4YSOA

Copper nitrite reductase from geobacillus thermodenitrificans - 0.064 mgy
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
295
structure length
295
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
source organism Geobacillus thermodenitrificans (strain ng80-2)
total genus 98
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ysoA00
2CJ3A 1W6LA 3WG7B 4KO5A 5D4HA 3OMNB 9PCYA 2IDUA 2IWFA 2IDFA 2OJ1A 3PXLA 3X2QB 4FAAB 4HCGA 1PZCA 1TU2A 3GDCA 4QKTA 5B1JC 4E9XA 4N8UA 4E9YA 5B7FA 3CDZA 1CC3A 3IE9A 3RYMA 1NWPA 4KO9A 1OCOB 1L9SA 3U25A 2DWSA 1NPJA 4E9SA 2IWEA 2DYRB 3NP3A 1PF3A 7PCYA 3OQRA 1QLEB 1FFTB 4HAKA 4HHWA 1JZJA 1UATA 1JOIA 2HXAA 4NAJA 5IY5B 3X1NA 2XUWA 1WS8A 1KCWA 3PAUA 3GXUB 1RCYA 2IH9A 2PP9A 1KCBA 3WKQA 1ET5A 2JXMA 2UX7A 1JVOA 3NJFA 1OE2A 3ZX1A 4E9QA 2HLEB 4AZUA 1JVLA 2YAFA 4P5SA 3FT0A 2AFNA 3QPKA 1YLBB 4YSCA 3MBWB 1SDDA 1PZAA 1RZQA 4BWTA 4DPBX 4YSEA 1PMYA 3CDZB 1JZEA 1NICA 2QPDB 1I53A 2QPEB 3CVBA 2IDQA 3NJNA 3S8GB 4BDVA 1AZBA 3WI9A 2GBAA 2DV6A 2J56A 2VSMB 2QDVA 3PPSA 5D4JA 2YXWA 1KYAA 2FT6A 5AKRA 3FU8A 1ZIAA 3FSVA 2B08A 2IWKA 1GS6X 2DYSB 1ZDQA 2BZ7A 3QQXA 3TASA 1NPNA 1VLXA 5B7MA 5I5JA 1PNDA 2XU9A 2YAEA 1SFDA 1PY0A 3ZBMA 3FQ1A 3OM3B 1PLCA 5B7EA 4DP4X 1MZYA 4KOCA 3UABA 2GSMB 1M57B 3IBOA 1SDDB 4HIPA 2J57A 2FT7A 2BWDA 2I7OA 4HCFA 3ZIYA 1WAEA 3NSCA 4MFHA 3AG4B 1JZFA 1L9PA 2HX7A 1KDJA 4Q89A 3UACA 2HRHA 1WS7A 2BZCA 2BO0A 3NYKA 2UXFA 3NSFA 2PCFA 3KW8A 4HALA 1EHKB 4YVUA 2Q9OA 3BVDB 4E9WA 1ADWA 2FQEA 1IBZA 4AKPA 1ET8A 1TEGA 3T9WA 4G72B 1SJMA 2BW4A 2Y69B 1BYOA 2XWZA 3X1BA 2FT8A 1ILUA 1GSKA 4K9JA 3CG8A 2VW6A 4YSRA 4YL4A 3QJQB 5I6OA 1J5CA 4A2EA 1PAZA 4YVNA 2UXVA 4DPCX 1JZGA 3CZUB 4M3HA 1AZUA 1KDIA 5EHFA 3GYRA 1IC0A 2IAAC 3NP4A 2XV3A 1NINA 2I7SA 1SF3A 3ASNB 4TXVB 2GHZA 2PPEA 2XX0A 1ILSA 1V10A 5I6KA 2XV2A 1PCSA 1AG0A 1AG6A 3BQVA 2IDTA 3S3DB 1TKWA 2BW5A 2FTAA 5F7AA 4DP5X 1F56A 1KBVA 4YSTA 2VW4A 2PPFA 3FS9A 4BWWA 5I6MA 1GR7A 1W8EA 5I6PA 1OOWA 1E67A 1A4BA 3UAAA 1BAWA 1ASPA 4YSSA 1GYCA 3ABLB 4G7QB 4KO6A 3EH4B 1JXFA 2GIMA 2VM4A 5PCYA 1N70A 3NJJA 2QDWA 2B3IA 1JZHA 2RACA 4KO7A 1CUOA 5ANHA 1ASQA 1NIBA 2CBPA 2FJSA 4AI7A 4BXVA 3V9CA 4AKQA 1XB3A 1TEFA 2UXTA 2YARA 4WKXA 4AX3A 4YSAA 3SQRA 1ZDSA 4W9ZA 3NJIA 1BYPA 4DP6X 2W88A 4GP8B 1A65A 1RZPA 5E9NA 1AOZA 2YAQA 1IUZA 2XX1A 3X1GA 5TK2A 3AG2B 1ZV2A 4JHVA 5TK4A 4L0PB 1MZZA 1PZBA 1E5ZA 2BWIA 3NJGA 4A66A 3UADA 5D4IA 4BWUA 4KNSA 2YAPA 5B1JA 3OMAB 1J5DA 3EHBB 5AFAA 5FC9A 4A2HA 4DP2X 1XMEB 3ZDWA 2JFCA 1CYXA 1X9RA 1AS7A 4G7SB 1NIEA 5I28A 1OE3A 3JT2A 2EILB 4A2FA 2AVFA 3NJKA 1OCZB 3SBQA 2FWLB 3AY2A 3G5WA 4E9VA 1AS8A 3EH3B 1M9WA 1M56B 5B3SB 3HB3B 3WNIA 2J5WA 2XVBA 2FQGA 2VMJA 3UGEA 2PP7A 4CSPA 3AG1B 5I6NA 1MG2C 5I5MA 2AANA 1AQ8A 2ZWNA 1GW0A 2VN3A 4DP9X 5B1KA 4CSZA 1J9RA 4E9RA 4BDVB 2ZOOA 1MDAA 3D12B 3L45A 2GB2A 3N2JA 1QNIA 4G71B 4P5RA 1N68A 3QJUB 1E65A 4X4KA 2PCYA 1DZ0A 1OV8A 1EZLA 1AIZA 1NIFA 1NTDA 2X88A 3OMIB 2R7EA 2XXGA 1BXAA 4A68A 3FPXA 2YXVA 2E86A 3NJLA 2FNWA 3FYEB 4GP5B 2ZXWB 2H3XC 1J9SA 1A8ZA 4DP0X 1GS7A 5I26A 2AZUA 1JERA 1KV7A 2YAHA 2HX9A 7PAZA 4F7KA 1L9OA 2Q5BA 3T6WA 2H5UA 3H4HA 4BK5C 2LLNA 3S3CB 3FPYA 3T6XA 3ABMB 2WO2B 1L9RA 3PAVA 1NWOA 2YQBA 2PPAA 2YAMA 4KOBA 4W1TA 1IKOP 4FA7B 2NRDA 4WTQA 2DY2A 8PAZA 4HCIA 1SFHA 1OE1A 1ZPUA 1BQ5A 3NSYA 2XYBA 2JKWA 2ZONA 3SBPA 1SF5A 1B3IA 4GXFA 3ASOB 1ID2A 2A3TA 3T6ZA 1V55B 4AKOA 1JXGA 1ASOA 1OF0A 1JZIA 1SNRA 2R7EB 2J55A 4DPAX 3X1FA 2GI0A 1BQKA 4DP7X 2FQDA 5F7BA 3NSDA 1DYZA 6PAZA 1HAUA 2Y1AA 2P80A 1OCRB 3NJMA 2OCCB 4G70B 3FQYA 4QLWA 2CALA 3FYIB 1AAJA 1L9QA 4YSQA 1R1CA 4RH4A 1E5YA 2BP8A 1HAWA 1W6WA 1PLAA 2TSAA 1MG3C 4NERA 3FQ2A 1CURA 3OD3A 2H47C 2XLLA 2EIJB 1FA4A 3AW5A 4KNUA 1GY2A 4UF7C 3SBRA 3ABKB 1URIA 4UANA 4Q8BA 2EIKB 3FSZA 3MX0B 2P80D 1XB8A 4GYBA 4YSOA 2PLTA 1AZNA 1NZRA 4PAZA 3UAEA 1IBYA 3QJRB 1NIDA 4KNTA 5B1AB 3FU7A 5PAZA 4PCYA 3ABGA 3NJHA 1BXUA 4M4RB 4YSDA 1SHWA 2CAKA 3TBBA 3JTBA 4F2FA 1WA2X 3DIVA 3WKPA 2HZHA 2HX8A 3IN2A 1V54B 1XB6A 3IN0A 2PPDA 1AZCA 4N4YB 2DWTA 3C75A 1JXDA 2W8CA 2VW7A 3T6VA 4EF3A 4E9TA 3N55A 4ZK8A 5B1BB 1ET7A 2MTAA 2BP8B 3WNJA 2BP0A 2CUAA 1WA0X 2XXFA 3H4FA 2VSKB 1OCCB 1AS6A 2WSDA 4UAHA 3WIAA 3DTUB 4DP1X 4DP8X 1L9TA 1FWXA 1AANA 2YAOA 2HRGA 3AG3B 5A7EA 1BXVA 2MRYA 3EH5B 3FSWA 4ENZA 3NT0A 3TBCA 3S3BB 1SHXA 3V9EA 1NDTA 4YSPA 1AACA 3FU7B 1PLBA 2VM3A 1ETJA 2EIMB 2QT6A 3KW7A 2EINB 4G7RB 2IDSA 2IH8A 2UXGA 2PPCA 3H56A 4A2DA 1A3ZA 2WO3B 3TU6A 1ZIBA 4F2EA 4NB7A 1E30A 5AZUA 1AR1B 6PCYA 4YSUA 3T71A 1BQRA 3QJVB 2CCWA 4GP4B 4JHUA 2N0MA 1T5KA 3CVDA 3FU9A 1KBWA 1KGYE 1A4AA 1X9UA 2BP0B 1GS8A 4A67A 2AZAA 2XV0A 2TSBA 1CYWA 1WA1X 3ERXA 5LDUA 3EF4A 3QJTB 5I5IA 1HFUA 4A2GA 3PCYA 3TA4D 2GC4C 2I85A 1QHQA 3HEIB 4BXSV 1GY1A 2GC7C 3S8FB 3X1EA 5I6LA 3AZUA 2FQFA 3QJSB 3FSAA 2OV0A 3IEAA 1J9QA 1RKRA 4HHGA 1A4CA 3CVCA 2PP8A 2UX6A 3PAZA 2X87A 4GY4A 1AZRA 1J9TA 1PNCA 4HZ1A 4JKNA 1NIAA 2BHFA 3PLYA 3DKHA 1BEXA
chains in the Genus database with same CATH superfamily
