2MKLC 3IKKA 4M1GL 4UQ3B 3KYAA 2YBRB 4Q9BA 4LLQA 3CPLB 3MREB 3VXSD 4YBHA 3BP7B 5D7KD 4X4YA 4MSWA 1FJ1A 1JPGA 1ONQB 1BJ1H 3WNLA 2W0FB 3A6CL 5E9DE 2UV3A 4K9EL 4PJAF 4LASL 4X6CE 1ZT1A 4KMTL 4RFEA 4N9GA 1TZHA 3BGMA 1PG7L 3LKPA 1G9NL 1EZVY 2OK0L 3DMMB 4OAWA 3RGVA 3ZE0F 3BH8A 4GRWE 5CEZL 4GG6B 4ZS6D 4I1NB 1Z3GL 1S8DA 1ZSDA 3CIQA 4BFIA 3O6FC 4YIQA 5E00A 4I0PA 4MA8L 2W59A 1VADA 2A6KB 3RIFK 3RZWA 3BKYL 2KKQA 2HT2D 2IMNA 5GRVL 1KEGH 3ALPA 3CFJA 4PJ5B 1EHLH 3BKMH 2FHFA 5DD0H 1FDLL 2Y06H 4YWGL 4E42B 5L2JA 5IQ7L 5IFHL 3PV6B 2ICWA 5I1JH 2EXWD 3QCVH 3GSOA 3HLAA 3MRBA 4LCYA 4NC1E 4V1DD 1FGVL 1I3GH 4JQIL 5TDNA 3BVNA 2IGFH 3GMOA 3Q5OA 4GS7B 4OLYL 1BIHA 1IGCH 2O5ZH 2RB8A 4FP8H 2DM4A 3SKJH 2AK4A 4PG2A 3HUJA 1HXMB 3O6LH 1FCGA 4YDVB 4RQQB 4M00A 2DQJL 5FIEA 4LCWB 1QHOA 4ZMAT 4P4RB 4Z0XB 1JMZA 4LKCA 1U3YA 2J88L 1U42A 3VI3F 3VWJD 1LGVA 2NY5L 1R5VB 3TO2B 1YZZA 3VGEA 4HWZB 1XGRA 4K7PL 5LJYH 5EWIH 4GW1B 2Y72A 1E4WL 1G9MC 4MD0A 1AHWC 1CE6A 2CLRB 1S9XB 4PJ9D 4O2EA 4IHOB 5I30H 1IT9H 3VFWB 2V9RA 2GIYA 3GB7A 2BSRB 2VDOL 5D7SL 1Z0NA 4KKAC 5E9DA 2A6IA 2Z35A 1RUKH 2OCFD 3RY6C 3M8OH 3W9EB 3T4AA 1RFDH 1E4XH 2JJSA 4ODUA 1TFHA 5DHXB 1DBJH 2A83A 4OGYL 4OLZH 5IQ9B 1XAUA 1J8HB 2IEPA 3P11H 3RWEA 1CD0A 2P8LA 1D9KD 4FQIH 4LSUH 4RSVA 3RGVD 1AXTL 1OLZA 4OI8A 5DJXB 1LMKA 1MVUA 4G3YH 4I0PD 3DVNA 3LEYL 1WJ3A 4LKXA 4ODWA 4M6NL 3PDDA 1G9NC 3V79C 5JW4N 4HIJB 1P84J 1G0DA 1FNEB 3RL1B 3Q1SH 2W1NA 3VFUA 3I75B 4L5FH 5ESQA 4BZ2H 4UQ2A 1JYWA 2DI9A 5IEHB 3LB6D 5DD1L 3LDBB 5IF0A 2NY2D 5F8QC 2DD8L 1HHJB 4LNRA 3RKDD 2D7NA 2FL5B 2LTQB 4YDLB 2AK4D 1YEIH 1T7XA 4QHUA 2GSGA 1UM4L 4YC2B 1GGCL 2WWMC 1EVUA 5DJ8A 4GRMA 4HKBB 4PJXF 1VFAA 1DN0A 1A7RL 2X4TB 3K8MA 5CINH 4RMSA 1MJ7H 1WCQA 5D1ZA 5DDHA 1QFWI 3BFOA 2VITB 4U1LA 4WHTA 4C58B 1U8OA 3ZTJH 4N90E 4HUVB 3VFTB 3GBLA 4JRYA 4HLJA 1TCRB 1PQZB 5SWQB 1S7UA 3EOTL 3ARDB 2FZ3B 2DJSA 4I48A 1JNLH 3NZHL 4G8IA 1CFNB 2BVTA 1F42A 2NY5C 4BH7A 1KJVB 1TXKA 1RZGB 4UT9L 5E9DD 4O2FA 3OXSA 1F45A 1TQBC 1AFVH 3K3QA 4PRHE 4WU7A 4HX1B 4PJFE 2PYFB 2NY3C 1TJHL 2DJUA 1UM6L 1FNGA 2ED8A 4Y2DC 1HKLH 1IQWL 5HGAA 2DQHL 2NY0D 2YC1B 4ZFZB 2QADD 1NDMA 4M93C 1A1OA 2H1PH 3HG1B 3W81A 4HDIA 1TVBA 3CC5A 4ELMF 1A6ZA 4PJ8A 3S4SB 2H2SC 2OXHA 5AWNL 3HE6D 1DBML 2X6MA 1MAJA 4GAFB 4OBRA 3RI5K 5JXEA 5FO7A 4O5LH 1QFPA 1W72L 4U1JA 2ITDB 4LRNH 3KPLA 5LAXA 5JHLH 1FO0H 4OZHA 3SE3A 2MJWA 4M1GH 3S96B 1M71A 4HPOL 2K3TA 4HWBA 4RGMC 5IVOA 1GOHA 4PGBB 1WWCA 5GGRY 4KZEH 3GI8L 4U6HA 3QFDB 2NYYC 4JDZB 3CFKB 1IGJA 1DEEB 2PXYC 3KNBB 4G6FB 4U6YB 5HPMB 3MRQA 5I19L 1L0XA 1XH3B 1NAMB 3WXVH 1OGAB 5F88A 1NAKH 1QKZH 3BN3B 3CDGB 1S7RB 4KMTH 1MI5B 2VN4A 1DFBH 3U36B 3ZDZF 2DKSA 1NH6A 3GMNB 4XX1G 4MHHI 4ZPVA 3AS1A 3VH8B 3X13B 5DHVH 4JHAH 4LLMB 3ARFC 3UTQA 4MHHG 5H37G 3GBML 3MLRH 3AM8C 4HQQL 4YFEA 1F6FB 2UVFA 5BQ7A 1T22A 3SDAB 3SO3C 3D0LA 2XWJB 4P9ML 3TBVB 