4YSOA

Copper nitrite reductase from geobacillus thermodenitrificans - 0.064 mgy
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
295
structure length
295
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
source organism Geobacillus thermodenitrificans (strain ng80-2)
molecule tags Oxidoreductase
total genus 98
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ysoA00
4GP8B 2PPDA 1SHXA 1SDDA 2HRHA 2OV0A 2YQBA 2J55A 5LDUA 3QPKA 2FT7A 4FAAB 1JXGA 3L45A 4F2EA 2CJ3A 4E9SA 1XMEB 2DYRB 2BHFA 2P80D 2I7SA 2ZXWB 1N68A 2GHZA 1AR1B 4YVNA 2CCWA 5B1JC 1ILSA 2HLEB 1J9QA 1WA2X 3OD3A 1E5ZA 1KDIA 4WTQA 1IKOP 3X1GA 2HX9A 5B7FA 3H56A 2ZOOA 1V55B 2VMJA 4DP5X 3FQ1A 2XUWA 3FSAA 1TEFA 1PZCA 4WKXA 5FC9A 5I6MA 2UXTA 2H3XC 2BP8B 4DP2X 1YLBB 5I6PA 1MZYA 1SDDB 1NDTA 1AS8A 1IC0A 1NWPA 3FU7A 3PPSA 2B3IA 1BQRA 1SFDA 1AZCA 3UAEA 1ZIAA 3ABMB 1MZZA 1RKRA 2BP0A 1GS6X 2OJ1A 1AG6A 3NJKA 3PCYA 3GDCA 4DP0X 3X1BA 1EZLA 5I5JA 3HB3B 2DWSA 2GC4C 3ABKB 3KW7A 3NP4A 3FSZA 4A2FA 4KO5A 1J9RA 3ERXA 5D4HA 2UXFA 2YARA 1PAZA 2JXMA 3AG2B 1HFUA 3V9EA 2FJSA 2VM3A 2XV0A 3FU7B 1BXAA 2YAEA 1WS8A 3EH5B 3T71A 4K9JA 3CZUB 3QJVB 1AG0A 3WKPA 3FYEB 2FQGA 3CVCA 1JZIA 3GXUB 1GR7A 1ID2A 2XU9A 3OQRA 1MDAA 2BP0B 4QKTA 1AZBA 1BAWA 5A7EA 2VSKB 1J5DA 2AANA 2J56A 2HZHA 2GI0A 3NJHA 3S8GB 4E9YA 1ET7A 2IH8A 2IWKA 3WNIA 2HRGA 2GB2A 2FWLB 4A2HA 1M56B 1A3ZA 1CC3A 3OMAB 5D4JA 4MFHA 5B1BB 1OE2A 1X9RA 4X4KA 4TXVB 1A8ZA 1PLAA 1R1CA 2VN3A 3NJLA 3UADA 1BEXA 1N70A 1ADWA 2LLNA 4M3HA 3NJFA 4HZ1A 5TK2A 4BWTA 4AKPA 1NIFA 4BDVA 3NSDA 3NP3A 1CURA 2BWDA 1JZJA 2W8CA 1E30A 2YAHA 2X87A 3AZUA 4N8UA 4DP8X 1PNCA 3PLYA 1XB6A 2YAOA 2BZ7A 3CDZA 3SBRA 2PPEA 2Y1AA 5AZUA 4A67A 1KBWA 3FSVA 4HAKA 1KCBA 2IWFA 2H47C 1V54B 2UX6A 4G72B 4YL4A 4FA7B 5I5MA 5D4IA 4CSPA 1JXDA 4DP7X 2HXAA 3UGEA 1OE3A 3NJMA 3FYIB 3CVBA 3PXLA 5I6NA 4BDVB 1J9SA 1GYCA 2J5WA 2EIMB 2P80A 4P5SA 1EHKB 1PZBA 1JXFA 3EH4B 3ZIYA 4BWWA 1XB8A 2YXWA 6PAZA 3T6XA 1FFTB 3SBQA 2GIMA 3AW5A 4DP6X 4YSOA 3D12B 5IY5B 1M9WA 4ENZA 3H4HA 4KO9A 6PCYA 1W6LA 4P5RA 1L9OA 2MRYA 2PP8A 1TEGA 2IDSA 4DP4X 1ZDQA 1L9TA 1W8EA 1AIZA 2XXGA 2VM4A 3EH3B 1DYZA 2BW4A 3IN0A 2OCCB 1RZPA 4BXSV 3U25A 1SF5A 4AKQA 1PCSA 2XV2A 3NJNA 3OMIB 2QPEB 5I26A 3ZX1A 2PP9A 2X88A 2PPCA 3QJRB 5PAZA 2XX0A 4HALA 5E9NA 3NJIA 1KGYE 1NTDA 1ZIBA 2VSMB 4AKOA 3G5WA 1W6WA 3FU9A 1RZQA 1RCYA 3WG7B 2PLTA 2IDQA 1SNRA 4EF3A 4NB7A 5F7AA 1L9SA 3NJGA 1A4CA 2HX7A 2ZWNA 4UF7C 2YXVA 1WA1X 3T6ZA 1DZ0A 4AZUA 2AZUA 2B08A 1PLCA 1TKWA 4F2FA 1AQ8A 3CVDA 4Q89A 3S8FB 5ANHA 1BYOA 4CSZA 1ET8A 2Q5BA 1ASOA 3NSCA 1JOIA 5B1JA 1FA4A 1M57B 2XV3A 4G7SB 4KNSA 1ASQA 3DKHA 5TK4A 1PZAA 2QPDB 3C75A 3IN2A 3H4FA 4KNUA 1HAWA 3DTUB 3QJSB 5F7BA 5I6OA 2XWZA 1OF0A 1GY2A 2BW5A 2FT8A 2AZAA 1JVOA 2W88A 2XVBA 3KW8A 4DP9X 7PCYA 5I6LA 1AS7A 3NSFA 3T9WA 1IBYA 4G71B 4QLWA 1ET5A 4HCFA 2FQDA 1NIEA 3V9CA 4YSAA 4KO7A 1SFHA 1PLBA 4YVUA 1A4AA 1IUZA 1NWOA 1A65A 1KDJA 4YSCA 2BZCA 2FT6A 5AKRA 2YAFA 3X1FA 1J5CA 3BQVA 2TSBA 3UAAA 4A68A 1B3IA 1JZGA 1NZRA 2PCYA 4A2EA 4E9XA 3AY2A 1AZRA 1GS7A 2FNWA 4F7KA 1E67A 2Y69B 1GSKA 4A2GA 2QDVA 8PAZA 1L9PA 1E65A 1OE1A 3ZBMA 2NRDA 1E5YA 3JTBA 5B3SB 3CG8A 1F56A 1ZV2A 3BVDB 4KNTA 7PAZA 3IBOA 1AOZA 1ILUA 4ZK8A 4NAJA 3ABLB 4KOBA 2BO0A 2XYBA 4M4RB 5PCYA 5B1KA 3QQXA 3NT0A 4YSSA 4JHUA 1NIDA 1NINA 2PPFA 3FQ2A 4GP5B 3JT2A 2IDUA 1URIA 3T6WA 1GS8A 2DV6A 2FTAA 2XLLA 9PCYA 4AI7A 2AFNA 1UATA 4JHVA 3FSWA 2XXFA 1JZFA 1CYXA 3X2QB 4DPAX 5I28A 3CDZB 3S3CB 1HAUA 2VW6A 3EF4A 1JZEA 1AZNA 4W9ZA 1QHQA 1QLEB 2UXVA 1PNDA 3AG4B 3QJTB 2EIJB 2HX8A 2XX1A 2GBAA 1L9RA 4A2DA 4BXVA 1WA0X 1TU2A 1V10A 2E86A 2UXGA 3N2JA 1J9TA 2I7OA 3ABGA 2UX7A 1JERA 1JVLA 2Q9OA 3MX0B 4E9QA 2QDWA 2IWEA 2ZONA 4DPCX 1WAEA 1AS6A 3NYKA 1FWXA 3TASA 4HCIA 1MG2C 4GXFA 4YSRA 5I6KA 1NPJA 3FU8A 1PY0A 2PPAA 3UABA 4YSUA 1AANA 4RH4A 2YAPA 3PAVA 1T5KA 3AG1B 2AVFA 3AG3B 4AX3A 2IAAC 3SQRA 3MBWB 1ASPA 3TA4D 3DIVA 4YSEA 3WI9A 1AZUA 3GYRA 2DY2A 1BQ5A 1QNIA 3ZDWA 5I5IA 1KV7A 4G7QB 2YAMA 5B7MA 3FPYA 2PP7A 3NJJA 2CUAA 4E9TA 3QJUB 2CBPA 3OMNB 1I53A 3WKQA 1A4BA 1NIAA 2A3TA 3X1EA 3EHBB 1PF3A 3FS9A 2DYSB 4W1TA 4N4YB 3ASNB 3WNJA 2R7EA 4GYBA 3SBPA 2EILB 3QJQB 2PCFA 4YSPA 1NICA 5B1AB 1NIBA 4BK5C 1OOWA 2VW4A 4L0PB 1SJMA 4NERA 4YSDA 2DWTA 3HEIB 1OCZB 2RACA 2CALA 4GP4B 3PAUA 4A66A 1ETJA 3FT0A 1X9UA 1KBVA 1SF3A 1VLXA 2MTAA 4UAHA 4KOCA 2GSMB 3UACA 1BXVA 3NSYA 4PCYA 3TBBA 4G70B 1KYAA 2I85A 4Q8BA 1IBZA 2IDTA 4GY4A 5EHFA 1AACA 2QT6A 2JFCA 3IEAA 4JKNA 3S3DB 4YSQA 1BXUA 4BWUA 1BQKA 2N0MA 4HHWA 3X1NA 2R7EB 2WO3B 3S3BB 1JZHA 1OCCB 3ASOB 2EIKB 4E9VA 3T6VA 4E9WA 1NPNA 1KCWA 4HIPA 3N55A 3FPXA 5AFAA 1XB3A 2VW7A 2IH9A 2TSAA 3RYMA 4YSTA 4PAZA 2IDFA 2H5UA 3FQYA 4KO6A 1SHWA 4DP1X 1OCRB 2BWIA 2EINB 2YAQA 2GC7C 1PMYA 2WO2B 1GW0A 2J57A 1ZDSA 2WSDA 3IE9A 1ZPUA 1OCOB 1AAJA 4HCGA 2FQEA 4HHGA 1CYWA 3TBCA 3OM3B 1WS7A 4UANA 3TU6A 1GY1A 5B7EA 4G7RB 1OV8A 3PAZA 2JKWA 3WIAA 1L9QA 1CUOA 4DPBX 4E9RA 1MG3C 2FQFA 2CAKA 2BP8A 1BYPA
chains in the Genus database with same CATH superfamily