4HXAL 3OLIA 3GSXB 4RGMC 3QORA 4U3CA 1QRNA 5DMIL 3W0WA 2IMNA 4QHPA 5GS0D 4PJHE 5C0CD 1RFDH 5AKSA 2DJSA 2ESVA 1SYSA 4ORGB 1TJXA 1KMGA 1MFBL 4P48A 2A5UA 5ERWA 3HR6A 4D0BA 2Y25A 4QGTA 5T8IA 3CN4A 1L9SA 3ARGC 4DNLA 1EFXB 2M26A 3KPRD 2DMHA 2H7WA 5T3ZH 3G08B 4XP5L 3L9RA 2MPVA 4C8XA 4KK9D 3FMGL 4QOKA 3TCLB 4L4VD 3UBXG 1FFTB 1WGOA 5G5DA 4I85A 1GGCL 5CU5A 2ADJB 3WE6B 3P0VH 1J87A 5EU3A 3O6KH 3KLQA 5I15L 4U1KA 1DFBH 4PG2A 1HE8A 4IHOA 4PVNA 1RK0A 3W9DA 1SGKA 3PAUA 1R19A 2Y1YA 1OAYL 3E38A 3KE0A 4L37A 4RRPG 4U1HB 5TDOA 3VXNB 2P43B 3UBHA 1AP2A 1EEYA 1BJ8A 2Q3XA 4QMEA 1EEZB 1KJ2A 1B6UA 2BS9A 2LR4A 4J3OC 4Z7NE 4QJ3B 3MV9A 2JJTA 4X6DE 1UWGH 3MJ7B 3GUTA 3HI6L 3Q6GH 3S5LA 2I5YH 1GKEA 2B14A 2JWYA 3QNYB 2E4TA 2JKSA 3EJJX 1ZLVH 2EDKA 1PGRB 2J8UA 3IU3B 4Y16B 2TRYA 4P5TB 3DMMD 3FO0H 2FZ3B 3S8GB 4CRPA 5JXED 2XZZA 4XPFL 4X6FB 1D6EB 4BDVA 3IMVA 2YMXH 4P4KB 2X9XA 5DD3H 4AJ0A 5AAMC 1AGEA 4WEBL 3DOSA 4MA1C 3S0PA 5DUBB 3MFGB 2JKLA 5FECB 1RZFH 5C97A 3PQYB 5D1XB 5I74C 1FVCA 3CMOH 4PJ5A 4TUKH 1EA9C 1CO1A 3C60B 4GIAA 5LGHH 5GPRA 5F7YC 2VISA 5DZOA 2NY3B 3ARWA 3S37X 3PWPB 5CCKH 3N1PC 3OKYA 3VMNA 2OYLA 4ZS6C 2QGEA 3LCYA 4JFHE 1EEUA 2CM6A 3ZYOA 1DN2A 3VB8A 1SLXA 2VLKD 4KBPA 3PWJA 4B53A 1BQHA 1LEGA 3ULVF 3S2AA 1KPVB 5D6DC 3DIFB 3BUDA 1ZWIA 1EWHA 4UINH 3VXOA 4BZ2A 4TUOA 2E8YA 3NFNA 3P73B 4PVMA 3DVNB 3AG4B 2IAMB 2O30A 2AJ3B 5CKAA 1S7WA 1Z5HA 3A5VA 3NA9L 1XF4A 3P4MB 1WS7A 3D51A 3HS0B 4PRNA 5E5RB 1CIDA 3RWGA 2ZUQC 3NYKA 4MWFA 2WOBA 4MJIA 2PCFA 4XH2A 3K72A 5I1CH 3K2KA 2PW1B 2ENYA 4MX7A 4WDIA 1TEGA 2FJHB 5L2KD 2F5BL 1D5MA 1CXKA 2G9HB 4G72B 3AS3A 3Q9QA 5E1QA 3BP4A 5DFTA 1T89C 4YXLL 3V0DA 5C2BH 3BO8B 3WEXA 2XZCH 3LPOA 3X1BA 2AGJL 1GSKA 4L8SB 3QUKB 1XX9C 4P9HH 4LVNC 2OR7A 3R0NA 5KSUB 5KSAC 2J8HA 3VFGH 1CLVA 2FECL 4B50A 1RPUA 2VCOA 4ODWB 5JW5A 4QHUA 1A6UL 3LX9A 2EC9U 2QL1A 3ECUA 1J5HA 1XHHA 3DSFL 2GYSA 5FYJE 3RURA 1TJHL 3U2IA 4R5VA 1BJMA 1NC4A 4W9JC 4KKAD 4DO4A 4JDZA 2X4NA 3AROA 4LSSL 2JH2A 2G4EA 3N40F 3MTXA 4NENB 5A2AA 1S3KH 3LN5A 1WG3A 1MREH 2ARJQ 1F1DA 2HKAA 2IDTA 3H85A 3S3DB 1BM3H 3RL1B 1NGYB 2W9DH 2Z4QB 3F2LA 3K5SA 1CVRA 1MHCA 3P3RA 1J0IA 1WBYB 3CE1A 4O2FA 2WNGA 1W8EA 1FG2A 1KIPA 2EO9A 1IMHC 5BVPL 3W56A 3EGXA 1XF5B 2CDGB 3AAZB 3TWCH 3U30C 3F65A 1FYHB 4ELMF 4KROC 3IFPA 3SJVD 3VWJC 3HFML 4DESA 3QQ4A 4YNYB 4B0MM 1N6QL 1WFJA 1R33A 2ZOLA 3B8YA 3BEVA 4LEBA 5DVMA 4AK2A 4Z77A 5BRZE 5KVGH 1ND0B 2O5YL 3FB5B 1MHEA 3P2BA 3AMLA 4Z3HA 2F19L 3G7TA 3CZFB 1QRNB 3T4AC 3KJ4C 5AW0B 5LXGH 3P77B 5F7HA 1BYPA 3N6YA 4LVOB 1QLFA 4PW9A 4L4TE 1XSOA 4KKNA 1BPVA 1X7QA 5EUKA 5FS5A 1IUZA 4YHMH 4YZWA 1M7IB 5DEZA 1ZV2A 4HYTB 1TLMA 1UCBL 1DQTA 3K46A 4OGYH 2X6BA 1XCXA 2G75B 1MZZA 2DL9A 1DEEB 1E5ZA 2BWIA 3B43A 3NJGA 4MD5B 1F0LA 1MUJA 4G7VH 5GGUA 1KJVA 2C3HA 3SDXA 4IIQC 2KQMA 1N3NA 1G9NC 2OMUB 5IB2B 5IT2H 4FLSA 5IM7B 3LN4B 4J12A 3QG6B 1M1XB 3ZR5A 1OTUC 1NIEA 1JP5A 2ORBH 3QULB 4H8WL 1G9ML 5SWSE 3VRLE 2OSXA 5C9JB 3OLGA 3NTCH 3IDJA 4BQ8A 3K6IA 5DMYA 3IMWA 1MFEL 5HVFB 2BJMH 3NABL 3R1GL 1Q94A 5C0FB 5HI4D 5CZRA 3SPVA 1FCGA 2VABA 2VM9A 4FQLL 2BH0A 2VRKA 1U8OA 4JDVA 1KBGL 1Z3RA 2CMRL 3NPZB 4X42A 3BQUD 4PJAF 2FCBA 3HB3B 4R4FL 4YHYB 3E6HA 2WXKA 1L7IL 1AD9B 1AKJD 2APSA 3PIQB 1L3WA 4IBZA 5HY9A 5IIEA 3QEQE 4OM0H 4OBRA 2AANA 2Q86A 4M43L 3F7QA 4C58B 1JYXA 1W8NA 3A6OA 3MOBH 4BDVB 5EU4A 4G71B 5LGJB 2ICES 2XIBA 3IDNA 3BZFB 2BVUA 1REIA 5FF6A 2X88A 4EZJA 1V5JA 2QQNL 5EC2B 4OLYH 5E8PA 4OZIE 4HCRA 4YIQB 2FNWA 4Y1AE 5HJ3A 1RZIB 4ETQB 2NYZA 5CMAA 4X8CA 3D0LA 3IM1A 4NRYB 3UCQA 2DAVA 2YAHA 5AAMA 3WFBH 2HVJB 3VWKC 4PCSA 3W57A 1BOGB 1L9OA 4PJIB 2YLHA 5EOTA 4C47A 1XF1A 2AABH 4GMSH 3BDBA 4YPGB 5E0FA 2GAZA 3W11C 1U8PA 3CXHJ 2VRQA 4RZKA 4PRIA 1MLBB 2VR5A 1WTGT 1VJSA 3LRLA 4X7SH 2DY2A 5F9WB 1ZPUA 4U6XA 2DMGA 4R26H 4K7PH 4UM8A 3IDIA 3SD2A 3HKZA 4Z7OE 4K8RH 4P2QE 2R2BA 4XPTL 1QLEH 4GXUN 2CBMA 2QSVA 2YGPA 3PWUB 4K3EH 4QO1B 4QXVA 4WTZA 4XOEA 4YQXH 5D6DA 4PRNB 3LKNB 3OB0H 2V3EA 4MWFB 3Q2LA 5J9PB 4U33A 3GEWB 1LJMA 2BSEA 1QI4A 1QSED 2BNRE 1DQDL 4UT6H 2DIAA 4JL2A 1AYOA 1BD2D 3ARVA 3DJRA 3H42H 4NPYB 3G6JF 1WAAF 4NQQA 1RHHB 3HZYB 4JO3H 1JZ8A 2ZSVA 4F92B 4PJ9D 4FYTA 4K2UL 1JF6A 1S9WA 4LSUH 1JD7A 3DHPA 1WFTA 1EPFA 2NUPB 4WSGA 4G70B 4XN1A 5MP6H 1Y18B 3BPOB 3KS0J 4AEHH 1FI8C 4LSQL 1AAJA 4PB9L 2CNZA 4QHUB 1T89A 5D2LE 4N26A 5ENWA 3QFJB 4ZAKB 3TX4A 4APXA 4LL9A 3VFPA 4DW2L 3FTUA 3MJ9L 3DROB 3G3LA 4R97C 3MRHB 3QUGA 4FQPA 4NJAH 3V2AR 1GY2A 1NC4B 2XFXB 5KSAA 2NYKA 4UANA 1NJ9B 1DQLH 4HWBA 2DQCL 1QSFE 1C1EH 4JZNA 1AZNA 1CFNB 3EYOB 1UM5H 1IGFL 3GKWL 3P9LA 3H3PL 1X3DA 1T7ZA 4TV3A 4LP8A 1IKFL 4XN4A 4NKDA 5SX4I 3TT3L 4M4RB 4NM4H 1QRKA 4YSDA 1EAOA 4FNPA 5LB1A 4GMTL 4YHZH 3MN8A 3VRJA 4OUUA 4ELKB 1XL4A 2YKLH 3PGCB 4ZPVB 3NA4A 3UZVB 4BA0A 1FZJA 2O5XL 5HHMB 2X1QA 2VDKB 3O2VL 3RWFB 3EXLA 3QWOB 1MJUL 4L1TA 4FF9A 4L9LC 3FB7B 1RUPH 2ZWSA 1OPGH 4OGXH 1WZMA 4GIOA 2OFQA 4W9HC 1BMGA 4PGEA 2CUAA 3VDBA 1J1XL 3K5RA 4HXAH 3SO5A 4UQ2A 4BQ9A 2VSKB 1BBJB 5JIDA 1AS6A 3MBEC 3HG2A 3GB7A 5F0JB 5DMIH 1U8QA 4IRJB 2ED9A 4FKEA 3VWJA 4Z7UE 4MB3A 3HPLA 4L2YA 3F5WA 2J1ZA 1BXVA 1MFBH 1WO2A 1CDUA 4PJCE 5D9SB 3KGUA 3TNNB 5IJVA 1GH7A 2XPGA 2UY7A 4OJEH 3BYYA 2DKUA 