4YSOA

Copper nitrite reductase from geobacillus thermodenitrificans - 0.064 mgy
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
295
structure length
295
Chain Sequence
b'IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
molecule tags Oxidoreductase
source organism Geobacillus thermodenitrificans (strain ng80-2)
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
total genus 98
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ysoA00
1GR7A 4M4RB 4BDVA 2PP8A 1JZGA 2BZ7A 2NRDA 4FA7B 3ABKB 4YSPA 1NPJA 4G7SB 1J9QA 1GYCA 4YSOA 3TA4D 3FS9A 3NSYA 4HALA 3FPYA 3IN2A 4N4YB 1MDAA 5B1JA 5I26A 1BQ5A 3FYIB 1WA0X 4YVUA 2GSMB 1A8ZA 1FFTB 2PPAA 9PCYA 1NTDA 4A2EA 3N55A 4BXSV 2XXGA 1OCZB 2YAHA 3BQVA 5I5IA 1YLBB 2XYBA 2GI0A 4F2EA 1RZPA 1V54B 3X1GA 1PY0A 4QLWA 3IEAA 2TSBA 3CZUB 1SDDB 2FQGA 2Y1AA 3NJFA 3T6VA 3TASA 4X4KA 3AZUA 2JXMA 3WNIA 2I85A 3FQYA 1NIDA 1PZBA 1V10A 3FU7B 4HAKA 4E9XA 5I6OA 2DV6A 4GY4A 2R7EA 2YAPA 3NSCA 4JHUA 3FSWA 2YQBA 2ZONA 4DP9X 1TEFA 1TU2A 2IWKA 2HLEB 4KO5A 4P5RA 2WSDA 4YSDA 1AOZA 1JVLA 1CURA 3H4HA 3S3BB 1PLCA 1NIAA 2IDTA 2YAFA 1GY1A 3NT0A 3UADA 1ET5A 1OV8A 3IBOA 4L0PB 4AKOA 4YSCA 1L9SA 1AZUA 1AR1B 1SJMA 3ERXA 1AS6A 6PCYA 2XV0A 4A67A 3AY2A 2IDSA 1OF0A 1PMYA 3BVDB 1HAWA 2HRGA 4G7QB 2PPFA 1ZIBA 2FWLB 1AS7A 4CSPA 3OMIB 3SQRA 2PPEA 1M57B 5I5MA 2MTAA 1BXAA 3QJUB 5IY5B 3KW7A 1KCWA 2IWFA 1X9RA 1W6WA 1GS7A 4YSUA 2A3TA 2EIMB 3C75A 2BW4A 3EH5B 1KDJA 2JFCA 5B1BB 1AANA 2ZOOA 2QPEB 4W9ZA 4K9JA 2XWZA 1W8EA 1XB8A 1RKRA 2HX7A 4UF7C 5AKRA 1QLEB 3PLYA 4HCIA 5D4IA 1CUOA 2DWTA 2HX8A 1BYOA 2J55A 3FPXA 1KYAA 2B08A 3NP3A 3HB3B 1ET7A 3QPKA 5AZUA 3ZX1A 2CBPA 2Q9OA 1SF5A 2X88A 3TBBA 5I6MA 4KO6A 2JKWA 3ASNB 2ZXWB 3NJKA 5B7MA 3MX0B 3CVCA 4EF3A 1CYWA 3T6WA 3NSFA 4F7KA 1OOWA 2UXVA 5B7FA 1A4AA 1E5ZA 5TK4A 1GS6X 3CDZB 1EZLA 2I7OA 6PAZA 7PAZA 1VLXA 2PCFA 1EHKB 2Q5BA 1PF3A 3WIAA 3ABMB 2CUAA 3FU8A 5LDUA 2H3XC 1JXGA 2GHZA 2IAAC 3DTUB 1L9PA 4KNSA 2UXFA 2ZWNA 2BP8B 1CC3A 3UGEA 2QPDB 1W6LA 2P80A 3OQRA 4GP8B 5B1KA 5TK2A 1NWOA 3FT0A 2DWSA 2WO2B 4RH4A 2XVBA 2IDFA 2FQEA 1SNRA 5B1AB 1BAWA 1KCBA 4G71B 2FT7A 3EH3B 3TU6A 1ASQA 2FT6A 4HCGA 3S8GB 1NIBA 4HHGA 2BO0A 4DP2X 1J9RA 1A4CA 3QJVB 1FA4A 1ID2A 2AZUA 3FYEB 4DPBX 1X9UA 1XB3A 4FAAB 2BZCA 3G5WA 2BWIA 4W1TA 2VSMB 4GYBA 5PAZA 1ASPA 1JERA 2XX0A 3JT2A 2HXAA 1DYZA 1NPNA 1PCSA 2IDQA 2N0MA 3DKHA 1IKOP 4MFHA 1JVOA 1WA1X 5B7EA 3NJLA 2EINB 4DP7X 3FQ1A 1ZDSA 3ZIYA 2YAOA 1A65A 2YXWA 4BK5C 1AACA 5I6PA 5I5JA 2GC7C 4HHWA 1KBWA 3QJRB 3NJGA 1OCOB 2J56A 4YSQA 1JZHA 1ASOA 2PPCA 1JZJA 4NAJA 2PP7A 1MG3C 3EHBB 2GIMA 3JTBA 1AG6A 1KDIA 2PP9A 2VM4A 1WA2X 4E9SA 2YAMA 1JZIA 1KGYE 1RCYA 1WAEA 5F7BA 3ASOB 4A2HA 1AS8A 1GY2A 2YAEA 1T5KA 4DP4X 2VW6A 3FQ2A 3ZBMA 2CAKA 1SHXA 3SBPA 2FQFA 3WKQA 2EIJB 1MZZA 3NJHA 4NERA 1UATA 4DPCX 4CSZA 2HX9A 3IE9A 1WS7A 4DP8X 2OV0A 1AZRA 2CALA 1AAJA 4DPAX 1SHWA 2DY2A 3CVDA 2MRYA 3IN0A 3AG1B 1MZYA 4YVNA 3EH4B 1NWPA 4HCFA 3PAVA 2VN3A 1R1CA 4G7RB 1JXDA 3H4FA 1GSKA 2BWDA 1PZAA 1PLAA 1PAZA 1AIZA 2XV3A 2FTAA 1ILUA 4YSTA 5B1JC 2YAQA 1J9TA 2FJSA 3WKPA 3NP4A 1N68A 3GXUB 1BXUA 2YXVA 4BWUA 2PCYA 4UAHA 2E86A 2Y69B 4HIPA 2BW5A 4A2DA 2QDWA 2TSAA 5EHFA 3NSDA 3OM3B 4A68A 3NJIA 4E9YA 2PLTA 1NZRA 3FU9A 1ZV2A 4WTQA 1PNDA 1AZBA 2GC4C 4HZ1A 4JKNA 4KNUA 1AZCA 4GXFA 5F7AA 4YSSA 8PAZA 3MBWB 4Q89A 3WI9A 3X2QB 3EF4A 4GP4B 4BDVB 2X87A 3H56A 1HAUA 2UXTA 1ET8A 3D12B 5E9NA 4YSAA 2UXGA 2FQDA 5PCYA 2WO3B 1OCCB 4NB7A 4N8UA 3OMNB 5I28A 2W88A 1A4BA 2IH9A 4E9WA 4A66A 3L45A 1OE2A 3CDZA 1KV7A 3V9CA 2IH8A 2FT8A 2PPDA 2XXFA 5A7EA 2QT6A 4DP6X 3RYMA 3ABGA 4AI7A 1CYXA 7PCYA 3X1BA 1DZ0A 3V9EA 4DP1X 3WG7B 2B3IA 2XU9A 4F2FA 4A2FA 3S3DB 4AKQA 2H47C 3ABLB 3QJTB 2OJ1A 4UANA 2XX1A 1TKWA 1ILSA 2H5UA 1JOIA 3GDCA 1L9QA 2FNWA 1AQ8A 1ZPUA 2P80D 5I6LA 1OCRB 3T71A 1TEGA 3AW5A 1L9RA 4ENZA 2DYSB 2GB2A 3X1EA 1SF3A 2XUWA 2YARA 3KW8A 2VW4A 1JZEA 3X1FA 4AZUA 1AG0A 2R7EB 3HEIB 2DYRB 2J5WA 1IUZA 1NINA 1M56B 3PAZA 2RACA 2BHFA 3ZDWA 3PXLA 3N2JA 4TXVB 3SBRA 1WS8A 3NJMA 3QQXA 4G72B 4G70B 1E65A 2VMJA 3GYRA 2OCCB 2AANA 1JXFA 5ANHA 2EIKB 2BP0B 2VW7A 5I6KA 4AKPA 3QJSB 1SFDA 4KOCA 1B3IA 1L9TA 3FSAA 2AVFA 1IBZA 4YSRA 3SBQA 1RZQA 3AG3B 3UACA 1ZIAA 1PLBA 4QKTA 1AZNA 2BP8A 1BQKA 1BQRA 4WKXA 1ADWA 1OE1A 1BXVA 1SDDA 3PCYA 3QJQB 1SFHA 3AG4B 4KO7A 3AG2B 3OMAB 3NYKA 5FC9A 3OD3A 2GBAA 2QDVA 3UAAA 2LLNA 2CJ3A 1IC0A 1OE3A 2EILB 1URIA 1BEXA 2AFNA 1J5DA 3PAUA 4P5SA 4BXVA 5B3SB 3TBCA 2HZHA 4KO9A 4E9VA 3UABA 4E9QA 3T6ZA 4ZK8A 2XV2A 3NJNA 2W8CA 3NJJA 1E30A 1M9WA 2CCWA 1BYPA 2IWEA 1J5CA 5AFAA 4M3HA 1E5YA 1MG2C 1HFUA 3FU7A 1F56A 1NICA 5D4JA 4YL4A 1A3ZA 4KOBA 3X1NA 4YSEA 4AX3A 4BWWA 4E9TA 3PPSA 4KNTA 2IDUA 1PNCA 1N70A 1PZCA 3WNJA 4DP5X 4Q8BA 1ZDQA 3T9WA 2VSKB 2UX7A 4DP0X 2UX6A 3S3CB 4E9RA 1IBYA 1L9OA 3UAEA 5I6NA 3CVBA 1XB6A 1NIEA 4BWTA 4PCYA 1QHQA 1ETJA 2I7SA 1NDTA 3FSVA 2J57A 1GS8A 2AZAA 4A2GA 4GP5B 3CG8A 3S8FB 1J9SA 1KBVA 5D4HA 1E67A 2VM3A 1XMEB 1I53A 1GW0A 2BP0A 3T6XA 3FSZA 3U25A 2HRHA 4JHVA 4PAZA 1FWXA 1V55B 1JZFA 1QNIA 3DIVA 2XLLA 1NIFA
chains in the Genus database with same CATH superfamily
