4YSOA

Copper nitrite reductase from geobacillus thermodenitrificans - 0.064 mgy
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
295
structure length
295
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
source organism Geobacillus thermodenitrificans (strain ng80-2)
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
total genus 98
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ysoA00
2QT6A 3FU7B 1NWPA 2Q9OA 3FYIB 2DV6A 1DYZA 4NB7A 1B3IA 5B1JA 3OMAB 1URIA 4GYBA 1BEXA 2J55A 3AW5A 2H3XC 3CZUB 4W9ZA 2PLTA 1AZNA 1AZCA 3FU8A 5B1AB 3TU6A 3PXLA 1GSKA 4W1TA 3S3BB 2XV2A 2OV0A 3ZX1A 2DWTA 2FT8A 4UF7C 4BWWA 4WTQA 1KV7A 2EIJB 1GY2A 1PNCA 2PPFA 1N70A 3CDZB 1PAZA 3FSVA 5TK4A 1YLBB 1AOZA 2JFCA 2EIMB 1JOIA 1V10A 2UXGA 1ETJA 1QLEB 1ZDSA 1RZPA 1AG6A 1OE1A 2IH8A 2W8CA 1AANA 1AS6A 3PAZA 3X1NA 1PNDA 3X1GA 5AKRA 5D4IA 3UABA 2CJ3A 2XV0A 1W8EA 2GHZA 3G5WA 4E9QA 1TU2A 2FQEA 3S3DB 3NJMA 4HALA 4P5SA 4QKTA 2GC7C 3NSYA 1SHXA 2BP8B 1I53A 4HCFA 4JHVA 4KOBA 4UANA 2XX0A 4KO6A 4HZ1A 2UXVA 4BK5C 4FAAB 3FSWA 2XV3A 2UX6A 3QJTB 1XB3A 3OM3B 1A4AA 4YSPA 1J5DA 5B3SB 1ZIAA 1SHWA 1CYXA 3T9WA 2B3IA 5B1BB 3PCYA 2N0MA 2XX1A 4BDVB 3NP4A 1ADWA 1KCBA 5FC9A 4HHWA 1XMEB 3NT0A 2HRGA 4GXFA 3SBQA 1QNIA 3U25A 3ABGA 1AS7A 4DP8X 4YVUA 1L9TA 7PCYA 1KBVA 2GSMB 4YSAA 4CSPA 1GS6X 2YAPA 2YAQA 3WG7B 3BVDB 3CVBA 2UXFA 5F7AA 1KDJA 4ENZA 2HRHA 4YSEA 1ASPA 2NRDA 4ZK8A 4A68A 5PCYA 2VW7A 4G71B 4QLWA 2BZ7A 4N4YB 2FTAA 2UX7A 4TXVB 3X1FA 2IWFA 4G7SB 3JTBA 1OE2A 1HAWA 1E5YA 3H4FA 4A2DA 1GYCA 5I6MA 2EILB 3FPYA 2I7OA 3KW8A 1BQ5A 3FT0A 8PAZA 3ABMB 4NERA 1W6WA 2BW4A 4YSRA 1IC0A 2YAEA 3NSFA 2J57A 1M56B 1TEGA 3SBRA 1JERA 2DYSB 4HAKA 2XWZA 6PCYA 4L0PB 3WKPA 2Y69B 3IBOA 2HLEB 2ZOOA 1DZ0A 3CVCA 2BP0B 1NPNA 1HFUA 2H47C 4DPAX 1NPJA 4NAJA 5TK2A 1AAJA 1ILSA 2YAFA 4CSZA 1BYPA 4YVNA 2GBAA 1IBZA 4E9WA 1WA0X 5F7BA 4DPBX 1PLAA 3AY2A 2DY2A 2QPEB 2DYRB 1SDDB 2HXAA 4BWUA 1AG0A 3UAEA 1T5KA 4YSSA 2JKWA 2LLNA 3H4HA 3FPXA 1GS7A 3GDCA 4AKPA 2QDWA 5LDUA 2PPCA 1V55B 2I7SA 1BXUA 2GI0A 3HB3B 3X2QB 3EF4A 4AKQA 1JXDA 3S8GB 3WIAA 1ZV2A 1PLBA 1J5CA 1M9WA 3NJJA 1PZCA 1MZZA 1E5ZA 3WNIA 4G72B 2Q5BA 1WS8A 5I28A 1QHQA 2FQFA 1PZAA 1SF3A 1L9RA 2Y1AA 3H56A 4G70B 4HHGA 4KNUA 4HIPA 3ZDWA 3TASA 2HX9A 4Q8BA 2GB2A 3DKHA 3TBBA 1BQRA 3SBPA 3NJNA 1L9OA 3QJVB 2DWSA 1NZRA 4PAZA 1OV8A 1XB8A 1CURA 1CYWA 2JXMA 1NDTA 1X9RA 5PAZA 2A3TA 1OE3A 5B1KA 1XB6A 2YAOA 5I6OA 1A4CA 1SF5A 1A8ZA 1JZEA 1E67A 3OMIB 5AFAA 1MZYA 1RCYA 1MG3C 2EINB 5E9NA 2AFNA 4YSDA 4AKOA 4DP6X 1JZHA 1JXFA 3NJIA 1CC3A 4DP1X 2WO3B 4BWTA 3QJSB 1OCOB 2BO0A 1WS7A 2CCWA 5I6PA 2BP8A 2FNWA 5I6NA 1NIFA 3EH4B 1JVLA 1MG2C 3FQ2A 2XVBA 4GY4A 1BQKA 2P80A 2IWKA 3FSAA 3FSZA 1JVOA 1NIEA 2ZWNA 4E9TA 3AG3B 1VLXA 5I5MA 3D12B 1ZDQA 4FA7B 1BYOA 2YAHA 3EH5B 3UADA 1OCZB 4YSQA 2IDUA 1AZRA 4HCIA 3NJFA 1WA2X 2B08A 4DPCX 5I5IA 5B7MA 2XXGA 4KNTA 2PPAA 4GP5B 3WKQA 2BZCA 1FA4A 3ERXA 3CVDA 1PF3A 4YSOA 3UAAA 3X1BA 4E9SA 2FQDA 3UACA 1MDAA 3S8FB 1NTDA 2TSAA 3IN0A 3S3CB 3GYRA 3T6ZA 3T6XA 1ASOA 2VN3A 3T6VA 4EF3A 1J9QA 3HEIB 3ZIYA 3ABLB 2X87A 2WSDA 4DP4X 3NSCA 5I6KA 1SNRA 9PCYA 1KYAA 3GXUB 1E65A 3FS9A 5B7FA 1OCCB 1AZBA 2VMJA 4UAHA 2GIMA 2E86A 3ABKB 1WAEA 1JXGA 1M57B 2ZONA 1AZUA 2CBPA 1NIDA 3FU7A 1SJMA 1HAUA 1JZJA 4A2EA 2PCYA 4K9JA 3CG8A 2IDFA 1IUZA 2PPEA 2R7EB 5I6LA 2H5UA 2HX8A 2ZXWB 5D4HA 4A66A 6PAZA 4YSUA 1BAWA 1EZLA 3OD3A 3V9EA 4A67A 3NYKA 2IWEA 3IN2A 5IY5B 2XXFA 1OCRB 1RKRA 4MFHA 2XUWA 1ILUA 1ET8A 3AG2B 4KOCA 2HZHA 3PAUA 3ZBMA 3KW7A 3QPKA 4WKXA 2VM3A 1BXVA 2J56A 4HCGA 1J9SA 5I5JA 2VSMB 1AR1B 4G7RB 2YQBA 1A3ZA 1AQ8A 2VW4A 4F2FA 1KBWA 2VSKB 3IE9A 2AANA 4M4RB 3OQRA 4AX3A 1BXAA 1PZBA 3BQVA 4DP0X 3FU9A 3JT2A 3NP3A 1ZPUA 3NJKA 2YXVA 3TA4D 3NSDA 3QJRB 4A2FA 4KO9A 4F2EA 3FQYA 4BXSV 1IBYA 1IKOP 4P5RA 4KO5A 4A2HA 2OCCB 4Q89A 2QPDB 2UXTA 3FYEB 2FT6A 2XYBA 5I26A 1NICA 1KGYE 3T71A 1JZFA 1RZQA 4JHUA 2RACA 5B1JC 2PCFA 4E9RA 1W6LA 2I85A 3OMNB 1L9PA 4A2GA 2TSBA 3QJQB 2CALA 5B7EA 1GY1A 2WO2B 4RH4A 1EHKB 4GP8B 2QDVA 2IDQA 3V9CA 3PPSA 1F56A 4BDVA 2PP7A 2AVFA 3PAVA 4PCYA 3UGEA 2J5WA 4AZUA 4GP4B 2YXWA 1JZGA 1SFHA 1KDIA 4DP7X 3AG4B 2VM4A 4JKNA 7PAZA 3L45A 2MRYA 4KO7A 3IEAA 4YSCA 1GW0A 2FJSA 2IDTA 1SDDA 2EIKB 4E9YA 5AZUA 1TKWA 1ZIBA 5EHFA 3AZUA 2OJ1A 1PCSA 3EH3B 2YARA 1NINA 1ASQA 3ASOB 1NWOA 1ET7A 2XU9A 2PP9A 1J9RA 2IH9A 1TEFA 2BHFA 3NJHA 4YL4A 3QQXA 1SFDA 2BWDA 3CDZA 2IDSA 4DP9X 1N68A 2W88A 1GS8A 1UATA 4E9VA 3MBWB 3N2JA 5A7EA 3T6WA 1OOWA 2YAMA 4X4KA 3X1EA 1OF0A 1AACA 2IAAC 1L9QA 1JZIA 1GR7A 3NJLA 1FFTB 4M3HA 5D4JA 1PY0A 4N8UA 1E30A 1R1CA 3QJUB 3EHBB 1ID2A 1AS8A 1AIZA 3C75A 1ET5A 3DIVA 2PPDA 1CUOA 3AG1B 3NJGA 3SQRA 3N55A 2BW5A 3FQ1A 3ASNB 2P80D 2XLLA 2CUAA 1NIBA 1WA1X 3DTUB 3PLYA 3TBCA 1A4BA 2X88A 4F7KA 3RYMA 2AZUA 1FWXA 2VW6A 4DP2X 3MX0B 1A65A 2FWLB 5ANHA 1PLCA 1V54B 4AI7A 4E9XA 1NIAA 1KCWA 2CAKA 2FQGA 2R7EA 1PMYA 4KNSA 4BXVA 2AZAA 4DP5X 4YSTA 2FT7A 2BWIA 1J9TA 2PP8A 2BP0A 2GC4C 3WI9A 3WNJA 2HX7A 2MTAA 1L9SA 4G7QB 1X9UA