4S1DD 4NOBA 5IFJB 1JNNH 3AU1A 3DO7B 1Z9OA 2APXA 3WLWC 5IVZA 5D7JC 5CJXA 4UOW0 5B39G 3VGHA 3DV6B 3RX7A 4X5XB 1RK1B 7CGTA 4ONOA 3C60B 2OR8A 2RFXB 3OJMB 3TPUB 4LHJB 1B0GB 2DM3A 5T1MB 4H1LB 1JIBA 4MGXA 3ULSA 1BQUA 2VWEC 3P4NB 3NBNA 1RZJC 3BE1L 4YQXL 1J1XH 3UJIH 4LF3A 5ICYA 3SE8L 3I6KA 1H8NA 4FFYL 2C4FU 4I4WB 4YO0A 4GSDH 1G9EA 5EORH 2JJTC 5EN2A 4PJ8D 3VG0L 3SDCD 3CFEB 1KCVH 3AC0A 4DVBA 3VDBA 5IFAL 2BFVL 2GFBA 5JXED 5HTSA 4K7PH 2B4CL 4UINH 1ZLVK 3MODL 1OAUH 4PJCE 3SO5A 1QRKA 1YEJH 5FYKH 1NBZB 4P2RE 5DJ2A 1F4XL 2W9EH 3FO0H 1ZHBB 5EBMA 1T03H 4D0DB 3UTSB 1OSPL 4L8SA 5EZOL 3ZTNL 1TNMA 1A2YB 5D7SH 1IEBB 1LD9B 4E41B 1X7QB 4N0YL 5FOBB 2O61A 4OCXL 3LN5A 3BEWA 1EHXA 2O5XL 1UJ3C 4LCCC 3FB6A 3TN0A 1SVCP 4BFGA 1IGML 4R97C 5A2IH 3I3DA 1F5WA 4JY6B 3HI1B 1YYLL 1ZTXH 4N90D 4NZUH 3FO9A 4M5YH 4PIRF 4A6YA 2PO6B 5F7MC 1SJEA 3Q6FB 2V2XA 1RJLA 2F53A 5I6XB 3AUVA 3CFBB 1E27A 3KXFE 3MMEA 2EEDA 3IGAA 1YPZB 2D31A 4TYUA 1RY7B 3NMEA 3MOAL 1HHIA 4TTDD 4PS4H 5DEFB 1AP2A 4M6NH 1TPXC 2F8OA 4FQCL 4HKJB 2VQ1B 1GGIH 1MCIA 1V8HA 1NFIA 5I74B 1NMBL 5DC0A 5TQ2L 1BWWA 2BOBA 3RPIB 4PRHD 1EBPA 2BCKB 2UWEE 4UNVA 1HI6A 4HBCH 1KJ2B 2AW2A 3T4YA 1G6VK 2YKLL 1YQ2A 3T3PE 5DD1H 1AGFA 2JK5A 3RWIB 1X5FA 2VLRE 2FSEB 2BY0A 3L5HA 5EBWB 1YDPA 5I71C 4P2OB 3WFBL 3IJSA 5FYJH 4LU5H 1UH2A 4BH8A 4HK3J 4TVPE 5FUCC 3UEZA 2J2ZA 2Z8VC 1JTPA 3MJ6A 4UIKL 3TO4D 5IMOA 1UM4H 1QA9B 4KHTL 2P46B 1WBXA 2XZAH 4JFDB 1J1PL 1T6WA 1MJ8L 4OCSH 1A7RH 4XB7A 1A47A 2SEBA 2ADIB 3GMMB 3ZKXB 1QACA 2NXZD 4NFCA 3C5ZB 2FX8L 2YPVH 2BRRH 3QUXB 2AI0L 4PJCA 1I7RB 2X4RB 2AVGA 3HZVA 4YFLF 2VL5A 3QHZL 4JO3H 2F58L 1FFOB 2VDNH 1AJ7L 3BYTA 4CAGA 4FMKA 3GBNL 2ZUSA 2BJMH 5EFIA 3EOTH 1NGZA 4AK1A 1RZJH 4L29A 5E03A 1EFQA 1CL7I 1WTGT 3NZHH 3MUGB 4OCLC 1A6UL 4P46C 2FO1A 1RUQH 5BXFA 1KUMA 4C4KT 4TUKH 4MNQE 1PX4A 4HXAH 4WDIB 1HYSD 5BS0E 2XZZA 2YEZB 1HH6A 3N85H 5I16A 3TN0D 4X98B 1P84K 2F9BT 3LS4H 4S0SD 5FYKU 2AV7B 3JVGC 5ID1A 3MLTA 1VFBA 4F7MB 3GSXA 4DW2H 1Q72H 4NPYB 4M48L 3Q5TA 3KXFA 5D6CA 1H8SA 3KG5A 4UBDD 2CDFB 1UACH 5HHXL 1CR9L 1S7SA 1DP0A 4FQJL 9CGTA 3DJ9A 5KSAC 2ZSVB 4FZEH 2ZSWA 1HQ4B 1T5XB 3EJYC 4HS8H 3V5DA 1HEZA 1I8IB 1EVTC 4CBPA 2NY1C 2UWEA 5LWYL 3L9RB 2JB5L 4N8PA 1GSMA 3MRFA 3VFPB 3ZE1E 4PRDB 2VLRA 3OPZH 4U3XA 2PETA 2H32A 4JHZA 4RNRA 4TSBL 1UXSA 5IMLA 5F1KC 5FV2A 1FZMB 3WHXB 1XCQB 3GI8H 4JQVC 4JKMA 1T0MA 3HN3A 4QHKI 4QYOB 1OPGL 4U4BA 4X6CF 5F7NC 3LEXB 5KVFL 2D7OA 1VKXA 1U3HB 3R06A 5J8OA 1G7IA 3H42H 1N0XL 1XGPB 1RZFH 4U6TA 3QA3A 3RWFB 1VFUA 2FR4B 5I1LA 2R2CA 4OZFH 43C9B 1DVFB 4GRWF 1P69B 4PP2B 4GBXA 3L3OB 4X7TB 1U41A 4L9LA 5C0RH 3L3HB 1J10A 3L95B 1I7UA 5FYJU 5CWSB 1RIVL 4ZTOL 1O7VA 2FB4L 4GUPA 3M1BA 3R8BB 3TJHC 4M7ZC 4P2RD 1GGTA 2X09A 3BO8A 4DK3A 1IBGH 4LSTH 4CNIB 3LKSA 3VWKA 3LMJH 2WQRA 1AIFA 4HIIB 5E6IA 1F2QA 3TV3L 2X40A 4W4NA 1S7XB 2XIDA 2GSIB 3HE7D 4MNQA 5IESL 3JTSA 