1GR7A 4DGIL 4N2HA 5AL8A 2J4WH 1NBQA 3FFCA 3MV8A 3ZKSD 1ZLWH 1B0RA 4PG9A 2W07A 1DDHB 5FUZH 5G4OA 4ODWA 3FS9A 3GLEA 1Q0XL 5E51A 4J3OG 4N2BA 4L8DA 2F74B 2H41A 1GGBL 4R90L 1LQBC 2C4FT 3V95A 4NAMA 1J8HD 4DFIA 2HVJB 2EVHA 2F74A 2R4SL 1A6UL 1QKZL 3QEUB 1EAPB 1NTDA 2CUHA 4NNPH 1NCDH 4P49A 1OCZB 4ZFZA 2DQIL 4Z7UB 1OM3H 3ZTNH 1OAXH 3DYOA 2XYBA 4J6IA 4LLYA 1S7TB 3FQRA 3QDGD 3KPPA 4JFDE 5GS0L 3CLFL 1IJ9A 1U58A 4ZT1A 1SDDB 5HDQL 3AT8A 3S48A 3NJFA 3UYRH 1QFWI 1BM3H 3F65A 4M1CD 3HMWL 2F8XC 5AVWB 2B9AA 1V3JA 2R0WH 1W72L 3KCPA 1UCBL 5CP3H 4DP9X 3K2UH 2CBMA 2Y5QA 3EXJA 2Z35B 4AUYA 3BN9C 1I82A 4JY6A 3D69B 5LBSA 5ADPL 1MHEB 2OX5A 3AREA 3LDBB 3S3BB 2IDTA 3KWXA 4J3SA 4LQ1A 4TQEH 4EJ1C 2GTZA 4GLRH 3QS2A 1XH2A 5DJZB 3GXPA 4Z5RB 3D3VD 3SDCB 4TNEA 5H8DA 3ILEA 3SCMA 4IRJB 4LEEA 1DQLH 1BREA 2NXZD 3S35X 2XN9A 4U1LB 4AT6B 1PBYA 2C26A 4RLDA 1UZ8A 4AUJA 4HPOL 1TPXC 3SO5A 4P2RA 3HPLA 1YEGL 4H26A 4JO1L 1RZ8A 3CFIC 1UG9A 2F58L 4RZKA 5FYLD 1E2ZA 2FE0A 4E5XG 2VZOA 4XB7A 3MRNB 4TN9A 2ESVA 3AAZB 3K3QA 3VD5A 1KCWA 1SXZA 4LF3B 2AERT 4MX7A 4PJCF 3JXAA 5BRQA 4YSUA 3EH2A 1UURA 2DDQH 4GRWF 5AEAA 3QRLA 2JJTA 3H1ZA 1FYTE 4BM7A 1XGRA 4U1SB 2WCSA 5E5MB 5HPMA 2OTUA 4G1EB 1HJBC 4Y2LA 1WFNA 4GXVL 4BEIA 4PW4A 2HWZH 4U1JA 3AREC 4LSDA 5GS1C 1GZHC 2VDPH 3H54A 3UC0L 3HE6D 3ETBJ 4LASH 3KGTA 1CDYA 1T2QH 3L3JA 3NABH 3RTQB 1VJSA 3QS3A 3EUUA 4JKLA 4ATWA 2H6OA 2JKJA 3ARBB 4M7JH 1F4WL 4NRYA 2WLNA 3DX4A 3QA3B 4XBEH 3KPPB 5DJXA 3BUYB 4J7RA 5I66A 4IOSA 2UXVA 4GRMB 2WXOA 2P49B 3VGHA 5HHMD 1FFPB 1V05A 6PAZA 2I7OA 1JWMA 4J27A 1E7VA 2Z1PA 1M7IA 2O5XL 4ZSOE 3WIAA 3GJFH 4J23A 1CK0L 3BHBA 3RWFA 1F42A 1QX1A 2FO8A 2ZWNA 5ACMA 3M86A 3BUTA 3T0EE 1PX8A 2AI0H 5TE6H 4NKOA 1CGVA 1I3RB 2BMKB 4KK6C 5TK2A 1NWOA 2PABA 3PS6A 3ESVF 2XSKA 3UZQA 4OKVB 4RH4A 4F7TB 1GPOL 2HFEA 4Q4EA 4MNQB 3OSVA 3FU5A 5CR1A 1KCBA 2UV3A 1EJOH 2AKRA 3DNKA 1EO8L 3FAXA 4MJ6B 5DK2B 3WHXB 2GJPA 4G71B 4M5ZH 1R3HA 4MB4A 1OTUD 4PJ5A 1BX2A 3DX7A 4N2GA 3D09A 1H3UA 5F89B 4JUSA 4JGJA 5ANME 1GJIA 2DYPB 3SJVB 4XPAL 3FYEB 3MMEA 5KJ4A 4UM9A 4XI5D 1HL5A 5D7JD 4HISA 4RSYA 2O6PA 1CGTA 4FFWC 3KR3H 1KWKA 2B14A 4HWBL 1MCPH 5KW9H 4PREB 1Y07A 1URLA 1Z1WA 2DQTL 1OGTB 4JJOA 3JWNE 2GIXA 3N43F 3NIFE 2BRRL 1LP9F 1TU2B 4IS6B 3ARXA 2ZXDA 2D73A 1EQWA 2NXZB 4NNYA 4G43B 5GGRA 3ETBF 4N0CD 2QVMA 2YKLL 1HE8A 3GIZH 3HC4H 3AB0B 5DVNA 5A2AA 3PGFL 1ZDSA 4OUUB 1GZHA 5F7UA 5DJAB 5IEKB 3IMUA 3RX8A 3GDBA 5I1HL 1FZJA 3BW9A 1IIIA 2JK5A 3GRGA 3IDGB 2BJML 2ADGB 3MJWA 1N8ZA 2ZF8A 3E2HC 1CXIA 1RP8A 2VRKA 3JTTB 3JWOL 2ZCHL 3VXPB 3CSFA 3JTBA 1G7PA 2AJ3A 1MW1A 2NXZC 2MCAA 4AENA 3KYOA 1OGSA 4DKAA 4RWHA 5L9DL 1A6AB 2D3LA 3FT3B 2YGQA 3G6JE 1M1SA 3CHQA 4AJ0A 4NRYB 5F9OL 1XBRA 3T77A 1O7VA 4N2MA 1MREH 4GRLD 5E1HB 1KB5H 4S10A 2DQHL 1UH3A 2W1NA 4LLDA 1RUML 3JWNH 4N3TA 4NC0B 4G8AC 3A6BL 4YGAB 3VD0A 1A7QL 1E4KC 3PGFH 4I48B 3DOIA 2PR9A 3WN6A 1MZYA 4HUUA 4ZOBA 1BVNP 1CF8L 1H15A 2DMKA 1U95B 2VR5A 2V5MA 1JPST 4HCFA 5D1QE 4N86A 2OR9L 3NIDE 3S5LG 2WXLA 1PSKL 3KPSA 9CGTA 3OXRA 4N0UA 2VE6B 4PS4L 4NCC1 1NCWL 2L7JA 1VKXA 2LLGA 3MYZA 4HXAL 3MLVL 4YSTA 1ZLUK 3VNYA 4X6DE 1J9TA 2TRHA 2I27N 3PWVA 4MJ6A 5DK2A 1ACYL 1K6QL 4BK5A 1HESA 2V7NB 4UAHA 5LBSH 1XCTB 2QDWA 2EO1A 1F1DA 2J3SA 5GS2H 2R27A 1HQRB 4JFXA 3MBXL 1BSIA 1S9WA 3NGBC 4AV5A 3FT3A 1QWUA 1WICA 1ZV2A 4MZ3A 1BMGA 1CGWA 1G1YA 3TNMA 3VXNB 3UMNA 2W94A 2V2WA 4KTYA 4P57B 4FXKB 8PAZA 1ZHNA 4FMVA 3EJQA 5TFSH 5ERWB 1XH0A 5I30H 3SCMB 3NCYP 3WJLC 5ADPH 4ZXBB 4M4RA 5JO5B 1CDBA 1WLHA 4FXGB 3V5HA 1HHJA 2HVBA 4BUQA 1EDHA 2JI2A 3QXTA 4QLRA 4ZS7L 3F85A 1WZ1H 1KXTB 5PCYA 3AREB 3OLDA 5D7EA 5E2UH 1JCVA 3LPWA 1TNMA 1PZSA 4PJBF 5JHLA 1INQB 1BW8A 1RSYA 1IARB 4FQLL 2E6PA 2GG1A 3D7PA 2A9DA 5B4MD 1F2QA 3EDKA 5CO1A 4I3SH 4WHDA 5E95B 3KYAA 5K9KA 3MMEB 4WFGE 4BSVB 1GKEA 1NM4A 2Z92B 5FUCE 1THAA 5FHBL 1JGVH 3TVMD 4AKQA 5T3ZE 1OHZA 1W8OA 2YHGA 3D33A 4EOWL 2KQMA 2W9DL 3MRCB 5GZOD 4KY2A 4P9HH 1JOIA 4MJIB 4HMDA 3CXHJ 4OCWL 6FABL 4NO2B 2BNRA 2WPGA 4NT6A 4GINA 2AHIA 5E03A 5CSZA 1OCRB 1TEGA 2CKNA 2A9CA 4QYAA 4LLMA 2J6EL 4J3TA 3H7BB 2BMKA 4WGKA 1ZGLB 4NENA 2CO3A 2QEJA 3RJOA 5LLIC 3O0LA 1OTTC 4XNQA 1OAZL 3C12A 4XWGL 5CLZA 2Q87A 1MFNA 3SZ6A 1EUUA 1KOAA 5E6YA 2J5WA 3D18A 5IEHB 4A6YH 3CDGA 5IQMA 5KJRH 3O4OB 3PDGA 4Z0BH 4U05A 3H0TB 1A0QL 4M7JL 3POHA 4ZX6A 2WCPA 4YHZL 4WO4A 4O58H 2ADIB 4D0BA 3NMEA 1EFXA 5HGBA 5FK9A 3WO4B 5BVJB 1P7KA 3DV4A 4K7PH 1L6XA 3UTZA 2EXSA 1UXMA 3BAJA 4XVUC 2IG2H 1XGTA 2K8MA 5JIDA 3RB5A 2RD0A 1W16A 4F15B 1H6UA 2ZOKA 4JO4H 1XGTB 3VQ1C 2C3VA 4LCYA 4X6CF 5GRUH 4CA4A 1QVOB 5HHMB 3EYQD 2W92A 2BCKB 4XWGH 4Z7OB 2AK4B 1SDDA 3UYPA 4BGDA 4FFZH 2RFXB 3D50A 4ZDHA 2BCMA 3GTNA 4PB0L 2DH3A 1JF5A 4GI9A 4JZOB 4UI2A 3ZK0A 1G9MH 3NYKA 4HIEB 4OFYA 4TVSa 2DWDA 1S9VB 1OAKH 2QKIC 2Y7SA 5GHWH 1XGZA 1LL1A 4XB8A 1Q1JH 2VB5A 3D07A 1D7DA 4I3GA 1URIA 3U4BL 2ZP9A 4HS3A 3QDME 2AV7B 4PJIE 3RWHB 5GGUB 3PHAA 2D31B 1SDAB 1KIRB 4S1DC 3CZFA 5JQ6H 3EYVB 3O3EA 2CCWA 3KWTA 3ULVE 4ZX5A 3BKJH 2A9ML 2FJUB 3CFEB 1YEEH 2GJZA 5CLWA 2EKJA 2DMGA 4UQ2B 5C0JB 3LS5L 3WXWL 3LCYA 1UM5L 3UBHA 5SWZB 5EF0A 4EVNA 3ULVF 