1AGCA 1D5XA 1E9OB 4FQXC 4A37A 3WFHB 4K23L 3ZDZF 1ETJA 1KXTB 3DX7A 4GQZA 2EINB 4XP5H 4J3SA 5IMMB 2IH8A 3FMGH 3Q48A 4G8AC 1N59B 1LP9B 4JQIL 1U8HB 1A3ZA 2FHBA 2HT2D 1TR7A 3HHRB 4FC3E 4KJPD 4Q4EA 4XVOA 4ZOAA 1GGCH 1G5AA 2EABA 1UOWA 3FBQA 3TN0A 3WCYA 3DVIA 3ARGB 1H5BB 2VXVL 3EJRA 4PG9B 3T71A 1WZKA 5I15H 4AYDC 3PREA 4IIQA 2VDOB 1OAYH 4BFRA 2FHFA 2VLRD 4P2RD 5CSGA 5F9AC 1OQOA 1Q9LA 4G6ML 2A4EA 2C9SA 4YHPB 3QARA 4X5LA 5INDA 4Q74A 2VABB 3L3KA 1WEJL 2OCFD 3HI6H 4EI5D 1P7HL 3PCYA 4OT1L 4TN9A 2P5EA 4F3FB 4AUYA 3RVVC 4ADIA 3E9TA 1I1FA 3QUYC 3QCUL 1QI5A 4F33A 4MKTA 5KTEL 1XGPA 4KUZL 2X4UB 3QYNA 4KKBC 4XPFH 4CGUB 4JQVC 4WVRA 5C9KA 2CO7B 4WZ9A 3UPRA 3D39D 1T0PB 4WEBH 5JIMA 5TGBA 3IDNB 2YD2A 2P7TA 2HWZL 3VFWA 3VH8G 2WXLA 4JCWA 4LL1A 5KVFL 3RVUC 4Y4HC 3E6FA 2A6KA 5CMAB 5HJBA 2IDFA 1BVOA 4AMWA 3UERA 5DJCA 5BV7B 1PZCA 3MBWA 4YHNB 1AHMA 4FEMA 4QKTA 3RZCD 4MA1B 3DPBB 3SBWC 5IMOA 4ES8A 2MHAB 4NDMA 4IYKA 4WO4D 5I74B 5E2VL 4HUXB 2GAZB 5CEYB 3GZQA 3CDGB 4U0RC 5J89A 4OQTA 3KDPB 1FYTE 2O4EA 1G43A 3HG1A 3TV3L 2IWEA 5TE4H 5E24E 5F3FA 4NAQA 7PCYA 3LRSB 3DXAA 1JHLL 4B7LA 2ZXQA 5ISZD 4MMXB 1E7UA 1SQ2N 4U0QB 4HT1L 3UROR 1X7SA 1O7VA 3VFSA 4ALAL 4QEGA 1MJ7L 5MHSE 3MRDB 2OSYA 2F5BH 4B96A 5IJDC 5KSVB 1I8MA 2PYEE 4YXLH 2G3NA 2LU3A 2AGJH 4ELDA 1JVOA 2HUEA 4LCUB 2CHDA 2ZUQB 1DEDA 2ZSVB 3QAZB 4PJGA 4HOZA 1HX0A 1YLBB 2JKXA 1UB5B 1SDDA 1A6UH 3SKMB 2NY2D 4LSRL 5IVZA 1JYNA 1NICA 1PD0A 3DSFH 1FO0L 1XCWA 4TSAL 2GFBA 1TJHH 3ALWA 5EUOF 2Z7ZA 5FHBL 4QHKJ 4LVNB 4LSSH 3QIWD 3WUWG 2OXGA 3FQUA 3MV7B 2EE9A 2J56A 3B2VH 5D96C 3AUWB 4AQ1B 1YC8A 2FT6A 5AKRA 3MLVL 5AW7B 2D0FA 2NW2A 5SX4H 1I85C 3JV6A 4K5MA 4G8IA 5IMLB 5K9JL 4R2GC 3OR7B 1S9KC 3EUUA 2DYSB 1YECL 1ZDQA 5BVPH 4HA1A 4PRAA 1FV1A 4HD5A 1PNDA 2OR9L 1SFDA 1PY0A 2QFPA 3D2UD 1JK9B 3FOMA 3HAEB 1V7NL 4LLWA 4PJAA 5HGAB 5AENA 3OM3B 4NNYB 5E94A 3LH2L 3MC0A 3HFMH 3VG9B 3VD4A 4MDIB 4HS3B 4TL4A 4QRPB 4V33A 5EC1B 5KBKA 1LMKA 1DUZA 4JFTA 3P3YA 4P2CG 4BFKA 5DYOA 1N6QH 3LN9A 3LZFL 4MHHI 2O5YH 3BH9A 3T4YA 1KDJA 4Y7OC 4JFED 2F19H 2VYRE 4UQ2B 1JWSA 3A47A 1ZA6A 3BPCB 4HJ0D 3U4EB 1SXAA 1PIGA 4G80B 2V2TB 1A1MA 4I88A 4L9LA 2ROXA 4YVUA 3L5HA 2OZNA 3RG1C 3UMTA 1CI3M 5IJVB 1E27B 2HJKA 3QZWB 3VFMB 1ADQA 1UCBH 3MBEA 4PWHA 5CN1A 4NQVA 4J6IA 4LEEA 2J5LB 4M7LT 1U58A 5D2NC 3T4AB 2HVKB 5I1AA 3QVAA 5F2FA 5ESAB 2ED7A 3CFBA 2BVEA 2K6ZA 1GC1L 3ATEA 4IOFD 3ETSA 4DGVL 1L5GA 2D3JA 4FQXA 3CIQA 5CJOL 2DB8A 5HYIA 1NAML 4H8WH 1G9MH 3UBXI 2WXMA 3QQNA 1R5WB 2YUXA 1XCQA 3ARXA 1MFEH 3U9UA 4WK4B 3NABH 4PV9B 3UJIL 1U41A 2BC4A 3DVGA 1PFOA 4TSBL 5FLUA 3ABZA 4FQLH 4R96A 5J0BA 1AG0A 1XF3A 4YDNA 5ADPL 1ZRUA 2VL5A 4AV4A 3D7PA 1NMBL 2VZTA 1KBGH 3LD8C 2CMRH 4IRSD 5I30L 3ESOA 2AK4B 2DF3A 4HPYL 3IAQA 3G6JA 1A64A 2FO8A 1C08B 1L7IH 2R2CA 4OVUA 4AOFA 3IRCA 3F7LA 3RB7A 1XH3B 1TMCB 1SMAA 4M43H 3SGEH 5K1NA 1CDJA 1CR9L 1NUNB 3OPZL 4GSQA 3V5DA 5CD3B 2B3IA 1K5WA 2BIMA 1G0DA 2Y06L 4LNRB 2H2PD 4X83A 2QQNH 2YWZA 2FBJL 3WNKA 3QUYA 2CBPA 2P7TB 4AI7A 5MENB 3UAFA 2X09A 4TNGA 3NIGF 4JQVA 2DBLH 2H0EA 2WBJD 1AI1L 1TEFA 3OJVC 2V9RA 1LEKB 4Z7WE 3MI6A 5HI3C 4YXKL 2Y72A 5LUMA 3GMQA 3KEDA 5EBLB 2W88A 3WIHL 4G9FA 3D4ZA 3R19A 3ZTJH 1MCSA 4LRIC 4NDMB 4Y4HA 1I8KB 3MNDA 3EFDL 4IGBD 3MRGA 3O3EA 1KOAA 3AQZA 4LCYA 3VWKB 3SBWA 1UH4A 4H5SB 5EMYA 4XPTH 4ELMB 7FABL 3BRDA 1T22A 3BPNB 4X50A 3S5LG 1LO5A 1TZGL 2X4RB 2JFCA 2H3NA 3HC4L 2AQ1A 1UA6L 4Q6IA 1KB9J 3H8NA 1DQDH 5D7IA 3VDCA 2V9QA 4JKLA 1T0NB 1CDYA 3BH8A 1J5OL 3ATDA 3MGTA 1HI6A 5M7QA 3A6CH 3EOAA 4K2UH 5H37A 4WUUA 1RZ7L 4BZ1A 3LKSB 1U95A 1VFUA 3FT1A 2QFRA 4FCAA 4L3CB 2J5WA 4LSQH 4PB9H 2IQAA 1WHOA 5F1IB 5KSBF 1D5ZA 5H94A 3K4DA 5IVZB 4MNHA 4DW2H 3DHJA 3GRBA 3MJ9H 3FJTA 4PU2A 4YBLC 3E8VA 4WJ5B 3X12A 5HGHB 5BNXD 1IVLA 1S7TA 3MV8D 4E41A 2DQCH 1BQHG 2FH8A 2GB2A 2YD3A 3RWHB 1XO8A 3ARDC 3QJUB 2IALA 3ZE0E 2ODIA 5CEZD 1IGFH 3GKWH 1NTDA 2I60L 4M61A 1BXAA 3DYMA 4LLUB 1CDBA 3H3PH 3NJLA 1U3ZA 5CXPA 4JANA 4FMKA 1G7PB 1J9SA 1SXCA 2WCSA 3TT3H 1KC5L 2BS8A 4F8OA 2AZUA 1HS6A 5C2UB 3IGKA 2APXA 1DJWA 2IXQA 4CBZA 1MHHA 5DHMC 4GMTH 5KEZA 5HYJD 5I8EA 2H5UA 2F53E 4CSTA 2JQZA 3H4HA 2ITFA 1ZCRA 4PJAB 1Y6NR 2O5XH 1I85A 3FZUD 3O2VH 5C09B 1MJUH 3ZKQD 4QTIL 4W1TA 1Y7VA 3HN5A 3P0GB 4FDWA 5HHOB 1EGJL 5KJRL 2KZKA 3UMNA 1J1XH 1OLZA 2LU4A 2B20A 1HOCB 2YSSA 1HQ4A 3U6XS 2ODHA 5CBAB 1ZJAA 4HV8A 1ID2A 5FO9A 3GT6A 5BUAA 4EDXA 5CIPH 1OF0A 2IGFL 5DK0A 5DJAB 1GGTA 3L3JA 1LO0L 1U4EA 4LLDB 1IC5L 3PDOB 4K23H 4NX0A 2CA4A 4M1GL 1Q38A 4QKXB 5DHXB 2EIBA 2MNUA 3ES6A 4JQIH 4U1IA 1GZPA 3D33A 4U7KA 5IVXE 3V0VB 1XGUA 2YD4A 4WI0A 3K1DA 1JGIA 4YSQA 3RU8H 3T3PB 5EIVA 2BSTA 2O5NA 2CO3A 4NERA 3RUGE 4AQ8C 4IBVA 2FGZA 4ZUSA 1CDHA 1IAIM 5D2NA 4HWZA 2XT1B 3MVSA 1RZ8B 1FF5A 4GG8A 1YNLL 1XCQB 2Q2EB 2GT9B 1WFUA 4G6MH 5CILL 5B3JF 4PGCA 1KJMB 1KLGA 1K8DA 2E74C 2EIZA 2DQTL 2Z92A 4DQOL 1EANA 1WEJH 2WD0A 3S96B 2VL5B 3O3DB 5B1AB 5FGSA 5PAZA 1O9VA 3BSZL 3DETC 2VLME 1SXNA 3KPPA 4M7JL 4OT1H 3QFDB 4N28A 4P05A 2V2XA 4GI6A 2OMVB 1MLCB 1W8OA 3WKNA 5KTEH 3QCUH 1KENL 1MCIA 4KUZH 3F8UB 5CGTA 1AHWA 5G4OA 2CRYA 4QAMB 1OP3K 1LWJA 4BFIB 