chains in the Genus database with same CATH superfamily
1OT2A 3AM8C 1A1OB 3NFNA 2GABA 4WI9A 2V2TA 2Q9OA 4TVSa 4ZAKA 1BAFH 5C0GA 3TBWB 5HI3C 2JXMB 1F3DH 2XN9A 3BIKB 1F11A 4PHXA 1JPST 2P5PA 1BEXA 2ZX6A 5C0AE 5AUMB 3TT3H 2EH7H 3K5SA 3NK3A 3ZHFA 2GK0B 4WNQB 3C5XA 4ZXBB 3MNVA 1O6TA 4NFDA 1EAPB 4OLWH 3UZVA 4Y16D 3A6CH 5DURD 5BOZG 1NH6A 2I5YH 2VMCA 3CDZB 4PLKD 4Y4KB 4DQAA 4FNLH 5CIPB 3WTSA 4AMKH 2ROXA 1RJCA 4P3CL 2DLIA 5D93C 4AUYA 3MCKB 5KVFH 2RHEA 2X2UA 4X8XA 1JOIA 5FGCE 3SQOL 5CGMA 1LE9B 1MRFL 4GFXA 4JZJC 1A7RL 1SMOA 4DKFH 4FNSA 3QPQC 3V4PA 1YY8A 2X2HA 5DEZA 1EX0A 1H3PL 2H45A 5D2NB 4XN2A 4HEPG 4LOFA 1NBYB 2D03H 3NMEA 1HDMA 1ED3A 4KXZI 3T2LA 1J0JA 4OZHE 1CR9H 4HIHB 3SOBH 5DK3A 1KJ2L 4TVPE 1P7BA 4YZWA 3RIAF 4P2RE 5EFIB 2C3HA 4R96B 3TFKC 5C92A 3NCYP 5D1QD 3HBZA 2VH5L 1N59B 5ESQA 4KRPB 3T4YB 1M3IA 2AEQH 1DUZA 1GGTA 4IMLB 1M71A 2EEBA 4JFUA 1W15A 3FFCE 3VFSB 2D31A 3FAXA 1E4XH 2D3JA 3QDAA 5E9DA 3FF8A 4U0QB 3HC4H 4JR9H 1GZPA 4FFZH 4S1RH 5EN2B 5CJ8A 5CWSA 4RFOL 3B5TA 3D85D 1I7RA 4HUMB 3KNBA 4Q9QL 1Z1WA 2PWDA 4XCNB 3N85L 3TBSB 3MRJA 4NKOA 2Y7NA 3O6FA 4DFHA 3FU0A 5I16B 5DI8B 4LO9A 3BP6A 1B2YA 5CMAA 4S0HA 1IVTA 1D5IH 1L9TA 1KT2B 3IDIB 3KPNB 3EJZD 5EEVA 1BF5A 3FJTA 4JFPA 2JI3A 4KPHH 2D31B 5BV7C 2YRZA 3OPZH 1BIIB 5DK2B 4G5AA 4YBHA 1F4WH 4PJHA 3ILPA 3FOLB 2VABA 3S36X 3L08A 1B4JH 3MRLA 3T0WA 4AV4A 5AL0A 4R8WL 2EDEA 2F61A 3Q13A 3H3PL 4ES9A 1JZ5A 5DD0H 4PJ8D 4ZMLA 5LG6A 2HWZH 1LXMA 1NMCC 2IAMD 3CLEH 4UT9A 1P4IL 3EAKA 4PBWD 2DMGA 4CU8A 1VADB 3T0XA 1TLKA 1SBBA 2NY3D 3N1GC 1TENA 5IVZB 2YMTA 1EO8H 4GINA 1WBZB 4AIZB 4DKEL 1HKLH 4IMLA 4M7LT 2XI9A 3MTRA 1MPAH 1MW0A 1XF5A 3ULUF 4XMPH 3WO3B 5C7XH 4J7RA 1AQDA 2MCPL 3RVXD 4AJYV 4HD5A 2I07B 1HQ4A 5EF0A 3WKPA 4BYHA 1D2PA 2Y69B 3S0PA 5ISZD 1MHHA 2X6UA 4EUPH 1KXVA 5DRNA 4Y2DC 2XRAL 1NPJA 4HLZG 1JWUA 2ZCKL 5K1NA 2O61A 1BZDA 4QXUH 3EJCA 4JFVA 2XN9B 3ARRA 2CUMA 3S35H 3HFFA 5FFOA 4M6OL 3DMMD 3CXHJ 1T5XA 4CSTA 4EDXA 1VIWA 3PWVB 1CZ8L 2LLNA 4MQXC 4YUEH 4GLRH 5IM7A 1BD2D 4APQB 4N0YL 3WNKA 1TF4A 4AYFB 3PGCA 5LDUA 5F70A 3QGVA 2O6CA 1EPFA 3WFCL 1CT8B 5IKCA 1AY1H 1DN2A 1XO8A 2VMDA 5KW9H 4OZGE 3ZYIA 2CLZA 3IJEB 3BPCB 2OK0L 2X5PA 3H55A 1E50A 1SJHB 3A67H 3Q2CA 2ATPA 1AGEA 3KE0A 2YBRA 3LRGA 1JVKA 3L3HB 3NRQA 4ALAH 3NCCB 3VTAA 1WFIA 5E00A 1UKTA 2GB2A 1QRND 4AT6A 4N2EA 1R0AL 1YMMA 2XZQH 1RJZB 1LO2H 1KOAA 1TCMA 3SBPA 1JRHL 1NMAL 4N6QA 1MCOH 2DJMA 5FOBA 4QUOA 3KPRB 4WI6A 2FR4B 2F7IA 5F96L 2BHZA 1TTFA 2R29H 1SEBB 1IGYB 3HZ3A 1NDTA 3TT3L 4WY7L 1Z3RA 2V5YA 1SLWA 4OF8A 5GS0C 2GFBA 5E8OA 3FB7B 4UCFA 4KVNL 2OMWB 3CZJA 2VDLB 3ZU8A 3MQIA 4KJWC 1I31A 1LP9F 1TLMA 2H32H 4G42A 3LTVA 3I2CL 5JW4R 3TF7C 4LPWA 4Q6IC 5ICZA 2AFNA 3ARWA 4X5XB 3UJJL 4N2NA 1WT5A 4MMXB 4ODTL 5JHLH 1F41A 2VDKH 2CCWA 4GXUM 1IJ9A 1FL6B 4D3CL 2ZKWA 3K2UL 1O75A 3BYYA 3MACH 3R06A 3QUMH 4N2LA 5AW0B 3R8QA 1E8XA 3CFNA 3Q3GB 2ZWNA 4KUCF 4UUJA 3QHFL 2JQZA 3EH2A 4AXWB 1MHEA 3BKYH 4OQTH 2PXYC 1OCZB 2PW1A 4K23H 2F5BH 2DH2A 4FJYA 2OJEA 5I82A 3QWQB 4DKEH 2PXYD 4TVPD 3BAKA 5B7MA 1C5CH 4JRYD 3RVVD 2WYZA 4GP5B 5J1AA 4WFHE 5DJCA 1KTKE 5KEZA 4O02H 3QO1A 2WY3B 1V05A 4M48H 5CXPA 1MY5A 5D1XC 1ZMYA 4KKCD 4N86A 3TWCH 5MEOB 2HG5A 2CQVA 4MQSB 1EJ6A 3CX5K 4HJSA 1Z9OA 5F7EH 1RIHL 3HMXH 5FYJL 5HDQH 2ICWB 4S11A 1X5AA 2BOBA 3KYKL 3O41B 4LIQE 4YHKL 1VJSA 4ONGL 3CUPA 4DUVA 1WSST 1KYAA 4WWOA 3GXUB 1IIKA 1EEYA 4OI9A 5C97A 2H26A 3QIBB 4L37A 1MCJA 1DVQA 5C0CE 4BUQA 1ZVNA 4JO5A 1CFBA 4M93B 2OW7A 4AV5A 3O3UN 2NTFA 4GFTB 1ZOXA 2OTUA 4HZLA 5I66A 4RDQF 5BUPA 4IGBD 1UA6L 2PCYA 4IU3A 3WY3A 4E0RB 3U7WH 3KYNA 2WBJD 5I6LA 4TULL 4B5EA 2AKRB 4I9WE 1D9KA 3BEVA 4S0TD 4XH2B 4A37A 3W38A 2CUHA 3C87A 4UTBH 5CF3A 2XXFA 3BQUC 5EZIL 5TDOB 4NENA 4AM0B 4P23D 3FFCD 3ZSSA 1BECA 3BPCA 1I9RL 2CLZB 3IJEA 3IDYB 4Q97A 1AR1B 3GT6A 3L7FB 3S5LA 3S9DB 4KRMB 5F89B 5BVJA 3VWKA 4OT1L 1M6UA 3RL2A 4H4NA 2EE6A 3IFOA 1NC4B 4PJHF 4PCSA 1J8SA 5JPMB 15C8H 4AGMA 4HUWB 4YFLF 1NBZB 1KJ2B 1ZPUA 1U4FA 1WWCA 1ES0A 3BWUF 3QPQD 4HJ1A 3L3IB 4DUWA 1OGTB 5DMIL 3N1QC 2E9WA 1S9XB 5IVXF 4GKNB 2O61B 1IU1A 1R24B 4P5RA 4JN1H 4QTIL 1RZJC 4XMWA 3VGAB 3GMPA 4PJIE 4QJ3B 4ORGA 4BEIA 3HG1E 1L6PA 1NCOA 1NFDB 4X4ZA 4X9IA 5IJKA 4OY9A 3DHMA 1CBVL 1R3HA 4IKJA 1KTCA 1RZKL 4HIJA 4K3DH 1NGWB 4X98B 1HTYA 1OARH 3BP4B 4XOBA 3WFCH 4GP8B 2NLJA 3U0TB 3HNVH 4K7FB 1GH7A 5AAMA 5IF0A 1MCCA 4ZFGH 4NPKA 5GRJH 5C0JA 4FABL 1A64A 4PCYA 4U2ZA 4AZUA 3ZQXA 1BGXH 1X5FA 4OQTL 2CBOA 2YQ2A 3A6BL 2WKOA 5D5MA 2XFXB 1MW3A 1EHLL 1T0MA 5C07B 3SYPA 3CN3A 1WZAA 4DESA 2HTKD 5EUOA 5F0JB 4UNTA 1YNLL 3C2SA 4BFNA 2GKIA 1Z9PA 4MSWA 3BPNB 2FJSA 5E5UB 2F1AA 2GTWB 4XOCA 3IXTB 3K2MC 4PS8A 3L17A 4KQ3L 3H8NA 3JBG7 4G1MB 1G9ML 1DJXA 2CKBB 2JELH 3WMPA 1VKXA 4QI3A 1G43A 4AUUA 1RXLA 1S9VB 3MRGA 4MZRA 1D5XB 1H15A 2PP9A 5CJOH 5EEXA 4GEJA 5LQBH 1OB1B 3O3AB 4AVHA 5E6RB 2OMXB 2P5WE 1CXIA 4NI6A 4DGVL 3IDIA 3LZOA 4YL4A 4B9YA 3FAWA 2AEIT 2P5ED 4I18A 3UERA 1ERNA 2YZ1A 4G6JH 1QSEA 1Q9KB 3D39D 1N68A 2W88A 3FTGB 4QGTA 4ZXBC 5LCVL 5MEQA 1OKEA 3OR6A 4PGDA 2OMTA 1OOWA 2J8OA 4M9PA 