1A3ZA 3MRJB 2Z91B 5D7SL 2Z1KA 2YPLB 3Q48A 2Y24A 3X1NA 3ZW3A 3B83A 3SYQA 1PNCA 5EZOL 3WNJA 3Q5OA 1IAII 3OJDB 3T9WA 4A7TA 5BVPL 1TVHA 4GKSA 1SZNA 2UX6A 1HKLH 1P2CA 4ZW6A 1IBYA 5I1EH 1K5NB 3FQTA 3WUWG 1P5VA 2X7LB 1RJYA 5TDOB 4X7TB 4K15A 4YXHH 3KYKH 5KUKA 3LKNB 2IGFL 4HIIA 5FCUL 4XMKL 5I71B 5AOMA 1AZZC 3KXFB 5C0RL 2A77L 5IB1B 2DWYA 3S3JA 1ZT4A 4Q2ZB 3P0GB 4PN6A 1UM5H 2E56A 3IGKA 3NOIA 4JDEB 3IRZA 3ZR5A 3WUWB 2X0WA 5IHZA 1KGXA 1IVLA 3SDXF 2HRHA 3KZ8A 4GXUN 3UTPE 3O81A 3U79A 4U1GC 4F1SA 2LGNA 4B95C 1WZAA 1KCRH 4ZFZB 4BDVA 2NNXA 1RUKH 5CHNB 3VD2A 2BZ7A 5DO2C 3ABKB 1G7HB 3UZEC 3L81A 4PTTB 2QKIA 3E9UA 3WGVB 4L1TA 4DETA 4C47A 3B3BA 2HJFA 2X4TA 3G3LA 2GCYB 1ZLVH 3EO9H 1B4LA 4AEIL 4JM2F 1BQ5A 4J3UA 1LO5B 3FYIB 4DCQA 1JNLH 3IB4A 3ARGA 2D7TL 3CN3A 4LQFH 4A2EA 2XG4B 1E7UA 2Q1EA 4M62L 4KKCC 5EZJB 1DHKA 3ZUNC 3A6CL 4XN8A 4R4NC 3ATDA 5KAQG 5EPMB 2W5PA 5C0CA 2UZYA 1V54B 4QLWA 4DAGH 1FFOA 4A7VA 2M26A 4QHNA 5DQ9A 1EZSA 3O2WL 3RI5F 2N01B 4QXGH 3WNIA 2PF6A 4M6OH 3FU7B 1BG9A 1PZBA 3TN0B 2MMXA 3WELA 2YZ1A 4NZFA 3P02A 4FNLL 1JJUA 3BZFB 4JFYA 3FC8A 1ECZA 1IMHC 4XRCB 1KBGL 3Q2VA 2KC0A 3SKJH 5ICUA 2XKNB 1KCKA 4UQEA 5EZLB 4JG9A 2AK1L 5C0DB 1PLCA 5F71A 1W9XA 4MKMA 4ANVA 4IDJH 3FB6B 4M56A 5AG9A 1LLAA 1UOKA 3HBGA 3MV7E 1BJ1H 3FTSA 5HHNA 4IBSA 3CDGB 3TOPA 3W11C 2P5EE 3ERXA 4LCWE 5K39B 3ULVC 3GBNH 1GC1L 1KZQA 1TYJA 4Z1PA 3I75A 4OJYA 3LKQA 4W4OC 1UH4A 4FQCL 3IXAB 1G9MC 3DUSA 1PMYA 4NO3A 4PRNB 4NN6C 3BKYL 4H40A 4MXWL 4G7QB 4NBZB 5E6IB 3DVGB 2IPUG 3TM6A 2FRGP 1KCSL 5DLLA 4QXUL 4P5MB 4WJ5B 3QIWA 3SQRA 3GSXB 4QHMA 2F8IA 3CFBB 4M5ZL 5DD6B 1LO4L 3QZBA 3ATFA 5ETUB 3B9DA 4WCYH 2FL5B 3I9AA 3PHOA 4ZSOB 2JKRM 3NAAL 3IDMA 3UTTA 3AS3A 4U6XA 3T4AA 4KRNA 5E08L 5EDSA 4R4FL 3DX8A 4CRPA 4F3FA 4TLUA 1QO3B 1CB4A 5KVFE 3CE1A 3SGEI 4GW4B 4AG4H 5ICZA 5KSAA 2MCMA 1M4KA 1XB8A 2GBVA 1AD0B 4LVNB 4FA6A 1W0VA 3PLYA 1QPKA 3ARYA 3W2DH 2A73A 3FPXA 2IADA 3TIEA 2CLRB 2FBRA 2DW5A 5D7JB 5G2NA 1RU9L 1CFQB 5C0FB 5C2BL 2R56L 4XWOD 5MEOB 4HKZA 3WDJA 5TGBA 3WS6A 2VR3A 3PGDB 2ED7A 5CZKA 5SV3A 4L1DA 1M6OB 5EG6C 1MFEH 5AALA 5T5FH 4KXZI 1KGWA 3KWWA 4Y19E 1Q72H 3ECVA 4W9LC 4U6HB 4JPWH 5I74C 1O6VA 2P7TA 3ZJAA 1RJZB 3UJIL 2N7BA 1R24A 4LAQH 1UCBH 4UQ3A 3UIZA 4QRFA 5DO2D 2ZT9C 5EBWB 3QUMB 1TYEB 4B7IA 1S7UA 4ENED 4QPEA 3MACL 1AR2A 1G9ML 3ULVH 1CC3A 1E8YA 5LAXA 4PHXA 4OM1H 2ZOWA 3F04A 2I9TB 4NO0D 3RA7L 4G8IB 1S7RA 3MRHB 1F41A 2VXSL 2WIIB 3I6KA 1UENA 3MRMA 1V8HA 3LKQB 1R0AH 4ODTH 4KHTH 4HS3B 3E0GA 1NA8A 4JRXB 5F7MC 2W0LA 1MFBL 1X7TA 1RQ5A 4HS8L 2ZICA 4ZPVA 4U7SA 2QGEA 2DB8A 5J1AB 4FAAB 3IJHA 1RH8A 1ZVHA 2BWIA 4WEEA 4XC3L 1JWUB 2G4GA 4XVJH 1DYZA 5KS9F 4DQOL 2VMFA 4ZODA 1UM6H 4OM0H 3F5WA 3I2CL 4X42A 3V10A 3KJ4B 1OAYL 1YY8A 2XZCL 2Z0UA 2EINB 1A6AA 2ICES 3IJEB 4P23A 1BFVL 2O5ZL 3SDCC 2DF3A 1TVDA 5J4MA 4WUUA 5KSBF 4LFHD 4B6ZA 5EEWA 2GC7C 4NUGH 4ERSL 1KJ2H 1XSJA 3F05A 4MMZC 3UPCA 4YDNA 1JN6B 1LMKA 1F3DJ 1UYWH 1T1WB 3N41B 4MCMA 5E1AB 3TO4C 4JL1A 4HLEA 2Y7NA 3PYCA 2F54E 3TCTA 3C8DA 5J3HC 3VRJA 2WXQA 1JRHL 3UTSD 3V55A 3ZDXB 4HG4K 1AGDA 2R59A 2Q8BL 3QI9D 1KGYE 2J8OA 4P05A 4Y19D 1EWHA 1VGEL 2G3XA 2VMDA 2QPUA 3VD4A 4LP5A 4HBQA 4EUPH 2ICWB 4B9PA 3F7RA 1KY7A 3HE6B 5D1ZA 4C56E 4PRDB 4ZS6D 5FA3B 3L3IA 5CEZE 1Q9WA 4Q58C 5A2KH 3AXHA 1NWPA 1ZT1B 4AEIH 2DYPA 4UILL 1W72H 3K71A 3QPQD 4NQSA 1E4WL 2AI0L 5TE6L 2XPGB 3GMRB 4OCRH 4OCLC 5JHDA 4Q6IC 1E4HA 3IDXH 4XMZA 4JZNA 5LVEA 4LPCA 2A9MH 2FJSA 5AUMB 4FTDA 4L9LB 4KUZL 3TJEL 5BXFA 2ITDB 4WQOA 3ZZ1A 1F6AB 4Y1AD 3M8OH 3WFHB 4U6VH 3W82A 1SXNA 2LU5A 3TO4A 2CDFB 2R29L 5EHFA 2PWFA 2Y2WA 4G7VL 4KKAC 2NSQA 3L3HA 3QIBA 3QUYA 1IAMA 3TFKC 4DOHE 1JPSL 2A2QT 1IFGA 3VFSA 3VU1A 3BPNB 2DKSA 4HU2A 1ZLWK 3CZEA 3NCJL 5EEXA 2A83A 3CFQA 4LFHG 5F3HB 3WFDH 2F58H 3EF4A 3O6FD 3UG5A 4YHNB 3DVNB 3LD8C 2BNQB 3GB7B 1MRDH 1XR8A 4GS7B 3UTSE 4QHUB 2YBRA 3BP7B 3PDDA 3MFFA 3NSXA 4JQIL 4Y5VC 3V6BR 1TFHA 3TVMC 1MVFA 3D12B 5CUSL 5E9NA 4OZIF 4KUZH 4MB3A 4GNKB 3VXNA 3D25B 1R34A 4MQSB 2VXQL 5SWSD 1R3LB 3US9A 3O6ML 1V27A 5DF0A 5E8PA 3B6SA 2ETWA 1FAIH 4BH7B 5J56B 1GCFA 1VACB 5BXFB 3WXVH 1UQSA 4OGZA 3HUJE 4O2CA 3KPQA 4M93B 5E5MA 5HPMB 1HS6A 4WGVB 2LU7A 1O6SB 3LXUX 1OTTD 4R3SA 2X70A 5ITBL 1A02N 1TETH 4MD0B 4OZHB 4RIRB 4BZ1A 3FB5A 1X5AA 3QDJA 1WBZB 2FUTA 3EO9L 4GBXC 2FNWA 5FKPB 5LUMA 5FA3A 5JOPE 2P44B 4OF5A 2C3HA 4XBPA 3BRDA 5TE7L 2K8QA 4P2RB 3VB8A 3LS5H 3WXWH 4QXTB 3LEXB 3I6LD 3T6QC 3F6JA 3RUGB 4RGMB 4S1DD 2E8ZA 1H8OA 2NXYB 2R1WA 3PL6A 3X1FA 4FADA 3WTXA 2FO4A 5I1KL 4UTAL 3FTGA 3LQZA 4H5SB 4P2OB 2CJSA 3KLHC 4X4YB 4PGDB 2NYZA 1T2JA 1R24B 2H1PL 5DO8A 3T09A 2EP6A 2X4QB 3D9AH 4K23H 4OLWL 1KN4L 1AO7B 4FNLH 5IW3A 3WFZA 1HOEA 2EIKB 4AY0A 4TUOB 4OFPA 2R0ZL 3GFUA 2M83A 1I75A 2XWEA 1T20B 3BW9B 1UXSB 5IW1A 3OF6A 4KK5C 4PB9L 4YDIH 4NS0A 2W59A 1XF3B 2IAMA 1BQKA 4Z3EA 4CMMA 1NBYA 3B2PA 4PTUA 4UQ9A 1BD2B 1YEJH 4PG2A 1MWAA 1FPTL 5FWRA 5AAWC 1FF5A 3JV4A 4M7KH 5JHDB 3WEMA 1KTKE 5TF0A 2ARWA 5C97A 5ESAB 4H20H 3O41B 2OQJB 4YE4L 5DWUH 3N1QC 1U33A 2YXFA 4TULH 2QDVA 3BYYA 5IIEA 1OGAA 1J1PL 2XETA 2IH1A 3BDBA 1CYGA 4JB9L 2Y2YA 4U6XB 3G6AA 2CK2A 2HZHA 