5DMIH 4HV8A 3MROA 3QIUC 3OB0H 2Z93B 4OIAA 5BS0A 4XNYH 3UZEA 2XFXA 2XKUA 2Z91B 4MA1C 4QT5B 4ODSH 5ICXA 4OGXL 1MCBA 1A9BA 3BYYA 2XPGA 2P24A 4HFUL 5T1DH 1SJVA 1P53A 4OLEA 2CPCA 3QHTC 5BMFL 1JRHH 1WBZB 15C8H 3KXFD 1UA6H 3SE8H 4UDTA 4NQSA 4JDVB 4LCUB 4RDQF 2J8OA 1JGUL 1IAIL 2W38A 1WISA 1CGWA 4HUWA 3TNMB 5IFAH 5EOTA 2VN7A 5J0BA 5LGHL 1QSZA 3MODH 3PWNA 5D1XD 5D72L 3BZFA 1JUFB 5HYSG 4XXDB 1JHTB 4WNQB 1WWBX 1A3RL 1N59B 2Z8SA 5EU4B 1NCBL 2VLRD 2X70B 4JM2C 4RAVA 1F4XH 4BSVA 3QI9C 4Y5XC 3QXDA 3LKRB 1P4BL 2P8MB 4TVPD 1ZGLM 5E94B 2DQEH 5FUOL 4AQ1B 3ZKQD 2BC4B 3TNNA 1T1XB 2AQ3A 3S5LB 1WZMA 1HINL 4IMLA 4NZDA 2R2BA 2EDEA 4FHBD 3BT2H 3FB7A 4IRZL 1G7HA 5IBUG 3IDNA 4LVNB 5A2KH 3O3DB 5B38A 5C70A 4KKLD 5HHVH 4ZNEE 1H5BA 1FFPB 3D2UA 2W0LA 5IMKB 3TZVD 1ED3B 3V4PH 2QLVB 4NQVB 4NQXA 5GRJH 5E7FA 4Y5VC 1AC6A 4LQFL 5AD0A 2ZG1A 1S78D 3ULUE 3DSFL 2Q8BH 3RVTD 1JI1A 3VWKD 3S98A 5E6ID 2HT4D 1JF1B 4HEPG 1WK0A 4MNQD 4YPJA 1I9JL 1PSKL 3DTXB 1S7TA 1F4YH 1X4ZA 5BS0D 4BSWA 2AQ1A 5JIPA 4YK4B 4NO5A 4QRRE 5J3HD 2OTUB 1PY9A 3B9DA 4GAGL 5FDWA 2V7HA 5KSVB 4ALAH 2DLGA 1GZQA 3H7BB 4Z5RB 4OTXL 4KKBD 1AQDB 5KVEH 2DYPA 4NT6B 1N64L 5KOMC 4Q97A 1I7TB 2ITCA 3OKNB 1Q38A 2JJWA 4XHJC 4WEBL 1II4E 1NLDH 2RGSA 3CPLA 1OQOA 1H3WM 5DR5H 2C4FT 4QOKB 1MJ8H 2B39A 2ZPKH 4HS3B 2X89A 3MXWL 4IM8A 2W0FA 1A7OL 1MFCL 1ZLUH 1YNKH 3EW3B 4XNXH 2CKBB 1YN6B 5KOVC 1J8KA 3V4UL 2H41A 1CFSA 5DURB 1KV3A 1NGWB 3DMMA 5FCSH 1F8TH 1AJ7H 4N8VB 3EFDL 2C1OB 5C09B 2BVYA 3OKOA 4XPTL 5CKAA 2E7MA 3HAEB 4PJFF 2A6KA 2M1KA 1R3JB 5DT1H 1KPUB 4PJ5A 5GGQL 4ZNEA 1NL0L 1ZLSH 2OL3B 6FABH 3PP3K 3PV6A 1Q94B 1R3IL 3G5YB 5CCKH 3A0OA 3PWUB 4OIBA 1EAPA 1C5BH 3X3FH 1GC1L 5AYUH 3TBTB 1ZANL 2OMBA 5HGBB 4U6XA 2ENSA 5HHXH 1CR9H 3OJDA 4CJ1A 3OF6D 4HF5L 4ODVH 1QSFB 1L6ZA 2KPNA 1ITCA 4HC1L 5EO1B 3EJZC 4RQQA 1P9MC 4XMLL 4P48A 4LCWA 3TH2T 4OF8A 2AJ3A 1SMAA 3KPQB 2R0WH 4QRRA 4P9HL 3P77B 2VSDA 2FJFB 3MXVL 4KAQL 3HS0B 4NOFA 3RIAK 3WBDA 1X5YA 4HWZA 1JGDB 2Z9TA 3WN5B 4PJGE 1Y6MR 1IAIM 4R3SB 1KEMH 1GCFA 4U1NA 1N5AB 3OAYK 2X1XR 3QNYB 2DYPD 5DVKA 4IHOA 4WW2A 1CVRA 5D1QA 3QZWA 2IH1B 1VGKB 5DJ0B 2BSRA 5IHUL 5AUMA 4U6VH 5DD6A 2FJHB 1M05B 3GMLB 2X89D 3BQUC 3HCVA 3W9EA 3RVWD 2AXFB 5J1SC 2DQDL 3KYOB 4CVZB 4JB9L 4ZTOH 1G7QB 2XTJE 1XR9B 2FBJL 3O11B 5IQ9A 1C5CH 1N6QL 4HEME 2AERT 2QL1A 3TV3H 4YJZL 5I17B 5F1OB 5B3JE 5B21A 4R4FL 5I8EA 1D5IL 3GSNL 4GFTB 3RWGB 2A74A 3U7YL 3MRRB 5C0JB 1RPQA 1A1NA 1U6AL 3BW9A 5DK0A 1XT5A 1FNEA 4QHNB 4Y5YB 5JORB 3CLFL 2AJSH 1I1YA 1BQLL 2MCG1 2LE9A 3C2AH 2IPTL 3HMWL 2IMMA 3D1MC 1CLYL 5FYLH 2OX5A 4EUPG 1U8NB 3CMOH 2LU3A 5A16A 4R2GD 3QEQE 5E2WL 3TBSB 4RX4D 5EU6E 4PJCF 4JKKA 2E7CA 2XQYG 3NZ8B 4UILL 1GC1C 4MMZC 1EFXA 1RU9L 4QRRD 4LRIC 2X4TA 5IG7A 2VZ1A 5IGXL 1NCBH 2WBJD 2VITA 3P0VH 4KK9D 4Y16C 1SVZA 3ZHLA 3H9HA 4ZDHA 4JZOA 4HUVA 4CVXB 3C9NB 4XBPB 2VXQL 4OB5L 2OJEB 4OZIE 