2OMZB 4PJDE 2VW7A 3EJQA 1MQ8A 5EUOA 4Z78B 2R8SL 4PW4A 4DN4H 3T0ED 3OBAA 4DK3A 5KVFH 2ADIA 4HMEA 4I0PC 5C0AA 4F57H 4P2OD 4ECNA 3ATAA 1VENA 4QRRE 5HHQB 2APFA 1Z9OA 3QXAB 4GW1B 5EOQL 3UAJD 3GMQB 1OB1B 3KXFE 3LQZB 1N0XL 5D7LD 1YAIA 5E2VH 5DVLA 1NSNL 4Q14A 1RVFL 3QDJA 1Y0LB 2ZG3A 1KXVA 3QCVL 1D3CA 3TV3H 4PRPE 3MRGB 1R4XA 3MRKB 1K4CB 2PPCA 2A9CA 1JHLH 2EXYD 3L9EA 1OIOA 4YFLI 4FMVA 4F2EA 4LRIA 4HT1H 1KEML 2EAEA 2GIXA 4N6RB 1PD6A 3ROLB 4RA0C 3IDMB 3UTQA 4ALAH 1MJ7H 3O6FB 4NCDA 4X5QA 1T5KA 2KZ1B 4PRHE 5DEFA 1BFOA 3FU9A 3IJ9A 4RGNB 1OQXA 4MJHA 3L1FA 4L3EA 3GK8L 5IW3A 5C0BA 1WA1X 4TQEL 5L4MA 2CZNA 5LDUA 1EBAA 5E8DL 2NPLX 2AQTA 4PLKD 3X3FL 4FJ6A 2E7MA 4N2EA 3TA4D 4LSRH 4FFVC 3OAYH 1DCLA 5JMOC 5DJXB 1B0RB 2IQAB 3ZDZB 4BXSV 4CL7A 1FO0H 4TSAH 1CQKA 2WBWB 1OGTA 4X6BA 1H6UA 5FHBH 1N8ZA 5DHDA 1G7MA 4XPBL 3ZU8A 4XHQA 1ZHBA 1IEBB 1T4KA 4XO4A 4QHMA 3MRFA 3BCDA 3NZ8A 1U91B 1EFXD 3IJYB 3LKPB 4NQTA 5CLYA 1JFHA 3MLVH 3WEMA 3FONA 4LASL 5T1DL 3GMLA 3EFFB 1WT5C 5K9JH 5IZ7A 2D31B 2GY5A 3KDMA 3HS9A 3OMZA 1YECH 3DJSA 3PV6A 4PLJD 3GD1C 3ARDA 4ISVA 4UQ9A 2TAAA 1JYWA 2OMTA 5JOPE 2OR9H 3ET9F 5D96B 4Y5YC 1V7NH 1E4WL 1OGAB 1RJCA 3LH2H 4F2MB 3BKYL 2WBKA 1PKQE 1TIUA 3H9SB 1ZLWH 1D6VL 2VL4A 3VCLB 2NZIA 3LZFH 5IG7B 3FQRB 3TESA 4RIRB 3QWQB 1QFOA 3KWVA 1WZAA 2Z91B 3K2MC 2FSEA 1F6AB 1IGML 2MCPL 4Y16D 3VXME 1EJ8A 4P5TD 4TQHA 5FYKE 4HX1A 3GPSA 2QADC 3TFBA 2I07B 3MXVL 4P4KD 5F7UA 1A21A 3TIEB 2UZYB 1PX4A 4XAKE 1TZIA 3X14A 2OJEB 3GSRB 2K7PA 5E2JA 4JFFE 3PQYD 3GXPA 2YAFA 5D1XD 3G9VA 5HPMA 3C60D 1GC1H 4DGVH 2WXHA 2Y3NA 2YN5A 4MXWL 4XCFL 2NY3D 1OL0A 3PWPD 1QHPA 5CJOH 2FLRT 3TJHC 1AQHA 1FQ9C 3CU1A 1OT1A 4U6HA 4N0FA 4R7DA 4PJ7A 5DJZA 3HCVB 2HFEB 3TZVC 5D7JB 4YX2L 3KLDA 4N0CC 1TCRB 4P46B 4JM4L 2WW8A 2DV6A 2RBLA 3UJIH 4TSBH 2VQUA 1HL5A 3S2CA 1XGRB 1X5YA 5IMKB 4GFTB 5ADPH 2B0SL 4AQ8A 2YWYA 1TTAA 5I30H 4HPYH 3KVPA 4JY6A 3HMXL 2ILLA 4KZCA 4KX7A 3EYSL 3BP6A 3FUJA 3GTNA 4ESKA 5GS2H 4DCQA 4NRXA 2ZT9C 1YN7B 1KB5A 1OP9A 5I5JA 4GEIA 4D9QE 1KCVL 4AL8C 1CR9H 3OPZH 3AC0A 2O6EA 1II4E 5CD5D 1YRKA 3ARUA 2B1HL 5KUMA 2Q76B 2Y06H 4Q9BA 3CFJB 1CB4A 2FBJH 1IAKB 1NFKA 3TEZA 4ZUUA 5DC4B 2FK9A 4GKOA 4ZW5A 3RP1A 1AI1H 3AFLA 3DV6B 5FYLL 3VD5A 2F7RA 4WW2F 4MMZB 4YXKH 2UYLB 2E5EA 1EXUB 3WE1A 3E1ZA 5GGQL 1I1CA 3WIHH 3TEYA 1HHKB 1JPFA 3D18A 3UZEC 1VHPA 4I0PA 3MCG1 4KKCC 4MXVE 4YAQA 4F7TA 2N7BA 3OB8A 5JO5A 4N2KA 4GBXC 2VZ1A 4A2EA 1LO4L 1KJ2L 5LNDA 4GIPD 2MCMA 7FABH 4FKHA 5LJYH 3M46A 1NAKL 1TZGH 3FOLB 3TYFA 5I1KL 3E7JA 4YK4C 2IAAC 3HC4H 4HMCA 3NP4A 1U8LA 4M56A 2I7SA 4JVUA 3MUHL 4F7EB 3MRIA 1WV7T 1M3JA 1UA6H 2DQFA 3QZPA 1SF3A 4MNQA 1RUAL 3US1A 1SMOA 2ZTBA 3QJHB 1AO7B 2G0LA 4AGNA 1J5OH 4X4MA 1HTYA 2WLNA 2XX0A 4P57B 1VGEL 5KWYC 3M7FB 3KLHD 2H6PA 5BVJA 1KPRB 3H54A 5E6IB 4GRLC 4L8BB 1N10A 1RZ7H 3BOVA 4PREA 1UWFA 4WHCA 1AR1C 3FUEA 2CBQA 3ZOAA 4KKRA 4UWQB 4UBDD 4DP5X 4YSTA 1E6OL 2J2ZB 3SKOA 2JMRA 3NJVA 4W70A 1QRND 3U6RA 1OOWA 4TTDD 4U4BA 1A4BA 5DTFA 1E90A 1GYCA 5EN3A 1S9YA 2EUWA 1TDQA 2O1AA 1Z9SB 2GJPA 5J1TC 3VI3E 1FCCA 1XF2A 2XY1A 1OF2B 4DOHE 3B9VA 2I60H 5IBLD 2NX5B 3WFCL 2YOAA 1FL5B 2F8IA 1NIBA 5DS8A 5JZ7D 4Q97A 4JJOA 2AQQA 3H2WA 5FYLD 3LS5L 4YBLB 4N5UA 1KC5H 3ARZA 3GNML 3LZOA 4QHKI 4BSVB 3GSQA 4V1DB 4QRTA 2QVMA 2XA3A 5KVDL 4P23B 2EVIA 5K39A 4OCWL 1WT5A 3SYAA 3K8KA 3OPUA 2XFGB 1QD0A 4QTIH 4ZMXA 4XCNB 5JHDB 4XN2A 4XNMA 4KDVA 1EGJH 2ZYIA 2IEPA 3APDA 4N8VA 5KJRH 3ILPA 4KNSA 3SKNB 4BA8A 1A1OA 4J3UA 4HKZA 4M7ZB 3HB3D 5EIIA 4PVBA 4GSDL 3K3QA 4FZ8L 5FC9A 2FEDD 2VSCA 3Q01A 1YNTF 3RTQC 3RWIB 5KBPA 3OKOB 4PJFA 3EZJB 2OK0L 1YNKL 1KYDA 3AACA 5I28A 4ANVA 2EVJA 4ZSOA 1OE3A 2C1PA 5EF1A 2EILB 1PJ9A 4A2FA 1MCWM 3NIGB 2IGFH 3NQKA 3OHXC 4DK6A 1DDHB 4LLQA 1LO0H 4OLZL 1IC5H 3DI2B 1F4YL 1O6TA 1R24A 2YQ3A 4M1GH 2BMKB 1I3GL 4KK5C 5AAPA 3NN8B 4OKVB 3DRTB 1D5IL 3LEYL 2ZNWA 4BE6A 5DS2A 2X6MA 4NRZB 4JFOA 4ZYKB 3LRKA 3ZTDC 5AYUL 5CP7B 3RB5A 5IREA 4MQTB 5DRWB 4V2CB 2XKNB 3H1ZA 4YDVB 5GRXG 3VGDA 4JVWA 3WTWA 2CK0L 2MNWA 2OJZL 2UY6A 1YNLH 5J6GB 5CILH 1J9RA 1L6ZA 4R7DB 4YLQT 5E4AA 3SDAC 2FL5A 2YK1L 3RKDC 5DZPA 3K2IA 3Q6FB 4JRXB 3VFTB 5KJ7E 2DQTH 4DQOH 3OMIB 4JKMA 3ASWA 5T1KB 1SHMA 2W0PA 4MA8L 1CN4A 3A4EA 4A04A 3O2WL 4M7JH 2CDEB 4JPWL 1KENH 4X5WB 2F74A 2BSBA 5HD8C 4KQ0A 5DQ9A 3TFKD 1DBBL 2P24B 5KSBB 2ZOUA 3I6GB 2XIDA 5I16B 2XETA 5JOFA 4M5YL 4FCHA 4H7VA 1TVHA 4WTQA 4NI3A 2R8SH 5LBVA 3KVQA 1T0MA 4L05A 1VEMA 3PHOB 4AQEB 3QJZA 1PX8A 4XPGL 4CVZA 3F7PC 3ULUF 1CLZL 2ZYSA 2UWEF 2IBBA 1H8NA 3QFJD 4ZAKD 3V6OE 1MH5B 3CQPA 1BLNA 3MRQA 5EOQH 4NQCA 2HG5B 1GL4B 5ICXB 2M83A 1N0XH 2HT4C 5HYSB 1NC4D 1JZIA 4J6RL 4ZBJA 1NSNH 4XVSL 2VDOL 3F84A 1O75A 1RVFH 2OI9C 4DSYA 4FI6A 4YAQB 2RFXB 5BZDB 4PTTB 4CJ1A 5KS9E 2HT3D 4LP5A 3V4PA 5C0IA 5J7CC 4ODHL 3NJMA 3ETBF 2IPUG 1KIUA 1TTGA 3UZEA 1KEMH 5FUCC 2BP8A 2K4AA 2X28A 1ONQA 3DJZA 1T21A 4N90E 4ZQKA 2FGWL 4O4YL 4YBQD 3EYFA 1FA4A 2YPLA 4KKLC 4ODSL 5A2JH 3VXQA 5HHMD 3QBTB 3VMOA 4UQEA 4TSCL 2OMWB 1SM3L 3T77A 3GK8H 3BFQG 2X2YA 1WCQA 3D52A 1NFAA 3IWUA 2VDRL 3Q2CA 4TQEH 4U3SB 2H6PB 3RTLA 3K4ZA 3BESR 3L9YA 4FTVB 2YXMA 