4PJBE 2PPDA 3DMMA 1F13A 4F9LA 2NXYB 1CGVA 2NXZB 4HJ1A 2HKFH 3MJ9L 1COBA 1MRFL 5F9OL 4IIQA 1KPVB 4D8PB 2GHZA 4OF7A 3RGVC 2CXKA 4NJAH 2HLEB 3BLKA 3BVNA 5BRPA 4XOCA 3BWUF 1LD9B 5CCJA 1KYDA 4AC2A 5L88L 3FCGA 3H9SA 3AU1A 3F65A 4HGWB 3S0PA 3VB8A 5CBAA 1AHMA 1YN6B 2QSCH 1B9ZA 1IAKA 4FQHA 1SVBA 4OW6A 3HN8A 4LNRB 3FQ1A 2H6PB 2YEZB 4WFFE 1PIFA 4PB0L 4JY4A 3RX5A 2BIOA 2H3XC 1O75A 1IM3D 5I6PA 1NGQL 5DLML 1DN0A 4QT5A 3ECWA 4X7DC 4N8VG 4KVCL 3WUWB 2YOCA 3C2AL 5JORA 4Y4HD 2VN6A 5INDA 4DK6A 1KFAL 1PIGA 4XAKE 4PWGA 4EI5B 4B9PA 2AXGB 5D7IB 5DUBB 3D0VA 4XC3L 4Z7OB 2NY0D 4TUUA 7FABL 1ROWA 2Q1EA 3JTTB 1EWHA 4CJ0A 2J2ZA 5DUPL 2EDOA 4DP0X 3B34A 3RZWA 2O6DA 4Z7QE 3SKJL 4F5CE 2A6DB 4L9LB 4UM8B 3WEXB 4ZMPA 5MEOA 5SWSE 2QKIB 3O6KH 4P49A 4Y89A 1B4JH 1D5MB 4F2MA 3U30C 5D4HA 3B9VA 1JGLL 5C07E 4ABUA 1KT2A 1OTUD 2ATPA 1S6NA 2K6ZA 5FYJL 1DDHA 4UBDD 1IV8A 1F1AA 4YHZH 3VFRA 5FYJE 1J0JA 2AABH 4YZFE 4LSQL 1JZDC 3BIBX 5LGHH 5DURD 4OM1L 1IKFH 2XVGA 1MWAB 3ILQC 2UY6B 4LB8A 2J6EA 2F7PA 5J6SA 3ZDXE 3TESA 2VQTA 3OF6A 3WIIL 1VAHA 5F7WC 2EACA 3DX3A 1P4IL 2FR4A 2DQFB 4ODTH 4LF3A 2Q10A 2FX7H 5EOTB 4E9YA 3QIUA 4I85A 4FP8H 5I1CH 2HH0L 3MRCA 3C5JB 4B60A 3E6FA 1QWNA 1Z9LA 1BFVL 2ODHA 1J05A 1MFEH 4OV5A 2DJMA 2C9QA 1YEJH 1T5WA 4UV4L 5IW6A 3NJLA 3IAPA 3MV8B 4LMQI 4J3VA 1EA9C 3BE1H 4J1UB 3HE7D 4HUWA 5AVZB 3MUGA 4AKPA 3D69A 1YEFH 4MQSB 1FNGA 2C9RA 3DPBA 4WW1B 1HX0A 4C56E 3DK0A 4I18C 1BAFL 1QKZL 4AL8H 5GS1B 4U33A 5HSFA 1XWVA 3RAJH 3RVUD 2XC8A 4IMKC 1HINH 1SM3H 2G5BA 4A67A 1E5BA 5C0RH 5IT2H 4B27A 4IYKA 2UY7A 3LQAC 3G5ZB 3BUIA 4NQUA 4TSBL 3UYRL 2Z3FA 4NRXA 4TRPL 1BQHG 1NH6A 2RH0A 5F93C 1CXFA 2F7IA 1S9VA 4V1DD 4Z7UF 3NJMA 3ZE0E 2EECA 4D8OA 4POYA 4Q52A 4QRRE 4OGYL 1BECA 2HG0A 3BGMB 1ZTMA 4LLMA 4OLEA 1OAKH 1TVBA 5DFVD 2P80A 4P5SA 4XHQA 4KMQA 1CTOA 1O9VA 1NCBH 3EG9A 2X89A 1OP3H 6PAZA 1FFPB 3SPCA 4F7MB 5I6XB 2Y9RT 2AGJH 4NNYB 2GEQA 3E6HA 4HQQL 3TNNA 3D12B 3DJRA 1NCAL 2B1OA 4L0YA 4AEFA 1T66C 1X5AA 4WU7A 2IGFH 4JJ5B 1TJGH 5FLVA 1K4DB 1PSKH 1NJ9A 3CBJB 3IGFA 3TEXA 4MWFA 1NKRA 4EEEA 1KIPB 2LLLA 1CMOA 1C8PA 5AENA 5MENA 1FZJA 2XSKA 4AW7A 4XPHL 3O6MH 4ALAL 4F20A 1QSFB 5IROD 1EAPB 5F7NC 3L1OL 5B38B 4UAOC 1G7PB 4N2LA 1OP5K 3MO1B 1OD9A 3ES6A 4LSUL 1NTDA 3DLQR 4XX5A 3SDXF 3BH9B 3VWJB 1S7TA 1CU4L 5FO2A 3TBSA 4Q6IB 4CKVX 1R9FA 4PJEB 1RK0A 1MWOA 2AAVA 1AZZC 3K91A 4XMWA 4ZFQA 4FJZA 5DQJB 3DRQB 4X6CE 5D71H 1FCGA 2ZWNA 4ABWA 5IR1A 2EVIA 3T0AA 4LLDA 1K4CB 3CSFA 5TPWL 2AZUA 3TJHC 3A67H 4DCQA 5IWLC 1WHPA 3BSZA 4GKZB 5I1HH 3UZEA 3S8FB 3ARUA 3D3VD 1H19A 1BX2B 1D9KB 2W9DH 3LZPA 4JZJB 1KG0B 4WAFA 4YPJA 1ASOA 4AQ8A 1F6AA 2YLHA 5GGQL 1JSYA 2X70A 2NZ9D 2HJFA 3SKOA 2XBTA 3NIDF 2APTA 3FCBA 5HYJE 3ZJAA 4NN6C 2Q2EB 2M2DA 5EBGA 5I74C 2WLYA 4ZFGL 1UJ3B 5IBLC 4OIIL 1DVUA 1G7IA 1INEL 2RCSL 1P7KA 5DRZB 2BOCA 2ZKHL 1QRNE 2WQAA 4LKXB 3DX9A 1H6EA 2X41A 5CUSL 5B8CB 1LK3H 3VI4B 1ND0A 2AZAA 4FFYA 1A6ZA 3ALWA 4G42B 2ZXBA 5LNDA 1HHGB 2PR4L 3DGGA 4JM0A 3MJ7B 1DTUA 1RZ8A 4WJKB 5T3XH 2XQYK 4PH8A 4BFRA 4L18A 3LZOA 2O72A 4QLWA 4X98B 5KOMC 2QQKH 3L3GA 2AK4B 3UJTL 4XWOC 2DKSA 4XVJL 4PJCA 3NPSC 4D0DB 2BINA 4LVHC 5M94B 1I85A 2NNFA 4ENEC 1NC4D 5GGTL 5BS0E 1Z3GH 2K0RA 3LB6C 2NQDA 4OJYA 1BIIB 1G6VK 2X2UA 5KN5B 2Y2TA 3FSOA 4PJDE 1OO2A 3UAAA 1U3ZA 4X5PA 2E7MA 1I8KA 3B83A 4B9CA 3RTQD 2ZCZA 3OSKA 3V4UH 4FMKA 3ULSA 1WZMA 1X5IA 1TZIB 3A3YB 3GMOB 3O3BA 4YXLH 1YEIL 1E40A 1KENL 5DD1H 4G80A 4BUHA 4K3JH 2QHLA 3Q8FA 1IC5H 1BM7A 5JOPE 4NO0A 1SDAB 1ILUA 1DN2A 2BXZA 2VC2L 4TUJB 2XYBA 3JWDC 1B0IA 4MDIB 2IWGA 5GJTH 1E6JH 2IPKB 2HP4A 5TH2A 5JXAH 2TRYA 2AV1B 1MCLA 2PPFA 4LCUA 4PP1C 5BO1H 4NXSA 3ETBF 4A37A 3T6WA 3IMBA 1MCQA 3SGJC 4AI7A 5I2IA 3DURA 2XFXB 3EFDH 1T1XA 3AXLB 3DTXA 1R0AH 1CPUA 2IALB 3T8XB 2E7LA 1FZMA 4JHAL 1MCNA 5GZNA 1KLFA 3CDZB 3KGUA 1W0VB 1AYRA 1ES0B 4PG2A 3BPOC 2YK1L 2XIBA 3LCYA 3SCMD 1Q1JH 3EF4A 12E8H 5K69A 5CLYA 1JF6A 1QYGL 2N01B 4L3EB 5CEYA 2NSMA 2K8MA 3S5ZA 4JFEE 1RSFA 3TP4A 3OL2A 3M17B 4KROC 3GB7B 3HE6D 2E86A 5I1KH 1TTRA 4OGQC 3IDJB 3N2JA 2VSCA 3EO0A 4QMEA 5IHUL 1CLOL 1KLGA 3RWGA 2KBGA 1A9BA 1A0QL 3D06A 3JZYA 3LD8B 1PZ5A 5D6DC 2JMRA 2R4SL 4RZCB 4XMLH 3CXDL 3P4LA 1G1YA 2ZICA 3QFJE 1HTYA 1T2XA 4MRBA 4WI3A 2HRLA 5HYQA 1RIHL 1QR4A 3LIZL 4RFEA 2EIZB 2VKWA 3EBIA 4ZPTA 5B3NA 4JANA 4BCXA 4JCMA 1B2YA 2CDEA 1PY0A 3V6BR 5BRZD 1ZSHA 4FZ8L 2YAPA 5C0ND 1OT4A 2H0PA 2V9TA 1NFKA 2AQ2A 2Y2YA 4WFEE 4FEMA 1JZ4A 1E2ZA 2RBLA 3S36X 4HEME 4G6ML 4MA3A 1IM3B 1PJ9A 1WP6A 1IO4C 3TA4D 5EU3A 2NW2B 4RMRA 2A9ML 2MQCA 3GYRA 3GHBL 1JPTL 4Y4HB 2OR8A 1BFOB 2C3VA 4K3EH 4OZIF 5EORH 1MIMH 4UMSA 3WFEH 1NMAH 3GINA 1YJDH 2DTSA 2NY0B 2J12B 3GZOA 1XVSA 5IUSA 1PF3A 4XPGL 2YIHA 5I19H 2X4UA 5GISL 1QFPA 2VDRL 2XNAB 4Y4FD 4ODVH 3A4FA 3OKNA 4RMSA 2DMCA 3T0EA 3MRJA 1G6RA 2V3FA 3GJFH 3SN6N 1D6VH 2P3YA 3NIFE 4TNVK 5F2FA 1FHNA 1KXVC 2OL3A 4TNWF 4U6HB 2EC9U 4QWWC 1SF3A 5D9SB 2NUPB 4MMXB 2YC1B 2EJ1A 1A14H 5GSRA 4PCYA 3ARVA 2MKLC 3ARED 5DUMH 3TBBA 3GRGA 4Q8BA 2YD8A 1IBZA 3EYQC 1LEKA 1AACA 1KJ3H 1HHHB 1ZHLB 5C86A 1AQHA 1HH9A 2DD8L 4YHPB 3ZE2E 4BWUA 3QNZA 2ZJSL 4N2NA 2HCZX 3BHBA 1I7ZB 2DI8A 2AXWA 4AQ1C 1LK2A 4I1NB 4P46C 2VABA 3O9WC 2IOOA 