3GHPA 4XCEB 1F5WA 5DJXA 3WIFA 2IAAC 1NM9A 4XBPA 3MJGX 2SEBA 5JHMA 2R0WL 1OCWL 1JV5B 1IGCH 1U3HC 3QFDB 3TN0D 1UKQA 1OM9A 1Q90A 2XXMB 4MS6A 1R1CA 4DZBA 1E5CA 1RY7B 1ID2A 2J8UF 4OBSA 4R7NA 1XF3B 3QARA 2ZXAA 2W95A 3MRCA 5C70A 1K2DA 3B9VA 1UCBH 2Y72A 4X4ME 3WO4B 2CUAA 3QNYA 1CXFA 4ZUSB 1N3NA 1UH2A 2IO5A 3JTTB 2OL3H 2R2EA 4YO0A 6FABH 4BQBA 5AVUB 4GQPH 2VDQL 3I75B 4M4RA 4KX9A 4WUUB 1DQMH 4ZUWA 1FG9C 3MJ7A 1J1XH 5IEKA 4EN3A 3EXLA 4P23B 1PMYA 4O2CA 1IM3D 2Y0SA 5IHBA 2A4CA 4IKIA 2ICWA 1G1CA 4YEEA 2Q7YB 4F15B 1G7LB 3RPKA 1K2DB 4QRBA 3IJ7A 3SKMA 3A67L 1H3PH 3KDPB 3T2PA 3TWCL 2C9XA 5LGHH 1CD8A 1EFXB 4ZYKA 3L4ZA 5KVFE 3GXDA 3GTTA 4N5EC 3HC3L 3QSKB 1QSFD 4A55A 5FDYA 2R0ZH 5MEPA 1MVUB 1XL6A 1VCBC 2G5RA 3NCFB 3V4VL 5HJDA 4OGAD 4U6VH 4XVSL 2J55A 2OMTB 2EE3A 3P40A 5I8KH 2PLTA 2XCMC 3FU8A 4M1DL 4NNYA 1KELH 5J6HA 1KIRB 1L7IL 2BCKA 2XJLA 1O0VA 4JGMA 5E99H 1TQUA 3T4AA 2AK4D 2ED6A 2JKJA 3N42F 4ZMTA 2OV0A 1WISA 1UHVA 1EAQA 3ZX1A 4ICXA 1S8DB 3V6OA 5D7LE 2MJWA 2AJVH 3U4AA 3R06B 4FYTA 5DT1L 3GD1C 1OAZH 1V10A 3HKZA 2E4FA 3IJSB 3IPBA 3U1SL 2ADFH 1KGIA 1RZPA 4WCYL 4EZMA 1U2YA 4TSBL 4OCXL 1IBDA 3FTSA 1WUNT 1AS6A 4YE4H 1FN4B 1PNDA 2MKLC 2YD4A 5BS0B 1G7MA 3W0WE 1KGXA 2BIMA 2OJEB 1W8EA 5EOTA 2FGWH 3EOAA 1W72H 4U4BA 2CNZA 1B4JL 2QKIB 4QKTA 1V3JA 2NXYD 4FQLL 1UM6L 2BX5A 5AOLA 4JPIA 3QAQA 4HCFA 3TEXA 4KO6A 2X3AA 1QSFE 1OW0C 2A6JB 2R51A 3ZR5A 1CJYA 4PMEA 3HR5B 2UZPA 2DWXA 4JFZL 5GGTA 1NFDF 1NFDA 1ZRUA 5GQBA 5B3SB 3OLGA 3VDAA 2GJZB 2G0KA 3F05A 5D1QE 3OGCB 4N2AA 2R69H 3D0LB 4OCYL 1EO5A 2HKAA 4N24A 4G5ZL 5HDLA 1IJNA 2BCKB 2MNJB 3VXUB 3OJMB 4K15A 4Y4FC 2YD9A 1XF2B 2HRGA 4GXFA 4UQBA 2OZNA 2G30A 5HHOD 4K71B 3Q5OA 4PGCA 4ZFZB 2X2IA 2V37A 1FZJA 1OPGL 2PCFB 2X38A 4LBEA 3UEZA 1SEBA 4E0RA 4OLUH 2FEEI 3UYOD 4GKLA 3ZHLA 4HFUL 2H1XA 3SYAA 1ASPA 2AI0H 1N6VA 1ZT4B 3EBAA 4G9FE 4GUPA 4NS0A 2R29A 2GSIB 1GXEA 1NFAA 1YMMB 1SQ2N 4PG2A 2WXMA 3CFTA 3K6IA 1DO5A 3QUZC 5E7FA 3WJMB 4WGKA 4HYTB 1OGPA 3I9GL 4YFLI 5L2KA 2EZ0C 5AG9A 1HINL 3ZL2A 3DXAB 2W9DL 1KLGB 4HH9A 2AV1B 2MKWA 4XBEL 3E1ZA 5E8PB 1DBML 5KZCD 3P02A 3H0TA 3KWXA 4YO0B 2XPZA 4HIIB 3ZRSA 3BMWA 5CILL 1J1PH 4QY8B 4DN3H 4CKQA 3TC9A 3AJ7A 4P49A 4I18C 3UTSB 3AXHA 5CD3B 5DGQA 5E1HB 2HJKA 4Q56A 1ECYA 4KK5C 5DC0A 4WW2C 4Y4HB 4UYPA 4OB5H 4R26H 1QMUA 4TUUA 4KK9C 2WZPD 3TO2B 1V7ML 1IKFL 5E8PA 1BSIA 3BVUA 4DPAX 2DS4A 5LWYH 2XZQL 4FQHB 2XQBH 4OQTA 4WRLA 3SGEH 5EBWB 2XQYG 3ECBB 4FCAA 5CEZH 3DWTA 2J7LA 4CSZA 1A47A 1TIUA 1ZHBB 1H19A 4E9WA 2NY7L 2KDYA 3T65B 2Q3XA 4EN3C 1KYDA 3LKPA 5D55A 1FDLL 2AK4B 3S36H 3DRTB 3QNXB 4YSSA 1NUNB 3IT8D 2YPLD 3FCTA 1C08A 3P9MB 4L1BA 3WN6A 3LPGA 3IGKA 1GGIL 4LDCA 2C3VA 4N9GB 5AOIA 4MCZA 3QI9B 2AQSA 4RGMB 1OAUH 3WEXB 3MOAH 4AENA 3L3JA 4QJ5B 3KAAA 4DWHA 1YN7A 2BSSA 2Z1KA 5HHVL 3W11C 4N6RB 4POYA 4FFZL 1WG3A 3ZZLA 3QEUA 5J56B 4XHJC 2Q5BA 3RDTD 1PZAA 1WRFA 2P7TA 1SJVA 3D3VE 2DQCL 4KNUA 5MI0C 3GSUB 3UL4A 4N5UA 1BGXL 1Y7VA 3KLDA 4D0BB 3GS0A 2LTQC 3BUTA 1I1AA 2NYYD 3SKOA 2R39A 3D33A 4ANKA 4QLRA 3DX9B 4LK4A 3O4LA 2FL5B 4LCCC 2YD8A 3E1F1 3I6KB 1TVHA 1QRNE 2AXWA 2YD1A 3B56A 2AV7A 4G6FB 1KG0B 2IXQA 4BZ2A 4WI3A 2V8MA 3FHAA 3LS4H 2XKNB 3ETBF 3HB3C 3LMJH 4NJ9L 1ZK5A 4AGLA 1YNTB 2WWOA 3OKLB 4JFFD 3DIDA 3GRBA 4PP1C 1MZYA 5EU5B 1A6ZA 2DQUH 3SODB 4U6XB 4Y5VC 4I3SH 1V27A 3PNWB 1VB9A 3OHXA 3L3IA 4HWUA 5HHOB 3CZNA 4DP1X 2Y3AA 2X2YA 3DVGA 3L4XA 1ROCA 5HDQL 4JANB 4KROC 3BKCL 5I6PA 5B22A 2XN1A 2WXJA 3L1OH 1I3UA 1D5ZA 5AL8A 5I9QC 1QEXA 3QEGH 1MPAL 1F90L 1KB5B 4WFEE 4Y9BA 3MRNA 1BQHG 2BRRL 3TBVA 3GHEH 4AYDC 2ADIB 2I26N 2IQ9L 1ITCA 2H3NA 1R3IL 3JV6B 4Y4KC 3ARDC 3Q2WA 3A22A 4WNQA 4IU2A 4J5VA 2IDUA 4OJFH 1AZRA 1YEGL 2COVD 5FYLH 3CHQA 1EHXA 2BSTA 4JPKL 3VQLA 1TUPA 2APXA 1CFSB 2WB7A 3VNZA 1FFRA 1I8LA 1NM4A 1RUPH 3LEVL 5HDBB 4NQXB 4U1GB 3MRRB 4WDIA 3RWDA 2X6VA 3CVDA 3UOAB 3RZCD 3T0EB 1LE9A 1MHCB 4AL8L 1E8YA 1S7TB 3MV8B 3V9FA 3CV5A 1IKFH 1YVLA 2DQTH 2G3XA 3NEEA 4C83B 2J21A 4JY6B 2DQIL 5I6XC 4JG5A 4PLNC 1FFQA 2XZAL 2YGPA 1YHPA 3SQBA 2A0LD 3K2IA 3OHMB 2VLJD 4BUGA 5JHDA 1EMTL 1XF1A 3K2KA 4G2AA 4AM0A 1OCCB 1ID5I 3O2DA 3MO1A 4BFJA 1Z3GL 3G6JF 3NN8B 4PJDB 5TD4A 3UBGA 1BVLA 1EXGA 1M05B 1IAIH 1OHQA 3N1PC 3OHXC 3I84A 4DKAA 1AI1L 1V3KA 1DQIA 4EIZC 2J20A 5T3XD 1XH0A 4AIZA 2ZX8A 2R7EB 4QO1B 4U05A 2ADGB 4BH8A 3QULB 5J06A 1MCOL 3BZEB 3QWRA 4M7LL 4CU6A 5EBGA 2QPSA 4IIZA 2E7CA 2VXQL 3GSNL 2HZHA 1DBMH 2VWEE 4A6YL 1S9KC 1EJOL 3FQXA 4DK6A 5IZ7A 3BT2H 4BBWA 3EFFA 5JW4M 2VLRE 2CM6A 3CAFA 3OKKA 4IOIA 4AK2A 5BO0D 4GRWE 2LU3A 3ZDXB 2VSKB 2X9YA 5DTFA 1Q72L 1M71B 2Z65C 1EEZA 2BP3A 5AOMA 2O4EA 4EUPA 1TJIH 2PYED 2O93L 1GAFH 1W72L 3LNDA 1QPXA 4PREA 2VDKL 3U83A 2IWGA 3MHZA 1AVAA 1FZOA 1Q9LB 2YD2A 3KPMB 1G9HA 3MYZA 4NT6A 4UZSA 5D72H 3WYRA 5CJ5A 1H0DA 5FM4A 3QUML 4AH2A 4GW1A 4QOKB 3SSGA 2Z7WA 2BVOB 4OUUA 1J10A 3WOVA 5HYQB 3MNDA 1T0MB 1I85C 3QHFH 1JTPA 3VNYA 1A25A 3ZE1E 5HI5D 5BO1L 4JQVC 4NP4L 3PUUA 3FB7A 3NCJL 5JXAL 2EDJA 3QG7L 3KYMA 2DQ6A 4UI2A 4NSKB 3LS5H 3N44B 5D2LB 1W6LA 1I7ZB 1YEEL 1RUAH 5GGRA 