4OB5L 1IQWH 4MJJA 3RY6C 4P3CL 4PGZA 3T6ZA 4XCNB 1P1ZB 5E9DB 2WBWB 5I9QB 4KQ0A 3JSSA 2YD5A 1PKQB 2CKBB 2D9QB 1I8LC 5FB8A 2NY5L 3HNSL 5C6TH 3OLIA 4OKVA 1A6WL 4HPYL 4W9GC 2KLSA 2LHAA 4OIIH 2C9UA 1K3IA 3V0WH 1WVZA 4GKNB 2N7SA 3BOVA 4ORGA 5LGHH 1T1WA 5E1AA 1QLFA 1S9YA 3NRPA 1BPVA 3QCUL 3FMGL 3QYCA 5MI0B 1PZCA 2DIEA 3MRDA 4L9LC 5AVTB 2X6VA 1QYGL 5CSBA 5ANMB 3S4SA 3B5GA 5E5RB 4YHMH 3MRLA 2EDLA 3ZE0E 2QZQA 4S1QL 3FUEA 3B3IA 2C1OB 4UT6L 4KXBA 2VWEC 5D1QC 3JYCA 1AGBB 3MVSA 3D2UA 4H2CA 4PHZA 4EI5A 5ID0B 2K7PA 1JV2A 5E4EC 1QNZL 3HG4A 4JPIA 3QWRA 3KBHE 4EI5D 2GYSA 4Q0XH 5BOJA 3UC2A 1BQLL 3QWRD 4M6MH 2VM3A 3FB8A 4OZGB 4OT1H 4QR7A 2RH0A 2HRLA 4NOFA 4X50A 1QRNE 1T0MA 4ZUUB 2I60L 4WHTB 1AIFB 3V7AG 3WE6A 4JANB 4WF7A 3JT0A 3I6KB 4PJ8C 1QZNA 2NY4D 4XXWC 2DN7A 1KLGB 2IV8A 5EZJA 1J5HA 3GRWH 1SEBA 1G1KA 1J9QA 1QW9A 1E9OA 3QO1A 2A0LC 1YEKL 3BWAB 2VGLM 3LV3B 1OOAA 2O26U 1UOLA 4QRAA 4UTBH 5LAXB 3U0TA 1E9OB 3CN0A 3C87A 5KSAC 1LNUA 1MAKA 3RVVC 3NAAH 2A74A 2PPAA 1Y6MR 4IOIB 1TJIL 4PJXE 1IKFH 2G30A 1QTSA 5CEYA 1CLVA 1PJ9A 3EFDL 4KXZH 4AGPA 3TV3L 2R29H 1YMHB 2FX8L 2P7TB 1AMXA 2AEQL 3UYRL 1R33A 5T1DH 5DUML 4OZGA 5T3ZH 3EOTH 5CCKH 3LRHA 3DMMC 3KGRA 1SOKA 1WAAF 1EERB 2P48B 4MRBA 3L7FB 3DPDA 2FWSA 2X10A 1HOCA 5KYWA 3NSCA 3K80A 2D7MA 4D9LH 5FUCC 4ERSH 5C0FA 1TU2A 1AOZA 3TBWA 2OK0H 2DJ4A 3D4GA 2QV2A 4V33A 1N0LA 5E9DD 1GGTA 3SDXA 4L1SA 2PYEE 1CLCA 1JPGA 1CR9H 5IQNA 5CBEA 1F97A 5C0EA 4XNYL 3H9SD 1RIHH 2NXYC 1ET5A 3QFJD 1OV8A 5GGTH 1V3MA 1NOAA 3GI8L 3TBSA 3MBWA 1SLVA 5DD0H 2JSFA 2FGWL 1K4DB 2FL5A 5M94B 5KVFL 5DUMH 2PYEA 3VGAB 3BVDB 4UAOB 2HFFA 4OQTL 2EDXA 1RUAH 2QR0A 5DEGA 1TETL 4U33A 3AVEA 4KQ3H 5B3JE 2N59A 3Q1SL 2IPKB 2J8UA 3H2WA 3UXFA 3DXAB 4G7YH 3U0WL 3QJUB 2NDFA 2E0PA 3KW7A 3O9WA 4NX0A 2CG9X 3N1PC 2IVFC 4Y4KC 3WFHA 5HXMA 3ULVD 3MV01 2EIMB 4X5XA 3EH5B 3L7EB 1KDJA 3EOBA 3BDYH 5G5DA 4UMSA 1D3CA 1H5BB 4MA7H 1CFSB 5GIRB 4F7PA 1S78D 3G7TA 3L3OC 4NQDB 1VAHA 2VUYA 3C60A 4PI0A 1L3NA 4GSDH 1DVZA 3D4YA 5DRNA 1SXAA 4JRXD 4R0LB 4JDEA 3V6OA 1UM4H 1M05B 4JO8A 3QGVA 4HHAB 5CS7A 5F9WB 4HSAC 1Q9WB 1S6NA 1QR4A 4ILDA 4HIIB 1ZGLP 1UACH 1M7UA 3T0ED 3DHPA 1MFCL 3TBYB 3F7PC 2DJMA 1N59A 3MOBL 5HI4D 5KVEL 3BVVA 2VN7A 4MQ7A 5AW6B 1RSFA 5IBTH 3ASNB 3ZRSA 1CVSC 1FG2B 3FCGA 3D30A 1TXKA 1U3NA 4AMKL 3CVCA 4PH8A 1EEQA 1TVHB 4GKSB 3T6WA 4YDJA 2LE9A 3DIFA 1FNEB 1QSEE 2ITCB 5FKAB 1MH5A 3L95B 4NDMB 1YO4A 5C0CD 1YEEL 3ZQWA 5HHXH 3SJVE 5IVNA 4ZOEA 2X4SB 2ZUXA 4ETQA 1T1ZB 1TQCB 4Y4KA 3QUKB 3WY3A 2DICA 2DQJH 3FCTB 2X4OA 3HLKA 1GHFH 1XX9C 3EOAB 2F7QA 1MFUA 2P80A 3OAYH 5KOMC 5CCHE 4KRLB 3ZHFA 2BSRA 2HLAB 5TDPB 1JZ2A 1L9NA 4EN3D 2AGJH 2DMBA 2GQHA 3MOBH 1AI1L 1XL6A 2FIRT 4UB0H 1JAEA 1PZ2A 2VZUA 1QI4A 3G08B 4HH9B 2WNXA 3O6FC 1R46A 1NL0L 2NQCA 3P3YA 2IEPA 5C0BA 3DI3B 4NC2B 3S8GB 3QR0A 1G9NH 4DP2X 1A4CA 4PM1A 3FB6A 3L3KB 1BJ8A 1KBBA 2AQPA 3MNMA 5EZPA 4DKFH 5IJCC 1AGCB 2I9LB 3QO0A 5CM1A 4OLEA 2Z92A 4JDZB 5KVGL 4KDWA 1AR1D 2ISDA 3EBIA 3MACH 4JX0A 4AJWA 1ASPA 3REWA 2HTKC 4NSKA 1AGBA 5F7HA 2EADA 2WIIA 3IAQA 4I18B 3PV6B 5C0IB 1NCGA 3MRHA 2Z35A 1T03H 1P4BL 5IVZB 1S7QA 3EJYD 3T8MA 1WIPA 3FL7A 1K4CA 1KENL 1KPVA 1UD8A 2DM4A 4ZMZA 3IBEA 4LE8A 4OF8A 2E27L 1X6LA 1EUTA 1R0AL 2X3CA 5ESQA 1KBWA 4R0LA 1OCOB 2Y25A 2VXVH 3RWJA 4MNHA 5ESVB 1EMTH 4OF7A 2R0ZH 1AKPA 1QFHA 3KJ4C 5FCSH 2ZAGA 1JZ3A 5D9SA 2X4RB 1IFHL 5JIMA 1WA2X 4X5WA 3ZE2E 2ZJSH 4ANWA 4BKLB 1RCYA 2BINA 4LLVA 1Y0LA 5C09D 4UDUB 5DJ0B 1LGVA 3FQ2A 1HL8A 2CAKA 4L0YA 5DVMA 5EO1A 3WKQA 1MZZA 4N6QA 4EI6A 1M2OA 4WI2A 3W0WB 1AAJA 1HEJC 5AKTA 5FO8A 4I89A 1L0YA 3IN0A 4DVBB 2ORBL 3CH1A 5BJTA 4E41D 4XP1L 4BQBA 3PWLA 3AQDA 4X8JB 5EEUA 1HYSC 4Y89A 2R2HA 5HGHA 4F27A 4I9WD 2BVUA 1IKNA 4MSWB 1RULH 1G5GA 2BWDA 1X4ZA 5EOCH 3UPAA 1FO0L 5A7BA 3ARFB 5DSCA 5DD1L 5MERA 4QD2E 1GMEA 3B9KA 3QNZA 1DDTA 1U3ZA 4NUMA 4J3OF 5D1ZB 1IEBB 3BVNB 1JCKA 4PWJA 3HE6A 1SEQL 1T20A 4FNUA 3QJXA 5E8EA 2E86A 4XP4H 3SY6A 4PJ8B 3BQUB 1BIHA 3GBNL 1XIWA 3BO8B 4L8SB 4Q7DA 5C07D 3MJ7A 3U30B 3X11A 3DX1A 2C9VA 5JQHC 2F7IA 1GTNA 3Q0HA 5FK9B 5BVJA 2DLTA 3SBWA 1YEFH 5A2BA 3QO0B 5DC4B 1PNDA 5FDWA 5ECGA 5LNEA 4DW2H 1T2XA 4LRNH 4QY8A 1MCBA 1XIWC 4FF9A 4W68A 3QWQB 2ZP0T 4G8FA 4OLUL 3ZIMA 2BP5M 1WZ1L 3KLHD 2YR3A 3QIUA 3F58L 3GZKA 1DQKA 1OSPH 3GKWH 1FZJB 4G59C 2H3KA 5L4FA 2Z93B 5KYYB 2H2PD 2BSBA 4N8UA 4EIBA 2FB4L 2WVSA 3RVUC 2PYED 3TPKA 5HJBA 5DMGC 1N64L 3OGOE 4FQQB 1AQDA 4PR5A 4HUWB 4XAKE 3LH8A 3RPIB 5D7IF 3SKUD 4KK5D 1CYXA 1DUZA 4QOKA 4ZPVB 2AJZA 4YN3A 2AF2A 4IHBA 4P9HC 4B60A 4OCXH 4LT7A 4KX9A 5DURB 3Q05A 3LS4H 2UVEA 2OJ1A 3O6KH 1GPOH 3B6SB 3EBHA 3U36B 1UXLA 1KCUH 1UD5A 2Y3NA 3KWVA 1MRFH 1PG7H 4OQ1A 5I6LA 2R0KH 3T4AC 3WNPA 5HDWA 3ZTCC 3TA3C 2MQ3A 2CA4A 2AQRA 1KTJA 1BFTA 2P5PA 3GMMB 2CGRH 3OZ9H 2BH0A 4ZFQA 4NOBA 3GMLA 4S2SB 1TSRA 1I7ZB 4RMBA 3C60B 4CVXA 1MIMH 1YJDH 1QFWM 2DYRB 2GUOA 4GO9A 3HHSA 3RE0A 3JWDL 3WE1A 2OSWA 4ZW7A 3BJ91 2VDPB 2AJ3B 4NC1E 2EDYA 3QFDA 1PU0A 1Z9MA 3D0LA 4B41A 1WS8A 5JUEH 3CMGA 1KELL 2IFFL 4GAGL 4ZTPL 4WW2B 5LO7A 4ODXA 5F1OB 1NCOA 1LO3H 3TF4A 4U6YA 2OZNA 4YUEL 2Y2TA 4AKPA 4K3DL 4GW1B 1D7CA 3QJSB 