1TEYA 1QI5A 5KSBE 4OZGF 3PGDB 4JPVL 1OSZA 3LH8A 1TTAA 4IHBA 4E9WA 3PJSB 4RX4A 1V3JA 5BOPA 5H94A 3HRZC 1PFCA 3CVHB 4PLKD 2CLRA 1CQKA 1X6NA 3I9GH 4PJ5D 3SGDH 4AQEB 3KR3H 3ASWA 3FQYA 3WDJA 4HJGB 2VLKA 2IV8A 3P3UA 4NNPH 4QHKI 1OCRB 2E74C 1A6UH 3O3EB 4OLUL 3WL9B 2QMKA 1FCCA 1CWVA 2K70A 5CWSA 3VFTA 4JDZB 4X6BB 1NFDB 3HE7B 1OB1A 2VJXA 1CT8A 4HJ0D 3WFDH 3CK0H 3WLBA 4EUPH 1DLHA 1IQDB 3D1MC 5IK3B 2NUTB 4OCSH 5AW1B 3W5MA 4AE1A 1GRWA 4PJBF 3BUPA 3WY3A 2XBDA 1LEGA 4ZBJA 2C9XA 4K3DH 1G1CA 4Y1AE 4R7XA 4HS8H 5FUZL 2CAKA 5HHVH 1L9NA 1RZKC 4QY8B 3DETD 4E36A 2UZXB 2K4WA 3QQDA 3LVTA 1ZT1B 1A1MB 2DTML 4BGDA 2YD0A 4LLVB 4V1DB 1HE8A 2A4EA 3QRFM 4PGEB 1OF2A 4IU3B 3RL2B 1RLBA 2IMMA 3VGDA 4RA3A 3VXSA 3QXDB 5DD0H 4W9GC 3LDBB 3GSOB 2XT1B 2ZXCA 4W93A 4X7TB 1ZVSB 4WDIB 4L8CA 4GKNA 3QZPA 5IBTL 4Z78B 5I17A 2ZOOA 2WBWB 2VN7A 3DOSB 1N64H 2ICEC 2EDYA 1H5BA 1LM8V 4R84A 3Q6GL 1CD1B 4C47A 2PYEA 1SJEB 3H9HA 5FYLL 3T0XA 1O6SA 3CFTA 2WLNA 4R8WL 4I2XA 4KJYB 5F7EL 3N43F 3LKQB 4ZMYA 5FYLE 3FF7A 4J3BA 3BX7C 4GNKB 1KUMA 1HSAA 1I8MB 5E2UH 4Z7QF 3MNMA 1URZA 2EIEA 4MJ6A 3U48A 4CBPA 1U8PB 5A40E 4B7IA 1WRFA 3ARFD 3CQPA 4KK8C 3WTSA 5BQ7A 1RKRA 2VDNB 4ZS7H 5LG6A 3PCYA 1EVUA 3NFSH 4TOYH 4RGNC 3QEUA 5AL8A 4LCIL 4HOWA 1K5WA 3FH7A 3CIAA 5IVZB 3LHAA 4MMYB 4YZFF 4O5LH 2WVVB 4M48L 5L4JA 3FHAA 4X7CC 5FGBC 4LARL 4FNUA 5H37G 1BBJB 3DDFA 3ZDXF 4P07A 4XAWL 4UOW1 4G6JL 4ZOAA 1KY6A 3QUKA 2EUWA 2VXQH 4JRXA 5DJ6A 1BP3B 1WVZA 2CNZA 2Y7QA 4CDGC 1MVUA 3GXUB 2Y1YA 2Y5TB 1PZ2A 1TIUA 2Y06H 3W81A 4LHUG 4GG6A 4TTGA 4IKNA 2GI0A 3WN6A 4XHJC 2DIJA 2IH8A 4QR7A 1FUNA 3IXAA 3K5RA 3WNLA 4CN4A 2FWLB 5C09D 1THAA 4U6YB 4JN2B 4LRNH 1CFQB 1TFPA 3GRWL 4YDLB 2A9NH 4JRYD 4YBQD 3N0AA 4NPKA 1C12B 1SLVA 1R1CA 2VN3A 4FG0A 5HYSB 4PJHE 4XNMB 4S1RL 4LHJB 1KIQA 3GBMH 1RUPH 2G2PA 3COOA 4XPTH 3W0WD 4ZQTA 1LP9A 1JV5A 4JY5H 2FATL 1NC4B 2BPBA 3AGWA 4HU8A 2C7UA 1M1XB 5FYKH 3BP6A 3QUXA 4NNXA 3G6JB 4PLNC 4ZUTA 4ODSL 3R8QA 2AQRA 1AE6L 4KH2A 4W9LC 3GIZL 3H6JA 3SBRA 5FO9B 5IFAL 4GRWE 3ZE0F 5I66B 3CDGA 3VXUE 3VXNB 2WPGA 1IBGL 3HG3A 4XMVA 1PQZB 1R3JA 2BVOB 3HW7A 3LRLA 3M88A 4U1LA 3HRPA 3VXTB 1BVLA 2WIIA 2CO7A 1FC1A 2Q7NA 4Z7WB 3TOPA 3OB0H 2G4GA 4G7VH 1Z9SA 1DBAL 2JTDA 4CMMB 1C7SA 1MI5E 5EZIL 2XA8L 2A9CA 2BJMH 1CB4A 4JDTH 5AB2A 2AV7A 3CMGA 2LV4A 3RIKA 3EO1B 1MUJB 2B0SH 4XWOD 5A16B 4BH8B 1P5UA 2GJPA 3FUKA 3TJPA 1MCKA 3H4HA 3P3SA 2VXSH 1TSHA 3R1GH 3CWGA 2FHBA 5TD4A 4LRIC 4UTCA 1I8IB 1W91A 2A1WH 3B9KC 3MRLB 4HT1H 3SCMB 3KS0J 3T3ME 2VZUA 1F2QA 1ZJAA 1TZOA 2F8XC 2X9XA 4LEEA 1DQJB 1R33A 1KXTB 3DROA 4CILA 2LW3A 3U25A 1SF5A 1XXFC 5E1GA 4AKQA 1DUZA 3VU1A 1PCSA 5DXWA 4XPFL 2AQSA 3IJ9A 3HE6B 1R3HB 4HS3A 5DMIH 5I9QB 3P4NB 4X6CF 4E41A 4CADA 4U2YA 1YYMH 1FORH 2NY3D 5J12C 2NY7H 5E8NB 5I8KH 5IJKC 3ULUC 1T7VA 2GFBB 2PLTA 4KRLB 1F97A 3WBDA 4A6YL 2J3SA 4NB7A 1IGFH 1L9SA 4G6KH 4X7SL 3VFMA 1BIHA 5DLLA 2ERJB 1MCCA 2CPUA 2YJQA 5E6YA 3TT1H 3KGTA 5C0EB 5BRZB 2GIYA 4FHKA 4PP1D 3IPBA 4UDUB 1ZGLP 3H55A 4HC1A 3B6SA 2Z91A 1BYOA 1PLGL 2Q5BA 1L9MA 2XN9A 5DEZA 4OFDA 1KTDB 4GAGH 1GAFL 3DNKA 3DHJA 1OP4A 1MRCL 1U8IA 3OLGA 3QNYB 2VDQB 4TNVF 2BVUA 2BFVH 4L4TA 3IN2A 1PDKA 5EU7C 4JNXA 4UZSA 4H88H 3OKLA 2E5EA 1CK0L 4UCFA 3FOLB 1XZ0A 4X4YA 4W9CC 1HAWA 1JGIA 1RK1B 2G75A 3VTMA 3WIHH 2OPCA 4LP5A 3SDYL 5CKGA 3Q43A 1MW1A 2DZEA 5ADOL 4KPHH 3L3KA 2JLLA 3I6LE 4Y4FB 1JNHB 2CDGA 3Q2LA 1AS7A 4F8NA 2F7RA 3NA9H 5EU6D 1IBYA 3AM8A 1UUSA 3EDKA 5ESQA 3MA7B 3EYFA 1HWHB 4PJDF 3SJVA 1L6XA 1MHPL 2WTRB 1B0GA 5KYNA 2HLAB 3LXUX 1YY8B 4B96A 1V05A 4CW1A 5DJ8B 4URTB 1NUFA 3D07A 4DZ8B 4F9LC 1SXBA 5TDOB 4NLAA 5I82A 4DNLA 5J89A 1JZGA 5DHXB 4XC1H 1MAJA 3QEGH 1SEBA 1ZA3A 1LO3L 1WZKA 2FNWA 4IIQC 4A2GA 4Z76B 1LO2H 1OE1A 4NBZB 4DGYH 2NRDA 1AKJD 1U8LA 3BWAB 3KEDA 4H8QA 2CIIB 3LQZA 3B5TA 4EZMA 1I7TB 3IBOA 4O58H 1JUFB 1OARH 1OTSC 3BFQG 4KC3B 4NCC1 4ZD3L 1G9EA 2ALWA 4HZAA 1JF5A 4IBZA 4G5ZH 1J0ZA 3NPZB 3L1FA 2QJDA 1XF5A 4Q4EA 1BWWA 3FB8B 1HDMA 3QQXA 1AHWC 2Z35B 4JPKH 2HPOA 3BEWB 2WQUA 3MOAH 4XN1A 1FL6B 1M7IB 2VWEE 1ED3B 1TO4A 2AEPL 5GPRA 3V4PH 4NX0A 1T21B 2WMPA 3VACA 5HY9B 3U30B 2EUVA 2HWZH 4GSRA 4I48B 1T3FB 3E80A 1CD8A 4AE0A 2PF6A 2ZYSA 1FBIH 3FT3A 2EE2A 2PW2B 2QLVB 4QWWD 5EZLB 4F37K 3NCJL 5I16B 2DMBA 1FL3A 1CE6B 4LBEA 5I1EH 1NMBL 2R29L 1UKTA 4L23A 1M6UA 4NI3A 5DYOA 5JHDE 4NQDD 3EYQD 4RQQA 1CLYH 2VUKA 5KVEL 4FYTA 4G9DB 5KVEE 1ORSB 4PY7A 4A2DA 4XX1E 3OSVA 1KGIA 3P2BA 1K2DB 1KEGL 2OZ4H 5ETUA 4ES8A 5AYUH 4MNQA 3O9WD 5BV7L 2DLFH 3QORA 2X4PB 4IK6A 1C16A 3ZPDA 1RULL 1HHIA 2ZE0A 1JVLA 5C0FB 5EUOA 5EZJA 4RGMC 1E3FA 3VU2A 2VZSA 4DZBB 3RBGA 3OAZH 4K9EH 3KYMA 4JHWL 1KJVA 5GGVH 2IPUK 4JQIH 1VIWA 1KYOJ 3CHQA 1OXYA 5DD5H 4XP1H 3ULVC 1Z0MA 5G2NA 3O8XC 1KGJA 2EH8H 2PTVA 3U0TA 1A3RH 1BZ7A 4N3TA 5TDNA 1OHQA 5LUMA 3BZDA 3H6AA 2HKHH 3LKSB 4DKDC 2YBRA 3F6IA 4NCDA 4HH8A 3U36A 1MFCL 3LN9A 4AXWA 4K94H 4DO5A 4MB5A 4NUQA 1XCTB 1J7VR 2IAAC 3C6LA 3H1ZA 4XP4L 5BW7A 3HZYA 4I18B 4K7PY 5FW8A 2FO4B 4XB3A 1NCGA 1P5VB 3DXAD 3KPRA 2W07B 3LYRA 1INQB 4OCYH 3S5LA 2H9GB 1XIWA 4G7QB 5FEBA 1A7NL 5B7MA 3GXDA 2PP7A 4J12A 4PJXB 1QX1A 5EO1B 3ZDYB 