3X3FH 3CBJB 3MRPA 1EK3A 1AIFB 2HB0A 5JW4Q 3BVTA 1KY6A 3NJHA 4JW3A 2CKNA 4AENA 4IRJD 5HDBF 4AXWB 5FPIA 1NPUA 3U6RB 4XZUA 3INOA 5E1AB 4GRLA 1BVKA 4WFGE 3GDBA 4XPBH 2CBTA 3LH8A 3MRMB 2FX9L 3ZZSA 2R59A 4XVUC 1H3UA 5H2BA 4NLAA 4QXTA 4JFDB 4LCCB 2JVUA 1AC6A 4LASH 5EO9B 3NRPA 5T1DH 4EF3A 2GK2A 2BOLA 3AUVA 3UEZA 5DS8B 3RA7H 5GSVA 4Y19E 1CMOA 2ITDA 4P5MA 5ACLA 2D7MA 4NQDA 4DP1X 4DP8X 4Y9EA 5LNGA 1GSMA 3ARGD 4FL4C 4FTDA 4H0IA 5EFIB 5EEVA 1AANA 4TL5A 3S4SB 3SOTA 1E4WH 5CJQL 4A39A 3OWEA 2V6HA 3OJDB 3PY9A 1PJWA 1FPTL 2R2EB 1T2XA 4HMDA 5E8OB 3SCMC 3V9EA 3BKYH 1Q0EA 5HDQL 3W81A 1M6OA 3ZTEA 5LN8A 1D6VH 3QUZA 5SWQB 1FAIL 2R1YB 3IJ8A 1HZHL 3ULUC 2UXGA 1CXLA 5C07E 4OZGB 2WO3B 3JTTA 4Y5YB 3U9PL 3EJCA 4FQIL 5MI0C 4H25A 5D70L 1IGMH 1K5NA 1YEJL 2MCPH 5A16B 2CIIA 1DN0A 4MZRA 3C5ZC 5I0ZA 3UTSE 3EYQC 5JPNC 1YEIL 3K91A 1XGQA 4WWPA 4PJHF 2GQHA 4J3OD 5JMRA 2KPNA 4B3EA 3MXVH 3CVDA 4PJ8C 4NSKB 2EZ0D 4Z6AT 1KGYE 4GW4B 1R5VA 5BS0A 4I2XB 4QWWC 3ZDYE 1H3TA 1KT2A 3RTQA 5JLZA 2OSLA 2VNCA 4HWBL 4K71C 1R24B 4GKSB 1HU8A 2WWMD 4LPCA 3AY4C 3HW7A 3SE3A 4AYFB 1N12A 4ES9A 2N56A 1G7IA 4UOW0 2QADB 3OHXA 4MXWH 4XCFH 3T1WA 4AIZB 4JFOB 1N4XL 3U9WA 4BUQA 2OM5A 1PDKA 5D7KE 4JCMA 1PZ3A 5DMJB 2DMKA 2Y3AA 4F7MA 3PNRB 3LEXA 4HIQA 2ZXDA 3L1OL 1UD4A 4YX2H 2E9JA 3IEAA 4ICXA 2NLJA 4HWUA 4ZT1A 4LCWA 3PAZA 5E5LA 4NP9A 2B0SH 1NGWA 2H26B 2VDNB 3I9GL 3HMXH 4ZS6D 3ZXAC 2CJ3A 5BZWA 4PTUA 3EYSH 4ZX5A 4AJYV 4NYLB 4X6DF 1BVLA 3B3IA 4JLRA 3HG4A 5D4HA 3QEHA 5AD0A 4C56E 4XMKL 3PXLA 3TZVB 1X5AA 3O8XB 2DS4A 5K93A 4HCGA 4KUCF 4WEEA 4GW5B 1G5GA 1KCVH 4M9PA 1GJUA 3E2HB 4WV1C 1CC3A 1QBLL 2CLZA 3BP7A 4UV7L 2F74B 3VFVB 3BE1H 4R83A 2B1HH 5DFVC 4O9HL 5DZLA 2Y6SD 3V0IA 2BVQA 3WLWD 3MCKA 3QDGA 2D3LA 3V0HA 1MFMA 3WHE0 4ZPTA 1DQJA 3CVHB 3FQNB 4WIQA 3TT1L 5IJKC 4LDEB 3OQRA 5D55A 2GABA 4Z3EA 1VEOA 4PGBB 2X2JA 2BVYA 3N9GL 1RZGB 5A3IC 4OV5A 1A4JB 2ALAA 2XJKA 1O6VA 1ZT4B 5GGQH 3MRQB 4JREC 1DHKA 1RCYA 3FQXB 3ZO9A 3MV7D 4UTAA 2EDJA 4X6EB 4K5OA 4NKIH 2F68X 1UEMA 3B37A 3F12B 2JXMA 4XN5A 3ZSSA 1G6RB 4UQDA 2CUIA 4R7XA 1G9NL 3CZLA 1IFHL 1LO4H 1P4BL 5T3XL 3VD0A 1V3MA 5E9DB 1KJ2H 4U4IA 3WEOA 4YSCA 4Z3JA 5MEOB 1LE5B 5M95B 1AQMA 3SGJC 3FN0L 1KIUB 1NAKH 4CC0A 4UI2A 4N9OB 2A77L 5F9DC 2IDQA 4UAOB 1T21B 4BCZA 4JDEB 5CNHA 4GBXB 4AEFA 3KEHA 2ESVE 1RUAH 15C8L 1E5UI 3DOHA 4XVTL 5IB1B 1WFNA 1VGEH 1O7SA 1D7CA 2V8LA 3HHSA 4U1GC 5ACZB 4E0RA 4K7PY 4QRPD 3AXLB 4IBWA 2DYPB 3FU8A 2CNYA 2CSPA 3MNZA 5SX5K 3ESMA 1CG9B 3MJ8A 3HE7C 1E6OH 4QOKE 5L4IA 1ZXQA 1ZA3A 5EA0L 5D1ZA 3CDFA 4G8GB 5GIRA 2KS0A 3MRCA 1XEDA 3VXSA 3D4CA 1KSRA 3TYGL 4H8VA 1BVKB 4YGAB 5DFAA 5IK3A 2GSMB 2EDQA 2IIJA 2UUDH 3SY6A 1FZKA 1INDL 4OZHF 4H0GA 1GJIA 3CMGA 4ZFOB 1X5IA 3IXTA 3ZQXA 2GITB 1ZLUK 2BWDA 2I7OA 3WFCH 5C8JA 5JQHC 2VDPH 4MQXC 4LDLB 2P44B 3ULVD 1A6PA 3LS5H 5FDWA 1JK8A 4EUPA 4OLVL 3GNMH 3VW3L 1GVIA 5EO1B 3ZHFA 4POZC 3NSFA 4N24A 2J8UE 4KK8D 4U6YA 2Q9OA 1TQCB 1FH2A 5TJWK 1OM9A 1S7VB 3UL4A 5KVDH 1GYAA 4OCWH 3MNMA 3Q5YA 1ORSA 4LNVA 1OAKL 4UDUA 2QMJA 2IV8A 2YLKA 2EADA 3HC3H 1SVBA 1JNHA 2AK4D 4YVNA 3O9WB 1UHVA 4ODBD 5HVHC 2EE0A 3GZPA 5JW4R 3MLRL 5IVNA 2X4SA 4FZ8H 3SCMA 4AM0A 4XNYL 2OK0H 1QUNA 3RVXC 4BKSC 1YNKH 3GQFA 2EYRB 2XV3A 5CJBA 4JFPB 2UWEA 4ZMAT 1UGNA 3MDJA 4OLZH 3FFDB 4WW2B 1TLKA 1V10A 1HXMB 1F4YH 5DC9B 2XV2A 4UQ3B 3P9MA 2D7OA 2OLDA 3C5ZA 3NCXA 1I3GH 3RTQB 3DDFA 5KYXB 5JPNA 4W9GC 1D5IH 5MEND 3LEYH 4W4OC 2Q6WA 1IRAY 3VSUA 3WTVA 1KBVA 3FO9B 2MJWA 5K9QG 4PJ8A 1GR7A 1CS6A 3CQQA 2WQAA 5AYUH 2NY4C 4RGOL 2P5WB 3MKKA 1JV5B 4JFSA 3MSPA 2I9TB 3TBWB 2CK0H 1X5HA 3AY4A 3T0BA 4BCXA 2ATKA 2LGNA 4J2XA 3FH7A 3GSNB 4M6OL 3VRLF 5AVUB 3G5XA 1PS3A 2YK1H 1OEZW 3FUDA 2I27N 4Y0GA 2RIKA 4LLYB 5J12C 3KGTA 5JPMB 3KNBA 4JY4B 2ISDA 2VZUA 4JUTA 1Z9LA 4ONOA 4G6AC 3VWKD 1NGZA 5BMFL 4GJTB 1K6QL 4FADA 1J0HA 5F44A 1P2CA 4NWTL 4Y5VB 3O2WH 3DJ9A 5AD0B 1RZJC 3CUPB 4RA3A 1TTRA 3SDAB 3ZKSD 4JPWH 1UWXK 5C0DA 1RIHH 1BX2A 1WBZB 1WD9A 2WNXA 3KBEA 1RZPA 1XR8A 3KPRE 4NQEA 4MRCA 1DBBH 2WXRA 1YC7A 3UTPD 4Y1TA 3PUUA 4F8TA 4M5YH 4PHZA 7TAAA 1VFOA 4L4VE 5F71A 1WQVT 1ADQL 3C5JA 2YAPA 1PIFA 4XPGH 3QGVA 1NDGB 5CSZA 2EEAA 4WV1A 5C3TA 3EJYD 3VD2A 3KPOB 4G43B 1CLZH 1HSBA 1J18A 1NBYA 3TPUA 4D7BA 4OZIF 1AQDA 4WNQA 5C0JB 2NT0A 3WTSA 4G7SB 2F2HA 1C16A 2DEYX 3X11A 1HHHA 3N04A 1W72B 1X5MA 1T66D 3MROB 4ZMVA 5C0EA 2QLYA 2ZJSL 4J6RH 4XVSH 2VDOH 1BZQK 5EH1A 4DKEL 1H8SA 1JG9A 2ITCB 5B4MD 3WTXA 2NTFA 3G5WA 2VJXA 4PJBE 4E9VA 1GRWA 2BNUB 5AVQB 3VGEA 4ODHH 2VSDA 2JCCE 3D25A 2IMMA 1ED3A 5TH2A 3C12A 1U8IB 2FQGA 2F1AA 4LVHB 2BRQA 4Z7OF 4OFPA 1G9EA 2P5PA 2E3VA 4O02A 2FGWH 5HGBA 4N2IA 4O4YH 4BFNA 3B6SB 1MWOA 4ODSH 4YEEA 4WI6A 2ZKXA 4FGMA 4J3OH 1CGYA 3ZMRA 1ML0A 5ADOL 5BOJA 5C09D 3L45A 4TSCH 3CFCL 1YNTB 1C5CL 3BWZA 1SM3H 3GBEA 2F1BA 3HHSB 1EZLA 5HHOD 2VDRH 3WTTA 3QUXC 2HLFC 3NPSC 4GKZB 5EN2A 1MELA 3ME0A 3FCUB 3GHPA 2RAMA 1QBML 2BCKB 1F2QA 1QATA 4LIQL 5J1SC 2GTQA 4KMLB 2NQDA 3MZTA 4R4BB 1DZBA 3CFIC 3GTTA 4XO5A 2X3AA 2EYTA 3CDYA 2ZOKB 1L6PA 3ABMB 3LKQB 2VQ1B 4KI5C 3HE7A 2FX9H 5IK3B 3V5HA 2XVKA 3QI9B 5ANMA 4K5PA 4EOWL 4XXWC 4X6CA 