1G7LB 3GJFH 3OAUL 1DBKH 1IEAB 2XXMB 3MLZL 4Q6IA 3QXAB 5I1KL 5D1QD 2IQAB 2PTUA 1SY6L 1RZIB 2FZ3A 4P2QB 2E8YA 5CHNA 3BWAB 5JIIA 1TIUA 4UI2A 5EZLB 1NCAH 4Q9RH 3TT1L 4KPHL 1IZKA 5D96B 2FX9L 3CCHB 1V3JA 2YPLE 4TNVF 2DQFB 4OGAD 3R1GH 4MVBD 1HSBB 2J3SA 4UAOC 3P30L 3BD4A 3DSFH 3FL7A 5GS2D 1SBSL 1UB6B 1Y6NR 3IFPB 3DIFB 4P5MB 4XI5C 2N7AA 2UWEF 5BW7A 2Y4SA 3T3PF 4DQOL 3OTTA 5J89A 3S4SA 4CDGC 3MNVA 3TJEH 5FA3B 3T8XB 1U8MB 4NN7C 4RCAA 4N0RA 5TQ0L 5L88H 2EO9A 1N3NB 1Y6KR 5EUKB 3TYGH 3RJQB 4R4BB 1KIQB 4W4OC 2WQ8A 5IK3B 3I9GL 3FN0H 5DVLA 2HA1A 3S96A 2CXGA 1TETH 1IGIL 5HI4D 3TCLB 1JYXA 1GVIA 1JHKL 35C8L 4PGBA 1XF1A 4JDZA 3CFKA 1NCDL 3QEQA 3UTSE 5EU6A 1CDBA 5HPMA 1NCUA 4UV7L 3DGGB 3QWOB 5CZXC 5E8PB 3WSQH 4HKZA 4Y4HC 2VDLH 5MERA 3PV7A 1BZ9B 5E5MB 1DR9A 1RUAH 1S7RA 1MI5A 1EFXD 4OFYA 3EDKA 3VXUB 4KK6C 3U36A 4RIRB 1KN2L 4DEPC 5CEYA 1ZGLP 4ORZC 1F6AB 5J12B 3VH8A 1JGEA 3EFDH 7FABH 1KNOB 1QLFB 2PR4H 4KY1L 3B3IB 1KCRH 4OZIA 3C08L 4LVHC 5LBSL 3RTQB 5TE6L 5KW9L 3L3IB 2X7LB 3QCTL 3SDAA 4J3VA 1XMWA 5FKAA 5IFJA 5C2BL 4K71B 4MDJB 3T04D 2VLKE 4FFWC 4Y1AB 2YPLA 2HLFC 4MZ2A 1AR1C 3CVHL 5LVEA 2ICEB 3C60A 5IROC 2XTJD 4IIQC 1PG7W 3QQ9C 5DJAB 2RFXA 4R96B 3TPUA 5MEPB 2W65B 4LNVA 1B0GA 2Z92A 1OF2B 5JOEA 4H1LA 4NC2B 4UU9B 1SMOA 2EDYA 4FQXC 4G80B 2R8SH 1X5JA 4L3CB 4JAMB 5C9KA 4WUKH 5DSCB 4OM0H 4HC1H 2IADA 3NFNA 4ZPTB 1PD6A 3EO0B 4OIIH 3ZE1F 4I4WA 1P6FA 4NDMA 3QDHA 4OZGB 1DTUA 4GW4B 2BMKA 5FGCB 1BAFL 4DAGH 5DK2B 3MXVH 5A3IC 4K3JH 4MWFB 3V7AG 5TDOB 2YUZA 3UO1H 3B9VA 4KTDH 3E3QE 1D5ZB 3C5SB 5F44A 1NGQH 1NBZA 4OF7A 1LK2B 5F71A 3NTCH 1U91A 5DGRA 4MAYA 4D0DA 1UADC 5C0DB 3N9GH 3UTSA 1A2YA 4JG1L 4ODXB 3QEQD 1LD9A 3TESA 3GIZL 1SEQL 5EU6D 4X7SL 1MFBL 4X83A 2I9LB 3WIIL 1DQDL 2CRIA 1JGLH 4I3RL 1JGVL 3U0TB 5T5NG 2Z31C 4MA3B 4LSPH 1FSKC 3PQYB 5T3ZL 1ZT4A 4OFYD 1BMGA 3W2DH 3THML 5L2KE 1X6NA 3E0GA 4JY6A 5FCUH 3VDCA 5JXAH 4HS6B 3NA9H 4HSQA 4L3EB 4R0LA 5EZJA 2VISB 4HUNB 2PO6A 2MPAH 2I07A 1QBAA 4P23B 1QVOB 1BZ7B 1T83A 1K6QL 3CFBA 5D8JH 4X6DB 3E8UH 1N26A 4XPFH 1WFTA 4XWOD 2R29H 2CDGA 4P5TD 3S36L 1SYSB 4NHCH 1YC7A 5AG9A 1UXWA 2R2HB 5ITFB 3OMZA 3O3AA 4HKJA 4W6YB 1DJSA 1TQCB 2NLJB 1XF3B 2ED9A 4JCLA 4LPWA 2YPLD 1MCKA 3RPIA 1CGYA 4WU5A 3WFCL 1UCBH 4PJIE 1BQLH 4YXKL 2AABL 3C60D 4WHDA 3STLA 3RWIA 2X4NA 2FSEA 4PGEB 4F7CA 5EO0B 5EBWA 3QNXB 1CLYH 5DRNB 3QDGE 4CVUA 5BO1H 4KKNA 2OP4L 3F5WB 4XNQA 3E6FB 3VFNB 3MLXH 4FQ2H 2FGZA 3P73A 5AAMA 1VFOA 2GJ6E 2W0KA 4E0RB 4JFZL 3GI9H 3ZKND 4FOMA 4POYA 3WJJC 1T0NA 3EOYG 4QTIH 1NUDA 2BNQB 4GQ9L 4WO4C 4YHPA 2R56H 3PXJA 1OTUC 2DQCL 3IDIB 5F7EL 1QLEH 1R3HB 2FWOA 1HCVA 1MVFA 3BIBX 3VRIA 4M7KH 3MRHB 2VXQH 2WV3A 4MDIB 5IIEA 1QYGL 1DLHB 3OAUH 1JF5A 4JFPB 1ZKAA 5C6PB 4MAYD 5I1DB 3UTSD 3O2VH 2NW2B 2BNRB 5DLML 3MRJA 3MUGA 2VDPL 4HCRL 2APWA 1FZJA 1UEMA 4XP6L 4KPHH 4N1EA 1OD7A 4U2ZA 5KN5B 1A6WH 2OTWB 3BD3A 