1WEJL 3CMOH 4LIQE 5EN2A 3ARFB 4WWPA 1XCXA 4L8BB 5DMYA 1PY4A 2PW1B 2E75C 3RPBA 2YD9A 3NJXA 4GYBA 4DVBA 3NIFF 5C08A 4GRLA 4R90L 3MI6A 3IDXH 3JVGA 3QUMB 1S5IH 4QF1B 2X6UA 3QQ9C 4KFZC 4YZWA 4PRHD 3FBKA 2CXGA 1JHKH 3ECUA 3PAUA 2R56H 3ZE2F 1F4XL 4E2OA 3TJEL 2RALA 4PRNB 4KZEL 1LQSR 1NAML 1HOEA 1EJ6A 2DYPD 4XN9A 4Z3TA 3QNXB 4NGHL 2C1PB 3MCKA 3MXWH 4C83B 3S2AA 5KSBF 5L2KE 4C58B 4BEIA 2QADC 4O02A 3X1NA 1RUKL 4U1NB 2YSSB 2Z64C 2WLHA 4JM2C 5EU4A 1PBYA 3ASOB 2OTWA 4LE8A 1RXLA 1T20B 1MLCA 5C09B 1MVFA 3N55A 5F7UA 5KVMC 4ZSOE 5H35B 4YEFA 2VDKB 3V5KA 1F2XK 1H6FA 2CLZA 4IS6A 5HGAB 4UT7L 4Y16A 4JRYB 4LCWA 4QEGA 5EC1A 4PGJA 4O51A 4JPWH 1XEDA 3HZ3A 2XQYG 1R5WB 1A2YB 3MTRA 3W0WB 2YD7A 4OZFB 1NC2A 3QO0B 2C8NA 1AAJA 4B53A 4KDWA 2CJUL 4YR6B 3KAAA 4KHTL 4HOZA 3SGDI 2BSBA 5IB3B 3Q2NA 4HU2A 4NRZB 3S3SA 4L8DB 4RZKA 3LKPA 3D4GA 3GC3A 3ZZQA 3Q0HA 1XAKA 3U7YH 2JCWA 4G8GE 2FNBA 4NN6B 4BUGA 1DFBL 5C9JA 1KCKA 4MNGE 5I74B 3BVUA 1UTDA 5F1KC 4F7TB 1UVQA 2VDLL 3B3IA 4L5FH 4HG4K 4GUOA 3AU0A 4PSPA 4LQFL 4XO5A 4JAMA 5DRWB 4UTAH 4XHJD 3MJ8B 4HDIA 2ZX9A 4UI2A 5DD3L 3BO8A 1MIEL 5EZOL 1U3JA 3UZEC 3UTZB 4AJ0A 2JKRM 3BVTA 3MCLL 4M6NH 5IQMA 4AQ8C 1CLZL 3HAEB 3Q9PA 1SYVA 2XIIA 2QKSA 2J71A 3QQ3B 3EOAA 4WK4B 5GGTA 3VXQA 25C8L 2R1XB 3A4AA 4UU9A 2H1XA 3JT0A 4JE4B 3NPSB 2ADYA 1ETZB 1L7TH 2VOTA 1KBPA 3PGFH 5EEZA 5FDWB 3QG6B 1FFRA 2WKLA 3O3DA 1DBBH 4ANKA 4Z77B 5GHWH 4AYBA 1NDTA 4J6RH 1UOVA 4AT6A 2WCSA 4MXVE 3UZQA 4AZ8B 3ILEA 4EI6A 3TURA 3TV8A 3FU7A 4MKTA 1EFQA 3LV3B 5GGUB 5CN1A 3VD7A 1ZRUA 4OBSA 1WBXB 4GW4B 5JW4N 1E6OH 1L0PA 1SFDA 4M8QA 1N67A 2JLPA 3WHE0 5DRXA 3CQFA 1XCQA 1YUKB 2ED7A 2HJKB 2V8MA 4OGZA 4IEFB 2NY3B 1QA9A 3L5XH 4NM8H 5DDHA 5IB1A 4P0DA 1PKQB 1BMWA 5DK2A 4OJFH 1OTTC 5H8DA 1W72H 3IF1A 5I75C 2QPFA 4MCYB 2BSRA 1KY7A 2KZBA 3WU1A 3WD5L 3FT4B 3H2PA 3UX9B 2IFGA 1CO1A 4RMBA 2FJSA 2AERT 4EUPA 5GS0H 2Y3NA 4B9JA 3D18A 3MRIB 5F8QC 4H1LH 2H8PB 1XF2A 1AQKL 1QG3A 4FXLA 5CEZL 4ODBD 2HTLC 4BFIB 4EIBA 4U1HB 4P05A 1XR9A 5CEZE 1YG9A 1LLAA 4D0CA 4BZ2H 2RR3A 1GGCL 2I5YL 1T0NA 2QQLH 4OBRA 3CZJA 2HRGA 3QDMA 2A77L 3MV9A 2PCFB 4PJHF 3ZKXC 3RQ3A 3MV11 4WSKA 2AMGA 1A7PH 2KZ1B 1NAKL 1ZWIB 3TBYA 2R2EA 5GZNC 5FIEA 3Q05A 4QRUA 5EU6B 4B0MB 1VSCA 4TXVB 2J6WA 5FECB 4I2XE 1QO3B 4PG2C 4TPRH 4H44C 5SV3A 3PV6B 3MV7B 1XGTA 3RX9A 1X4XA 4M3HA 1MJJB 2OYLA 1B4RA 3TPUA 1BD2D 1WZ1L 1U8KA 2J1KA 4KUZH 4GRWF 4CC0A 4OAWA 1XGUA 5L9DL 4BZ1H 2DPKA 1JZJA 4RFNB 2W8CA 4K8RD 1FNLA 4NHUA 4K07A 4Y5VA 3SHSA 4OFIA 3IDMB 4M1DH 1OALA 4K5MA 3WCYA 3WXWH 2ADFH 3EAKA 3ZMNA 4ZRGA 4ATTA 3KYKL 5DTFA 4DVRH 1VZIA 3WUZA 1SMDA 3PABB 1E7VA 3R18A 1ZTXH 1AKJB 4LKCA 3KWWB 2F7OA 4E0RB 4JKPH 2IWFA 3HHSB 1U8OB 3ZRSA 1A6WL 3F01A 4FFWD 1H15B 3VI3B 2W59A 4ETQB 1JTTA 4OF8A 4JRXE 3MLRL 1KGCD 2JJWA 4FE9A 5CLWA 3N41F 3AABA 3L3DB 3MUZ1 1ZVHA 3N40F 5FXCH 1AVAA 2XKNB 3MX0A 3LPOA 5D1QE 5FO7A 4LOEA 5SWZD 2MH4A 5EOCJ 3GSVA 3UZVB 1TTUA 3T3MF 3RDTC 3IU3A 4H8WH 3RPKA 2EEAA 4YSOA 2VXQA 1R5IA 1A4KA 1HT6A 2MRYA 1C5DB 4H8UA 4IRJA 1ZLEA 4QPEA 4X80H 3VE0B 3S37H 1EO8H 2APFA 3VH8G 1DJIA 3FOMB 4NJAL 3ZTEA 3G08B 4QHNB 1DYZA 2BW4A 4NQDB 1SJXA 3MBEA 5D1XC 1EZVX 5D2NC 1QI4A 3H53A 1MCRA 5BUGA 1P7QA 4LCYA 1DBKL 3ZW3A 4JFZL 3PL6A 3T0EC 5I1AB 1DEEA 3D6GA 4P46B 1JFHA 3O9WB 4Z8FH 1I1CA 1HNGA 1U8CB 2ESVD 4X4MA 2VDOB 1U3YA 1GZHA 4H8HA 4OIBA 3TC9A 1WISA 2ROYA 5HI5C 3H9SD 1OTSD 4AGNA 3CFJA 3TO2A 3LXBA 3HRZB 2ZP9A 4NQXA 3GSWB 2J43A 4M4PA 1ROCA 3BKMH 3DHMA 3QH3A 4M6OL 3TV3H 2XG5B 5ICYA 3DSFL 4JL2A 4UIMB 3M8OH 5EBLB 1DQVA 2XBZA 2BY3A 2ZWKA 1DQKA 4NT6A 1UT1A 4DUXA 3D4ZA 5BQDA 1LWRA 1MAML 3U0PA 2DQIL 2V17L 1AGDB 1FO0B 5HDLA 1T1WA 1YNTF 5F7HA 5F3FA 1C08B 3CSBA 3DKHA 1R75A 4GQQA 4PJFE 4OD2A 4JN1L 5D7JD 4FLSA 3L5WA 1L3WA 2XRAL 1MW3A 2H32B 4ELMB 5LGHL 4FNLH 4NP9A 1AKPA 1GL4B 1NEZA 1HHKA 2GI7A 3QNFA 1KXHA 4UM9B 4JFOB 4I3SH 3C6SA 3WFCH 3UC0L 3TCLB 2VLME 1XSOA 3T9WA 4ODTL 5HPMA 2FX7L 4EVNA 3HMWH 3V9CA 5SX4H 2F54E 2Z1PA 5IF0B 5B39B 2EZ0C 3GSRA 4X50A 5F3HA 5AOIA 3KVDD 3O8XD 3OF6D 4MQXC 4G9FA 1MJUH 4JGMA 3FN0L 2ICEB 2K1MA 3DUUA 1M3IA 2P43B 2UWEA 3VYOA 1VRSA 2B4CC 4A2EA 1RAMA 3RNQB 1AP2A 1FVCA 3RI5K 1IMHC 3VFGL 3E8VA 2FGWH 2WCPA 1CVRA 1KB5B 3CFNA 3H2QA 2Y5QA 2Z9TA 2NYZA 3BSHA 3IMUA 3ZBMA 3WAKA 4WW2B 1MWAH 5HJ3B 3ZE1E 3MBXL 2WXQA 4UNIA 1VGEH 3C5SB 4KMTL 3CG8A 2D7NA 1L7IH 3FK3A 3T2LA 5F97E 3RAJL 3HB3C 1HINL 1TZ8A 5E00A 1TLMA 3MNZA 3FQTA 2P7TB 2R2HA 3LQMA 5C0RL 2E59A 1H5BC 3ZYOA 3TTSA 2NR6C 4XXDB 4DKEL 4ONGL 1MNNA 4JHUA 2NYYC 3IDGA 3QXWA 2Q86B 3O6FA 4DH2A 5K1NA 3KH3A 5G4NA 3FO9A 2KL6A 5D2LA 1RPUA 5HGHA 5LO7A 2FZ3A 4F8OA 4APXA 2JJVA 4Z1PA 5HDQH 5MEPB 2F8VA 1LWHA 4HISA 3D9AH 2FD6L 1PEZA 3QCVH 3P3RA 2DQGH 2FSDA 3EH2A 3V5DA 4BFOA 3EOBA 1U4EA 2ED8A 4M7JL 3FZUC 1QHQA 1QLEB 5ICUA 2XKUA 1E42A 4FTDA 3KHOA 1AD0A 2QADD 1BZOA 1N5AB 2IGFL 1E9OA 2YPVA 1U2CA 3ZT5A 3U9PH 1BM3H 4F57H 3FTGA 1FFOB 5K9OA 4JM2D 1ZANH 2FYYB 2WUBH 4LOFA 4QYOB 4XCFH 2WVTA 5F1IB 1WWCA 4ADJA 4TVUA 1G84A 1D5ZB 3NZHL 2H41A 1ZS2A 2MOGA 2JE8A 4CJ1A 1PD6A 4X99B 4E9QA 3UP1A 4O00A 4K5LA 2M8XA 5ILTL 1OGSA 2XTJE 3IJSA 4HLZG 3LSOA 1M2VB 