2ITDA 3AU1A 2VYRE 4GQZA 1CFTB 4KDVA 2DTML 3WHE0 4HYTB 2KDYA 4J8RA 4YSRA 5GGRB 3NCWA 4MJIA 4LMQE 4Z7QB 4X0NA 3AGVA 2IOIA 3WKNA 1ZSDB 4YPGA 3E80A 3AWEA 4L3AA 3TTSA 3I2CH 4MCZB 1NCAL 3HHRB 3SKNB 1AI1H 1DVSA 2NZ1A 4NYLA 1T1XB 3VFUA 4LCWD 5EEYA 3RNQB 2FX7L 3ZYIA 4PIBA 2P24A 1Q1PA 4GW5A 5C0BD 2V8MA 5DJYA 5GSVB 4GAGH 4ZTPH 3BP5B 3TBWB 3BT2H 3U9WA 3TBCA 4HWBA 4M1DL 3VQ2C 1E9QB 2AJSH 1D2OA 1DBKH 4CMMB 2XA8H 5AW7B 3G08A 2KPNA 4HV8A 1P7QA 5E0FA 4BRVA 4HXAH 2P47B 2RJMA 1MLCA 5BW7C 1FSKC 4TSAL 5FDYA 1I4FA 3WD5H 1J5CA 4GMTL 2WXRA 3O3EB 2VZSA 2ZG3A 1CWVA 2A0LD 1FL3B 1JN6A 3EJTA 4ELMB 2Y6SD 1RUQH 3CHSA 3VXPA 3AXIA 1ZLUH 1XAKA 3MBXH 4TRPL 5D9SB 1P5UB 1AGDB 1CL7I 4JAMA 1A22B 4I77L 3BUYA 5I66B 3MGTB 1YUHA 3MO1A 4DP0X 4G11A 3SYAA 1IGCL 1I1RA 1OTUC 3CVIL 5IQLA 3VWJB 4MNGB 4JG0H 3D4ZA 3B7TA 4FRWA 4G1MA 4PMEA 2ZSWB 1QTYT 2CMRL 4PRPA 3N42F 2YD4A 1NUNB 3IJEA 4K23L 2G75B 1KBVA 1RIHL 3RWEB 1HHIB 2WN3A 4PJDF 4ADIA 3BPNC 1I53A 4JRXA 3DV4B 2DAVA 4TNFA 4JKKA 4G1EA 1S7SB 4WFGD 1RIVL 2W0FB 1PX3A 4WENB 3CVHB 2KQNA 2D3NA 1QNIA 4G6AD 2BIMA 3PG2A 5MENA 1M1XA 3LNHA 3V5DB 4RRPG 3TN0D 3FZUD 2WJ7A 3S6CA 4ODVH 5D8JH 1ERNA 4PP1D 1WK0A 4G6FD 2CGYA 2X6AA 2YKKA 2ZCLL 1A5FL 4R9HA 4ZUTB 2EE2A 1G7JB 1I3RA 3ML8A 4OI9A 3MXWH 2D0GA 2H9GA 1JIBA 2QKIB 3WKML 5I26A 4C57C 4H26B 1B9KA 3C60C 3GSWB 3O11B 1Y7VA 4H20L 1B4TA 1BD2E 2PCPB 2R2EB 4L4JA 2B16A 1XTMA 4Z7WA 4AV4A 1NUFA 4F7CA 3M7OA 4AGLA 2X9YA 4BXSV 1EPFA 1OARL 1FNHA 3K2KA 1IQWL 3F7LA 4ZAKA 1OB0A 4LXFA 3STZA 4ZX3A 4BFRA 2BY3A 4UQAA 4P2QA 4F15C 5CMAB 5I76B 4QXGL 1F11B 4KGLA 3LN4A 1NAMA 4KZEL 1I4FB 1JGUH 1DLFH 4IEFB 3CFTA 3B2XA 3V8CA 2GJ6D 5EU4A 2A9BA 3Q2NA 3QXDB 2M1KA 4E9XA 4F33A 1PD6A 3FONA 4IYKA 3RDTB 1PZ5A 5JYMA 2VDOB 5KJRL 4HJEA 1ZCRA 2PETA 1S7QB 5IHHA 5GGVY 2ID5A 1M71B 4J2QA 1I8IB 1F4YL 5AW0B 2XKSA 1CURA 5JLZA 5ICZB 4F80A 1IKFL 2E6JA 1EV2E 4M7LL 4NQDE 1MVUA 1U6AH 4IRZH 5IV2B 5ESAA 1N64H 5ICYA 2IADB 1H3WM 1I1CA 5KYNA 2EE9A 3MRFA 1NBZA 4X7CC 3W39A 4DWHA 1TJXA 2X3BA 1AS6A 3T08A 5JA8B 4OFYD 3CH1B 4OV6F 2VR7A 3QYMA 4WNJA 4QOKD 4JFFE 2X4UB 1O5PA 2PPFA 2VITB 5EU5A 3K0WA 5EUOB 4A04A 4CSPA 2Z8WC 1MCKA 3CX2A 3LS4L 3EDDA 3HMXA 4QRQB 1GMIA 3RUGE 1FNLA 3Q6GH 1IFRA 5LGJB 5C92A 1DVTA 1BXAA 3LKPA 1EHNA 1YPZA 4PJHF 4CN4A 3QUXA 1TZAA 3QIWB 1SJHB 4LPTA 4FLSA 5D1XB 3SCMD 4IRJA 4AQ1A 4HFUL 2NPLX 3NH7L 3R06B 4X5WB 4B0MM 4E42A 3FFDB 3NCMA 4GBXD 3CX5J 4WNQB 1IU1A 3B2UD 1UA6H 3ZE1E 1BZ7B 5T5FA 1AKJB 3ZL2A 1EXUB 4JPKH 4TUJA 2IXQA 5EFIB 5AKRA 3KAAA 5F7YC 4DGVH 2H6PA 2NNRA 3ARTA 4FQHA 5HHNB 3FOLA 5SWSE 5AW8B 4PI2A 5AAMA 1J9CT 1EAQA 2AJXL 4I18A 1HWHB 5HDOA 1HZKA 3CFCL 3VFTB 4FHKA 2ENQA 4FL4B 2Z7UA 3BH8B 4H8UA 1BP3B 1F6LL 4XB3A 4FA8A 1N19A 1FDLL 5HJDA 2NZ9D 2COVD 2FSEA 3UGXA 1N18A 4M48H 3EF7A 4G5ZH 1ZT7A 4K3EH 5CZVL 3P4MA 4NQQA 4H25A 1A4AA 3TH3T 3RP1A 2KZKA 1SJHA 2VERA 5D1XA 1CICB 1JPTL 5AG8A 5C07A 4JPKL 4YZFF 4PYGA 3DGGA 2YK1H 4FABL 1K5WA 3Q44A 1RZ8B 2X9XA 3RKPA 3UGEA 2FX7H 3DC0A 3NFSH 5FGBA 3UP6A 4DKEL 4DN4L 3SKOB 1IC5H 1SPDA 2IALB 1T89A 3KS0J 4JFED 2VL5A 4M61A 4NRXB 3OJVC 2BS71 2W95A 4IU3B 5ITFB 4JFSA 2A1WL 4NAQA 5CD5C 5E9DA 2BJMH 4BYHA 1FZKB 3IFPB 4XMPL 4U1NB 3WIHH 3ZE2B 5K93A 2RGSA 4ADJA 4U3XA 1C1EL 3KPRE 1ZTXH 2QKSA 1MHEA 2P43B 4I9XA 4OJFL 5EC1B 4YXLH 3C9NB 5E2VL 2A4ZA 2ICWI 5CZRA 1JERA 2CJUH 3M6DA 1KY6A 1ML0A 5TQ2L 3FFCD 3ROLB 2HH0L 3BVNA 3PREA 5K33A 3A6CH 3IDNA 3MTRA 3JWDH 1XF3A 2KDGA 1WFIA 1ZLVK 4ACPA 2ZCKL 4NRZA 4I0KA 1LK3H 3W38A 1ZHKA 3FQRB 1C5BL 1O75A 4UQBA 2YOCA 4IJ3C 5A6MA 3MOAH 3R4DA 4Z7AA 4FS0A 1BXXA 4I1PA 5D71L 1G4RA 1ZHNB 3D0LB 3QK0A 4J6RH 1F3JA 4JHWL 1UKTA 3V7MA 3NEEA 1DQVA 2WIMA 5FV2A 5HPOA 3U6RA 3KYMA 5HYIA 5A2LH 5FF6B 4TVUA 5CAYB 1G9HA 2ZP8A 1NGYA 2V3FA 4ZQKA 1E8WA 2ATAA 3PIQB 2FQFA 4XPHL 1MHHA 4MGXA 5DA0B 1G6RB 3P0VH 3CFMA 1WS7A 3FFCB 3GSNH 3RBSA 3GNML 4DPAX 4QWWD 2E27H 4Z18A 3EJPA 1GZQB 2Y22A 3C6SB 3LSOA 2OCJA 1ND0B 3ZL4L 2WOBA 4R90H 1IM3D 4LEBA 4QHKI 1I1FB 5E1IA 5I1AA 4D9LL 2CO6A 1JYWA 3INUL 5JHDE 1GHFL 3VB9A 1HXYA 3VWJC 2OL3A 4BHUI 4XAWL 4XPFH 1KCUL 2N56A 4Q56A 4WUUB 5B1JC 3OXSB 4XCEB 3WKPA 2Y3AA 4PLJC 4Y5XB 5IVZA 1UGKA 3GM8A 3RIFF 2KL6A 4O2CB 4IBVA 3DJZA 4AYGA 1FBIH 1WZKA 4QUOA 5E5LA 4L9DA 3BVWA 2FGWH 1OHQA 3NDZE 4MXVF 2FR4A 4A68A 2GBUA 2GIYA 3MR9B 4HD9A 4PRHB 4PY7B 1PVHA 2FJGB 3FU9A 3TYFA 2OKMA 3GI9H 4A7SA 5I15H 4GMSH 2FO1A 5BRZA 4POYA 1F4HA 3VQMA 4N8CH 4GAAA 4DH2A 2QFPA 1U8QA 2DIBA 3P4OA 2DZEA 1IC4H 3FT1A 3VH8B 3WS3A 4QHUA 3A22A 3TX4A 1ZMYA 4JFPB 5LGYA 3BT0A 2BHUA 4IJTA 4ZMQA 2W9DH 5FGSA 1F4XL 2DQCH 3G04A 3OAUH 5K9OB 2MPVA 2WNGA 3H56A 1C8QA 4TUKL 1K8DA 3HMXH 1HYRC 3ECWA 1UB5B 1VB9A 3HJ0A 5FIEA 3VGFA 4LL1A 1IZJA 4Y2DB 2GFBB 2NXYD 2F53E 1MJJB 1YYMH 4PRIA 4NQEE 2NYYC 4XTRC 5F6IC 4UIKH 4PJFA 2AVGA 1U8PA 2EXTA 3BAYA 1JHKH 1E3FA 2W0KA 3L45A 2K70A 4XMKH 5ISZE 2Y6SC 5T33H 5EN2A 1F02I 1BF8A 1XAUA 2IQ9L 1T0PB 4G6KH 3V0GA 5L2KB 1Z3RA 1E28B 1MJ8H 1BOGB 5LXVA 5AOLA 4YPGB 2AAVA 3ABLB 1DL7H 4OZIB 5J13B 4R3SB 4UANA 3U0PA 4JMXA 5IFHH 2B5IB 1WWBX 4OZIA 2MQ0A 4F2MA 1WO2A 1ZT4B 2ROYA 1KGUA 1FHNA 4LSRH 1MW0A 1MSPA 4FJ6A 5E4AA 3MV9A 4LP8A 5BCAA 