1E8ZA 4MCZB 5DRXA 2BP5M 2EDBA 3PNRB 4OJEH 1F56A 1KBPA 5FW7A 3DDGA 4GT7A 2WZ0A 1ED3B 2YHGA 4LSPH 2PUQT 2Y7LA 1ZPLA 2IALA 1MLBA 1KLGA 2OP4L 2XN0A 4M02A 4KUZH 4JB9L 1BMZA 1SDDA 4YHKH 3WFDL 3SDXB 5C0GB 1RUML 3TIDA 3TNNB 4Q9QH 2WCGA 3MXWH 4R4ND 3SQBB 4EDWL 1OHZA 2RTTA 4MA7H 3U7YH 5HYSG 2KT6A 1E90A 2YARA 3B9KB 1LO5A 5E6UB 1J8HE 3PUCA 4PJFE 3EBIA 3LD8B 4WFFD 2CLVA 4PIRF 2HJKB 3VFWA 5I30H 3RFZB 1SRDA 4NFBA 2E9IA 3DETC 3CK0L 4LIQH 1EAPA 4W68A 4KITB 4PJGF 4CC4C 1NCIA 1YG9A 2BWDA 4KJYA 2AK1H 4FMFA 5HP5A 3Q2NA 5BZXA 3SD2A 4LXFA 4Z7OB 3WY4A 3F85A 2BLFA 1FFNB 1ZHNA 2MWCA 4IOFC 4YC2C 1D5IL 3MREA 1OB0A 4FKHA 1TEYA 5D7IB 4ZDHA 2CDGA 6TAAA 1T2QH 4M5YH 2CRYA 4M3HA 1M7XA 5DSCB 5GS2D 2DMKA 3FUNA 1YEJH 3WXVL 1MCFA 1E30A 2P5EA 3HE7D 4PTUB 5T3XL 3X14B 3MV7A 4ONFL 3EFDL 4F58H 1BPLB 3BLBA 3N55A 2LAGB 3GI9L 4JDTH 4QHPA 3F3HA 4Y2DB 4N0UA 4NCDA 5ACMA 3O4OC 3DK0A 5EF1A 1NIBA 3KPSD 4X6EB 5I8CA 5TDPB 4G9FB 4LBEB 2B20A 1SHSA 3TIDB 5FB8A 5IESL 4G1MA 4H0GA 1MRCH 2E6JA 1L5GA 3QG6B 4LKCA 4KNSA 3CMOH 4Z7UA 1NGYB 1BX2A 4HWEL 3ARXA 4GW1B 5CP7A 3LRHA 3LXAA 4JE0A 3DV4A 4MJ6A 4MRCA 2KYIA 5LXGL 3KPLA 4UV4L 3O3EA 1SM3H 3GZQA 4I1RA 1XHHA 4N3UA 1O5PA 4JFDA 3VXMB 1NWPA 3QXUA 4DQOH 4GW5A 2K9UA 4GAGL 5J89A 3LEYL 4RFEB 2PW1B 4FABH 3T8XA 1JFHA 1IC5L 4G3YH 5LB1A 3STLA 4HXBH 1QRKA 5CSGA 5EIIB 1GGBL 5DMJB 3RNQA 1H6TA 4J6RL 4M00A 2CPCA 3VRIA 2COQA 3QUZD 1GSKA 1H5BC 1JXJA 4U6TA 5EU5A 3N42B 1B6UA 5DRWB 5I1JL 5IMKB 2XV2A 1RLBA 4H8VA 1S7RA 5ALBL 1IBHA 2Z7UA 4UF7C 3HAEH 2E7LA 2EIJB 3S48A 4N6RA 1EANA 4FTDA 3UIYA 2ED8A 3WU1A 4C4UA 2JKIS 5KUMA 2D4FA 4M4PA 5F7UA 1AOZA 3I3EA 4AZ8B 4L3EA 5DWPA 2Z6FA 1LP9E 1VACB 4ISVB 2OZ4L 2UXGA 2ZKHH 3DX8B 5F7FA 4Z7WE 3GMRA 3S2AA 1ZDSA 1MUJB 2J12B 3D5OF 3MSPA 1SVBA 2WMPA 1YNKH 2W8CA 3IMVA 4KI5D 5TFSL 5JHBA 3UBHA 2YA0A 4RGNB 5ITBH 1SY6H 3BFOA 2V3FA 3O2VL 1A7PH 4GIAA 1UXWB 3C2AH 4M1DH 4N2MA 1I1YB 3H42L 1H3UA 2Y7OA 3FMGH 1TQTA 3P4MA 5F7LB 4JRXE 1X5KA 3HJ0A 1HINH 4EZKA 3B9KD 1DUZB 4HCRL 4YHNA 1XDTT 4PJFB 3E9TA 4XNYL 1AR1C 1J5DA 4K2UL 3IJHA 4NP9A 4XR8C 35C8H 3G5YA 4P4KC 4UNVA 1BZEA 1C08B 2DIEA 3BD4A 1KCUH 1U8JB 3GGWB 4V1DD 4BDVB 1INDL 3BKJH 2BNRB 4OFKA 3VSTA 3BE1L 3MRIB 2OMVA 2HPTA 1ORSB 3C6LD 3SBQA 3E2HB 3S5ZA 1Q9KA 3T0DA 3OJVC 4FE9A 4GBXC 1WC7A 4F9LA 1D7DA 1ODAA 4DK5A 3CZLA 3GLZA 1GS6X 2X28A 1HHKB 2IAMA 5D7KD 2CDFB 3STZA 1KDJA 3SDXF 2HRHA 1T2JA 4U1MA 4EDXB 2VDRH 4PRAA 3MRGB 1E4WH 3TBTB 3PWJA 2XG4B 4W4NA 4Y2DD 4N0UE 4G71B 4JY5H 2BZ7A 5DR5L 2XWJB 4OFPA 4TXVB 5HHXH 2X4RA 2I9TB 4HS8H 1MCDA 5JQ6H 2AJZB 1OE2A 1PX8A 4PWGA 1JGUL 5JIDA 5E4EB 4H8WC 4E68A 1E9PB 4XVSH 4GAFB 3FPYA 3M8OL 4M93C 2I7OA 5FX3A 2R1XA 3FTGA 3L5WA 3MOAL 4OCWH 3W1ZA 4L1DA 3Q6FB 1KJMA 1MF2L 2EUWA 3H85A 4J3OG 4AIXA 5T5FA 2CZNA 4YHOH 5EBLB 3SGKA 4LSDA 3WTTA 3SY6A 4K7FA 1CD1A 1HOEA 4LLMB 1USZA 3DETD 3QFJD 5GRZA 4NCC1 3US9A 4Y4FA 4M7KH 3KBFA 3HHRB 4QRRB 1N7ML 4S2SB 4HK3N 2XY2A 1NBCA 2MHAB 1TJIL 3CFQA 3FRPG 1FZJB 1O7DE 3D69A 4Z3TA 4JMNA 2YO3A 2GBAA 4Y16B 5FXCH 2DQFA 4JJHA 5DURB 3I6LE 3WL9A 3D7PA 3QYMA 1A21A 3O45A 3CXHK 4NWTH 2YWYA 5AVYB 1AG0A 4K8RH 5CU5A 4Y9GA 5EDSA 3GUTA 4JDVA 1P6FA 4S1SH 3W81A 2XT1B 1NBZA 4P46C 3MROA 2NPLX 3ZY7A 4LPXA 3VQ2C 4AKPA 3IDGA 3M45A 1UGNA 3LNIA 4L1SA 4H8WL 4MD0A 4UNIA 1E2WA 4PEEA 4MAYA 5EOCH 1SMDA 4B9KC 4NPYA 2UWEF 1AHWC 4YDZA 5ITBL 5IEHB 2OLDA 4MVBC 1N12A 2LFEA 3HG3A 2IANE 3KHQA 1WCBA 1QHQA 2FQFA 3SE8H 3ZTNL 2RB8A 4XP6H 3GUTB 5JA9A 3X12A 5A3ID 2XN2A 3L3HA 5M7QA 3TO4B 3TYFB 1XSIA 1GJIA 5SV4A 2OX5A 3W2DH 2X1WL 4QKXB 2XPGA 3KDMA 4ZUVA 5FECB 2ZXBA 3GS4A 4YXLL 1T20B 5IROD 3IAQA 2ZCZA 4JPVH 3QJVB 1U0QA 2V2WB 3ELQA 1LVEA 3MV8E 2EDTA 5DMYA 3D34A 2EIEA 5ABDE 2HT2D 2WVSA 4GQRA 4UT7H 5FW8A 1QBLL 5HDBE 4HIIA 3NCEB 4DK3A 1TNMA 5CGYD 3MGOA 3IF1B 4QRQA 5B4MD 1J8HA 4TV3A 4XVTL 4F7CA 3ZQWA 3IDMA 4I8DA 3ZDZF 3P4NB 1E67A 4GS7B 4Q58C 4P4KB 1K5NB 5I24A 2YJLA 2K1MA 3CFEB 4NRZB 4YSDA 4XBEH 1AD0A 5BMFL 3HMXA 5DWUH 1RZ8B 3MODL 4NUPA 5ILTL 3VM7A 2BO0A 1FVEB 3K80A 5GGQL 3VXQA 4O4YL 2RD0A 2C26A 2BP8A 4LCYA 1B4TA 5A2IH 3KLKA 3K0WA 3BXNA 3ZHKA 3EH4B 3U82B 2ZJSH 5MHSD 3D2TA 3NJVA 5B8CA 4DVBA 1PIGA 3CQPA 4FFYA 4W9KC 4HT1H 1B6DA 4MYWB 2F54B 2DEWX 4WGVB 1FL5B 4LAJH 1I85A 5BQDA 2KI6A 5LGYA 3ARSA 4KV5F 5H4YA 4H44C 2VXVL 4HJTA 1ZS8B 3LRKA 5IBTH 4X0KB 3JV5A 2IC2A 1NGXA 4M7LH 3MZTA 4G8EA 5E24E 5CSZA 3WKQA 1QNZH 3KWWA 4Q7DA 2OFQA 3ERXA 3QNYB 5TF1L 3S8FB 4PI2A 3QRFM 3S3CB 2W38A 4S10A 2VN3A 1MDTA 4S1DC 1B0IA 1PD1A 2BK8A 5FK9A 5G55A 3U9WA 4GMSL 2UY7B 4P23C 4MYPA 3NSCA 5I6KA 2YWZA 3NRFA 4DFIA 1MHPL 2BNQE 2CXGA 5JUEL 5H8DA 1ACCA 3QQNA 3FQXB 1YNTF 5EOQH 1TZ8A 4GRMA 1PL3A 2E86A 1F4YH 2FX9L 3PJLA 4NXSA 1UD4A 3QFGA 4OGZA 1MCKA 1HHIA 1T66C 5F7DB 4WHCA 4XWGL 3ZKQD 1JZJA 3DO3A 1RHHA 1G1KA 3BHBA 2IDFA 3MLRL 5DFVC 5HHPA 2DPKA 1L9MA 2GAZA 1UB6B 2H5UA 3R0NA 2JMRA 3V9EA 2DQTL 1KMGA 1HNFA 4AT6B 4TS6A 2EQDA 3D6GA 3T08A 1UT1A 2XA8L 2HT4D 1UYWL 4KOCA 5DMGC 2IPKA 2VZTA 4XPBH 3ARGB 2J56A 3LQZB 3EGSB 4DOHB 4D0CA 1CXEA 4R7DA 5KTEL 1DLFL 3FC8A 3B1UA 3IDNB 