4ZMTA 1BQ5A 2VR8A 4JG5A 5B38G 2E75C 4L8DA 4KRNA 4YDZA 3U1PA 4KXAA 3TO2A 3DV4A 1VERA 4BHUA 1JTPA 3T6ZA 2A3TA 1B4LA 4UYQA 1MCWW 1JGVL 1MFAL 3ZVVA 3GTVA 5EU5B 2Y5TB 5CJQH 4S0TD 4PV8A 1FPTH 4H1LG 2IC2A 2WLLB 1AOHA 2JKTM 3VB9A 1INQB 5HDQH 1B4RA 1P7QA 4QRQB 2FQDA 4EN3C 1FAIH 3V5KB 4EJ1C 1OWWA 1Y1DA 1HZHH 3QXDB 2GTZA 1I31A 3EJSA 2WIIB 3RDTB 4FLRA 5IGXL 2HFGL 4FFZA 3U9PH 2X4PA 3L5IA 4QLWA 4FQIH 2VJ0A 5D70H 5BUPA 1YEJH 3PABA 3FCSB 3BVXA 2XBTA 1YEIH 4Y2DB 3FQ2A 1B2YA 3VNYA 2ZXBA 4Z7UF 1ODUA 3U4AA 3B9KC 1T6WA 2MOGA 4HUUA 5DD5L 1YEDA 2B9AA 5F89B 1ZVSA 5FM5O 3WL9B 5A1AA 3FCBA 5I73B 5F0MB 1OXYA 3F58L 4PRIE 4HWBH 2JCWA 5MI0B 3C5ZB 5INCA 4JHWL 2ENPA 2R51A 1Z9MA 4NN5C 3TBYA 4JRYB 1SJEA 2CJUL 5E5UB 5IQ9A 4B9CA 1CLOL 1N4XH 3P4LA 4HIXL 4RSYA 1SHWA 4JHZA 3TA3C 3TBBA 3UBFA 5F70A 3O45B 3DX8A 3L2MA 1A4KB 1KTCA 1S7UB 4QHLA 4XCCL 3IN2A 4HGWA 4Y4KB 2XN9E 4E5XA 1XB6A 5IHZA 2A73B 3EOYG 3U2JA 3HAEH 3L1OH 1R5IA 4W4OA 2VDQL 3C75A 1MCBA 4G9FD 5L0QB 2F7PA 3TH3T 1UGKA 4R90L 3G5XB 2EP6A 4H2CA 2W8CA 2D7NA 2F0CA 1QW9A 5JNYA 3BT2L 3I9GH 4DGYL 5SWZB 4I0CC 4MJ6A 3RIKA 4POYA 2WLMA 4PIBA 4XMKH 4Z5RB 5E00A 3BI9X 1JZ7A 3O6FD 1AE6L 1QBLH 2WLHA 4FXKA 4UV7H 1W0VA 3UDWC 4ENZA 1V7ML 4TNEA 3S3BB 1SHXA 4O9HH 4NUJA 4RGND 5HDBB 1CE1L 2IG2L 4QY8B 1C5DB 1IM9B 1BM7A 2NY0C 3B2DC 4GUOA 1GAFL 2YC1A 2W0LA 4WUUD 2K3TA 3LXUX 3RWCB 3LPPA 4NQSB 3QEUA 1M1SA 2N1KA 3N9GH 4LSPL 2Y07L 5EZJA 3QO1B 4WNQB 3V8CA 2PTTA 3R4RA 2P8LB 4G8EA 3P4NB 4XN7A 2BOBA 3QDMA 4HH9B 2F9BT 1A4AA 2BP0B 4KTYA 3IKCA 4D0DA 3CGTA 1LK2A 3P4OB 4HJGB 1G9NH 5DVKA 3DX9B 1IFHH 1FNAA 2BFGA 1P4BH 5T3XH 2X4TA 3EF4A 1S8DA 1JPGA 1Q1JL 5DWPA 3ZY7A 3T8VA 2Z6FA 1MWAA 3OXRB 1ED3B 3FN0H 2AC0A 3B34A 3QNXB 1QHQA 2Z8VC 3WEBA 2DQUL 2Z8WC 2A77H 3S8FB 2IGLA 1TVBA 4KGJA 5HGBB 3AZUA 1OGAD 2KKQA 4I9WD 4HZLB 3EXJA 15C8H 2OX5B 3QH3A 4XVTH 6TAAA 4L1DA 3WTYA 5IHBA 1MI5A 3PLYA 4WW1B 3H9SD 1W2KT 2HKHH 4RMQA 3JZ7A 3TBTB 4PJHB 3S36X 4L4TA 1JV2B 1Q1PA 2VITA 4LKCA 1AGDA 1VKXA 1T7XA 2N4IA 5EA0H 4OVVA 3RGVC 4HWNA 1E9QB 2BOCB 5BJTA 3LZQA 4PBVC 4KVNL 2X6AA 1E2VA 4JGJA 3QIBB 4Q0XL 3GDCA 4M3JA 4WJG3 3QUXA 1UEYA 1FIEA 1NANI 3CDZA 3MRLB 3STZB 3TYGH 1PQZB 1OP4A 4Y8DC 3QNZB 3IAGC 2PO6B 3HOGA 3B7YA 3HE7B 4FOMA 1INDH 5IHUL 3B7UX 3GIZL 3KWUA 5BOPA 1QZNA 1IE5A 3W9EB 4PWEA 4OQTH 2DYRB 4E36A 5SWSA 3GGWB 2WXNA 1YUHB 4OLVH 4RX4A 1EDQA 1ZSHA 5IR1B 3DBXB 1QSEE 4CADA 4B5EA 2NYYD 4U1MA 2P5EE 5I0XA 1BD2E 4HIIB 3MTRA 1UH2A 2DQHL 3X1NA 2JK5A 4XXWA 3ARBA 3H9HB 4LQ1A 4X6DB 3ZMNA 5D7JD 4PV8B 4GPVA 4P46D 3ZKMD 1INEL 1OAKH 1I82A 2J3SA 4P99A 4AYSA 3PFUA 3EGDA 4B9PA 4GO9A 4XBPB 4R3SA 5IW6A 3H55A 3FTXA 3MLRH 2VIRB 5DK2A 2XWTA 5E8EB 5T1LB 5HI5D 4AT6B 3EBIA 4DPBX 4XTRC 1BF2A 4XNYH 2PW2A 1XXDC 2XSKA 3FK3A 4FX5A 4EN3A 3NJNA 1MJ8L 4JUSA 5KBMA 5TPWL 1QASA 3NCFB 4XB3A 2WZPD 2C7FA 4LSTL 2E56A 1S78C 3JV4B 3O3BA 1AJ7L 3PP3K 1P1VA 4K7FB 4Y1AA 3N91A 1VA9A 5CSBA 4LPWA 5HVHB 2IVFC 3OGCA 5DJ6A 3DUSB 2NY5L 3HG1E 3DA0A 3B9KA 1JGUL 3BKML 3PL6C 3DO7B 4X98A 5JTWA 3DXAE 4AGPA 1SOQA 4KMTL 2DOCA 1TF4A 4RGOH 3IJEB 1EZVX 4P2AA 3FB8B 3CFQA 4WWID 5IP4A 1TQBC 1E28A 1JAEA 3ZBMA 3IMRA 1UUSA 2BSSA 3CVIL 5B7EA 4M6OH 3T0VA 5FO8B 2XPYA 1NBVL 4TQ8A 1KGCD 1DJHA 5A2CA 4GAJL 3TA3A 3VUAA 2X0VA 3SZKC 1JN6A 5HI3D 1WIOA 4R9HA 1WAEA 1W0WA 1O5DT 1G7HA 5BMFH 1K6QH 4PJGE 4NWTH 5AALA 2C1OA 2WINA 2H32A 4MS6A 2K9FB 5LBSA 1SEBA 4G9DA 3OAZH 5AVVB 3KW8A 2IANE 1NOAA 1T4WA 1XGTB 3BUYA 3NZSA 1BF5A 3MREB 1S9VA 1AO7D 1OKEA 1SJMA 4PY7A 5L6YL 1M3IA 3ULSB 4EN2A 2XWZA 3BGMA 5D2LA 3HNTL 1ILUA 2A6JA 1JNLH 4EIGB 6CGTA 1ADQH 1G9HA 3L4CA 2XWXA 5E6ID 2NSXA 3VXRD 4OJCA 3Q2VA 1E4HA 5EU6A 3QPXL 1P7KB 5AW4B 2Y7QB 1UWYA 4BIKA 1F11A 4L48A 3UDWA 4M3HA 3RDJA 5E6UB 1CGXA 3GMOB 3THML 4OZHB 1QSFA 1KDIA 2NY6B 2OW7A 3BXNA 3BSHA 4Z7WF 2AQ2A 2XZQL 2R9HC 1QAWA 1K2DA 1XSJA 4UILL 4Z0XA 2ZJSH 1JWUB 3EKCA 4DKEH 3B9DA 2XWBB 4Q4IA 3VVWA 5I6KA 4Z95L 2GY7B 5E7BA 5GZOA 2F54A 2NX5D 4K3GA 1YAZA 4J4PD 1R3JB 3SDDC 1C8PA 4JE0A 3PWLA 1F56A 3UG4A 4J23A 3RZWA 2ZNXA 1CDIA 3G6DL 5GGSY 1MWAB 4LPXA 2VN4A 3NSXA 3IMBA 4WI5A 1BAWA 5I17B 3ZGHA 5E6RB 4V1DD 4NKMA 4HUWA 4QYOA 2LHAA 5FX3A 1FLRL 4JPQA 5ADOH 3L3OC 4P23D 5GRJL 4G1MA 4I1RA 5BRZB 4PSRA 3CFCH 3TBSB 3RWEB 1K8IA 1X7TA 4KO7A 5JHDD 1BBDL 1CUOA 4RQQB 3K71A 2DICA 1CFBA 1OP5H 1QQDB 3U7WL 4PJCA 1QKZH 4L4TB 4HEPA 1QBMH 1FRGH 3PWVB 3B3BA 5A43C 1HQRA 1VKXB 4EIBA 1X6NA 4LIQH 3SQRA 3RPIA 4OFYD 1NANH 4AH2B 4UM9A 5FEBA 3BPLB 5FDYA 4JBSA 3NPSB 3AABA 5TK4A 3LKOA 3SY0B 3RGVA 1Q72L 5FXCH 3VVVA 3ZW3A 3IS1X 1ZS8A 4Q2ZB 4BUHA 4X8GA 2QQLL 1I3VA 2DM7A 1PAMA 2VUYA 2CJSA 1AGFA 2A9NL 2XYCA 4DP2X 3EGSB 4GB9A 5FWRA 2KBGA 1CYXA 1JGVH 1FLTX 1MFAH 3LY6A 4Z1PA 2KLTA 5I24A 1RJYA 3TONA 3FT4A 5F9JA 1KPUB 1HDMB 4F37K 2H8PA 2JK5B 1OW0C 5KYNA 1N2RB 3V0WL 4HJTA 1JHTB 4S1RL 4JRXD 3UYRL 2X9YA 1XGYL 1PKOA 4BCYA 3NFPA 1CICB 2NOYA 3QEQB 3J2PA 5KYUB 3OR6B 5T1KD 4Y2LA 2J25A 2WVSA 5IGXH 2HFGH 3BIAX 5H37H 5MEPB 5JUEL 2ZCHL 1A3RL 3RBGA 2X70A 1TZOA 2FWOB 3DUUB 5ITBH 2WZ5A 2GUOB 4W93A 4Q52A 5DLLA 1BVNP 1G4RA 5B4MC 1FNGB 5DD5H 4OZIB 1MDAA 2WLIA 4OLWL 3F58H 1PVHA 4PRDA 