2YARA 4KI5F 1NFIA 3BVXA 4S0HA 2WLKA 1I85A 3NJXA 3QORA 4F57L 5BO1H 3CZKA 1R5VB 3C5ZC 4R4ND 1R5IB 3DSNB 1FFQA 1IEHA 4LASL 3HNTL 1IUZA 2ENPA 3JQOB 4K8RD 4W93A 1JWMB 4BQ9A 4MNQD 2X4QA 1SEQH 5ALCL 4ODSH 4JFZL 3G5YB 1NCUA 3IDMB 3UTTB 3EBAA 2RCSL 2JELL 2NY0B 1ZA6A 4N1EA 5H37A 4Q9CA 1UVQB 1MWAH 4IOFC 5GZND 1EGJL 1QWNA 3CFDA 1JGEA 2R1YB 4Z7VF 4L1HA 5LWYH 5AOJA 4JM2C 3QZWG 4PJ5E 3O3BA 3CPLB 3E1ZA 1S9KC 3GLDA 4HJJL 3HG1B 3RL1A 1SHSA 2VJXA 1FCGA 1S2EA 5JQIB 1PG7X 2XT1B 1MRCH 3O11A 3US0A 2X6UA 4JVWA 1SOXA 3AWGA 1WRFA 1BQSA 2GK0A 2W9LA 3K81A 2IQAA 1U8JA 2YFOA 1TZHA 4AM0B 4CVUA 1XZ0B 1ADWA 4PGBB 1LP9B 1FG9C 2XY2A 4X98A 4X7SL 4HULB 5IR1B 2K0RA 3W11D 5D7SH 3T0EA 2OQJA 5IF0A 2I9LA 4TSCL 3EYFA 3EYUL 3QXAB 4IBTA 4F20A 5IP4A 1U41A 4JM4H 4NQED 2IFFH 1RZJC 1KLFA 2PO6C 1OE3A 3O4LD 1UOWA 3VNZA 4EZMA 4P5SA 2NY5C 2WP3O 4XRCA 3ARWA 4H2AA 5CWSA 1VACA 5EULV 4DGIH 3KG5A 4E9QA 2VXVL 3S88H 4LNVA 3VXRA 4JHZA 3OX8A 1FIGL 3KLDA 1WISA 2BHZA 4U4IA 5J13C 3IGFA 3HPLB 5DYOB 4FQHB 1EBPA 4OD1H 1Q4NX 3KLAA 4O02A 5LGHL 1MHCA 2R4SH 1NDMB 2RIKA 4ODUB 4XPGH 1TTGA 2I26N 2XWXA 4DPRA 4KOBA 4O9HH 4GG6A 4TV3A 3GB7A 4G7VH 4OBRA 1NGWB 3U7YH 2NY4B 4CKQA 5HYSA 3GXDA 5I17B 1FL5B 5I2IA 1RVFL 5F6IB 2IPUK 1CXFA 1F58H 5CR8A 1KCRL 3EW3B 1QACA 5HHQA 2A6JA 1RZIA 4ODHH 4R7LA 2B2XL 2YA0A 1R3JA 3B7UX 3QARA 1NCBH 2EEFA 3PL6C 3OHXA 2OMBA 1R5IA 1DBJL 3DSNA 4PJ6A 3WGUB 1RULL 3N5AA 4TTDD 2A9NH 1JMXA 1ETJA 5TD4A 1P5UC 3WFDL 1GS8A 2A6KA 3CU7A 4GP5B 4OGAC 1U3YA 4JRWA 4DF9A 2OXGA 5E1GA 1T0MB 4HK3J 1B2WL 4ZUUA 5T5FL 5F1SA 3WLBB 1GW0A 1DQDL 1JGLH 3P0VL 3V0JA 5BZDB 5DRZB 1ACXA 3ES6A 4JBSA 1MCCA 4Z7NE 4PRBB 2XZCH 3RPBA 5C0AB 4ELKA 3DVFA 3MUZ1 3I6GA 3KH3A 5ICYB 5GRVL 4OZ4B 5DUJA 3SE3A 3L7EA 1IO4C 1VPOL 5CD3B 3HIZA 4OLVH 1NCCL 1WEJH 3B4NA 3IGUA 3R8BB 1QSFA 4HALA 1QPPA 3QUML 4N0FA 4D0DA 4M43H 4XX1G 4PRPD 3RRQA 1OQOA 3ZHNA 3IJ8A 1YZZA 4C59B 3VGEA 2VKWA 5MHSE 4WAFA 3EFDH 5CSGA 4M61B 4NRXA 4F7TA 5CJQL 2QFRA 3RBGA 3M1BA 4BELD 4FG2A 3PRZA 2PYEB 4W6WB 3TP4A 3BESR 5IMKB 4UQCA 3KXFE 4N2CA 2VDLH 1MJ7H 3L4UA 3QXWA 3VFWA 2HG0A 3ARBA 3VTTA 3S5LA 4GBXB 4UUJB 3IKKA 4N68A 1ZEAL 3MLXL 2X4NA 3F2LA 3WAJA 3OJMB 4M7ZB 4XN2A 3GHBH 3QZPA 3AZUA 5DYOA 4Z7WB 3OAWA 2I85A 2R2EA 2B0SH 1AKJD 3II1A 2DV6A 1M3JA 4HUVB 1PZ3A 2BOBB 4QTIH 2IMNA 5EO9B 4ACTA 4WO0A 4YSDA 2XBTA 4AE1A 3IETA 4K3EL 5CZVH 4AUUA 3OGCA 1MNUH 2DD8H 5CJQH 4BZ1L 4MB1A 3W9EA 1A21A 3NT0A 4HC1L 3D0AA 1RZGB 2ZKMX 3WLWD 4BINA 3KGUA 1TTCA 3CCHA 1EEYB 4NO0A 2WXFA 3K7UA 2CGRL 2Q76B 3OZ9L 1J88A 4HWUA 4R7DB 5IQOA 3DX6B 2XV0A 1HIML 5JTWA 1EFXD 2JI1A 1FLRL 4WRLA 4FG6D 4X99B 2ZKXA 4A67A 5C1MB 1N5YH 4U49A 3T4AB 5JHAA 1T4KB 5TPWL 4GS7C 2ZWYA 4Z7UF 1B6UA 8CGTA 4P5TA 1ZIBA 2FWLB 1AS7A 3VG0H 1YQVL 3QNYB 5GGVH 4HKJA 4D9QD 1TMQA 1MRDL 4LF3A 1MHHB 5JNYA 2QBWA 4D7BA 3FHEA 2GPZA 5EU3A 4XC1L 1P6WA 1SLXA 1GS7A 2B39A 2A3TA 1YEIH 3MV9D 4L4VA 1B4JL 2WXKA 2ZUWA 3DUSB 3UGUA 4RA3A 5I0WA 2O5YL 2XVLA 4G8FB 1CLZH 2J6WA 3B2VL 3QUYD 4NN7C 1UM4L 1NGXA 2CPUA 2AJVH 3KWWB 4X4MA 2GTWA 5KBDA 2ADFH 3WUWA 3P73B 4LCWB 2RR3A 4EN3B 1AJ7H 2HG5B 2ZYSA 3D06A 1LXMA 3SKMA 1ET7A 2PKDA 2WZ5A 4AH2A 4DUWA 1M9SA 3BQUA 4JL2A 4N8VG 2I69A 1S7TA 3LEVL 3LEYL 1J7VR 2BVEA 4JN2A 4U4BA 4ONHA 3BLBA 3EKCA 4WNSA 4WK2B 4YE4H 2AEWA 2VLJD 5INDB 5LQBH 3L1OH 3SZKC 4LDOB 3TT1L 5L7XL 1AOHA 5CU9A 1JRHI 3NESA 2OL3B 3RFZB 4DK5A 2BSDA 2RQEA 2YRBA 3QBTB 4B3EA 4GMTH 2EQDA 2WM0A 4XXDB 1KLUB 5I76A 6CGTA 3IFPA 2FIKA 1KIPA 1FZKA 3DRQB 2I60H 3WEXA 2GEEA 2GSIB 4AGNA 2BM3A 4OAWA 5B1KA 1BM3L 1RPKA 4PGJA 1J0HA 4K94L 4F9LA 3MUHL 1YA5A 3ARFC 5DVOA 3PIQA 3CHOA 3CVHH 5HHPB 1OLZA 4G2AA 1OTSD 3VVWA 4R97C 2ZWZA 5EUKA 1P4IL 5D55A 1PD0A 1TTRA 3S34H 3IMBA 3PUCA 1MCFA 3VH8A 3WS3B 1HXMB 3DARA 3MJ6A 3DDGA 3UAJD 4LSRL 4HK0B 1NFDA 1J0YA 2DWDB 1VIWA 4W1TA 3JVFC 2C7UA 1ACZA 4FLRA 4JO5A 4MA1B 5JR1H 1NDGB 4BSWB 3GMNA 4L9LA 1ZRUA 2IGTA 4G3YL 2E7DA 1CDJA 2DLHA 2A6KB 1TSHA 4YHYB 4PLJD 2G75A 3NJLA 2ZSVA 3EHBC 3BZDA 3RGVA 4HX1B 4KZDL 1N7ML 3NIFF 4HKBA 2YAOA 3HG2A 3CGTA 1RJYB 1ZWIB 5TFSL 5CIPB 4FQ1H 1BFOB 2AJYL 2XG5B 3ULUE 3MXWL 4ZPTA 3KBFA 5E2WH 2IOMA 4PRDA 5EU6A 2PP9A 1JPEA 5I17A 3C6SA 2DIAA 1N8OE 5E2TH 4FXTA 3BD4A 5E8OA 3DSFL 1WIUA 3K4ZA 2FLBT 4N2AA 4GAFB 4LLDB 1NGZB 4B0MB 3V5KB 2HMIC 3MJGX 4JS7A 1CR9L 3RFZC 3OPUA 4BCXA 1SLUA 1MAMH 4NN5C 3ET9F 1R75A 2WUBH 2YD8A 4YDIL 3WSQH 3V52H 1JPSH 2MRYA 3AG1B 3Q5YA 3VXRB 2BSSB 5ADOL 1Y6KR 4GAJH 4L4TD 2WLLB 3QJHB 5E4EB 3ZU8A 2WQSA 3NZ8A 3FCTA 4LKXA 4A1RA 4YDVA 1CF1A 4YBLC 1GSKA 3RZWA 4CC1A 4JQXC 5EWIH 1W15A 3BFWA 2P45B 4DN4H 3TYFB 1AIZA 3O9WC 4JZOA 1F00I 4Q97A 1D9KB 1TEYA 3OKLA 1DQQB 2VC2H 1RY7B 4HETA 4NN7B 4P9HL 3WMSA 2F54B 4JFQA 4K5LA 3P30H 4KQ4L 1EIBA 1I7UB 3PHSA 4JFYB 5H94A 4DO6A 2Y69B 3LKNA 4OIFA 3MV9E 3V4PA 1E4XI 2GK0B 4MQ7B 2YLHA 1UXWA 4MD5A 1ZD6A 2ZX7A 2WYHA 2APXA 2HKFH 4QRUA 1V7NL 1H3PH 4HK0A 4YZWA 3ZTDC 5HYQB 5I1CL 2PYFB 2IWGA 2LVEA 1D5MB 5EFIA 5DT1L 2GC4C 3SDAA 2ILLA 1X5IA 5I6XB 3WI9A 5SX5H 5IJVA 2JWYA 4U1NA 3BN9D 2V0AA 2KBGA 3CLEH 1KCVL 1E6JH 4NO5B 1JNHA 1QYGH 5DCCA 3JWNC 2UXGA 3LRKA 1WYJA 3VXMB 1GC1H 1UA6L 2HJFB 2X4TB 3VFNA 