3KPOA 1U93A 3L48A 2YSSA 4Y0GA 3V4PB 2XWRA 3GJFA 2ZYHA 3Q43A 4PRIB 2R0ZL 2DKMA 3BKCH 3OF6A 4Q9RH 4H88H 1BMWA 4XNUL 1PGRB 5DHEA 1JZ2A 3NJKA 4S1QL 2J1WA 1H9VA 2MCMA 1CGXA 4KXZH 1F00I 4NM4L 4GNKB 5TE4L 1N5AA 1SUJA 1JZ8A 1QSFA 4PGEB 2H32B 5AW8B 4U1KA 1DJZA 1A1NA 1IKOP 5E99L 3UZVB 3KG5A 2IQ9H 4XNQA 3HG0A 1JNNH 4WO4D 3VGAC 4HVBA 3L5WB 2V7HB 3N85H 4DEPB 4Q89A 1RMFL 2WSPA 3JTSA 1NICA 5I26A 1KXTB 3SDDD 4ZDHB 3B7SA 2QZQA 1OLZA 3ENEA 2BERA 1YMME 4ABVA 3F6IA 5TDNA 1EA9C 1OGAD 4MNQD 2H0PA 3QUMB 3D30A 3GSRA 4WWKC 4FZEH 4ODXB 5I1IL 2KKQA 3BEVB 4KY1L 1CPUA 1B0WA 1QI5A 4QHMA 4XNMB 2Z92B 5CJBA 2VMFA 2VLLA 1MLCB 2AJXH 2J5WA 3ABZA 4Y2DA 5E2UL 1G7HA 4GP4B 2IBZY 4TUJB 1P2CA 3ZTEA 3DX2A 5TH2A 2FE0A 1BF2A 1I8IB 4AQ8C 2V3DA 1L7TH 3SDDC 1YAIA 3KZ8A 3MBXH 3E3QC 2EIKB 2IOMA 4C4KO 2N1KA 1JPGA 5AZUA 2O30A 5F96H 5C9JB 4JO3H 3FBKA 4FDWA 5KVGL 3KL5A 4Y19E 4F57L 1DDTA 1BA9A 3SO3B 4Y9CA 4JY4B 5F9OH 2FEJA 1OP4A 2XBZA 2ORBL 4KWUA 4NZ8A 1JV2B 2FJHB 3DX9A 3NEXA 2E74C 3ZDYE 1A0QH 3LIZL 3D9AL 4K94C 5C08E 1DSFL 1MAML 3KPNA 3N40P 5FYKL 3P4MB 2XZZA 5SWZB 4CNIB 4WQOA 3T6WA 3OR6B 4PGDB 4H8HA 4MJ5A 5DFTA 3LNHA 2AABL 3TJEH 2OP4H 2H2SC 2VTFA 5BMFH 1L9QA 3U9PH 4B27A 1PZ5A 3AU1B 3QUXC 4P2YA 4X5RA 2WJ7A 1OVZA 4HIXL 3F7RA 4PJ6A 5HPMB 3MLRH 3C75A 3U0TA 4OUUB 4L29A 3L3JB 3THMH 1JGIA 3OPUA 4JFQB 5LHDA 3RAJL 1F97A 4MXWL 2ZWSA 2AJUL 3PWLA 3N0PB 2JWYA 5DC9B 2GI7A 4K5PA 4P06A 2Z1PA 4U33A 1U8HA 2I27N 1GJWA 3K4AA 4I0PA 1UEMA 1DLHA 3GXFA 3HAEA 5FFGA 2OK0H 4DP2X 5I15L 1LO2L 3V52L 5J9PB 2G9HA 2R4RH 5LGKA 5EOCL 4M48L 3FO1B 1INEL 4JKMA 5D2LE 5FLUA 2W94A 2QVIA 5HJGA 2XKSA 3OVUB 3UG4A 4FXLA 1T2QL 2VAAB 4AEIL 5KYYB 1B90A 1I1FB 3DMMA 3IB4A 2ZG2A 5TFSH 2YN5A 4KRPD 5CGTA 5I1AB 4S1QH 3CFKA 3D4CA 3CXDL 1XEUA 4HEME 4PRID 4QNPE 1W0YT 4KZCA 4TNGA 3PDOA 1URIA 2ENSA 5BVJB 3DOIA 4E5XG 1UOKA 3OKNA 2ARJB 3FMGL 5HGHB 3AW5A 4JZJA 5DD1H 5FFLA 4XNXL 2IANA 1RMFH 2YJQA 3BAEL 3HRZC 3LB6D 4V33A 4Z7UF 5T5FL 3TU6A 5JW5A 2XTJB 5TE6L 5FA3B 5DRZA 1DVTA 3O8XB 2CUIA 1BBJB 3K2UH 4MX7A 1UACH 1NAMH 5E56A 2BOCB 3N40F 2WVUA 1UJTA 3AUWB 4WTQA 4X7CC 2C9UA 2JB6A 1GY2A 2PTTA 4HUUA 3UJJH 3SPIA 3DUUA 3LIUA 1DJIA 3HI5H 4D9RE 5TDPA 3W82A 4J39A 3OAZK 3L9EA 4OKVB 4ADIA 1TZHB 1G6RL 4HZLB 2YUWA 4AQ1C 2BFVH 3VFPA 1AZVA 4PWFA 1MW1A 3EUDA 4PJ8B 3WMSA 4QWWD 1SZNA 3PAZA 2KS0A 3WSQH 4GAGH 1AC0A 4LLYB 3SQOH 4QHMB 5DD5L 1SLUA 4HX1B 4OLVH 4OI8A 3QP3A 1SOSA 2BXZA 2JVUA 3PU7A 4L9LC 2WLKA 2VDRL 4L1TA 4WI8A 2YOCA 1AIFA 3RJOA 5E1AA 1OAYL 1Q9OB 4KOBA 5D96B 2D7MA 2W9EH 4UT6L 4MD4B 3QJOA 4HZ1A 4TNEA 3EO1A 4X7SL 2ORBH 5CJXA 2P4AB 3JWOH 5FYJH 2K4AA 4HS8L 4ZUTA 1C1EL 2WQUA 4Z77A 4FQPA 3TBVB 1A0QL 3LIZH 1JRHH 1QI3A 1XB3A 1CLOL 1KN4L 5GHWL 4TYUA 2A6DB 3D39B 3L1EA 3UJTL 1XF5B 4TOYL 4P5MA 3FO0L 3QUKA 2ICWI 4NBZB 2DBLL 5FHAH 1ZLWH 4QRSB 3GB7A 4JBSA 4ZFOA 1CFQA 1XMEB 2DLGA 1BW8A 2LLGA 3MXVL 5F93C 2WO4A 4S1RL 3U9PL 2PTTB 2F7RA 3C60C 3EADA 5DEJA 4DP8X 3VXRD 5KSBB 3PDDA 5JPNA 3IDNA 1HOCA 3GIZH 4PG2C 4F7MB 4HWEH 2Q20A 4W4OC 5AZEH 4MXVF 1Z5LB 4UWQB 4Y2NA 1IAKA 3MCLL 4PLKC 4ENZA 5EIVA 1I75A 1UWEH 2HT3C 2VCOA 1ZWIB 4PP2A 1AQMA 3BIBX 5J12C 4A68A 4HW6A 1CDUA 1AKPA 2WXKA 4MMZA 4R7XA 3CSBA 2BVQB 3LY6A 1T83A 3RWCB 1WUZA 5HD8C 4XP1H 2G75B 4HFWA 2B39A 5CMAB 1JPSH 2B14A 1RD6A 2DEXX 3K8KA 4NNXB 4IOSA 2Z8SA 5IUSA 4MMYB 4ZOCA 4EN2A 1IC0A 3VWKD 2YAEA 3Q3GA 2HJLA 4OGXH 4ANWA 4ZO8A 4YDLB 1YNTA 1M56B 4OT1H 2DLEA 2G3MA 2Y7MA 1SJEA 2Y6SC 4OV5B 5BZWB 3SBRA 5IW6B 4KROD 5DJZB 3KPMA 2GK2A 1G9NC 2YUXA 3KPRD 1GC1H 2C1OB 3V5HB 1UD8A 4ES8A 2HFEB 3G04A 4YDKH 1PG7X 1Q0YH 4WHYG 2XWZA 1JCVA 3FUHA 1FZKA 1TJGH 2EEAA 4RETB 1KLFB 4AW7A 1WZMA 4GRWF 3O4LB 4PU2A 4WKZA 4L29B 4QRFA 2WM0A 5ERWB 1CG9A 4LF3A 2N59A 2NSMA 3OKKB 3LD8C 3HB3D 3GSNA 4F1ZA 5I74B 4TLSA 4H2AA 2Q7NA 4P5TD 4JO2L 4XPHH 1DUYA 1XIWB 3GSOB 3RX5A 3BEWB 1XEDA 1QBLH 4G7YL 2JKWA 3QC6X 5EUKA 5DUPH 2KPNA 3SBWC 5HHMB 1VENA 4EO5A 1P1ZB 3BZ4A 1KPUB 5D1XB 3TPUB 1OL0A 3G6AB 3NIFB 2GI0A 3TO2A 3V6OC 4ODVL 2NY1B 4L5FL 3V7MA 3F84A 3MRCB 4PG9B 4DVRH 4Z7IA 1U3HA 4YDJA 5KS9E 5M95B 5CIPA 3AU0A 2JF1A 3O2DL 2WUCH 2KZBA 2G2NA 5C0CB 1XZ0B 3OTTA 1E5ZA 3SOTA 4H40A 5I28A 1J0IA 2BSBA 1INDH 3BKJL 2WVTA 5TTRA 4FQ1L 2ALWA 1T7YA 5DVOA 2X4QB 1QZNA 3K6SB 3U2SB 5L7XH 1AD0B 1YEFH 1IE4A 5D2NA 2FWOA 2GCYA 2K8MA 2QQNH 5TQ0H 4JCWA 5K39A 1AQDB 5I17B 2DWSA 4NC2B 2G2RB 5DFAA 4PAZA 1K8DA 5ADOL 1CGVA 1L7IH 1XB8A 5D96C 5EOCJ 2BDNH 5G2NA 4PI0A 1M3JA 1YC8A 2BNRE 2QPUA 3DJSA 3HS0A 3MV11 1XB6A 4JRWA 3N9GH 2YR3A 3UTSA 4FEIA 4CBPA 3ZGHA 2C3WA 2F0CA 3FT3A 1YEHL 4FNQA 1OQOA 2AEOA 3VXRB 1IRAY 3ZVVA 4YNYB 2R2BB 3EO0B 3DJZA 1CDYA 3RKPA 2Z34A 3ESVF 3VFTB 4B3VA 4J3XA 1WS7A 1A1NB 3VXUA 4WTZA 4X9GA 4D8PA 4NZJA 2BXYA 1ZT7B 3MV01 2H6PA 3OXSB 4AWJC 5I2IA 2M1KA 4HH8A 4WSKA 2EEFA 5J11C 3PGDB 1LK3L 4KXAA 4NEHB 2A99A 5DC4B 1BVKB 1WFMA 5DJ0B 4LLQB 5BOPA 3GJFB 1OP3K 5IB4A 3UTTB 2JE8A 1DVUA 3KLHD 1JPTH 3MROB 1A6ZB 5C09E 4RRPM 3ZTJH 1EZSA 1AR1D 2QKIA 1B9ZA 4LSSL 3WKNA 2JJUA 1P5VB 3BKYL 5AW4B 4D0CB 3B3BA 1KTLA 3JWOL 1T1YB 2P52A 3K4ZA 