2OL3A 5D4QA 1AIZA 1CT8A 5H35B 3AGWA 3FPXA 4JHWH 3SHSA 3F7YB 3STLA 1MJJA 4N8CL 3LPFA 1CLOH 1A8ZA 1M7DA 3CLEL 4JAMB 1MCKA 3HG5A 1FYTA 4FERA 4XCCH 3N41F 5L88L 1IBGL 2WQXA 1T1XA 3RUGF 5K9QI 4K7PX 1QSZA 4IKLA 5E2TL 2YKKA 3AREA 3S3CB 1ES0B 2VDQH 3T6XA 5D7IE 3PL6A 4H88L 4R90H 2PPAA 4Z7OB 1O6SB 2YD0A 4P2QB 7CGTA 5IROD 1B4JL 3MUGB 3BT2H 2YUZA 3U7AA 4A7VA 3K80A 1JN6B 1GJWA 5DFWH 1NEPA 5SV4A 2JKWA 3VGAC 1G7HB 1PW3A 4R0LC 1RPQA 3NIFE 2PYEA 3B5TA 4YFDB 2BNRB 1H15B 4WFFD 1U92A 1U36A 3GI8L 4GRWH 4RAUB 4DAGH 1AE6H 1V8HA 5CR8A 5A40E 2JJVA 1V7MH 4GAGL 4BH8B 2J55A 1NGXB 3L7FB 3HS8A 4CGTA 1HHIB 1CE1H 1TQSA 5B8CC 4IBUA 2IG2H 3GMRA 3AB0C 2C5DC 3BGMB 4NXSA 1VGKB 4YDKL 3IJHB 3OC8A 4ZW3A 5JHLA 1GAFH 4ZNCD 5MEQB 4RMBA 4TRPH 1OAUL 4FTVD 3SPIA 1JDCA 3K6FA 5LBGA 3OKLA 4HKJA 1N18A 3SDCC 1G1KA 5ESQB 5C7ZA 1L9QA 2WSKA 4LSPH 3S35X 4K3DL 2Y07H 2LLGA 2WXPA 3I2CH 2OXHA 4O51B 1EVUA 2GHWB 4OCRL 5J6HB 3FHQA 4ETYA 2EDYA 3HNSL 1SHSA 3LDBC 2NY0B 3WNNA 3BZEB 3ABKB 3O41B 3BT0A 2AW2A 3NGBB 5CN2A 4OD2B 2FRGP 2LTQC 4IJTA 3NACH 4AGLA 4JFDD 4WGWB 3D8MA 4MJ2A 1IE4A 4AE1A 2X2UA 3QEGL 1Q1JH 2CXGA 2UZXB 4O2CA 43CAB 1N7ML 3FU7A 3ZE2E 1BZ9B 1HCVA 1P9MA 1FZOA 1SJHB 3IE4A 4G7YL 2DQUH 2L7QA 4Y9BA 4ENEC 2AQRA 2XHNA 4UNIA 2P49B 1NOLA 1ZLVK 1GGIL 3D85A 4I48B 1WTLA 4OF0A 3GZKA 4ZXBC 4D8OA 1K4DB 1EERB 5T5FL 4OCMC 4JB9L 4Z76A 3SE8L 4R7VA 5EPMB 1UA7A 4PR5A 4APQC 3RWJA 3VRIA 3SPCA 1KWGA 2A83A 1P5UC 1RJZB 5I2IA 1SQMA 5FM4A 4Q9RH 4Z7UB 5B1BB 1IARB 2MTAA 4ZNEE 3L54A 1EXHA 3L5WA 3K71B 1E42A 2ZYRA 4GLRI 4WFED 5T1MB 3CVHL 4X99B 3L3OA 2Z7WA 5DUJA 1AD0B 2GSGB 2EEFA 2NR6D 3SN6N 1G0YR 2IBZY 4AL8L 1CVSC 1XMWA 1DE4B 4NXKA 4Q0XH 5AVYB 5ESVA 3AT9A 3H7BA 1MCPL 1UYWL 2FLMA 2AXWA 3O0RL 2ICEC 3C08L 4KC3B 2AXGA 1KTDB 2F58L 4WWOA 1U8CA 4PP2A 3PXHA 1TENA 4PJXE 4HS8H 1MVUB 3GIZH 3JZYA 5IHUH 3VI4B 2WUBH 3IDYC 2A0LC 2O6CA 3L3IB 5AW6B 1G6RL 1QR4A 3MA7A 1A6AA 3DHMA 3VXPA 1O9WA 1OCWL 4ZO8A 5FA3A 3OKKA 3V6FB 2VE6A 2P8MA 2QADD 4NT6B 4IBYA 1MAML 4NB7A 3U0TA 4MCZB 3BUBA 3V4VA 2DMCA 3X3GL 4K9EC 6PCYA 5CFHA 4DGWC 3CIAA 1F41A 1FFRA 2DQHH 1ACXA 3NIDE 2KI6A 1CK0L 3ZYJA 5F3BB 4F9LA 2MQGA 1M71A 1ZTXE 1INEH 1G7LB 2W0FB 8CGTA 2BZDA 4P4RA 3HVNA 2W07A 3QP3A 3MBXL 2BSRB 2ZAGA 3TJHD 3FTYA 4ONGL 2KDGA 1VIWA 2Y9RT 5CJXC 4LEXH 3DK0A 3U1SL 5K1JA 2ENSA 1FUNA 3HC0A 1J12A 5IBUB 5C0AE 3TZVD 3O8XD 3FQTB 1FNEB 4F7PB 1PZUB 2X70B 3KYNA 3MV8E 1QO3A 1MJ8H 3CFEB 1JF1B 4JZOA 4NPJA 5TPWH 4BELD 4LSTH 4XR8C 5CEZE 1AJ7H 4K55A 3RFZB 2IPTL 1A47A 2FB4L 1MCNA 4RMUA 3F05A 3IGAA 2N0KA 1I1AC 4WHYG 3QQ9C 4Y2OB 3WS6C 2NY5H 2N7SA 3C2AL 1WC7A 2YEVB 2NSMA 1TZHA 3EO9L 3B9EA 5EULV 3SODB 1BEXA 3BKMH 3JV0A 5AOJA 1U4FA 3FO1A 1G94A 3OZKA 5FKPA 4F8LA 1T5XB 2YD5A 2AAAA 2JLPA 5EEXA 1PZSA 3TEXA 2EYSA 4JJ5B 1FYTB 5B7FA 3R4DA 2P9RA 1KLUA 1DVFC 2BM3A 2B59B 3CVIH 3WXWL 4ZFFB 5FA4B 1NBVH 3U25A 5DRXA 4MZ3A 1DQQB 3PL6B 2FR4A 3DARA 3BHBA 2ZX8A 1ZAGA 3B7TA 4R4NC 2D0HA 5CZVL 2YO3A 2AQSA 3IMSA 5E9DD 3A6BL 4FG0A 4LKXB 5JDSB 3DGGA 3BP5B 4CNIA 1JZJA 2F7QA 1LD9B 4JN1L 2PYEB 1GYUA 3OG4B 4NO0A 1KUMA 3PHQA 1E43A 5AOZA 3U2SA 4GBXD 1FL3B 1YY9D 2DEXX 2XUWA 4LHUB 1BIIB 1QPXA 2OR8A 5FAAA 3T8XB 1DBML 2AV7A 2IFFL 4CMMA 3GSOA 1FNHA 3RJQB 4D8PB 3U0WL 4AV0A 3UC2A 5L6YH 3UOAB 1JYVA 3EO1B 2HLEB 2DYPD 4OCNC 3K6SA 4ODXB 5KAQG 1DJZA 2ZP0T 4J7RA 4NZFA 3L9BA 1H19A 1JS4A 1S5IL 2IGTA 4H20L 2QKIC 1PZAA 1CFQA 1YHPA 1VFBA 3G5ZB 3GRWL 3HE6C 3REWA 2YUVA 4G8GD 4GQQA 4JPIA 3ZDXE 5B8CA 1IAOB 4QHNA 3L1GA 1I7ZA 2XZQH 4DZBA 4NO2B 4UILH 4E5XG 5IV2B 1QFPA 3CSFA 1P6FA 4NHUB 1VSCA 4PCTA 3MRJB 1R3KB 2DQJL 4R6UA 4F7CB 4Z95H 2C9RA 5I8OL 3L7EA 1H6EA 1ZT7A 4MNGB 32C2A 2Z4TA 1RP8A 1Q9KB 4MXVF 3FSVA 2E7LC 4DVBA 3GSVA 2ARWA 2HRLA 1GKOA 4GAYB 3HN8A 4OZ4B 4DETA 3G6DH 5J11C 2FYYB 2OTUA 3VXTA 3KYKL 4OGQC 3O4LA 1U8NA 1T1WB 1EDHA 2O26U 5B7MA 4OTXH 2YRZA 2YA2A 2B39A 1FLRH 4YLBA 1KB9K 1KB5H 2R1XB 5IEKA 1ZV5A 4HIJA 5GRJH 3GMPB 1KIRB 1RIUL 4AIXA 3SDDB 2WWOA 2GCYB 2GTWB 4E42A 4OZFA 4TVPL 1AGBB 3DX1A 3GXMA 3PUCA 1MF2L 3RWJB 1BBDH 4KY1L 4X80L 2HMIC 5BOZG 4P07A 2RCSL 4ZXBA 3O9WD 2WVVB 1IIIA 2IJ0C 2VR6A 4U05A 3UJTH 2BRRL 3I9PA 2CLVB 3UYPA 4APQA 2PABA 4HALA 1P5UA 2V17L 1CBJA 4L0ZA 2CLRB 5ESVB 4AKPA 4QUOA 3UP6A 1BEYL 5AZEL 5IVXA 1W72L 2Y69B 3LZNA 4PJ7E 3VX0A 2AXGB 1BYOA 2WOYA 3VI3F 1Q72H 1U8CB 3TLRA 4KZEL 1JZ2A 5DD6A 2VW6A 4BH7B 3VTAA 4YL4A 3RUGA 3RTQD 4UTAL 5IFJB 4JFYA 3H3KA 2QQLH 3FFCE 4YFLF 2OZ4A 1RK1B 2EDOA 1ZSDB 5E8NA 1V27A 1NFDA 2ICEA 2A9NH 2WXOA 1AZUA 1CLYL 1YPZE 2P5WD 4XOAA 3VXUA 1XBRA 2JTDA 4H26A 2W91A 4AGMA 4GUPA 1Q9WA 1QFWI 4PRBB 3EBHA 4EXPX 2O6DA 3DX0A 4U1NB 3V0WH 3ZGIA 4M5TA 4S1RH 1UZ8A 3QR2A 3HKFA 2UV3A 2DRUA 3UYRH 1FNSL 1XGYH 4JFUA 2YQGA 5KN5A 1ZHNB 4OUOA 3BZ4B 3GMNB 1JGLL 3BCFA 1T83C 2Y7SA 5LDSA 3T2LA 1KIQA 1U3HC 1XBDA 5JUEH 2ZCHH 5J13C 1A3RH 5GSRA 2PTUA 1CD0A 2A74C 4HS6B 3SDAD 4JO4L 4PJDA 3H2PA 3KYNB 1Z3GL 3TO4B 4QLRA 4JZOB 3GIVB 4D94A 2F5AH 2CIKB 1E3FA 5CINL 1WWWX 1N70A 3MLUL 4TVPD 5CJXA 4I4WA 3OKDA 1DP0A 3WEAA 4OF5A 4E68A 4HFUH 4Z7WB 4G2AA 4MAYC 4QRRA 4BXVA 4S2SB 3KXFA 1H3PL 3V9CA 4BV1A 1XB3A 2CCLA 4N8CH 4RRPA 