4PCTA 1FLRH 4JQXA 5F7EH 1TNNA 5CGYD 1JUFB 4FYRA 4HAFA 1Z9NA 4E9WA 4F7MB 1CTNA 2ZUUA 2AV7A 4FFZL 4MQTB 3RWHA 2F2HA 2OYLA 2WKOA 2FT8A 5GISH 3T1FA 3M46A 4DP6X 4E0RA 5I1HH 5IFAH 2VCOA 2MCPL 1NFDE 3HLAB 3ILPA 5INDA 5AVSB 4AE0A 5IVXB 3MI6A 3L4YA 5BZZA 4UB0L 1FSKB 4DGUA 1I9RL 3LNFA 2DQHH 2VABA 3U46B 4JHBA 5FFLA 5IB2B 1NFDF 4R96A 1D5MA 1LE5B 3PPEA 1KJ3L 3CBRA 1ECYA 3DPBB 5AD0A 1JV5A 4HEPA 2NYKA 4N22A 3MLRL 1OP5H 5E24E 2JJTC 1G0XA 2IFGA 4DN3H 4P04A 4WWKB 2IGLA 3RVVD 3MUY1 1A1OA 1JS4A 4JRYB 3JUYA 1G7IB 2HT2D 3ARED 4L37A 1MI5E 1RK7A 3N40F 4W9HC 5EU6E 1BFSA 4MNGA 1AHMA 3SYPA 3QDJD 2J1KA 3OHXC 2O93L 4HGMA 5GS1A 1C12B 5ELIA 4KAQL 4KQ3L 5D93C 1GOGA 1UD2A 1RUPL 3PHOB 4XCCH 4ZSOA 1KJMA 2CDGB 3PXLA 1H3GA 2X12A 1YEHL 4ZAKB 3P3RA 3VH8G 3KPLB 4QTIL 3BUIA 3ZE1B 2L0DA 5IVXE 4U1KB 2ED6A 2F5BH 1ONQA 3L1FA 1A4KB 1HSBA 3PQYD 4H0HB 4NLAA 3NA9L 3K6DA 2ZOTA 4FI6A 2BSRB 5FDWB 4YFDB 5TDPA 3FSAA 2OMVB 2ZUQB 4TOYL 2AVFA 4J39A 2B20A 2MEJB 4R6UA 1CI5A 4GSDL 2WBJB 2F19H 5I30L 3QHZL 4YBQC 3CXHK 1SXSA 2OJEA 4AQ8C 4O4YL 2O61A 3HZKA 3MNZA 4FFTA 5AOZA 3FO9B 4WI6A 3J8F7 4JUTA 4HIJB 4LEXL 3TJHD 5IROD 3DIFB 3O9WD 4FQXC 4HIXL 1DSWA 4WTXA 3VX1A 2IJ0C 5I8OL 2XA8L 4GQ9L 1U8JB 1ITCA 1MCHA 3K1DA 1QUNB 2DLFH 4FERA 4LNRB 1DLHB 1L6ZA 4HS8H 3LSOB 5DS8A 2R9HC 1CFNB 4G6KL 4X6EA 1M9WA 1SMOA 3H42H 1DN2A 2V9UA 4XP9H 5KSUB 2MNUA 3L4ZA 4EZLA 4A38A 4BFKA 2AV1B 5LXGL 3QNFA 2DYPD 3Q43A 5DJDA 3GHPA 3L13A 3X12B 2K45A 1A1MA 2Q7YB 1S78C 2FD6H 3P2TA 1F3RB 1U3JA 4Z7UA 1H5BA 2F7OA 2IDUA 3ARGD 3EJSA 4UM8B 3FTYA 2IAMC 3OKKA 3VFWB 2E4FA 1HL9A 2EDJA 2ARJQ 3O9WB 4G9FA 2BXZA 3H9SE 1V7MH 4TQIA 2VR4A 4U1IA 4I2XA 1KXHA 2RMNA 4Z0BL 1B0RB 3D05A 1A64A 1YY9D 4PG9B 1DJYA 1TFPA 2JELH 2RCSH 3I9GL 1DVYA 4P4KD 2WXGA 3Q8AA 3OLGA 2AC0A 4LDEB 4DO4A 1KXQA 3MYJA 4N0FB 3TTYA 4D0DB 1B3JA 3FSZA 4LAJH 3B1UA 5ECJE 4L4VE 4F7EB 4KTEH 4JREC 4QJ4B 4JHVA 1KENH 2CHZA 1VZIA 1RHHA 5EOTB 3VJ6A 2XLLA 4OH2A 3QEQE 2VRQA 1FO0A 1KPUB 3FOMB 4O51A 4PJ7B 3WNLA 4AQEB 3I3DA 1I8IA 3RILA 4PJFB 2NY0C 4ICXA 5HP5A 1YC7A 5EWIL 1QFWH 4B50A 4CC4A 4FQXB 3T04D 1QLEL 3VO0A 4I1NB 3EYUH 3MCYA 2NCEA 3MV7B 3LRMA 4Q6IA 2WV3A 3OL2A 4KKQA 5AYQA 2FYVA 3FN9A 3II2A 3MV8E 2R69A 1OM3L 5HYSB 5GRUL 1OIOA 4PRNA 4LCCA 1CS6A 2BIQA 3IFOA 2FLRT 1ZOXA 4YLCA 2TSBA 1KEGH 2F1BA 1E4KA 1UZGA 3F7QA 1IGYA 2B5IC 4Z9KB 1OAJA 1ZT7B 3S5YA 1Q1JL 5DJZA 1CFBA 1QZ1A 2EXWD 5E7BA 1CG9A 2F53B 2J6EA 2ENSA 4IU2B 2FLMA 2CBTA 4PVBA 2EICA 3FCUB 5DHVH 5FHBH 3WJMB 3X14A 3GXIA 4JQIH 3FO1B 4XHJC 4YEEA 4FQ1L 2D7TH 3WCYA 4CGUB 3TBYA 5EO0B 5L7XH 4XVSL 4HDIB 1JZ6A 3GJFA 2H6PB 5KJ7E 1HKFA 3PJLA 1S5IH 5DEZA 3N1FC 4LARL 4YSCA 2D9CA 5DVPA 1AZUA 5I73B 2VABB 5BO1L 3CNKA 4HFWA 1JI1A 2A9NL 3KHQA 5FYJU 4KTGA 2VDKH 5F88A 4HX1A 1O6SA 4PPTA 1J18A 4J3OD 5BVPH 4C4KO 4DK6A 4XN9A 4LDLB 2YUWA 1I9RH 1PFOA 2HFGH 2XY1A 4X98B 5DRWA 5JMRA 3Q7JA 3AC0A 4ZQKB 3ZDZF 2FECI 3HI6H 2VXSH 1IBGH 5DI8B 3OF6D 3MJ9L 1QFOA 4M1GL 3T4YA 3B3IB 5CJOH 3HG1D 4IBZA 4F2ME 3RL2A 3O2DL 7FABL 2WB7A 5CHNA 3TEWA 1AANA 4GIOA 1Y1UA 4G5AA 5DHMC 4OU3A 4HJTA 3ZZSA 4P9ML 3ECBA 3ULUD 3H9YA 3KNBA 4WSJA 1TQSA 1HNGA 2IC2A 3UC0H 1KTCA 3UJJL 3SJVD 5I18L 2VLKB 3KYNA 2J55A 3MC0A 4HKZB 3TEXA 5KSVA 1AFVH 3I85A 1R17A 1RURH 4RDQF 4K5OA 5F6HI 5JPNC 1U91A 4JNXA 3SYCA 5DT1H 3N04A 1N0LB 5HHOA 3CZLA 4N2IA 4OI7A 4K5NA 4XBEL 3A6OA 4GG6F 1G0DA 1LO4H 1NFIB 2DQMA 2ATPB 5HHOD 3MJ9H 2KZ1B 5DURD 5EC1A 2NY1C 2C3GA 3T1WA 4ECNA 2R23B 3JWOC 4TM9A 3RI5K 1MCWM 3HKZA 5C08B 5EA0H 2Q8AH 3CXDH 3BWUC 2WOYA 1VLXA 2X6MA 4KHXH 2VLRA 3X13A 4CU7A 3F6LA 3TT3H 3ABMB 5F3BB 2MOGA 1W0WA 4YWGH 5BUAA 3FQWA 3VFRA 2VZ1A 1PLGH 3ZTEA 2A99A 1CDGA 5HI5D 5DJ8A 5CGTA 4PRPE 1LK2B 4BKTC 2WO2B 4LIQE 1J5OH 4NM8H 2V5YA 4GAJL 4Z7VB 4WFED 3T3MB 3LEYH 3PU7A 1F2XK 1NMAH 3NCBB 4L1BA 5CIPH 3RWFB 5KSAD 2P5WD 2H3NA 1XIWD 1BAFH 4Y4KB 5IHWA 5F0JB 5KBPA 2BO0A 3HNSH 2NR6D 3P0YL 4Z3HA 4ZFOA 4PJAF 4LPYA 3HI1B 2VNCA 5GGVL 1FHGA 1GGBH 1KB3A 4YNYB 1Z7JA 5TQ0H 2V8LA 1R19A 2YD6A 1WWWX 1X9LA 5GXBB 5HJGA 4H7VA 3WAKA 1PQZA 1WCBA 4M8QA 2HJKA 2WYIA 3MZGB 4IRSC 1SY6L 2EVJA 3VGAC 3I6SA 4C56B 3EYOB 4PRIE 3UDWA 1DVFC 1UOVA 4B9IA 5I0ZA 4PJGE 4PY8I 1WA1X 5BRZD 4LLUA 1OAXL 1XSIA 2IPTL 1TZIB 4G9FD 3LNEA 4OI8A 5FS5A 4KJPC 5ALBL 1AACA 2IXQB 4CVWA 3NIGB 2V2XA 3RTLA 3OKMA 2J56A 3CCHB 4NO0B 5HDBB 5T1LA 2C7UB 3GBML 3I50H 3FH5A 1XGPA 2X3AA 4MJID 1SDYA 1DBML 1WFUA 4ONFH 4V1DE 4E9SA 1UD3A 2H3NB 2FWUA 1S3KL 4IOFD 4LKXB 3UEZA 4MTMA 1IBBA 2R4RH 4LHUD 3LKOB 4KPHH 2CIIB 5EF3A 1U6AL 4JFWA 3FH7A 2H32A 5TF1L 1E5BA 5HHPA 2Y7LA 3G5ZA 3GSVA 3WTSA 4OFKA 5IB4B 2OJZL 5L8LB 3HVNA 4YDLC 3ARUA 1G7PB 3FQNA 1OANA 2HJLB 1DBAL 3KDPB 3LTVA 1H6EA 2V6HA 3INUH 4YHOL 5BV7B 4RDQG 3RTQC 4PJFF 5KYUA 2VN3A 3ZO9A 1HU8A 2WWKO 2FEEL 3A4EA 4PJ7F 1CXEA 2VRAA 1BVLA 5CGBA 2ZOLB 3UCQA 1PLAA 2ITCA 2MTPA 3GZOA 3BIAX 1XXFC 4PJFE 4XE0A 4WU7A 2PYFA 5C9JB 4XOAA 8FABB 2DQEL 3P4NA 2I07B 1E5AA 3IWVA 4WUUD 4UT6A 2AJSL 4YC2C 3CZGA 1L7IH 3RGVB 4DGYH 2C1PB 2WXHA 5DD3H 2WKOF 4NZRH 3FKUS 4YHKL 3NSDA 3U2SB 1BZ9B 4ONGH 3HKFA 3L7FA 1VSCA 3MA7A 4RESB 2J1WA 1ZA3A 1P0SE 5DK3A 5GZNA 2BVOA 4KNUA 5DRZA 2KERA 