3FU8A 3TNMB 4GG8B 3HUJB 1KN2L 3C60D 2IANE 2A6JA 5F0LB 2HAZA 3DIFA 2XY2A 2OXHB 1BBDH 2EP6A 3HLAA 4PBXA 5IIEA 2IIJA 3VGBA 1FHGA 3KXFB 4MJID 5H2BA 4S0HA 1NCHA 5D71L 3MMEB 4UQCA 3DJZA 1XTMA 2FH6A 2X6CA 3WI9A 4P23A 3FNKA 1U8QB 5F9JB 4R4BB 3WKYA 3N50A 4IBSA 5I15H 3FB5B 2VXUL 5TGBB 2WQXA 4CGTA 4YDJB 4E9LA 4FLOA 2OK0L 2Y0SA 4HUXA 4WUUA 1UASA 4MYWB 1EIBA 2CLVB 3KLAA 2W9DL 4G82A 3SY6A 4FERA 5LGKA 1VFUA 2FGZA 4BQCA 4JB9L 2CKBB 4F27A 4ZUUA 3WN5A 1H6TA 5LGJA 3QEHB 2ZOLB 4MNHA 4MJ5B 1NLBH 1BWMA 4MQ7A 4RISL 2WYZA 4EOWH 5C9KA 3QUXC 5B1AB 1AFVH 1NGPH 2EIBA 2EYSA 2Z31C 4N0FA 3VQLA 1SJMA 5HHXH 4IGBA 1QNZL 3ET9F 5BOZG 5KBDA 5FW6A 1OAQL 1LK3L 2AF2A 3REVA 3X14A 1CI3M 4BA8A 3DVNA 1YYLL 3GMMB 4MX7A 4ZOEA 1JS4A 4AK2A 4DGWC 1Y7VA 2YFOA 2KPWA 2VMEA 2XZAH 4UYPA 5T1MB 4ELKB 5T3XE 3PE9A 3WOVA 1XBRA 2HB0A 5EHFA 2QQKL 2CRIA 3P73A 4L1HA 4LDOB 4UQAA 5J3HC 1MEXH 5I30H 3Q2WA 4AMWA 4QXVA 2V2XB 4N8VB 3WNMA 5FDYA 4D3CL 1F5WA 3KPMB 3K6OA 2EXWC 4K5OA 5ELIA 3T6VA 3DO7A 4FCHA 2GJ6A 3D8MA 3MLVH 5E9DE 4N0UA 5KZCD 3KBEA 3AQDA 1P5UC 3MLZL 3FPXA 4HGMA 3STZA 5AFAA 1XB3A 3RP1A 2BZDA 2PNDA 2X4RA 3SDAA 1T83A 4AYEC 3UBGA 1QWHA 2CHZA 3KPRE 3WV0A 4DP1X 4Z23A 2COVD 1KSRA 2CHWA 5F7YC 5IFJB 2BSED 1BD2B 2R23B 2B5IB 1T2JA 4NHCL 4WO0A 4Y5YA 3TBCA 3MZGB 3SIKA 1CL7L 3T3PE 1Z7JA 5C0IA 5GRXG 1WD8A 3UCRA 2DM2A 5JXAL 4UT6H 3GPEA 5C08E 3NEEA 1RUQH 3S8WA 3QP3A 5JHBA 3VJ6B 5CD3B 5IEKB 2R8SH 3B7YA 1H0DB 1DANU 3QIWA 3KLHC 2OMTB 4GP8B 4QO1B 1KJ2A 2YPKB 4LGRB 1ZY9A 3D39E 5DJCB 3QK0A 4KRMB 4KDTA 3RZCA 4NN7C 1I9IH 1NCCH 2DLHA 4PFEA 4Q6YA 4Y9GA 2I9TB 1OP3K 2G60H 3NIGE 5IB2B 5JOFA 5SV4A 2OX5A 4FFZA 5FHAL 3ZDZE 1VFAA 5SWZB 1RV6X 2BNUA 5DS1A 2VLRB 3MLTB 2BHZA 2N56A 4R2GC 4DTGL 4MXVF 4X6DE 1FYTD 1MCWM 2P49B 1IM9A 1S7WA 2DM3A 1TVHB 2CO1A 2D7MA 3K6NA 4CC1A 4UOZA 2Z93A 3T4YB 4DP2X 3AGVA 5TE4H 1I8UA 2EE9A 4JO1H 2JJSA 4RAUB 1UKSA 3NQKA 3QRLA 3TH2T 5HBBA 3L95B 3TBVA 4R97B 5DHVA 3W9DB 2X3AA 2KUTA 5KSAD 1BOGA 1I3GH 1RIVH 4NN5C 2X10A 1MAKA 5JW4Q 2ESVB 1E0OB 2VDPL 3BVNB 3ZTNL 2BP0A 4QXTA 5I1JH 4KFMA 3U79A 3H9SB 3AU1B 1T6WA 4J27A 4HWEL 5CBAB 3S4SA 5IMOB 1EZLA 2CHNA 3CFUA 1IAIH 3VXME 4CVWA 4G8IA 3LNGA 5EORL 1MIML 3WFEL 1NMAL 4Z3GA 1YMHB 4KO5A 3HTLX 4PJ8D 1U91B 1AHWB 2IPUG 1FE8H 1BLNB 3GZQA 4XOEA 2ICCA 4NKMB 1DN0B 4QT5B 2KZWA 3HLKA 4U3XA 1A22B 2XV0A 3RDTD 3RG1C 1G7QA 3KG5A 1MRDH 4UQ3A 3CZUB 3AMLA 4ODVL 4ZAKD 3UTSA 3A4EA 3WKPA 3H9ZA 1T89A 5I66A 4PJIB 3VD5A 5CP7B 3F12B 4UNTA 5TFSL 4ZMXA 2I25N 4B5ZA 4X4XA 2OS7A 3GLEA 4E42A 2AJYH 3CXHJ 5D1XD 3RA7H 1J12A 4HZLA 4AGQA 2VSKB 3P40A 1WBZB 5J5EA 2OYMA 3PHOB 1A9EB 4B9YA 3NESA 4GI6A 5MEOB 1R3IL 4QRQB 4Q7DA 3I84A 3VRIB 4AEHL 1MJ7H 2P8MB 4F2MB 3GXIA 3WXVH 2R1YA 1EXGA 1KT2B 3RI5F 4U1IA 1XGRA 2Y3AA 3N1MC 3GBNH 1KGXA 3BP4B 4J23A 5DQ9A 4RGMB 4TQHA 1WE5A 3ATAA 3EJRA 5HI5D 3CDYA 3NG5A 4LNVA 3F7VA 2E47A 1KCSL 3QB7C 3US1A 2P5ED 5C7ZA 3IFPB 4M8UA 4HFWB 3QCUH 2FIKA 2X9YA 2EEFA 4ZO9A 2ZXQA 4OD3L 3ZTCC 2DQTH 1KIRB 3O8XB 1Z5LB 3GXNA 3NSDA 3ARBA 1HE7A 2XJLA 4AMXA 4CMHC 2FEEI 2ZSVB 3I9GL 4WVRA 1N0LA 3NN8A 4LF3B 5F6HJ 1FN4B 3HI1A 3QORC 2EDDA 2CWRA 5AUMB 1Q9KA 1CR9L 1A6UL 2B1HL 5LBSL 3NDZE 5KOVC 5MERA 3FQNB 4YHLH 3T1FA 2V2TA 3FSVA 3KL3A 1PKOA 2DQUL 3QXUA 3HS9A 4GRMA 1KWKA 3U83A 3G6AB 3MLXH 4HPOL 2H47C 3CC5A 1V54B 1MFMA 4OCXL 3IRZA 4HLJA 2VLKD 4OCSL 3WTTA 3S97C 4OV5B 1X9LA 4J4PA 3UG4A 1IVTA 3FYIB 1W72A 3K4AA 5DT1L 1INDH 3IFNL 3ESOA 4XCEA 3BT2L 4HUWB 2BIIA 3PXLA 5I6NA 1WFMA 2WBKA 2AKRA 4OF3A 1N7MH 1LNUA 3HS0C 3EGXA 3C6LC 4U1MB 1OAZH 2RIKA 3CVHH 5EF3A 5HHPB 2Z0BA 2F53E 3QS3A 4GBXA 4M5SA 5D7LD 2VR3A 3AW5A 3RVWD 5F9DC 1I9EA 1IGYA 5DS8B 3QDME 1TEGA 1ML0A 3EJSA 1BHGA 2BDNL 4MQXD 4TLKA 3ZL2A 2B3RA 3V4VH 4YUEL 3W9EB 5BMFL 2LT9A 1ZMYA 4JKMA 1RZPA 5JZ7D 1PYWB 5HD8C 4GRLC 5F71A 2QADB 3CH1A 4R7LA 2YWZA 1S9KC 3I6KA 3KWVA 2GSGA 1KB9J 5FFLA 4JM2B 1OSYA 1UH2A 2DDQL 2WOYA 2VXTH 4F93B 3FB7B 3M07A 2IC2A 5EO0A 3EG9B 1D5BB 3GGWA 4FXGA 5LXVA 4H5SA 3ECQA 3HB3D 5SX5H 4WU7B 3WAJA 5C0GB 4ALAC 2NR6D 1WIPA 2YXVA 3MRDA 4HPYL 4HS6A 2VZVA 4XX1G 4AZUA 2QSQA 3NFPB 2NY4D 2OJZL 3EYSH 4ZS7L 1CF8L 3RVTC 1DHKA 4PRPA 1GGBL 2CK0H 4NENA 3UJJL 4AH2A 4L9DA 4H0IA 3WTYA 4PJFF 4MJIB 5E6RB 4CSZA 4ODWB 1NCWH 2BP5M 4H20L 5LN4A 3UAJA 4KKBD 3FC8A 2LU7A 2Q8BL 1OQXA 3V55A 2HT3D 1OK0A 4F91B 3TF4A 4YE0A 1A1OA 2YKKA 1UM5H 3H4FA 3N42B 1RK0B 4G1EB 4Y16C 3D34A 5ESAA 2HJLA 4X42A 4LLDB 5GRJL 3ARWA 4N22A 1WAAE 4WHTA 1G5GA 3GJFK 1J5OH 1I1YA 2CKNA 3CN2A 5DJDA 4K15A 3D25B 2ZX7A 4A39A 3MRPA 1FLTX 3G5VA 3D48R 1F6AB 1N2RA 1PG7L 2X70B 1SLXA 2H1PH 4KO7A 3MRKB 3BUDA 1SFHA 2ZZUT 3C8KA 4LRNL 2J7LA 4YHNA 1JL8A 3PRZA 4HKXA 5AVUB 2A9NL 4LASH 5KBNC 4IQHA 3ZE1F 2TSBA 4LAQH 5I76B 1P7KB 1PGRB 4N1CA 3Q8AA 5DSCA 4YEEA 3DX9B 1KBKA 5CINL 4F58H 4JY5L 1F41A 1MFUA 2MHAB 2Y69B 5AYQA 8PAZA 3LZRA 1E65A 5GRUH 3DGGB 3KGSA 3MRHB 3GKWH 4WKZA 5G5DB 5FYKE 3Q13A 2Y25A 3FQXB 5KZCB 3SZ6A 1V5JA 3DVFA 3B2MA 4PJCB 1T0OA 1CGYA 4XP9H 1U6AH 4XMKL 1X5HA 3TVMC 1TJHL 1JDCA 3VXRD 1A5FL 3CFIC 5EDSA 1A6TB 4UZUA 4JG5A 3V52L 1KPVA 1NINA 3O45A 4OSUH 4D8PA 3HN3A 2Z31D 2JIXD 1ADQH 2ZCKL 5CS7A 4P9HL 