4NZJA 4ZQKB 3CFCL 3CXDL 5E99L 3ULUF 2OZ4H 1Q0XH 4XNZB 4F57H 3VCLA 1OAXL 4NKMB 1RUPH 4F7MA 2A0LD 2X1OA 4D0BB 4G9DB 1BM3L 3ILQD 1NSNH 4DFHA 2ZUWA 1IC5L 1KULA 4ZUTA 2CDFA 4K7PY 1A4JB 3GJEA 1XEDA 3D0VA 3UYPA 5DMGC 4JFEE 4WY7H 4FNLH 4G6JL 5I9QC 3GM8A 4LHUD 2OR9L 4LVOB 2VLKD 4QXWA 1G1YA 3T1WA 1MHCB 1U8HB 1YY8A 1F4WL 4PJIA 3GSVB 4Y4KC 2WP3T 2VTFA 4WW2F 3C09C 5DA0B 4BQBA 4XAWL 4ZYKA 1U8PA 3STBA 3ARGB 4KTYA 1CXKA 2E7LA 1FZMA 1JHKH 35C8H 2O5YL 4S1RH 4RAHA 5D70H 3PWVB 1RVFL 3EYFA 4E9LA 1IC7H 3LEXA 3LIZH 2G5RA 1U3HA 2BVPA 3A67L 4OCWH 2HMIC 4RAUB 1YJDH 4Z0BH 5B39B 2ZUQC 3LY6A 1E6JL 1PDKA 4OF0A 4UV4L 2V5YA 2WUBH 1YUHA 1KTLB 3BSZL 3O3EB 1FV1A 2FR4A 4F2MB 1DVFA 3MBEB 4PP2A 3L3OA 4X7TA 3BGAA 4MB5A 5C07B 3S35H 3O4OB 3L95A 1EGJH 3C8KB 5CWSA 4ZUUB 1I7ZB 1OHQA 5J06A 3IXAB 4JO1L 4OQTA 3QUYB 5TPWH 1Z5LB 4PPTA 4YHKH 3WCYA 4X6FA 3QUKA 3QCTH 4OT1L 4LDLB 4XGZB 2GQHA 2UYLB 4FG6C 4HIIA 2OLDA 1HE7A 4F7EB 1UM5H 2OM5A 2GTZB 3KAAA 2AGJL 1S7XA 5JA9A 1F97A 2J8UE 2MFNA 3T0EB 4YHYB 3RP1A 1P7KB 1U8JA 4YHIB 3T65B 4HMCA 4XC3L 2Z91A 3QIBD 1I8KB 2DL9A 1KBGL 4PRBB 5L2KD 2XT1B 3AB0B 5KAQF 1I8LC 1N4XH 2HT2C 3OGCA 5IBTH 3RJDA 4JFEA 1BX2A 4JDVA 1A1MA 3Q6GL 2EXWC 2R1XB 3CD4A 1BAFH 1LWRA 4PJGF 1C7TA 1YEGH 3EBAA 2PN5A 4ZAKA 2GT9A 2BVOB 4WFFE 4XNUH 2FHBA 3TNMA 3MTRA 2ADJA 4ZXBB 1G84A 4OSUH 4AIOA 4ODBD 4ZUWA 3QH3A 1LP9E 4YHNA 3VGGA 3ZSSA 1MH5B 1R3KA 4JZJC 4WNQA 5KSUB 1A6AA 1I1AA 1CFTA 4TUJB 5HHPB 3HRZB 3SKNA 3ROLB 3ETBF 2P8PB 3MYZA 2P8MA 1ZAGA 3FTGB 3H3KA 4JG1H 4JY4B 1T1XA 4X9IA 1BVLB 2BRQA 5BRZE 1M7DA 3S5LA 2DMCA 2GJ6D 2E27L 4HW6A 3MRDB 3L5WA 4FQQB 4UNUA 1EHAA 4PJ9C 4PLNC 1FFPA 4AIZA 5F9WC 3CH1A 5GSRB 5EZIH 5B3JF 4M6ML 5IMKA 1JI2A 3DETD 4P99A 1OLLA 5F89B 1G6RB 3LEVL 1TZGL 3O45B 2VUOA 3HRPA 4PRAB 4CUCA 5C08E 3MCKA 4FFVD 1KPRA 4NWUL 2J8UA 5D2NB 5FO9B 4X5LA 1JF1A 3BDYL 4U1GB 5DUMH 2YUVA 1D9KC 3DTXA 5ISZB 3SGEH 3RGVC 1XIWB 1J87A 3BPOC 3FFDB 3PHQA 4YXKH 2OTUA 3MRLA 2XA3A 4DVRH 1UT9A 1PAMA 3ARVA 1JV5B 3GNML 1A3LL 3D39E 2VLLA 3H7BA 4I0PC 4Z5RA 2QHRL 3B6SB 3K8KA 1AQDA 5C0GB 5FDYA 4NGHL 1I7TA 2MHAB 4JANA 4HJGB 1J0JA 1F3JB 2VL4A 2DICA 2QSQA 3KPRB 4DOHB 4APQA 4GKSB 4JFED 1FGNH 5KSBB 5C0FB 1DEDA 5CSZB 3IJYB 5HGDB 5IBLC 5I15L 5L9DL 1IKFL 3LB6C 4K3EH 4LDEB 1FP5A 4ZAKD 5C0AE 1PVHA 2NY2C 1WBYB 1LP9A 1VERA 4U1IB 3CVIL 4B0MM 1W8OA 3SQOL 2CKBA 5GS1B 2DQCH 4OZIF 4QXGL 2DWDB 1CLZL 2NX5E 3RKDC 5HYJE 1F02I 3KDMB 3NIFE 5F1IB 3UBXI 5IHZB 1I1AD 1QYGH 2K9UA 1NGWA 2IQ9L 3V9FA 3IU4H 4N8VA 5DZNA 3UBXG 2QQNL 5C09A 1GIGH 2F8XC 2EDRA 3RU8H 4D0CB 2HRPL 4LBEA 5DLMH 4LFHG 1WZ1H 2FATH 1T4KA 1LO0H 1WWAX 2AEPL 1IAOB 1R3JA 1PYWB 4TRPL 5E99H 1MCCA 5FV1L 4GMSH 3GMQB 3QAZB 5J6HA 3K1DA 4HZAA 4OCRL 3HPLA 3P9MB 2F15A 1OAXH 1RI8A 4Z7WE 1A02N 3G5YA 4U31A 4QTHA 1ACYL 1NGPH 5L6YL 1G7JB 3TH4T 2VXSL 4YH6A 1QRNE 5HVHC 3IF1A 1SM3H 4FZ8L 4AL8L 1YNLL 1FAKT 3E2HB 5C08A 