4L48A 2HKHH 3Q01A 1W0WB 3HMWH 4Q52A 1A6AA 3VFSA 1F8TH 2FQDA 4TMPA 1JWMB 4HKBA 4XAKD 4HUWA 2CJTA 4BCZA 1PCXA 4FP8H 4Q9BA 1ASOA 1UB6A 3IJSA 3CVIL 4YDLC 2ZOUA 4OVUA 4G6ML 3S4SG 4F7TB 3T6VA 3F04A 1K8IA 2W1NA 1E28B 3A23A 4A6YH 4ALAL 4UT9H 5AVQB 3X13B 2ITCA 4WHTA 4F7PB 4G8IA 3SJVE 1T5WB 4PFEA 3VH8B 4NQDA 4LRIA 4TLKA 2BVTA 4L9LA 4PRHD 2XOTA 3H9YA 4HD9A 5T3XH 3C6SB 1M57B 2L0DA 4MAYD 2VJ8A 2WLLA 1YECH 1WVZA 2EH8L 3SD5A 3TGXA 2H8PB 2J2ZB 1SXZA 1XZWA 2YD0A 3MUY1 4IJTA 4K9JA 3ZKMC 4UTAH 3NA9L 1G0XA 4PGZA 4BE6A 3GINA 4XGZB 1B2WL 3ARTA 4ZSOE 3VFOA 1L6XA 3C5SA 4MJIE 3BDYL 3FUFA 5CILH 1MRCL 2FGZA 4EI6A 3D0VA 4XPAH 4HWBA 4ZUUB 3SCMD 3S37H 5AVZB 1P4BL 3N43F 4IM8A 5D7SH 2D7QA 3P11H 3NRPA 5GZOD 4KDTC 3ATEA 1BM3H 1JYNA 2H1PH 1A7QH 1CU4L 2OMBA 5JHLL 1AQ8A 2DRUA 4HK0B 1IAOB 4PVBA 3UYPB 4OZFB 5EWIL 4GQQA 1URZA 4M29A 5G4NA 1DBAL 2EDHA 1IEBA 4UZGA 5IMLA 1MREH 4M5ZL 4RSYA 3D0VB 3KXFA 1NCUA 2CCVA 2YMXL 3HZVB 4ADJA 3BPNC 4GAYA 1GSMA 2WWKT 3B2VL 3MRKA 3TYGH 3U6RA 1HYSD 3IRZA 1IAIM 2N3JA 3N04A 1A9BA 3FRUB 4P5TC 3F7YA 4JO2H 5JNYB 2RCSL 2KPWA 3FDWA 3LPOA 3C8HA 4K07A 3BESR 4OFIA 4JGJA 1I3GL 1M4KA 3GM8A 4MB4A 1TPXB 3B7UX 4P2OB 2Y5TB 3BO8B 3K6DA 4FJ6A 3QDGA 2BMKB 3FULA 5JDSB 2QDVA 3SGDH 5KUKA 3NH7H 2EXWC 5AWNH 2AABH 2VLRA 3GGWA 4KFZC 3JWNH 3RI5K 4BDVA 4CVXB 3QDMA 1YYLH 1NEPA 1RVFH 1KY7A 1OAZL 4MRBA 3TJHC 3X11A 2L3BA 5SX4I 1BVZA 2JI2A 4FJZA 1MJ8H 3KJ4C 2I25N 1G6RB 3OB0K 2LT9A 3O45B 1ND0B 4WU7A 3TEUA 1JNJA 1T7XA 4E41B 5AEAA 3MRHA 4GRLC 1ZA3B 1LDPL 4WWID 4LVOB 4BH7B 2KDGA 3QNZA 3G6JB 2GJZA 1NWOA 2XU9A 2FSDA 3VD7A 4JFYA 3TN0C 3QEHA 3ZDYF 1FNGB 35C8L 1RZJL 2UZYB 3KPRA 2AHIA 2WYHA 1L3NA 4RNRB 3FRPB 3DSNA 3MRFB 3IKKA 2VLJB 1QG3A 1SFDA 2DQHL 4ELKA 3LOWA 5E4EC 2D3VA 3ILDA 1NLBH 1NGZA 1OTSD 2GEEA 1IAMA 4RAUA 5F71A 1KYUA 5KJ4A 4PLOB 4JFFA 2QVKA 2MFNA 1JNHB 3OJDA 3IFPA 2ARJQ 3VXPB 2BJML 1D5BB 1DN0B 4QHKJ 3LKNB 4PRHB 1ZANL 4NN7C 1OM3H 1XGRB 2LE9A 1X5IA 5DRWA 3ZDXE 1AS8A 3FK3A 2AMGA 4LLAA 4PWKA 4MWFB 2F53E 3AG1B 4WNJA 5E6ZA 1ZD6A 4LEXL 4XHJD 3I9PA 3CH1B 3ASNB 1YN6B 4HFUH 1OTSC 4LQFL 4XXDA 5HHXL 3ULVD 3B6SB 3MUHL 3PY9A 2OM5A 3TFKD 5HI4C 1D9KC 2VN6A 3FL7A 1T04A 1GHFH 1U8NB 5KJ7E 2APWA 3WNPA 4PP2B 1A1MB 4IRZL 3QHZH 4R6UA 3AXIA 3JQOB 3S37X 5DSCA 2C9QA 4IIQA 3U2SA 1QRNA 4YSTA 4DP5X 3MLZL 5CP7B 3SJVD 2CCLA 4LSVL 3RWFB 3MRIA 4Z7AA 3WSQL 1G84A 5I18H 4RAVA 1LO3H 3B5GA 2E56A 4K7PL 1QKZH 4W9EC 2WZAA 3DGGB 5DHYA 4NB7A 4K3GA 4W9GC 3RTLA 1O6SA 2KQMA 1KXQE 3NEOA 4LCWA 3FFCA 5INDB 2SEBB 5T3ZL 1XCQB 3VCLB 4Q2ZA 3BGFC 2OR9L 2VUKA 4UZUA 1G9MH 3VJ6A 4KJQD 2W0LA 2H26B 3QIBA 4L37B 4QMEA 4BSVA 3VFUB 3EGDA 5ACZB 2FT8A 2G5BA 3HC4L 3MBXL 4JR9L 4EVNA 1CE6A 2B16A 1N4XL 1UZ6F 2JB6B 4HUUB 5TE7L 4C8XA 2KLSA 4HCRH 4H8WH 5J12B 5TK4A 4U0RB 4WW2B 3ZTJG 4AGQA 5IBLC 4Z7WB 3T4AC 1QABA 2XC8A 1TPXC 2QR0A 4WK2B 3S98A 1AG6A 4CVUA 1GGCH 2EADA 1CDJA 3BE1H 5INCA 5CLWA 2XQ0A 2X4NB 5IB3B 2CGRH 3F65A 5HYJB 3POHA 4ELME 2VISB 1J0ZA 4CVWA 1KYFA 1MCNA 2X0VA 1KFAL 2P26A 3NJMA 1U8IB 2CBQA 2QQKL 4ANUA 2DL2A 5T8IA 4YBQD 3WHE0 1EAJA 3PV7A 3ECUA 3MUZ1 1GPOH 4HQQH 3QS2A 2XFXA 4LGSB 2HPOA 4BIKA 3FB6B 3KJ4B 1EDHA 5HDOA 4FAAB 4MB3A 3C6LC 1XGUA 3WLBA 5CD5C 1NOLA 1G4MA 1NCWH 2FB4H 2VKXA 1QBML 3GMRB 4U1IB 4JL1A 4YXHH 3GHBL 4X9HA 5DUMH 3RX8A 4FQQB 3EJPA 1U2CA 3FQWB 5B1BB 3VWJC 2Q1EA 2UZXA 4HU8A 3HHMA 4BQ8A 3CC1A 4GUCA 1C5BL 1TCRA 3C08L 2IEPA 1WAAF 3DURB 4H8PA 4HHWA 2BJMH 3SPCA 1TZOA 3LS4L 1X6LA 2Q8AH 5K69A 4RQQB 4ORGB 5ESVA 5F7WC 4JQXC 4Y1AE 4Z3JA 2I32A 1E6JL 5GRYA 5ITFB 4OCYH 4NQSA 4HIEB 2CR0A 4K7PX 2YD6A 5J3HC 5IVXA 4KRPC 1HE7A 3QJHB 2VDPH 1MCPL 4EBQH 3FB8B 1IARB 2MPAH 3VW3L 3PWUA 3RFRA 3QAZC 1YYLL 5ICYB 1S3KL 4JVUA 5EDXA 2QVMA 1N7MH 3KVPA 3PXJA 3RGVB 1KN4H 5GHWH 3QJZA 1GZHC 1HCZA 1E7VA 5I1EH 3L1FA 2OI9B 3DPBB 4Z18A 1KELL 3VACA 3KPLB 4PCKA 2DH3A 3P0YL 4OFYD 3SJVA 1LL1A 2EILB 3M1BB 5DHVA 3OX8B 4JO1H 5KYXA 3CU7A 4HPHA 1LO3L 4IRJB 1E3FA 1MFCH 4ILDA 4O58H 3RTQA 4L8SC 1SGKA 5DJ8B 4YAQA 1N19A 1BQUA 3Q8BA 2HB0A 1CLZH 4HX1A 4L4VB 4WUKL 5DGRA 2FO1A 5DJAA 1ZLEA 3UTZA 4F24A 3GMOB 1A6VH 4KZEL 1DZ0A 3CVCA 2BP0B 1OGAE 3TM6A 4FI8A 4JFWA 4BRVA 3PV6A 3K46A 1DBAH 4P4RA 1Y0LB 4GSQA 4W9IC 4DT2A 2YAFA 3Q5TA 3FT4A 2V17H 2ADJB 1TVDA 3NCWA 2YIHA 3F8UB 1V7MH 3DGCR 4I3RL 4JVPA 4RCAA 3QQ9D 4KI5F 3ULUL 3BPOC 1PLAA 4F80A 3WEBA 2VT0A 5DJ8A 1SDDB 3UAEA 5CBEB 3MV9E 4Z3HA 1MFDL 4OD3L 4OLXL 2H4EA 3UGXA 2ZCLH 3UTPE 25C8L 4DHLA 3CH8A 4IIQB 3D3VD 3VXSD 4OZGB 4XCFH 3EF4A 4Y5XB 5DQ9B 3TTSA 4RGND 4Y5YA 3O81A 2VSCA 2R69L 4JCLA 3ZSTA 4B9FA 4E42B 1RUMH 1JZ3A 4HV8A 3MRBB 5GGVL 3L7EB 4NBXB 3P30L 4G72B 3NA4A 3SPGA 5HYFA 1WBZA 3H56A 5DVMA 3V6ZB 1HZLA 5C09A 3NGBB 2J1YA 3T2NL 4JM4H 1UXMA 4HJGB 4P2AA 1UASA 3ZZSA 3L6FB 4X6BB 4HKJB 3D07A 4L0YA 4M3KB 5JZ7C 4FQXD 4Y89A 4Z7VF 4YIQA 3SE4A 1L9OA 2NQDA 4MA7L 3QCTH 2QVFB 4AH2B 4PJGA 4IOFD 1OSYA 1EHNA 1C16B 5BOJA 1BIHA 3O0LA 3P2TA 5A6MA 4XNZC 3AXLB 3E8UL 4FNPA 4XNQB 3DVFA 2A4EA 3VXUE 3HN8A 2H9GA 9CGTA 2DLFH 2DTML 4KHXH 3C6LB 2NXYB 5EA0L 2Q8AL 3EHBC 3MLYH 3ZMEA 