1KXQA 5L9DL 2MKWA 3FO1B 3D4GA 3BVWA 4PP1D 3CLEH 5FK9A 3WS6A 2K45A 4DTGL 3Q3GB 1I1AA 1AXIB 4JFQB 5B39B 3R06B 2VT0A 2VN6A 5L88H 4PRPA 1IBGH 4N3TA 3TIDB 1MCQA 4JGMA 5E2TH 5L2JA 2ZSWA 3D08A 2WM0A 4KAQL 4H88H 1JUFA 3CAFA 1TKWB 3GBLA 2EE3A 3CN3A 4MZ2A 4X4ME 5DRXB 4MA3B 1B4JH 4PJ6A 2BLFA 3UADA 4JM2C 4TTGA 4KK6D 1JMZA 5DMKA 1JZ4A 3UO1L 5IKCA 4U1SB 1DVFA 5AFAA 3KPMA 2AQNA 5FW7A 4TYUA 4A2HA 4BGLA 5J5EA 5F1SA 5CAYB 1SY6A 1IGJB 2WKOA 5LAPA 3GI8H 4Z7VE 3TJEL 1YY8B 3B7SA 1DJGA 3FRPA 3RHWK 4GAGH 1EEQA 3PQYE 4R0LB 2CUMA 4U2ZA 3ULUL 4YDKH 4OF8A 3D07A 1AS8A 1OAUH 2ADGA 3K6NA 1U3NA 2JJUA 3V8OA 4TF4A 1I9EA 4KKLD 1E5CA 4K3DH 3AWEA 2HN7B 3IB4A 2X05A 1MHPH 4Y4FC 5I6NA 1S5HA 4OCRH 4OJDH 3KWXA 1WYJA 4IU3B 3HNSH 3AB0B 2VXQA 4PJEA 2WKGA 3BAKA 3KAAA 3L95B 3BVNA 2QKIA 4LF3A 4XCYA 3SDCB 1DBJL 3FRUA 3MFFA 2DWDA 1QNIA 1HCFX 1JI2A 1FFNB 4YHIA 3JWNC 3QI9D 4CUCA 4X2UA 3HE6A 4X9YA 2XKSA 4N2MA 3GWJA 4I3SL 5FHAL 4FXGB 3WKYA 3G9AB 4FG6C 4XBGB 3QEGH 1YZZA 1N7MH 5KS9F 2F53B 3Q43A 4EQ2A 2GI7A 2EDWA 4I9XA 1BREA 1FN4A 4G7YH 3KPLB 3OKEA 1CBVH 2ICWJ 3IFOA 1PKQA 2EH7L 4I7ZC 2DW5A 3ARFC 1P69B 2E7LA 1WBXB 5T5FH 4JB9H 1ACCA 1D9KC 1JDAA 3BX7C 5LCVA 3SE8H 2OP4H 3CFKB 1S7RB 3RDTD 3CVHH 2P8PA 1ZVHA 3RIFF 1Z66A 2BVPA 5IW1A 2GJRA 4AL8H 2K9UA 3EOBB 2UZIL 2V3FA 3MRNB 3PPEA 4OIIL 4Y2DD 4YZFE 5E2WL 3RQ3A 1S2EA 1P5UB 4UNUA 1MCPH 1UYWH 3O0RH 4CW1B 1JXGA 3C08H 5CUSL 1HSAA 3ULUD 2F58H 2Z93A 2DJUA 1BXXA 3P69A 1F6FB 1NMAL 3N41B 3UGXA 2FD6L 1G6RH 1TTBA 3C5ZD 3ESNA 4XOCA 3RUGB 1BJ1J 1FZMA 1OCWH 4JRYD 4HJJH 4OI9A 3LSOA 3UTZB 4F8NA 1DBKL 3FYIB 1IGTB 3FF8A 1KYOK 2ICEB 5C86A 3X3GH 4MJJA 1PLAA 1QFWH 4BK4A 4NN6B 4U7SA 4Y4KD 1GGBL 1CK0H 4OLEA 4H26B 5GGTL 5FOBB 4GUPB 4O02L 1T20B 3L3HB 3K7UA 3M17B 4MJ5B 1UXSA 1LGVA 3D2TA 3CLWA 3MBXH 3VFNB 1SVZA 4MLIA 2FHCA 1NCJA 2NTSP 3BWSA 4ONGH 2NSQA 3QJRB 4NO3A 4LDCA 5SWZD 4PCYA 5EDXA 3U1SH 4R8WL 2AKRB 1YG9A 3QT2A 1UQSB 4HEPG 3OGOE 3V6OC 5FO7B 5J56B 3EAKA 5GS1B 1Y6KR 5CGMA 4LMQI 3V6BR 2YN3A 1RLBA 5I8KL 1T83A 2IPTH 1UURA 2FB4H 5F3HA 5D1ZI 3FB6B 4ABVA 3MRRB 3UBXB 1UVQB 4ADGA 3VFOB 4MTMA 5I71B 5FYLE 2A74A 1YSOA 1IM9D 3C2AH 5F7DB 2QHRL 3ZDYF 3N50A 1S7QB 3AS1A 4PMEA 1I9IL 4XRCB 5FM5M 2NXZB 3W39A 4UDTA 4W81A 1C7TA 1I1AB 2J88L 3WS3A 1NEZB 3FBKA 4U1LA 5C1MB 3AG3B 4JKPL 4MAYA 4PRPB 4HLZG 4B9KC 3U7YL 3WXWH 3NEOA 2JI1A 1UB6B 3KL5A 5L2JB 1FDLL 1TTCA 2YEZA 3CSPA 5A6LA 1IEAA 2X4OA 1GZQA 1QP1A 3SPHA 2Q0ZX 5CZVH 2IF7A 3A6BH 4EI6A 5I19L 3S36L 4JN1H 4PGDA 4PRHB 3ZKXB 1KCKA 3CFDB 3K2UL 4FFZL 4K94C 1I3RB 1RHFA 4JPSA 1G0XA 3NMEA 5JW4M 5IB3A 2CCWA 2BY1A 4JM2A 3BGFB 3FO2B 1LXMA 4JHUA 1ORQA 4IBTA 5DRZB 4UOZA 1DBMH 2IFFH 4BEIA 2BSCA 3U0WH 5LNEA 1X9UA 5KVMC 2WJ5A 1GS8A 1BZEA 2YA0A 5LAXA 1TQTA 3P0VL 5GGSB 1S5IH 1XSIA 4H20H 2ADGB 5AW1B 3DI3B 3BUTA 3VI3A 2WP3T 4PJIE 3TNMA 2GC4C 2V7HB 2ZUXA 1SXBA 4CJ0A 3QIBD 1S5HB 3X1EA 2CGZA 3ECBA 1UJ3B 4B27A 2X1PA 1H3GA 3TBVA 2OTWA 3FSAA 5DGQA 2PO6D 5I8OH 4LZKA 2DQJH 3HE7D 5FYJU 3Q6GL 5I66A 2GBVA 3MYJA 1G7QA 1GIGH 2DWDB 2I5YL 4Y4FA 3CH1A 4NUPA 2I26N 4HZ1A 4Y7MA 3SO3C 3O3AB 3TPKA 4U6TA 4IJ3C 5C71A 4P59L 5AWNL 2EO7A 8FABB 4PN6A 9PCYA 4RZCA 4EO5A 2K6YA 1FAKT 3KYKH 3OF6D 4TLSA 5CHNB 3D05A 4G8FB 1UA3A 5BRQA 3K4AA 4UOJA 4FAAB 2N01B 2O93L 2R69A 5DJ8A 3CCHA 1T1ZA 4BKLA 2YFOA 4XHJC 1IX2A 1F5WA 2A6IA 2CXKA 4X4ZA 1T6VN 5D7SH 2HFFA 1Z9NA 1RIUH 4L5FE 4MQXD 3U48A 2JQAA 2CO6B 4KUCD 5J11B 5BS0E 1MF2H 4KY1H 4X80H 4N0UA 3VXMB 5DO2D 4POZD 1EUUA 3DO3A 5F21B 4PCKA 3IGLA 5FYJL 4YHKL 1ZLDA 2DIJA 5T1LD 2BRRH 1D9KA 3IXAB 1E6JL 4CU8A 1IM3A 2V17H 4MDJB 4ODUA 1NL0L 5EWIL 1MNUL 4Z0BL 4JFFB 1BEYH 3GBNL 5J1AB 5AZEH 1HHGA 2WYTA 4GUQA 1W72H 2OW6A 1L0YA 1PZ2A 3QHZL 3LV3B 2OMYA 1ET5A 3OJMB 4KZEH 3KL3A 1VZIA 3QAQA 4QI3A 2YXFA 5IB5A 3TEWA 4UTAH 4LCWE 3BGAA 1J0KA 3RVXD 2EXWC 5G55A 4AVJA 3Q8FA 4I0KA 3B2UD 1YMHB 2FO4B 1CLYH 2J12B 2NUTB 5AAWC 3JUYA 4M1DL 3CZGA 3I3BA 4BFJA 1MWAL 1T2JA 2A6DA 4RBPH 5D93B 2ZX6A 2IQ9L 1E9PB 4FQQB 4P9HC 3OXSA 2J8UF 1A14L 2FAUA 1AZBA 3WI9A 6FABL 5JIIA 3WY4A 1FNSH 2X7LA 3EJTA 2X4QB 2HJLB 4Z18A 1VFMA 1JGLH 3MR9A 2Z8SA 1JCVA 1GS6X 3L2NA 3BAEL 3VAEA 3GJFA 3QWRD 1NUGA 4JO4H 1J1PL 2MSPA 4KRPC 2H2SD 1Z3GH 2ERJB 2YAEA 3HMWL 4HPOL 5CINH 1VAHA 2EIDA 3BLKA 1MZYA 3MLUH 2K8MA 1QG3A 5KOMC 3QYMA 2CKBB 3PF2A 2FJGA 5F3HB 5DHVA 1U3HB 1EJ6A 3IKKA 4GQ9L 5J13B 3WMSA 2BX5A 4YDMA 4LT7A 5FWQA 2GK0B 1FNLA 2CDFB 5FYJD 2EKJA 1H3PH 4D9RD 3TVMB 3RVWC 2CRMA 5DS1A 4J2QA 1FVEA 1JGDA 4RWHA 4QCIA 5L9DH 4Y5XB 3RL2A 3RNKA 3A21A 4I77L 2NY6D 5JORA 3KWTA 1I7RA 1M2OA 4EUPH 2SEBA 3BIKA 3MUJA 3S3JA 4C4KT 1SXSA 1ZT1A 4JX0A 5EZLB 3BW9A 5GGRA 3GLAA 4IDLA 4JZJC 4MAYB 1D7DA 4BHUI 1AKPA 5KVGL 1IAMA 4FNSA 1A9EA 1U8JA 2G5RA 2W60B 1J8HE 1KTBA 4YSRA 2ADFL 4LLVB 2GSIA 3MUUA 4LMQE 3IGUA 2FH6A 3DTXA 4GRMB 5TDPA 4I5BB 2WB1A 4I89A 2DDQL 2XWDA 4MXQC 1B2WL 3FT3A 4PG2C 2ZKHL 1ICTA 4JM0A 4UCFA 3U36A 1IGIL 4MQ7B 2Z31C 5BRZD 1BG1A 3HN3A 4B9FA 3ULUH 5D5MA 4QPEA 5FW8A 1LE9B 1AC0A 3BAXA 1OANA 4A63A 1AG6A 5FKAA 1HINL 4B3VA 3JWOC 2XY2A 2H1LM 2BW5A 4FNUA 4L4TD 4X5PA 4K73A 1WWBX 1DSWA 1QTSA 1J8KA 1UT2A 3I75A 3KJ6L 5EZOL