5IVXA 2P5PA 1KOAA 4XRCB 1LD9A 4MSWB 1UATA 1YA5A 2Q8AL 1EUTA 4M5YL 5FM5M 4JHVA 3QIBD 1MHHA 4YGVB 4G7VL 4HGWA 5DMGD 1YN6A 3O3BB 1CYXA 2M26A 1JK8B 3T1WA 2BJML 4LNRA 3TO4C 2H6PA 2CGYA 1RERA 2D3JA 2YEZA 4JDTL 3JWNC 4MAYC 3RWEA 1AZNA 5ICXB 4M61A 1YSOA 4PWEA 5J3HD 4GUCA 4WCYL 3R1GL 1MKFA 3KPLB 3QZOA 4OVVA 4R5TA 1XCWA 2IQAA 1RMFL 4EI5A 4HT1L 1MCJA 2YGVA 4KK6C 4WTXA 2AXGA 5D7IA 5K9KB 2Q2LA 3BWSA 3UERA 1DVQA 2JKXA 5ICZB 4NSKB 3ZKXB 3OPZL 4Z7NE 3JTTA 2ZONA 5HHMB 3PXHA 1T1XB 4PJ7E 1DE4A 2QGDA 2AQNA 2IADA 4JQVA 1KLFB 2A6DA 4L9LA 2EDLA 4UM8A 1YYML 3WEXA 1FORL 2QKIA 3KGRA 3NMEA 4AVJA 2NY7L 1LMIA 5BZWA 2E7BA 1FYTB 3VD0A 3INUL 1MCIA 4WEBH 1T5KA 3O2DL 5MI0C 2X3BA 1EHLL 2R0LL 3IDUA 5KUKA 1IARB 3CLWA 4OLVH 3TA3C 3EO0B 5I73C 1QSZA 2HT2C 3DX0A 3HBPA 1XGYL 4E41D 2CA4A 3RWGB 3TT1L 2DY2A 1BQ5A 2UZIL 1A9BB 3UPCA 2VQ1B 1MWAA 2UY6A 4KI1A 5KG9A 1N6UA 3U4AA 5KSAB 4P9ML 4JFHE 4MA8L 3MN8A 3X1EA 3U4BL 1AZVA 4HWBL 4RFEB 2EUXA 1IGCH 4MBOA 5EOTA 5KYUA 2P9RA 3IS1X 2Y6TE 5AVXB 4YSPA 1XV8A 3LXCA 4OCRL 2BOLA 2DLTA 1G0YR 1MW2A 2NDFA 3C5JA 4KTDL 4C8XA 4JM4H 4PJ8B 1AXSB 1NBYA 3T8VA 3ESNA 4R6UA 3ETTA 4TULL 1OCZB 3PWLB 1K8IA 2CALA 4KKAC 3QG7L 1ETJA 3CUPA 3RDTB 1X9UA 5KTEL 1AGCA 3MV8A 1QFWH 5GSVB 2BNQE 4UAHA 4R2GD 2BS8A 5FGSA 4J1UA 3ULAB 3NSYA 1RK7A 1JFQL 2VL4A 1T1ZB 5K59E 2NCEA 2JFCA 1BG1A 3S3DB 3DX1A 4MAZA 1UYWH 5GS1A 4JQXA 2XFGB 4RWHA 5D1XB 5D2NB 4CVZB 4PGZA 2D0HA 4NI6A 4XH2A 4XBMA 3OKNB 3VDBA 4LP8A 4X8CA 1NOFA 1WCQA 2XWDA 3OG6B 1TQUA 4OIFA 2X4QB 5FX3A 4WFFD 1AIFB 3LNFA 3OAYH 2AI0H 4HIPA 4JJHA 4U6VH 3ZVVA 4XC1L 2JK5B 4TVPL 5FWQA 1LO2L 1GVIA 2IDFA 2ZF9A 1NGZB 2H6UA 2P5EB 3BGMA 5GSRB 3T3PF 2XQBL 3WJMA 1JPEA 1GW0A 1ZDSA 2WSDA 4URKA 1FGVH 4WUUE 4XAKD 5D7KD 1HH9B 4LL4A 5AWNH 4HCGA 2BHYA 4Y88A 1FFPA 4QXWA 4ZOCA 4F7MA 1RL1A 3PL6C 1H3XA 4NNYA 1WS7A 2VABB 4LXFA 1LDPH 1FPTH 4YX2H 4G7RB 3MOAL 3F5WB 1GZHC 1N8ZA 3EZ8A 4KXBA 5CCHE 2CO6B 5AEAA 3SDXB 4YHKH 5SWSD 4R9HA 1X7SA 5C07D 2WNGA 2XDHA 3NIGF 1QSFA 3OB0K 4RSVA 1EAPA 2VLKB 3ENEA 5LDUA 1G7PA 3ZDZF 3FUNA 3MO1A 3K6DA 2ARJA 2OMBA 5FYJD 1LGVA 1OVZA 1DQDL 4J2QA 2DYRB 2IBBA 5CWSB 3T65B 3VWJA 2ZXWB 1F3DH 4NO5A 4X6DF 4Q6IA 3WLBB 4PJEA 4NAQA 2OZ4L 1WA2X 4HIQA 2Z7WA 4OB5H 5D7SL 3N1QC 5DQJA 3DRQA 5AL0A 4NO3B 5D7LB 3PHSA 1K4CA 2DS4A 5DFWH 3NIDB 5IQ7H 5HVWA 1EHAA 4X9IA 4QRFA 4ZPVB 4Z7IA 4GKZA 4G3YH 4ZFOB 4JQIL 2EO9A 1Q0YL 4LSRH 5DD5L 1BX2A 1D9KA 3QQDB 1UB5B 4JZJA 1KG0A 2YQ2A 5D1ZC 3HR6A 3RB5A 2HFGH 4A2MA 1A3RL 3Q44A 4LHQB 1CXIA 1BZDA 5CGMA 4Q58C 1UJ3A 2ZWZA 1EO7A 1E4WL 1WG3A 2YHGA 3QPXH 1T04B 1U8MA 3P0YL 2MPAH 5DQDL 5DRZA 4TLTA 5EWIH 4LKXA 2UYLA 3THMH 4OCYL 4C56D 2G9KA 5I17B 4N9OB 2AXJA 4O4YH 5B8CA 3HB3B 1AXTH 2HVKB 3QHFH 5HVFB 1GHFH 1EEUA 4G42A 3NRPA 1MN4A 1HHGA 1UWFA 3CMOL 3MJ7A 3FKUS 4JHBA 3S34H 5I71C 2DQHH 1H3TA 3FQWB 5DZPA 2UXFA 2EEDA 2NY4B 2PYEB 3SPJA 4PJGE 3RKPA 3TYGL 4BK4A 3AG2B 5M95B 2ICWB 2AK4A 1A6AB 2V37A 1HXKA 2D2CC 1DJHA 1IAII 2PUQT 2WINB 4FXKC 4KGJA 4D0DA 4A1RA 2H2PD 2YOAA 2O6FA 3QJVB 3ZKND 5E94A 1S5IL 1WBYB 2FQGA 1RJZB 4QRRD 1BIIA 3FO1B 5KN5A 4BKTC 5EOCL 2ENYA 3GXMA 1JHKL 3PUUA 4DAGH 2R56L 5AZ2H 3QEUB 2EDRA 1TZIA 3KPPB 3NQIA 3GMOA 4KBPA 4XXWA 3WNIA 3W56A 3B7SA 3W1ZA 2EXYD 3VVWA 4PB9L 3CZSA 4MCZB 5DK0B 2MCMA 3OMAB 3LQAH 5FCSH 1D7BA 2ARWA 4MFHA 5C3LD 1RZJL 4MDIA 5FYJU 4MAUH 1XMWA 4DFIA 3RNKB 2AV1A 5A7BA 3GTNA 2X4OA 2WYHA 3RVTD 2PCPB 3X17A 4WTZA 2XFXA 2ZF8A 3AXLA 5HYEA 2IALA 3T8XA 2H1LM 1JGUH 4YDZA 1K6QL 4AVHA 1XB6A 2BZ7A 3CDZA 5E2WH 5GJSL 2PPEA 4WWKC 4NJ9L 4FQJL 2R83A 3G5XA 3PP4H 2K78A 4RSYA 3PAYA 1YRKA 3UIZA 5MHSE 2J8UB 3OWRA 5DGRA 3DI3B 1QQDB 2GPZA 3MRGB 2ZWLT 5IKCB 3U7YL 4GIOA 3UTSE 2AQ1A 4DGIL 3L9EA 1KV3A 3VXRB 2J5WA 4YHMH 5E6SB 5HYJD 5EB9A 2ZPKH 4NNXB 1JXFA 2EDNA 1OGPA 2Z31B 2JIXB 2O6PA 2J8HA 3TFBA 1GW6A 1GKOA 3N9GH 4P23C 5T3ZH 4ZUTB 4L5FE 4DSYA 1R24A 1WT5A 2XICA 2GIMA 1CE1H 4FF9A 1WK0A 3ARDD 4TN9A 4XMTA 2DICA 1W6LA 2OI9C 3KPTA 4GAYB 4M6NL 4OLWH 2OP4L 1YNLH 4A7QA 2B8OT 4OZIB 3U4EA 4X5LA 4FCAA 2SODB 4HWNA 4U1LB 1O7DC 4U1GC 4FG6C 1IM3A 3WLWD 1F8TL 2NW2A 5EG6C 4NQQA 3ZHLA 5I26A 3MACL 2Z4TA 4Y4HA 1BFOA 2X2HA 1EJOL 3GO1H 4HALA 6CGTA 3JVFC 1P2CB 2QMJA 2VLJE 4PI0A 4XCCH 1JBJA 3AQZA 3DX4A 3OAZK 4I0PA 5GHWL 5BS0D 1CGWA 4JO4H 2E9BA 5DC0A 1JPGB 3TCTA 4LSVL 1JYVA 4A2LA 3TVMD 2ICWJ 3O11A 3T6ZA 4PHXA 3TYFB 2BS9A 2ZOWA 1JYXA 4X9YA 3FUJA 4NQEE 2WSPA 4Y4KC 2W1NA 4XWGH 2EADA 4AUJA 1MDTA 2BMKB 4OJFL 5JOPD 2DQJH 5JUEH 1KBBA 3JUYA 5KJRH 2PXYD 3ELQA 5D9SA 4MMXA 2YC1A 3AS1A 2X6MA 4E41B 3TO4D 4KNSA 5JR1H 1FG2B 4FC3E 1A6VH 4MAYD 3ATBA 4KJQD 3C75A 1WAAF 2DWEA 1ZHLA 3FCSB 5GS0L 4YHPA 1T83C 3KD4A 1VGKB 1D3CA 3VYNA 1I7ZA 4JR9L 1MCSA 2H2SC 5JW3H 5AVVB 3GSXA 3BD5A 4LCVA 3ETBJ 3QZWG 5GS2D 1ZV9A 1WYJA 3KW8A 1HILA 1G7HB 3PGDA 1AR1C 2NTFB 3PJSA 5KSVA 4FI6A 4Y5YC 4NN7B 3SQOH 2O26U 3NSFA 3CFDA 3FXIC 4BZ2L 4G71B 2JXMB 3HI6H 5IMLB 2QQLL 3CHOA 2FQDA 4P5MB 3ALPA 5C0BE 4AQEA 2Y4SA 2X2YA 4JFED 4TYUA 1U58B 4HJGA 3IGAB 2Q76B 5MP6H 2IH3B 3JSSA 2D7PA 3JWDH 1GTNA 1U8IB 3K74B 3GXFA 1A7PL 3O3EA 3WL9A 4R2GB 3QIWC 4N0YH 4Y8AA 3NH7H 4JDZA 4X6BA 1NFDA 1WSST 3HE7A 