1EEZB 5FHBH 5FO2A 4BFKA 2GAZB 2PXYB 5BVPL 5ETUB 1I1AB 1BFSA 4P59H 2FATH 2AQRA 4AKOA 4D0BA 1JZHA 4QYOA 4L4TD 5E8EA 1JDCA 3QA3A 3O6FB 2ERJC 2Z35A 2VDRB 4LAQL 1MCRA 4HIEA 2BVOA 2E8YA 4I3SL 4I88A 3T2QA 3EZ8A 4RFNC 2EYRA 2HFFA 3NK4A 1OIOA 2I9LB 1F6FB 1D6VH 2XWCA 4GY4A 4JFOA 4QRTA 3ARUA 4GG6E 3INOA 5IQ9B 2JV6A 4GMSH 1FNSH 1I8KA 4LRNL 4E9TA 3L1OL 5KOMC 2R69A 5B39A 5KVEL 5FUOH 4HS3B 3ZPDA 2GPZA 2CIKB 4X42A 4YSQA 1WIUA 5DD6A 1FZMB 1GKOA 4U1IA 4YEFA 4MNHB 3RGVC 1U9KA 4PS4L 1JNLH 1P7QD 2ZCHL 4X4MA 4CVXA 1UH4A 2ICEA 4RNRA 1KIPB 1NLDH 5TJWK 3TZVD 4ZMZA 3BUYB 2E59A 3EFFB 4WTXA 3ZE0B 1NL0H 1CFVL 1OOAA 4NQEE 4KMQA 1G94A 5DEFB 5KYUB 2CBTA 1IGYA 1PF3A 3NIDB 3OKMB 3UAAA 1NCWL 3S96B 4QRRD 2CLRB 2WOYA 3OAYH 4N0YH 3DXAD 3I6GA 1VGEL 4UQ2B 5KZCB 4Z7VA 2C9PA 1BG9A 2PXYA 5JTWA 4FNTA 3FFCB 1D5MA 3NQKA 4NO5B 4Z3GA 3ABLB 4R84A 4XPBL 4X9BA 2BWQA 3G5ZB 4DP4X 1KJ3L 2LU7A 4JRXA 3OG4B 5GPRA 2APTA 5D1ZI 1E65A 1T2XA 3FONA 3BKML 1T4KB 5DU7A 4AEHL 2X10A 3MOBL 1FFOB 3CVHL 2DM2A 3OKEA 5IQLA 3AACA 1E0OB 2ZF9A 1QR1B 2QGDA 5H94B 2UYLB 4FL4C 3UTQB 4F1SA 1U42A 1WP6A 1S7XB 2E3VA 1LGVA 3FU7A 4XE0A 3RFZC 1HAUA 3HMWL 4S0SD 4UQ3A 1JGEB 2ENYA 1A1MA 2PPEA 1HWWA 1WH0A 3H9SE 4LP8A 2FCBA 3TURA 4HDIB 4XP4H 2M83A 2NCEA 5FR3A 3ET9F 3IN2A 3QUXA 4J1UA 2XTJC 5K93A 4K94L 3T1FB 1UZ8B 4Z76A 4KDWA 4KX8A 4XMLH 4NQXA 4RAHA 4IBWA 2TRYA 3H3KA 3G6DL 2VLMD 2EYSA 3WAJA 3W5MA 3H9SB 2VR4A 5JMOC 4B0MM 4FXGB 4YZFF 2CPUA 1RP9A 3W39B 4CVZA 5D6CB 1M1XB 4FQXB 2BOLA 2HTKC 3BIKA 5JYMA 4ZFFA 3EG9A 2HP4A 4WF7A 1OP3H 1A02N 1OZTG 3HG1A 1F2XK 1T5WA 4DTGH 4RISH 3EH1A 2BSRA 2MTPA 3OG6B 4S1SL 4PR5A 4ZMXA 5EO9B 1LK3H 1KT2A 4C56D 4HGWA 4KJPC 4KBPA 4X6DA 2ODIA 4AQ8A 3HUJA 4W9LC 1G7QB 1X5YA 1I1AD 2J8UB 3HNSL 1EERB 2PCFA 1XSOA 5DS2A 5HJBA 3SKJH 1YJDC 5B21A 1QFHA 4JDVB 4ODHL 1MFNA 4RLDA 4YAQB 4BD4A 5B38B 4NP4H 3RY6C 3OZ9H 5B7EA 5L0QB 3RG1C 4CRPA 5EOTB 2JKRM 4LASH 5I19H 2PWEA 5E2WH 4JAMA 1JCKA 2IDQA 3VXOA 3DBSA 3V9CA 4P57B 2Z4TA 1FO0A 1VCAA 1IGTA 4XMPL 2VITA 5EC1A 1IQDB 3CFCL 1J1OH 5JORB 2VM4A 4G1EB 4I77L 1JD9A 1QYGL 3SZ6A 1NL0L 4N2CA 3LKPB 1K3IA 4E9YA 4YFEA 5HHQA 2WP3T 4HHAA 1WAAA 4JVWA 4EAEA 1KB9J 3IMBA 1YDPB 1CFNA 3PHSA 1AI1H 1KB9K 5IVXE 1P4LB 4WTWA 4RMRA 4PJ7E 3O4OB 1JN6A 4JG9A 4LSTL 4HPOL 2D0FA 2R1YB 2VDQH 2DJ4A 1IQWL 1N8OE 3DSFL 5ITFA 1CXHA 4WFHD 2C4FT 2D0GA 3CDZA 1X5LA 1FO0L 1Z7JA 5IG7A 1G7QA 5IWLC 2SODB 3FTXA 5G4OA 1F4HA 4X6DB 2ZICA 1WWAX 1DR9A 5A7EA 3PYCA 3W11D 1BVKA 5DJ0A 1BFTA 4GI9A 4OLYH 1R33A 4IGBA 3QUXB 3BJ91 3FU3A 4J1UB 5JDSA 3LNEA 4HKXB 2D7TL 2WBJA 4POUB 2WIMA 4MCYB 4YLCA 4FTVE 2PPDA 1WE5A 3UMTA 1CDCA 1F6AA 1V7NL 1BWWA 3RVWC 4CGTA 1ORSA 4P2QE 1QSZA 1A5FL 4ZUSA 1MVUA 3ISRA 4HMCA 5LAPA 1S7SB 2W9LA 4MJIB 1GJUA 3ZT5A 1T1XA 1P0SE 5JXAH 4EI5B 1A2YB 2FQGA 4XCFL 3LH9A 4XVUC 3SE8L 1XWVA 2DN7A 1ZGLA 3HNTH 4PBDA 3TNMA 4ZT1A 3ARVA 2DQDH 5LJYH 2Q7YA 5KS9F 4WVRA 1MCWM 3TPUA 3EOBB 1NGPL 1J9TA 2BIIA 2FSEA 2R1YA 2WLJA 4OCXH 4OJCA 3K71B 1T83C 2CBMA 2CRIA 2NY1C 3GMMA 1WJ3A 2FBJL 4FI7A 1L9SA 4B9IA 1A1OA 3RBGA 5J3HD 2P49B 5EMYA 4E5XB 1XR8A 1UOWA 1DYZA 4AK1A 1B3IA 4KQ4L 2VXSL 3UO1H 1FVDB 5MENE 1NCCL 3QRGL 3PWPE 4ZFGL 1A7NH 3LPWA 3R7RA 3EZJB 3W56A 4LLWA 1Y6MR 2EXTA 4AVIA 5EUOF 2H3XC 3C5SB 4W9ZA 1FV1B 5F0MB 5IQMA 4TQIA 2F74A 2CH8A 4JHZA 3QQ4B 5FGSA 5DDHB 4MB5A 3VXNB 3GIVB 1OGAB 4C4BA 1NCBL 4F3FB 1LD9B 2DQGH 4BWWA 2DWTA 1GGBH 3VU1A 1I3RB 3QUHA 1SDAB 3ME0A 3QZBA 4P8QA 3IVKA 5E7BA 1K4DB 4G5ZH 3FSVA 4PD4K 3DROB 5E2TH 2NNCA 4NQTA 1CFNB 2OI9C 4PW3A 4TOYH 3A5VA 1NFIA 4PJ8C 4GI8A 5L4JA 1Q1PA 1W9XA 5H2BB 5AW7B 5LLIC 4LVHC 1OSZB 3GEWB 4BFRA 1J48A 4GG8A 5CJXC 3MGTA 2XV0A 4HT1L 1TU2B 4E9QA 1FZMA 2FQEA 4W9HC 3V6FA 3BQUA 5K5YA 8CGTA 1B0RB 2HUEA 1YEFL 3O3EB 1ZA6A 1YN6A 1SHXA 3JUYA 4PJAB 2BNUA 4K71C 2ZUXA 4ONGH 5L88L 2P42B 1RFDL 2OJZL 4JFTA 1FNHA 5BPPA 3RIFF 3NZSA 4PBVC 4WFGE 1YMMD 4KTYA 5CR8A 1E4HA 3GXIA 5ACLA 1ZIAA 5IROA 2OYKA 1CYXA 1QWHA 5FDWA 1J86A 3STLB 4G8AC 4W6XB 5C0JB 3U7WL 1CL7I 1DQJB 4PR5B 4QRSA 5IF0B 1JPSL 3SKMB 3C60B 2O26U 3GMLB 2CJUH 3T5WA 4ELKB 3HBQA 2VWEC 5E9DD 4XAWL 4MS8C 5TQ2H 3UTSD 3BFWA 1CZ8H 3Q8EA 4ZRGA 2VL5B 2ICCA 2C8NA 1YQVH 3AXLA 2GUOB 4ZUTB 4Z7QB 3VD0A 2G60H 1Z5LA 4DAGH 3CC5B 5CR1A 4HC1A 2NW3A 5CEZL 3MNZA 2P47B 1NCAL 2B4CL 1ZTXH 4Y19D 1NOFA 3QJFA 4Z8FL 5A2KH 3S35X 3RKDD 2FB4L 1PYWA 3B9EA 5I76A 2OMYB 4TPRH 4QLWA 4Z7WF 2R2HB 3CDGA 5I1LA 4FQIL 4ELMB 2WNKA 4OGAC 2CXKA 1XF4A 2VDMB 5DMIH 2NTFB 3FT0A 1QP1A 2YFOA 2A9ML 4YSRA 4BFGA 5IHWA 4XT1C 2FBJH 3I6SA 4XN9A 4EN3B 3ARPA 3TP4A 2VDOB 3QR0A 5F3BB 2BMKA 5IEKB 4KQ0A 2YFNA 2WBWB 4ODUA 3TWYA 1TEGA 2VJXA 5IV2B 3EDKA 1KZQA 3N50A 3B2PA 5J5EA 4XE5B 5JHAA 1TZGL 1KY6A 1KIPA 2DQCH 1HL4A 4N20A 2VQ4A 2NZIA 4MX7B 4H88L 3V0WL 3NSXA 3MA7B 4NM8H 5C0EB 4WKZB 3MRDB 3WNLA 4LRIC 4DH2A 3E9UA 3O9WA 1RZIA 4OZ4A 1OSEA 5KSUA 4OZIB 1PD0A 4B0MB 5BQ7A 2ITDB 4UDUB 1WFTA 2WB1A 4AIOA 4IYKA 1WA0X 5CFAA 4TM9A 2QFRA 3BOVA 3VFPB 3I6GB 4WHDA 4PJ7B 5IMLB 3CZFA 1I7ZA 5T1LA 3CC5A 1Z9MA 2E6PA 2O5ZH 5EEUA 3MLYL 1MNUH 2AGJL 2PPCA 5GS0L 4DF9A 