4PB0H 4R26H 5H35A 3HNVL 4G6JH 2XXCB 2JJSC 5EO1A 2OR9H 2EDOA 2IANB 1MCPH 1UWXK 4TOYL 4JFOA 1IAII 1JWMA 5DHVA 3KPQA 1YEDA 5LKNA 2QADC 1MCWM 2XN9B 3HS0A 4XAWH 3D39A 1ZLWK 3WN5A 3VD7A 2HRLA 3ARBB 3V6ZA 4HWBL 5D71H 1N5AA 4PLJD 1MNUH 3QNYA 3NABL 4F3FA 5BV7B 2D9QB 4FXKA 4HBQA 4NNPL 5I1EL 1PJ9A 5MEQA 3F12A 1VGKA 4APQD 1PG7X 3VD9A 4F9PA 4U1SB 5ELIA 1FFQA 1E6JH 2EIDA 5E2TL 4WFFD 2FJHA 3SHSA 3GMLA 5EOQL 2DTMH 3ECBB 4PTTA 2NX5A 1RSFA 5DC4B 1OM3L 3KYOA 2RCSL 4CVZA 3GK8L 4LSSL 5FYJE 2V17H 3TVMB 1G7QA 3STZA 3O11A 4AMKL 2WANA 1FNHA 2CGRH 4BJLA 3OKMB 1PW3A 3RL2B 4Q2ZB 4OT1H 4RGNE 1KJ3L 1MHPL 3ZDXE 3EZJB 1G7MA 3FOLB 5ERWB 5FHBH 3AAZA 3O8XA 2EDBA 2AGJH 2BVEA 3VMOA 4G8GE 5BRZD 2R2EB 4EN3B 1BJ1J 4LARL 3MX0A 2W9DH 5AZ2H 3F58H 4XC3H 3I50H 1ZVSB 5B8CA 1S9WA 2CIKB 3BH9A 1WICA 3P4MA 5C0JA 5HYSB 1KBGH 1IM3B 4QO1A 1NFDE 5ANMB 1KLFA 4J3WA 1DL7H 1RQ5A 3BPCB 1NANH 4QHNA 4Y19E 5FOJA 1WSST 1EJOH 5DVOA 3TA3A 2NZIA 4S1DC 1JF6A 3WXWH 1IQDA 3DX6B 4P0DA 4HAGA 3RWJB 5C7XH 3D85D 3U4BL 4JFFE 4P4KA 2F5AL 3VU2A 5C08D 5FFLA 1MIML 3VGFA 5EO9B 3MRKB 1MLBA 2ATPB 1LEKB 2KL6A 5IBUB 3ROOB 2FDBP 3FQRB 4HXBH 5CIPB 2VDQL 1W0YT 3K1KC 3MC0A 5L8JB 3HNTH 2B2XH 1WF5A 3BEVB 1RJZB 4F15B 3D39D 4EI6B 3HMXA 4CVXA 2NR6D 4HLZG 2FEEL 3C9NA 4XBPA 3U6RA 4PJ8C 1CYGA 3SDCC 1T1ZB 3HZYB 1MRFH 1M7IA 4UNTA 1G7LA 2JIXA 5INDB 5JXEC 3PUCA 3QXAA 3SDDB 1ETZB 2IQAA 2NY4C 1RZIA 1BJ8A 3BWAA 4MAUL 1WEJH 5C86A 4WTZG 3PDOA 4PRPE 5C0AD 3J8F7 4LHQB 3SE3C 1FZKA 1Q0YL 2NX5D 1GPOH 4CKVX 5HYJD 3N1QC 3S37X 4F8QA 1HSBA 1VESA 4OCYH 3LEVH 2DQGL 4ONFL 2GI7A 4FABH 3QXUA 4K8RH 1A6TB 5J13C 5CUSL 1H0DA 2Q8AH 5HYEA 1UB6A 3IFPA 5D2LE 1CFQA 2YD4A 5AZEH 1G1CA 3O8XD 1RIUL 2XNAB 3H0TB 4PJIF 3WIHH 4MD5B 1OB1B 4LPTA 4GKNB 2ED7A 1NFDA 4OLWL 1ZV5A 1U8MA 3C6LA 3WE6A 2C1PB 3JUZA 1DANU 1DZBA 5EUKA 5GISH 5IHBA 4R4BA 1KIQA 1AQKH 5GRXG 3GNMH 4GRLA 1K5NB 5DQ9B 5IK3A 3TA3D 1U36A 4TTDC 1MCQA 1OAYH 3LRSB 4NGHH 4JFFA 5BZDA 4LDOB 3IFOA 4XCNB 4P4KD 3BZ4A 3KYKH 3R0NA 5CJXC 3U9PL 1FYTE 4RFNB 1A4KA 4O4YL 2X4OA 3FO2A 1FAIH 3P0YH 3DGGA 5E8PA 1NLBH 1F58L 4JPVH 5E5MA 4QXGH 3L3DB 3NCJH 4G6MH 4BA8A 1OW0C 4Z8FL 3VXUA 4XT1C 4RIRA 2EDWA 1QSVA 1RMFH 2EYSB 3PGFH 2R9HD 1VPOH 2Y1VA 5IMMB 2QQNH 1KTDB 4LLVA 1KPVB 2XYCA 1FL5A 1QLFA 2NYYD 3MOQA 1P7HL 2PXYD 3SJVE 3RTQA 2NXZC 3ZDYE 2X44D 2DM7A 3PWLA 3LH2L 3ES6B 4X6DE 1AO7E 1LK3L 2JIXD 3ZSTA 2VXUL 4TUOB 3E6HB 3EOAB 4BQ9A 5CP7A 4X7FC 4FA8A 1W0VB 5D7LE 4QRQB 4U1MB 5B3NA 4U0QB 1FL3B 3RWHA 1BEYL 2R0KL 5FYJD 4AM0B 1HOCB 2UUDK 4L8SC 4PRIB 1S7QB 4R96A 4AL8H 5MEPA 5E2UH 4MXWL 1R24B 4QRTA 4G8EA 4RGND 5HXMA 4HUUB 4Q58C 3T09A 1HYSC 2ZOKA 1OSZA 5DSCA 3OKYA 3BRDA 3MLSH 4C56B 4PJDB 1MHHB 4OZFA 4G8GD 4MXVE 3TN0C 2BVQB 1CD1B 4IOFD 3WFDL 3G6DH 3FB8A 4NYLB 4OZGA 2ARJA 5MENE 1X6LA 3PL6A 2ATKB 3NCYP 2R4SH 4MWFA 1LILA 4Z7VB 1ZK9A 3C6LD 4Y19D 5TDOA 1AD9A 5IT2L 4UBDC 4NCC2 