4X9FA 4PY8I 4XB8A 3H9YA 4YWGH 4EDXB 4OTXL 3FUHA 3I50H 4X4YB 4K7FB 5IK3A 1IQDA 5DF0A 5I0YA 4QRPE 3QFJD 2E6QA 2NUTA 4WNSA 3TA3D 1PFOA 2P45B 5C6WH 2YD3A 3L3KB 4CU7A 3JTBA 1TUPA 3LRMA 4BZ1L 4FNSA 3A22A 3BVXA 2NX5E 1WIUA 2AJZB 3BJLA 3SKNB 7PAZA 4NN5B 2L7UA 3EYFB 4QY8A 2GK2A 2UZXA 2XZCL 4M1DL 3IJHB 4K7PL 4WFED 1ZT1A 1A1MA 3WXWL 2WCGA 4LLVA 4V1DA 3L4VA 3BISA 1S7RA 4ZUSA 3D4YA 4TMPA 1HHJB 4IU3A 3RL2A 4UV7H 4CW1B 5JHLL 3L54A 3QXDA 1A1NB 4NOFA 4X7EC 1ZTXE 1N26A 4LZKA 4OUUA 1URIA 3GMPA 1QUNB 4X7TA 2XLLA 3MXVL 2AFNA 4WDIA 3W2DH 3S2CA 4KKAD 3BPNC 3N43B 4Z78A 1SN0A 1YO4A 1RU9H 5I28A 1OM3H 2PETA 4GMSH 3OZKA 1CD1A 2R69L 4H8WL 3O2WL 1SJEA 3GRBA 3HG0A 1KNOB 4KJYA 2EDKA 3LKQA 4BXVA 4Z7NF 3K3QA 5C07B 5IROA 2JCCB 2V7NB 2R27A 1OP9A 5EIQA 5TE7L 4PJ7F 1I8MA 3LN5B 4L3CB 3LRGA 5KJ7E 1RHHA 5DR5L 1JERA 1FFNA 1U8PA 1BF2A 4H7VA 4N2DA 4NWUH 4C59B 1N19A 2WKOA 4RCAA 1MF2L 4RDBA 1CG9B 1ERNA 1P4UA 4HCRH 1JHLH 4XMPL 2NW3A 1T89C 3GZPA 5E4OA 2N1TE 3ECVA 3V7AE 1OGTA 3HG1D 3IETB 1N0XH 4FQCH 4MMYA 3KPOB 2ADIB 4OQTL 4D9QE 1JYNA 5BV7C 2XCMC 2ZXDA 4ONHB 3JV4B 1UA6H 4UINL 5EF0A 4ORGB 5AW2B 4BFFA 4CMHB 1RUAH 3D3VA 3SQRA 5EO9B 1D7CA 3TV3L 2AEIT 1SOQA 1MCFA 4NQCE 35C8L 1AYOA 4NZJA 2Y5TA 3WFBH 3F84A 3IJ8A 1NIAA 4LU5H 2X5PA 5E99L 4OJDH 3UTQB 4HUKB 4ZJ9A 1M42A 4CA4A 1MCOH 1VFBA 3ARBC 4GO8A 1BZ7B 3OTTA 1S2EA 5TDNB 2ATKA 5DJXB 2OSXA 1P1VA 1BZEA 4U6YA 4JN2A 1OWWA 2VNCA 5B4MC 2VDOH 1CFQA 2W80C 4AXWB 2WNWA 2V6HA 3HS0B 4Y1AD 3RWJA 4ZS6C 3P30H 5CZRA 1C12A 3HZYB 4FNLL 4HK3N 5H4YA 5HDOA 3E0GA 5HYSA 3FT0A 5IV2B 3QA3B 5K59F 3MKKA 3S5LB 4IRZA 4I3SL 1S3RA 1NC4A 3RUGF 2VRKA 3T5WA 2VMDA 1M1XA 3VMOA 1IGMH 3NACH 4J4PC 3G6JA 3HPLA 3WS3B 2J1WA 4WU5B 2ZOUA 5D1ZD 5DEFB 2Z7YA 5GXBB 1OD7A 3RTQA 2ZUUA 2OMNA 4GRLB 5FO9A 2OAAA 1FO0H 1MJUL 2GITB 2KMWA 3K0YA 5EA0L 1Q8MA 1HCFX 1FRGL 2QVIA 4P2QE 4FQ1H 1ZLVH 3QAZC 2F1AA 2BRRH 1UZ8B 4PWJA 3VCLB 4GBXC 3EOYG 5IB5B 4N28A 1PQZA 2BVOA 3P4OB 1RP8A 5DVMA 4G6AC 3EUDA 3VXTA 4EBQH 2FGWL 3S3JA 1KPUB 1RZKH 4OLXH 2H32H 3ZSSA 5GGRY 4G8EB 3A21A 4KXAA 4Z7WA 1K9TA 2G4EA 3EXLA 4L8SA 5D70H 2VQ4A 5FYLD 4CMMA 2A0LC 3P9LB 1ZLSL 3V6ZB 1L7IL 3HVNA 1ZPUA 3MCKB 5E2TH 4UQDA 1KLUB 3OGOE 5F70A 1LO4H 2ZUQC 3P3TA 5J6HB 4QHMA 4HHGA 5DZJA 1P0SE 1MUJA 3GBEA 4AGLA 4BH8A 5A16A 1DVXA 3MLSH 4GO6B 5EU4B 2VO8A 2OTWB 3KYOB 2W0KA 4QXGL 5CJXA 3CCHB 3C5ZC 4L2YA 4EN3D 1DL7L 2Y72A 3IPEA 3MRLA 4FXGC 4X6CB 3VSTA 3SCMA 1MLCB 4Q9QL 2AXFA 3HG5A 3S35H 5CF3A 2HUEA 3ML8A 4S1SL 4OGXL 1UC6A 1JNLL 1KXTA 1NLDH 2NY6C 4Y16B 3MQIA 1HL9A 3D9AL 3Q8BA 3HE6A 4O51B 1R3HA 4F3FB 1KB5H 1CDUA 2ARJQ 4CUCA 5DI8B 4E9SA 3MDJA 3N1GC 1NKOA 1VCBC 5ALCL 3GNML 1S5HB 5E8NA 5HYJB 2JQAA 1X7QB 2VDML 5IJBC 2GFBA 5HYFA 5F89A 1J9QA 3OD3A 3UAJC 1BM3L 2B15A 4F57L 4AYID 2WUBL 5L6YL 4KX8A 3VGHA 3LKPB 3RFRA 5AAWA 4NM4H 4EUPG 3ARDB 2JQZA 2WW8A 3BGFC 4DP5X 5C0EA 2OSLB 2ZWYA 3FSAA 5BRZA 2HG5B 5FC9A 2H0JA 4UDUA 4FD0A 4FADA 3T2PA 2P5WE 4XO9A 1UVQB 2N3JA 3FO2B 1AO7A 4MJJA 4M1GL 5J4MA 1KTDA 4TS6A 4V11A 4FLRA 1UACH 4K8RL 1BBDL 3QNYA 2GW5A 3QRBA 4WWKD 2QZ5A 1OK8A 4OF0A 5BS0B 4JG0L 3EYUH 5C70A 1FF5A 1X3DA 3V6FB 2KLRA 4PJGF 4M5TA 2VZ1A 4UU9B 1RK1A 1TXKA 1WQVT 5I15L 4POUB 5F9AC 4BV1A 2OMYA 3TVMB 3KW7A 1DFXA 4Y4FA 1JNHA 2W9LA 43CAB 3ZMRA 2DBLH 3F7LA 1E43A 4ZXBD 3VXUD 1HCVA 2AQTA 3L9YA 4P23D 3UZQB 5DS2A 1M9SA 2R9HC 3FU7B 1NLBL 2GCYB 2YAEA 4Z7VA 3AJ7A 4UTBH 2WTRA 4EOWL 2F6AA 4M43L 3QO1A 4M8QB 2HLAA 3WNPA 3VH8B 5DJ8A 3TO4B 1R19A 4DZ8A 1JZIA 5HHXL 2H26B 3AREA 1MI5D 1XCQB 1IAIM 2VC2B 4MAYB 2NXYC 2NXZC 5D72H 5TDOA 3UBHA 2C9PA 4LSTH 4OFQA 4PJEE 2FBRA 3V8CA 4DEWA 1ZD6A 1SOXA 2F19H 3V9FA 4GIAA 1JE6A 7CGTA 1BW8A 1MY5A 1NEUA 2BSRB 2B1AH 2IWKA 4NKOB 3BWAA 1H3PH 2WBJC 2CIIA 1NBVL 3T08A 1Y1DA 2Y07H 1M56B 5K93A 1PZ3A 3ZUNC 2PWFA 4HEPG 1YECH 4PJ5A 4PP2A 1PLAA 3ZN6A 3HNVH 4GLRH 4JFEB 4Z0XB 3TXAA 4B9IA 3FB8A 3UADA 3MLVL 2EXTA 2Z35A 3O2DA 4N2OA 5KUMA 4KNQA 2UVEA 1FL6A 1M7IA 1ED3A 1XR9B 1CDCA 4BDVA 1SEQH 3NP3A 4UQEA 3UTPE 4HJEA 1T21A 4YDIH 2JELL 4Y4KD 2WC7A 1OAXL 2YAHA 2CU9A 2J5LB 4I48A 5FUCC 4MQTB 1S3KH 1T3FA 2K7QA 5MI0B 4EI5C 1HC1A 1SHSA 3QFJB 5EZLA 3VI4E 3TA3B 4EDWH 1T7WA 2D9CA 1X5MA 1CE6A 1KBWA 3K2MC 4LPXA 4HWBA 3SOBH 1WD9A 2R2EB 2NT1A 4NWTH 4XP6L 5E7BA 3B7TA 3UP6A 4JQVC 4G9DA 5HXMA 1ORSA 1WJ3A 1MCEA 3FFOA 4UT6L 3GSNL 2A2QT 1K2DA 4PCTA 1JDAA 2OA9A 2H2SD 3VMPA 3TH4T 1XGTB 3JYBA 1WH0A 2H4EA 3HC3L 2X4PA 4H0GA 1CGSH 5BO0D 1BFSA 3C12A 2VQUA 1RZFL 5JO5B 3SE8L 5C0FA 1AR1D 2ZYIA 4PREB 3SDCD 2DEYX 1PZBA 4DZBA 5HHQB 2YD4A 4EN2A 4GH7B 2YXWA 3SO3C 2Q7AA 1BREA 5T33L 3SBQA 3ULUH 3LZFL 3I2CH 3AT9A 1Q4NX 4KO9A 4ONFH 2XJKA 3R19A 3EFFB 4CVXB 4PJ9C 3VD1A 1JF1A 2LVEA 4LKCB 2VXVH 5A2LH 3KPSD 2YUWA 3EH3B 3V0IA 1KGUA 5T5NG 1WZLA 3I6LD 1XCTA 1RUML 2VDRB 4G8FB 3GMRB 1F90H 4I18A 2FO4A 1P5VA 2W07A 1G4RA 1INQA 2YXMA 4M7LH 2HN7B 2H9GA 2XX0A 4R4FH 4G11A 3QYMA 2R39A 3WHXA 5D4QA 5I5RA 4PJXA 5EO1A 5TE4L 1SBSH 3GSVB 1E5UI 4I9WD 3MPCA 4B50A 4GB9A 1NEZG 4FMVA 4GKOA 1S8DB 1JRHL 3ARFA 4MMZC 1DVSA 4L8BA 2J1ZA 1SNRA 2ENSA 3MYZA 3ZE2B 2DH3A 3NJGA 4UT9H 5K9JL 1TCRA 4FDWA 3QULB 3QUMA 2O5ZH 1WA1X 