3GK8H 3UTPD 1NCJA 1TPXB 1WD9A 4G6FB 4OFQA 4TLKA 1T7VA 2ZOUA 1MAJA 4HWZB 5D2NE 1JHTB 4H0LC 3IE4A 3TF7C 2GJZB 32C2A 4GXVH 4WEMB 1T5XA 2GI7A 1ET8A 1NH6A 2JB6B 4AYMC 4E5XA 2FQDA 3EYVA 1R3KB 4PJ9A 5DQDL 3QZNA 1OCCB 1VDGA 3ARBD 4NFDA 4NB7A 2VDKL 3WLWC 2DLGA 1F3DH 3PAYA 2W88A 4HCRH 2YMXH 5CINH 4Y2DA 4A2MA 1MFAL 3NQKA 1ZLSH 1FFRA 2WHVA 1NC4B 2ED8A 4PU2A 2PPDA 1MJ8L 4ALAC 2JIXB 2OTPA 5AW1B 1GGCL 3IFNL 5C2BH 1KTDB 1YEJL 2FIKB 3HN8A 3B7RL 1MCOH 4HJSA 4M1GH 3DK0A 3RDTC 3VFGL 1WBZA 3AABA 4K8RH 4CNIA 3O6LL 3TS8A 5D5MA 2XX1A 1TKWA 5B39G 5I0XA 1QLEH 3TPUB 3TBTA 3G6JB 3VXSE 5E6IC 3BH4A 4OD2B 1LO0H 4H8VA 4RMUA 3PXHA 3L1EA 3IRCA 4JGUA 3OR7B 2WQ8A 3JUZA 1L9RA 1KZYA 2R83A 1B0GA 3W3BA 4C8XA 3KLSA 5KVDH 1M05A 4GRLC 3KW8A 3C5ZB 1AG0A 3CHXA 1YN7B 3GC3A 4N9OB 4X9YA 3D25A 3FUHA 5I8CA 4A7GA 4IBLT 1O7DE 2BRRH 3N2JA 5C7XL 4TXVB 1HHGA 2GY5A 3G6DH 4Z76B 3S36X 2BSSA 3H6AA 1TR7A 2PXYA 4QRTB 1MCPL 4U3SA 5DJAA 4QRPD 1LM8V 3QIWD 3VSUA 3O3BB 4IMLB 4R7NB 3QAZC 3IFLL 4ZMAT 1GJWA 5C9KA 5I1KH 3D0VA 1QSFB 4QRQA 3IJ9A 4R8WL 1HN1A 3GTVA 4UIMA 2G5UA 4PJBE 32C2B 2OMWB 1MVUB 3AG4B 3GINA 4G3YH 5AWNL 4RGMC 4PVMA 2TAAA 4Y2DC 2LAAA 5F93C 1IM3A 3S36H 1U8OB 5MERB 5C0EB 2BS8A 3MLPA 4F7EA 3TNNA 3MRBA 2LLNA 2J72A 2X1WL 1J5DA 4WDIB 5KG9A 5JQ6L 3CVIH 3OKYA 4EXKA 5KWYC 1MLBB 3S5ZA 4DVBA 5IGXL 4IIZA 4TQEL 1SYSA 2ZUVA 5GGSY 3VSTA 2CHDA 3LRLA 5AZ2H 2BNUB 4K7FB 2BY0A 3NGBB 4MMYB 4C4KT 1FAIL 2XFXB 5ABDE 4FQXD 1OAQL 1FYHB 2HPOA 3HZYB 4AX3A 5IB3A 4BWWA 4X5XB 1KC5H 2QSVA 4L5FH 3EOTL 4BA8A 5CCKL 3NN8A 1RURL 5D2NA 1DBJH 2DRUA 4TKWA 4QT5B 3W5NA 3LN5B 2ZAIA 3DHMA 2CLVA 4UT7L 1MEXL 2WD0A 5IK3A 1MFMA 4I8DA 4OCRL 1FZOA 4AEHL 3TIDA 3IDXL 3KPOA 1TLKA 4KXAA 4OJFH 4A2GA 1OWRM 1GH7A 2XIIA 4Y4HC 5DFVC 5H2BA 4Y9FA 2YN3A 1UJ3B 3QEHA 1MCDA 1XMEB 4ZUTA 5IHUL 1WC7B 3GMOA 5DMIL 4NHUB 2OJZH 4M29A 5JXED 3FXIC 1O0VA 1XL4A 4OZ4A 2FEDC 5KBLA 3AMKA 1FWXA 3W1ZA 5BZDA 4TOYH 4FEIA 4FQPA 2AEPL 2AP2A 1JZGA 1RV6X 4FKEA 5LKNA 5JW3H 1MIEL 2E9IA 5IR1A 4N2EA 5GJSL 2BVYA 1HYSD 1YEDB 3STLB 4EDXA 4JHWH 5B1JA 1CU4H 4IGBB 3UTQA 1IGYB 1V3LA 4PJIF 1FRGL 5MEND 3DYMA 1Z5LA 3B5HA 3Q9QA 1MUJA 3IDYC 3N55A 5J06A 4AT6A 4ZZFA 1X5KA 3C5JB 4JQVC 2ICCA 4CC0A 1NKGA 2P1YA 3EYQC 2NUPA 4I3SL 4W9EC 4XPHH 4ZUWB 1J0KA 5D2LF 1WV7T 1XR8B 4PJ5D 5J11B 2VDMB 5TDNB 1JD9A 3RVUD 1XCQA 3GO1L 5T1KB 3CZUB 4N0YL 3UBGA 2CE6A 3ZE0B 4R2GC 2VDNL 1ODUA 4GAYB 2EVFA 25C8H 4UQDA 5AB1A 4ZXBD 4AJVA 2L04A 4JVPA 4PVLA 4R84A 4O02B 5E2VH 4GY4A 5CU5A 1E9QA 4FFYL 2EO7A 3NIFB 2B1OA 4FNRA 5E8EB 1EJ8A 4ODSL 4YO0B 4XAKD 1W80A 1A0QH 3MV9B 3OKNA 1OT4A 2C9SA 4YGVA 5C6WH 4IDJL 3H4HA 1TJIH 5GQBA 1LK3L 2X42A 4W70A 4UBDD 4X8GA 1NUGA 2E6QA 1DQMH 4Y4FA 2EVGA 4QDGA 4HQQL 5TE7H 3VXUE 4AKOA 4OZHA 4HJJH 1SJMA 1IE5A 3QI9C 3WHXA 2ENYA 2AKRB 4KK8D 2CSPA 1FNAA 3WNMA 1SHMA 4JPIB 4N0YH 1IGIL 2IDSA 3Q6FA 4C56D 4ZTOL 4ZFGL 3DXAD 3VD1A 1YECH 4F3FB 3SB3A 1WTLA 2O4EA 3W0WE 3O6LH 1XSOA 5ABAA 4G9FB 1AQKH 2E9BA 3D85A 3I74A 3VE0B 3VFNB 4TNWK 4TLSA 3D1MC 5IY5B 2Y07L 3FUMA 1QSEB 4NPYB 2NNCA 3E3QC 4RFNC 3UX9B 2AQQA 3TGXA 3QFDB 3QQDA 4Q0XL 1OM9A 3C75A 2XQ0A 3X3GH 5J6GA 1EGJA 2JFCA 5H37G 2QPSA 4LRIA 4MAUL 1F11A 4JRXE 3V8OA 1YYML 5IW6A 1ZA6B 2NYYD 3TZVA 2GUYA 3GMLB 4S2SA 2E7BA 4LHUB 4P5KA 1JMZA 3IU3A 3EUDA 1RUMH 2FJHB 4PJXA 2YK1L 4P2AA 1CUOA 1QBMH 2K9UA 3SBWC 1BYOA 2VZVA 2B59B 3T3ME 3M1CA 3ZHDA 5CEZL 3G5ZB 3GSVB 5K9QI 3RZCD 1VHPA 1ZV5A 4FNQA 4O9HL 2H4EA 3QUZD 4HIXH 5DVKA 1G7JA 5HYEA 3F5WB 5DQJB 5KUMA 1Q72L 2A1WH 4OGYH 3T3MF 5I6MA 5KN5A 1HH9A 3LOWA 3MLTA 3Q1EA 4JDZA 4Q74A 3LY6A 1DUZB 1CYWA 1PKOA 3NSFA 4RMWA 2YA1A 3II3A 3QXAA 4NI3A 3CVHA 5MENB 3E6FA 5FYJH 4XP9L 4LBEA 2VLJE 5T1LB 1KPRB 4MAYA 2OPCA 2AK4A 2H3XC 4BFOA 1FFOB 2VISB 2Z8VC 3D51A 4O5LH 4AQ1C 3VFTA 1EBAA 2XXCB 3UJJH 1JL8A 5EPMA 1CT8A 2OMUB 4LLQB 2HLAA 4LCUA 4PJCB 1E9PB 5I1GL 5JW4N 2DWSA 1EEUA 4YFLF 3LXBA 4K7PX 4ZUSB 5HJ3A 3EOAA 5AW9B 5K1NA 5E8NA 1FNGB 1O9VA 4AIZA 2NNAA 1QBLH 1PQZB 5B38G 4XNXH 1Z66A 4I0PA 4LVOB 1S7UB 2DBLH 3ZDZE 1BZ7A 2CDGA 3SE9H 2X1XR 4YHIA 4QWWC 3VI4E 3O45A 1N67A 1MRCL 1PY4A 2ADYA 4RX4A 2WINB 3BYTA 2ZD0A 1S4IA 1QWHA 3GZQA 1AIFA 4LB8A 4DPBX 5I1JL 1N5AA 3VFMB 4IKNA 2VDLL 3B9EA 1QSZA 2D03H 5FYLE 1E27B 2Q2LA 2XHNA 1WJ3A 5J5EA 2ZSVB 1RIUL 4JFTA 2IDQA 5G55A 4UZUA 1IKOP 1Q90A 1NLDL 4N2KA 4GRWE 3GMNB 1C5DB 2VISA 1P4LA 2WVVB 1CZ8H 4Y1AB 5D72L 5DSCB 1I3UA 2OW7A 4JR9H 3FB5B 3OKDB 4JRLA 5I6PA 4LRNL 1NL0H 3U6XA 1P84J 5B8CA 4FMKA 4LQFL 4PJ9C 4XP5H 1DSFH 1BG1A 1JZHA 3RHWK 1ASOA 3RNQA 4O51B 1AH1A 1ICTA 1NLBL 2XN1A 1QHPA 3IJYA 2IF7A 1GC1C 2IANE 3KEDA 1DUYB 2X1PA 4GSXA 5IESL 4UIMB 5DMKB 3K6FA 2PN5A 3ASOB 1BX2B 3DX7B 1CPUA 4O2EB 1A2YB 2VW6A 3T8XB 1IAIL 4B9ZA 4RAVA 1Z3GL 3PWUA 3AU0A 4G42A 5IQ9A 3BWSA 4PWEA 1DO5A 4KMQA 4UQ2A 2HX9A 3IE9A 2VKXA 3AU1B 5C0JA 2CALA 1MQ8A 3IFNH 1WITA 4P2CG 3VRIB 4QRRB 3W37A 2FBJH 1KBGH 3QDGA 3K0YA 3V4PH 3RURA 3GBLA 3P9MA 3IXAA 4NO3B 4QOKE 3G5YA 3ARRA 3C6LC 1KYDA 4Z76A 1CD9B 1PLGL 4F9LC 2ZYIA 5FO7A 4U6HA 4M02A 2XV3A 1ZE3H 3M7FB 4F92B 1KB9K 1Z32X 3QEQA 3WIHA 1PG7L 1U92B 4MA8L 5HVGB 1L9MA 1S9VA 2NY6C 4TUKH 5IJDC 1J10A 3NCXA 3UTQB