4M43L 4G9FB 1U92B 2HT3D 3FFCE 4M62L 4ETYA 5HGHB 2DIBA 4GRLD 1T2QL 4TVPL 4JE4B 1RZKC 2C3VA 3VXRE 2D7TL 4OFPA 4JFFD 5DUBA 1LK2A 3RNKB 4NNPH 4OFKA 4HGWB 1FYTA 1HN1A 3DV4B 1TJGL 3FAWA 2GAZB 2EH8L 1VEPA 5MP6H 5DTFB 5E95B 3BIKB 4ODXA 3CLEH 5EOQH 1DDHA 4ODTH 1AHWB 4DKEL 1PKQE 3OHXB 3IDYC 5LGKA 2A9ML 2ZCLH 5HI5D 2VXTL 4JKPL 4N0CD 3DI2B 3BDBA 4MA3A 1MLCB 1CLOH 3DPBA 2FECL 4HS6A 2XKNB 2CRMA 1MHPH 4L3EA 2J8UF 2VISA 3OAZH 3QPXL 4WI7A 3SJVA 3B8SA 4I18A 4FQHB 4N5UA 1KFAH 4YNYB 1CICA 5TDPA 4KH2A 1SJHA 1FO0B 4H8WL 1AO7A 4X6DA 3O81A 4K3DH 4LLUB 4DGVL 1SYSA 2G60H 1MEXH 1MCHA 2HFEB 5D7LA 4PRPD 2JELL 5E8EA 4K2UL 2XZCH 2NLJA 3G5VB 5AG8A 4I13B 3FMGH 4XPHH 2F19H 2XRAH 2F54E 4W6WB 4XX1E 3L3JA 3IDJA 1DLFH 4PGEA 5EO0A 5BZWA 3WIFB 5ACZA 5DEGA 1JZ8A 2HTLD 4IDJH 4I9WE 3CSYB 1AH1A 4NQUA 4P2CG 3MV9E 1KB9J 1LP9F 3E6FA 3VFNA 2BOCB 5IVXB 3CFDA 1E4KA 1ORQB 4P5KA 5CGYC 4XBEL 1I1FB 3REWB 5MENA 3O6KH 2B1HL 4QLRA 2BNQA 3PL6D 5GGUB 3FFCA 5F7LB 1NCCL 2B0SL 4KJYB 4PBWD 3K7UA 1IILE 2EC9U 3K0WA 3FT3A 3RWCA 5JZ7D 1R3HA 1EA9C 3X3GL 5SX5H 3VXRA 1QR1B 1MIEH 1UWEH 3MRHA 4MDIA 4CU6A 1ZE3C 2J4WH 4X80L 3MRPB 4WHYG 2EH7H 4JFPA 4YGAB 2NQCA 1FYTD 1YQVL 1LEGB 2Y07H 2BNRA 3OL2A 3G6JB 1TVHB 3NCEB 1PKQA 3BOVA 1JNHB 3BGFC 5KN5A 4ZQKA 4OUOA 5I66B 4A6YH 3KLSA 4X9GA 3U0PB 3MRIB 1XF5A 4HJJL 3VI4E 2IALB 1VGEL 4AEHL 5IW6B 2X5PA 4UTAL 1KJMB 3LQZA 1MF2H 2QSCH 3MLUL 5I8OL 5E8NB 1TQBB 3HTLX 3SJVD 1RZKH 3UAJD 1A4JA 1CICD 1TTFA 1IEHA 4KKLC 1AO7D 2NY3B 3T1FB 4ONGL 5GJTH 3GMPB 4Y2DB 4L9LC 2EDFA 2EZ0C 5D7LD 1NJ9A 1YN7B 4KXZH 1L6XA 5CJ5A 1MHCA 1U8HA 3DUUA 4M93B 3UJJH 2A38A 2F54A 4EBQH 1S7VA 3GSVA 3RVTC 3HR5A 3VWKC 5E6IC 3S3JA 4ERSH 3HFML 1C8PA 2HT4C 3TFKD 2GK0B 2V5RA 5SX4I 1MCLA 2VH5H 3P2TA 3MACL 1RJYB 3MV9A 1JZ4A 2BSSB 3PWVA 4FTVE 5J3HC 3GUTB 4Z95H 2AJUL 3CJJA 4EIGB 3ZL4H 4JQXC 2YMXH 5I1HL 1B2WH 4X7DC 3NIFF 4RAUA 5MEND 5B39A 4RGMB 5C8JB 2ORBL 2Q7YA 2WUCH 4LPVA 1NC2A 2MMXA 4HULB 5HHQB 2WINB 2BNQD 5I2IB 3I2CH 3FFCD 2OJZH 1UH3A 2RQ8A 1FIGL 2BXZA 5FYLE 3C8KA 4ZUUA 4X9FA 1I7ZA 5I1CH 1YEHH 1AE6L 3VXRD 3GO1L 4N1HB 1OP3K 1ZHNB 4Q0XL 4S1SL 3PGCB 3QUYA 2IFGA 3CGTA 4MQTB 4RMWA 1CK0L 4WI9A 4ZS7L 2YPKA 1PEWA 5FM5M 4XGZA 2UYLA 4MQ7B 2VXUH 4Z7WF 4PG9A 2GTZA 4NQDB 3OXRB 4M03A 3GSWB 3IFNH 3B2UD 1DBAL 3CMGA 3MOBL 1P7KA 4YHIA 4H88L 5A40E 2AEQH 1FNAA 4UUJB 5F96H 1EAJA 5ISZE 3EYOA 1BGXL 3VRJB 4G6KH 4NKOB 3NFPB 3MR9B 5JO5B 3FT2B 2A2QT 4DCQA 2YD2A 3ULUL 4HZLB 3WDIA 2R69L 1S3KH 3O9WD 4OCNC 4Q9QL 2LV4A 3LN9A 2ADFH 4JY5L 4WW1A 2YWYA 5DJDB 4KTEL 2R1XA 4J3XA 5K93A 2HJFA 2BVOA 1L9NA 3I02A 2GKIA 4XBGA 3SGDI 2DWEB 4XCFL 3U46A 2DLHA 1DANT 3DRTB 2HFTA 2F54D 1MH5A 1U0QA 2E9IA 5KSUA 3QG6B 1MFDH 2P5WE 3S34H 2PCPA 3IS1X 3QUML 4EXPX 1MWAH 5FGBA 1RHHB 1WQVT 4I9WD 4UTBL 1UYWH 1XFPA 2HFFB 3EDDA 2P8PA 3PWJB 4M1DH 5I76B 5J9PB 1UQSA 3FTGA 3MV9D 4IJ3C 4Q6YA 4DJMA 3H2WA 1ZT7B 