3BKJH 5CD5C 3FFCE 4R4NC 4L3EE 2H6OA 1Q9LB 3HG1B 4IJTA 4QF1A 4U1SA 1SVZA 4UIKH 2AC0A 1A7RH 5GS1C 1G1KA 3CVDA 4Y5XC 3WDIA 5CGTA 1F4WH 1SY6A 3WY4A 5KSBB 1IAIL 3BYYA 3OKOB 2O5YH 4PRNA 3SYPA 1DEEB 4HXAL 4R26H 3VWKD 4DN4L 2XWEA 4OKVA 3U2SB 1A7QL 3G5YB 4DT2A 1IGIL 4FKKA 4C83A 4DUWA 2WOBA 1KZYA 1UXSB 5D93C 5CCKH 2F5AH 2YSSA 4PW3A 2OMZA 3B9EA 3QH3B 2XWZA 5ICYB 1BVNP 1MQKH 1T20A 5G4OA 2X9WA 2QVTA 5I6LA 5C09A 1RIUL 3O0LA 3RA7L 4APQD 3EZJB 5H35A 5JHDD 1OW0C 5BVPL 4DWHA 3IU4H 5JQ6L 3CHSA 4Y1AB 1AY1L 2LFGA 1TJXA 3WXVL 2F5BL 4IKLA 1R5WA 3T2NL 1A2YA 2EKSB 3W0WA 4OZFA 3PDGA 1I4FB 3MUJA 3QO0A 4J8QA 2MCPL 3VQMA 3WSQH 1OGAE 4K4KA 5ECGA 4I77L 2AQPA 5IWLA 4NRZA 3Q1SL 3DECA 1O7SA 1J5IA 3II1A 2GTWB 5FM8A 1AZRA 2VN5A 1I8LC 3VWJC 4L8DA 5D1ZB 1U9KA 1HHKB 1UWGH 3OC5A 3STBA 2CE6A 2EUZA 1EUUA 4Q6IC 4AYSA 1R3LB 1J5HA 2MOQA 2Y5EA 3QWRD 1Q9WA 4HH9A 4NPYB 3ME0B 3BVDB 2IFFL 2PABA 3VXOB 1ZGLA 4F7TA 1D7FA 1X4YA 2VERA 1JNNH 4BQBA 2G0KA 1HH6B 1X5YA 5DRWA 4AX3A 4A63A 2VRQA 4D9RE 2LOEA 2YLKA 3UTZA 4PEEA 5K9QI 1DBJH 2A38A 3HAEA 5GGRB 2NOYA 5KW9L 3WKMH 1U8JB 3DX2A 4JCWA 2X2JA 5I71B 2DV6A 3ESUF 1FVCB 3QQ3A 4KKLC 1INDL 2R1XA 4BE5A 1UT2A 3MGTB 1WFUA 2MSPA 4FXKB 4DPAX 5CO1A 2ZCLH 3ULVH 2J6EH 1A3LH 5FDWA 3ARGC 1F42A 1KC5L 3QG6A 4XNYH 4Z77A 2B2XL 1U36A 4N2MA 4M7KH 5B8CC 5C0CA 2ILLA 5AQ0A 2GBAA 4H2CA 1DBMH 1GC1H 1M7XA 1V10A 3LV3A 5GGUA 3T77B 2IJ0C 1X44A 1WBXA 4GW4A 4OCWH 5JIIA 1GIGH 3V4VL 3F83A 3FU6A 1P84K 3K6FA 4KRPC 3STLB 1G9ML 4R7VA 1UFUA 4O2EA 4IEFA 2J4WH 4IRSC 4AV5A 4APXB 5F21B 2YQ3A 5CGYC 5L2KD 4G6AD 5LB1A 4HCIA 3GUTA 5L7XL 2YD2A 1PZUB 5T1DL 4MCYA 2VXTL 5DWUL 3DV4B 2H0FA 2A0LD 2GJZA 1DJGA 2MOVA 3FFDB 3FT4A 3MCYA 3B2DC 1FGNL 1GMIA 5E70A 2W95A 3KCWA 4KY1H 3EJUA 4XXWC 3QZLA 1AR2A 4DQAA 3MRIA 3FTGB 3BDXA 4I5BB 2ITDB 2H8PA 3ZDWA 3QJZA 5IM7B 5TDPB 3C5ZD 3NRQA 4WV1C 5GGSY 4BGLA 1V7ML 5C3IA 4BFIA 4U1HA 4WWKB 2CUAA 3PFQA 2I9LB 4NPJA 3ROOA 1MXGA 4GFTB 2NY6D 1CFMA 5GRVL 4JGUA 3SBPA 1KCUL 3W39B 4PRID 4NBYB 2A6JB 2OM5A 2PCFA 5CSZA 4WENB 1UM5L 3APMA 5CJ5A 1OOWA 4FX5A 5IG7A 4L0PB 1OSPL 5D6DA 1ZWIA 5IIEB 4NZRH 2R1WA 4GRWB 1AJ7H 4G8GD 5E2VL 4DEPC 5EU6A 3R06B 2W65B 5FECA 3BXNA 3VXUB 2ZUXA 1IE4A 2ZX5A 1QO3A 1A02N 4P23B 1NA8A 3PV6A 3BJ91 1EPFA 1J5OL 5DJAA 1EEYB 1RJYA 4NP4H 1MJJA 2OI9B 4LEOB 2I85A 4M7LT 3M7OA 1F00I 5JA9A 1QPPA 4LSPL 3O0RH 1MI5B 4HD9A 2LTQC 5F9WC 1S7VB 1BV8A 2WLKA 2C26A 4ZUUB 3WMPA 4U1GB 3BKYH 1JZHA 4K71C 1SLWA 1P9MC 4RWYL 2WIMA 1HOCB 3N41B 4P06A 1U95B 3PABA 4AGPA 1AKJA 5D55A 4N0FB 5JW4R 3KWWA 4E0RA 1WAPA 3HHSA 1U8OA 3MNDA 3WNNA 4KQ0A 4AEIL 2QV4A 4F58L 3T3MB 5I0WA 3VI3A 3H2WA 3MODH 3REVB 3PXJA 3Q3GB 4KO6A 1GH7A 5T1KD 4FG2A 2VCOA 4Y0GA 3ZHFA 2WO2B 4OLYH 3WFZA 2WWMC 4I3RL 3BSZH 1EMTH 1R17A 1PG7W 2E56A 1OCOB 4OGAC 4Y19E 4WGVB 3HKZA 4XP9L 1S7XA 3UZVA 2VT0A 5EEUA 2Y7MA 2DBJA 2YN5A 1U6AL 4Y4KB 4Y4HC 4LLUB 4PS8A 4UANA 1ZHBB 2R9HD 3U6XA 3OKYA 3QZNA 1H9DA 5EOQL 1GY1A 1G1OA 5FV2A 1TETL 4I0PC 1HNYA 3DO7B 4N0RA 3O41A 2GJ6B 3I85A 1ADQL 4N0UB 3FOMA 3BCDA 4A6YB 1J10A 4AYFB 3F00A 3G08A 4QHNA 1WZAA 5AOMA 5KS9B 4NQDA 4E9RA 4ZNCD 1OPGL 2JKNA 3A6CH 2RB8A 2ZAHA 5JA8B 2EH7H 1QABA 1AQMA 1SHXA 4M8RA 2HRHA 5HVHC 2YQBA 3WNOA 3EO9H 5I1AA 2H3NB 1CFVH 3O9WA 2Y36L 2WBJD 1U8CA 4OVUA 1OTUC 2I7SA 1FVDB 1T22B 4XB7A 2R2CA 4UBDC 1AR1B 3G6JE 4Y5YB 2J1YA 3W11C 5CEZD 3HRZA 4LCCC 4MMXC 2I26N 4PJAE 4R7DB 5C0IB 3GSWA 4K0OA 4RGOH 3ZL1A 3BZ5A 2YS4A 4KTYA 1V55B 5CILL 1NOLA 4JZNB 2XG5A 1YNTB 1MHEB 3GMNB 4FZEH 1TEFA 5EBLA 4WKXA 2IH1B 1G43A 3QZBA 3KPSB 3N0PB 5FUOH 3U7WH 5HP5A 3E2HC 1TJIL 2HUHA 2K9FB 1CXHA 1KCVL 1E9PA 3DIDA 3B37A 3RBSA 1AGDA 4QOKE 1UM6H 4FLQA 3DXAA 2X0VA 4FQIH 4XBGB 3CZEA 3VW3H 5C7XH 4R0LC 4ANUA 5SX5K 4AIZB 2IQ9H 2ODIA 4NKIL 2E6JA 2ZKYA 3WDHA 4ELMA 2MQ3A 1NUDA 2BERA 2AJXH 2E7HA 2YGPA 4JFOA 5E8PA 1TTFA 4NUJB 5HHOE 4A2FA 2BNRE 1MFBL 3O6LH 1OZTG 5DHMC 2NQ3A 3JZ7A 2NY5L 1I3UA 2VM3A 4PRHA 1TMQA 1PX3A 5B39A 2YKLL 3CN3A 2AEWA 3N06B 4PJEF 5GRVK 1RZ7H 5IF0A 2JKSA 3QDGA 1AG0A 1GGIH 2FJHB 2ZG2A 2R69A 2E27L 1YAZA 4PJ9D 4KHXL 2Y23A 3VWKB 5HJGA 4CN6A 2DYPA 5E7FA 1WC7B 2XPGB 3ATEA 1AGFB 2BP0B 3OQRA 3B43A 5D1QD 3FUIA 4RIRB 5J7CC 1C5BH 3OLDA 4HYTB 3RNQA 2EKJA 3KYAA 1QFWL 3A23A 3NJHA 4G8IB 2CD0A 3Q8CA 1KB5A 3ZO9A 1NBQA 4X5WA 1X5KA 4WW2A 1RFDH 1UEYA 2XPYA 5HJ3A 3T8MA 3C5SA 3I6SA 1VPOH 2UZPA 1R6VA 1UYWL 3B5GA 3JBG7 1GJIA 5JHDB 2VZ3A 1P4BH 4PWFA 4BRJA 4RMWA 1HESA 4YBLC 4XXDA 4K2UL 1MPAL 3EJCA 3CFEB 4N5UA 1GGTA 5F6IC 3RWIB 5CD5D 3IDNB 1UOWA 5KYXA 4XCYB 2Q86A 4R4ND 3VI4F 1Y6MR 4H1LG 3VVVA 3V0JA 2LVCA 3I6GB 3QRGH 5BV7B 1BGXH 1E30A 2X87A 3LN4B 4HZLB 5FGBA 4GLRI 1LILA 1TT6A 2DM4A 2Q3ZA 5TE6H 1QSEE 1KCRL 3O3AB 4HIXL 4N8CL 3ZGHA 2VJ8A 3POCA 1LWJA 2GSIA 2Y1AA 3P54A 3VD4A 4ZO8A 2R1YB 5AWNL 4HAKA 3APNA 1J8HE 4BFNA 5DQ9B 1ZA6B 4YDKH 3WGUB 5IMKA 4G72B 2WBXA 2QHRH 4N0CC 1JXDA 1FFOA 5I8CB 1BVNT 2FYYA 4JHZA 4QYOA 5IHZA 5F1IA 2Z8VC 1G6RH 4ZW7A 3MLYH 4X99A 4A7GF 1L6ZA 4HGKC 1NEPA 1XB8A 2OL3H 2DI7A 1FFTB 2E7DA 5KBPA 5F0PB 2B59B 1M2VA 4U6XA 1E4XH 3RTLA 3DX8A 4WK0B 4GG8A 5MERB 3T1FB 3K72A 1NOAA 2QELA 1W16A 1L9TA 2DIEA 4WUKH 4I9XA