1V7ML 1DQQB 4IEFB 3WD5L 3RUGB 4JPIB 3MLVL 5BVPH 4X99A 3AS2A 4H20L 1WFUA 1QEWB 1NC2D 3ZDXF 5K59E 4JREC 5DEZA 4EOWL 1DQTA 1EEYA 4U1HA 4A2MA 4QXUH 5GSRA 2HFGH 1Z9MA 1W72B 4YXLL 5F89A 3V95A 1INEH 2CLZB 4LCCB 4XPGL 3DYMA 4PRAA 3RVWC 4BUGA 4ZFFA 1NFDF 5E5UB 2E3VA 5FO9A 3GRWL 3QEGH 3T77A 3VXPB 2YK1L 2HYMA 5KS9E 5ISZA 1X9QA 1CZ8H 4KKCD 3PWPE 3EO1A 5D7IB 3GJFA 3MRGA 2EIZB 2VZSA 1E4JA 3GDBA 4ZTPH 1TPXB 3EFFB 4AG4L 1LO2L 1DQJB 1EXUB 2I60H 1CTNA 5C0GA 3G6AB 5EUOE 2Q3AA 1OD9A 4XVSL 5DS8B 2MHAA 4YDJB 1F3JA 1KTRL 1N6VA 1ZS8B 4YAQB 1JBJA 4GKSA 1R3LB 1NC4B 1V3LA 4RISH 3PP4H 2V5SA 1MQKH 3F7VB 3ET9F 4G7YL 5CSZA 5ALBH 3V7MA 4WWKB 1KXQE 2GY7B 1FVDA 4DTGL 1WBYA 1YEFH 4N9OB 2NZ9D 4U1IA 3IETB 3KGRA 4O58L 2DWDA 3HC3H 2BY2A 3SEPA 2GCYA 2P5WA 2A77H 3MFFA 4KU1A 5CEXB 5H94B 5IHZA 5HGGS 1KT2A 4NSKA 3DURA 4R2GC 1X4YA 4U2YA 4XHJD 5F6HJ 5C6TH 3BXNA 1KB5H 5EC1B 2Q1EA 4FTVD 5ADOL 1FRGH 3MBXL 4LEXH 4QF1A 4KZDH 3S88L 3RDTD 3W39B 2WBJC 4LL9A 1A7QL 2P5EB 3JV5A 1PYWA 5ALCL 1C5DB 3GMQA 2H2PC 3L7EA 4FQ1L 4DWHA 1H9VA 3H8NA 5D2LF 4GG8B 5GIRB 5DRXB 4WW2C 32C2A 4PUBH 5FYLD 2CKNA 8FABB 5D1QC 1HCFX 3EYSL 4NC0B 5K9QI 3KPSE 2DQIL 2ILLA 3V6BR 4UDUA 4XXCA 4PJBE 4F33A 5K9QG 3JV4A 4YHOL 1NCWH 2JF1A 3B2VH 2BNUA 2D03H 2XA8L 4J1UA 1KB9K 1W0WB 4ZG1A 4MVBC 2IANA 3UYRL 5KS9A 1C1EL 5KJRL 4DKFL 4TSCL 2A6DB 2CRYA 5ISZD 2XN9A 5TGBB 1XCTB 3KJ6L 1U8IB 5KSAB 1BECA 3MNZB 4O51A 3QDAA 5EUOA 5GZOD 2NY1B 1VDGA 4HIEB 4YHZL 4OJFL 2EIEA 3G5ZA 5GRUH 3KHOA 2IWGA 2ORBH 5HY9B 1MCNA 2MKWA 1L0YA 4IRSA 3OKDB 3LDBC 4HKXA 4LPYA 5HI4C 2YD1A 3BIAX 1Q1JL 3VFMB 3QPQD 1ZHLA 3ZDYF 2VDRH 3TVMA 2EC9T 2LTQC 3KLDA 2P5WD 5F7FA 1GGYA 1CQYA 4Z9KB 4EVNA 3OKMA 4YC2C 3PE9A 4Q2ZA 4Z77A 2H26B 3MJ7B 4ZOEA 4Z18A 5ADPL 4D94A 4JKWA 4L1HA 3L3GA 1BOYA 2Z4QB 4JG0H 1L9MA 4XPBH 1U8KB 2VC2H 4M7ZB 4KI5C 3WUWB 1ORSB 3DX7A 4JR9H 4RMRA 5HDQL 1IM3A 5ANMA 3QRGL 3MUY1 4J12A 1R5IA 1NEZA 3WKML 3GHBL 4MXVF 5JOFB 3KPSA 1XGYL 4Q6IC 3QIUB 1EO8H 3SY0B 3DX6A 5DRZA 3I6GB 5BVJB 5IB4A 3UJTL 1I8MB 4LLDA 1S9VB 2JJVA 1KSRA 1BQHB 4NRYA 3FZUD 4IDLA 3GSQB 4XP4H 4JY5H 4WV1B 1I4FA 4KTEH 2JCCE 3QFJE 1CXHA 3HZKA 4QHLB 2I5YL 2XTJC 4Y4FA 5JUEH 1LO5A 3I85A 3FQRA 3KR3H 2BP3A 4LCIH 4NKIL 5CIPA 4Z7UB 4BM7A 2UZIL 4NWTL 3PWPD 4OFVA 3H9SE 3L1OH 5KVDH 5KZCD 1WVZA 3BEVA 4HT1L 1CVSC 1K9TA 1JN6B 3NCMA 5BW7C 4EI6A 1QOKA 1CGSH 2GITB 3BP4B 4GLRH 3UX9B 2YD8A 3T0VA 1T1ZA 3HZYA 5CMAB 3RFZC 2VAAB 4C83B 4X4XB 3D3VB 5H2BA 3WD5H 4DGYL 3IXTB 4L8BB 3MLVH 4JM2B 1A7PH 3WLBA 2VDML 2CMRL 4Y5XB 3PHSA 1FPTH 4IRSD 3WL9A 2G75B 4L8CA 1X5IA 2C7UB 1LO4H 4O2CA 3VD3A 4KI1A 3SDYH 3QQ3B 2CH8A 4UZGA 5FEBA 1INDL 2NXYB 2MSPA 1UG9A 3EDJA 2R23B 2P7TB 5GRZA 4NO0D 1LE9A 1A6TA 2HN7A 5FGSA 4YXHH 2QQKL 5DYOA 4YGVB 5GGSA 4BK5A 4CVWA 2XNAA 3H0TA 5FK9A 1ADQA 4Y5VB 1EMTH 2OXGA 4LGRB 4MD5A 1OB1A 5DJCB 1HH9B 3INUH 3D18B 4M7JL 4S2SB 4I5BB 2OQJB 3MV01 3LPFA