3HRPA 1V55B 3BGAA 3FQUB 1S7UA 3BSZL 3BUYA 4M61B 4PUBH 5I8EA 4J3UA 5AOKA 3TTYA 3N3EA 2X4OA 1NC2D 1ML0A 2DQJH 3OX8A 3CDFA 2WANA 3QDJD 2HCZX 4X7FC 3T3MB 4LASL 5I19L 4G70B 1BLIA 2CKBA 5ICXA 3EDEA 3PIQB 1RFDH 1Z32X 1J7VR 2CRMA 2IH3A 2NMSA 2OJZH 3QE5A 1WBXB 2Q0ZX 1AP2A 3DKHA 4PV8B 5FIEA 4OCMC 3UZQB 1E6OL 3SDCD 1TVBB 3QXAB 3WKML 3PABB 1I1FA 4UOW1 5IJDC 2XICA 4YQXL 1A7OH 4OLXH 3F5WB 4J4PD 4RMWA 3LN5A 32C2B 1CIUA 3V4VA 1VFUA 4N0CC 3DLQR 5E6YA 3NCMA 1KJ2H 1T1ZB 3D2UB 4JJOA 1ZLSL 5BRPA 2F7QA 1X44A 2YAOA 4U3SB 1DLHB 2BVPA 1EUUA 2VZSA 3RZCC 3C60D 1UADC 1JBJA 2ZOKB 2W9DH 4PREB 3S34L 4BRJA 2VLJE 4MJ6B 3DJRA 3GBEA 1FO0B 4DAGL 5K9OA 3NFPB 1ETZB 2KC0A 1L6ZA 2YUZA 1XGTA 4LCIL 1DQLH 1DSYA 4J8RA 2HTLD 2IBGA 4NUJB 5CKGA 2A6KA 2RH0A 3FSZA 3CN1A 4V1DA 4QT5A 4MA1B 1FBIH 1BQHB 5CN2A 1F02I 2DLFL 4X7SH 1K6QH 5HD8D 5FYKE 1DJYA 4QD2E 2L7EA 1CN4A 3F01A 2AVGA 5FYLE 4GMTL 5HYJA 5LAXA 4HF5L 3CZSA 2FIKB 4Y5XA 4XNMA 1GYUA 1PG7W 4KROB 4I5BA 5JPNC 1FFPB 1IGJB 3FO0H 4EZLA 3GZKA 3VD2A 1X6NA 1UKSA 4K9EL 4XODA 5DVLA 4PN6A 4MXQC 4NM8L 4LHUD 4OJFL 2DLTA 4IU2B 5L2KD 2IBZX 3OC8A 4OJAA 4XOEA 3CX5J 4M8RA 5KVDH 4LFHD 3ARBB 3SE9L 3UCQA 2X87A 4HPYL 5MENA 1R5WB 1HT6A 1TETL 2P24A 5AW1B 4XNXH 4JRXB 4DO5A 3WY1A 4JRLA 2FIRT 1AZBA 2MCG1 3IXAA 4FYRA 5F7NC 2VJ0A 3T0EA 2WXQA 4UQCA 5D1XD 3VWJB 2PYEB 3WXWH 4DSYA 1NDMA 1QPKA 1MHPH 5JUEH 3MLWL 3U4KA 1G7IA 1CFTB 1M2VB 2Y07H 3RTQB 2KLTA 2W0FA 1DQDH 4PRHA 4MD5B 3I3DA 5K9QG 3PHQA 5A2FA 2G4EA 4B41A 2F58L 2MIZA 1GHFL 2HLAB 2X89A 1HQ4B 1J1XL 1ILUA 2WIIA 3LVEA 5D7LA 1AKJB 2OL3B 4IHOA 5GISH 3I74A 1MCIA 4JG1L 1HHGA 3GSQB 4DN4H 1WDAA 5GJSH 1CGSH 4G7RB 3ZKNC 3JV4A 5D7HA 3RDTC 5DJYA 1A6TB 1WEJH 2VAJA 5AYUH 4XPFL 2ICEC 3V8CA 3WUZA 2DQUL 4FFYL 1IBGH 2ZSWA 5E6ID 5KSAB 3OQRA 4FGMA 3BH9B 2OMWA 3U1QA 3MFFA 3QFJA 4URTB 5LNEA 1BBDH 3HG4A 5JR1H 1PBYA 4D0DB 2FO4B 5EU3A 4BH7A 2G9HB 2YD7A 1X5MA 3CZFB 4A2MA 1IC4H 3PAYA 3EDFA 3Q7JA 5DMKA 3EGSA 2O1AA 5EO0B 1YCSA 3U2IA 4L8SB 3JWNC 5ERWA 3HHSA 4PJBA 5SWZD 3H54A 3ETBJ 1ZE3H 3T3PB 2F8IA 1UENA 5F9WC 2OCCB 2WVVB 1EZVX 2E4TA 2PMZA 2UUDH 1KGYE 4RAUB 4GKSA 4HETA 5HGAB 1THAA 3HS9A 2EIDA 4WEBL 3CCHB 5HHPB 4XO3A 1UWGH 4WGWB 3KBPA 3QUGA 1UACL 3OQ3B 2IFFH 3GM0A 3OMNB 3OLEA 3EJSA 2AK4A 2WWKO 1WAAE 4KKQA 3U4EB 2XBDA 1NGXB 4WCYH 3WUWA 1I7RB 1U3HD 3ROOA 1GC1C 3GJFH 3LAFA 1K6QL 3LEXA 2J25A 4LCUA 1H3TA 3GKWL 4P9HH 1VHPA 3E6HB 3F7YB 4OB5L 3L3OA 4R26L 3ETSA 3IEAA 3MRBA 2ATKA 1KEGH 3AVEA 3CNKA 1TKWA 3EBHA 3KM1A 3GSRB 1ZIBA 3QIBC 1ZWIA 4J28A 2XN9E 1HH9B 5TDNB 4OVVA 2BSDA 1G7PA 1J05A 4TUOA 1NINA 1S6NA 3MV9B 3NSJA 1ET7A 5BJTA 3HKFA 4I89A 1S7WA 4TNFA 1TEFA 2WN3A 4IEFB 4YIQB 1KCKA 2I60L 3QIUC 5ACZA 4NO0D 1SUHA 3RZWA 4F57H 2CKNA 4LB8A 1CT8A 1X5HA 5EBWA 4PGEA 1NCGA 5MERA 5TH2B 1D2OA 1RPUA 2IDSA 2EDNA 1IAII 1GCFA 3VTMA 5JNYA 4E9VA 1DBKL 3PFQA 2WUBH 4JN2B 3U4BH 1KENL 3AITA 1JI2A 4JHWL 4WO4C 1QATA 2CM5A 3IMRA 1PU0A 1RJLB 4NO2A 3MLWH 1FFTB 2CKBL 1IBBA 2YRPA 1NEZG 4M43L 2VXSH 2EUZA 1P7KB 1E4JA 1RIUH 1OQXA 3WUWB 4YX2H 5DJAB 3CFJA 3EHBB 5C6TH 1AIZA 4LCYB 2BSTB 4LHJB 3TJEL 1JWUB 3FT1A 1U8LB 2UYLA 3UAJD 1JL8A 5CD5D 4W9JC 2PKDA 1D7BA 1XGQA 5AAMC 1A6WL 3BSGA 3B3IB 1FSKB 5ALBH 2R1WA 1EWHA 3O8XC 1I3VA 5DHVB 1L0YA 3O2DH 1R3LB 3DIFB 4FTVD 4DTGL 3GQFA 4MJJA 4L9DA 4Z7UE 2J5LC 4PJ8A 3BSZH 3GLDA 2B5IB 5AD0A 3ZHDA 3T3PF 2XYCA 3L9RA 4KK6D 3PL6C 2FT7A 2WKGA 2R29L 4WJ5A 4N28A 1CIDA 4QHKI 2NY5L 3J07A 5IOPB 4MWFA 4PJFF 2NT0A 2BH0A 4M1GH 3GSWA 3TT1L 5JXEA 3LN5B 4UNUA 4FA6A 1K4DA 2LQRA 3ZKMD 5KSAA 5LCVA 2XKNA 1BM7A 1U92B 3OMAB 4WU7B 1MJUH 3T77A 3QIWB 3GK8H 4PTTB 3G9AB 2JTDA 3UZEA 1RUQL 3CBJB 3LRSB 4IS6B 3I3BA 5D1QB 1F90H 2AXGA 4X6CE 1T1WB 1RZKC 5EIQA 4PRPA 2DAVA 4WHTB 1FV1A 2Y36H 5C3TA 4F7PA 2UY6B 2B15A 4YPJA 3UJIL 1UWGL 1ULVA 3P9MA 1TJHH 2YRBA 4I87A 5EO0A 1OP5H 2VLRB 1O5DT 3RVTC 2EH7L 4CJ0A 1KC5L 1U3NA 1WD9A 1HDMB 5I16A 1PNCA 1S8DA 2PPFA 1N70A 1PSKL 1TITA 5F1IB 3B5HA 3B9DA 4PJXF 2HH0L 4X99A 4CA4A 2N7SA 2WTRA 4KY2A 1QAWA 4IBTA 2W65B 3VSUA 2IPTL 2BZDA 1A6AB 4G82A 5KJRH 2ARWA 1LP9A 3C5JB 3WL9B 3MLVL 2G9KA 1NCCH 1G6RH 2YKKA 3PREA 2DIBA 4NXKA 4XNDA 2VISA 4TQ8A 4GB9A 4HALA 2GIXA 4OD2A 4QWWC 2OCJA 4W9DC 5DK0B 5FKPA 1JD7A 1MCQA 3UCRA 1CYGA 5D70L 5D9SA 2H0EA 4JHVA 3G9VA 1I53A 1I7TA 2XX0A 1HCYA 1IKNC 2OZ4H 4R7LA 3KPSE 2F6AA 4F7EA 2VR5A 1XR8B 1K3ZA 1SYVA 5C2BH 3KM2A 1DEEB 4GJTB 4WW2A 4X2UA 2IAMB 3WLBB 1CB4A 5EBLA 4OZFA 4XTRC 3FN9A 3QJTB 4UMSA 3DO7A 3TBWA 1AYRA 5HGDA 1JHTB 5K9KB 1RK0A 1PJ9A 3MAWA 3NZHH 2IQAB 3QZLA 3M07A 5IUCA 2YGQA 5ANMB 3O4LD 3L3DB 4P5KA 3T0EE 3QZPA 5I8OL 2OS7A 3L8QA 4EI6B 4XVUD 3UJTH 4HIQA 3FHQA 4YVUA 5BQ7B 2KERA 2ZPKH 4OIIL 4RA3A 4UB0H 1H5BA 1XIWD 2X7LB 1T7VA 1RERA 1ZJBA 5AW3B 3CVBA 2CHDA 4UQ2A 3KPQA 1N8ZA 1QBBA 1OSPH 2N01B 3CFEA 4XCEA 3MNZB 3EDJA 4MCYA 3P4NA 3DX6B 4WUUE 1GA2A 2J3SA 2YQGA 1KCVL 4BE5A 2V33A 2R0WH 4ZMVA 3WN5C 5T5FH 4H25A 3MV7E 2RAMA 3GRWL 4JPKH 4R8WH 5D72L 2NY0B 3NDYE 4N0CD 4PJCB 4DEUA 3FQTA 1TSRA 5JORA 4FRWA 1XF4B 1AD9B 1BQ5A 1RUPL 3T8VA 2YRLA 2A38A 3ABMB 3MMEB 4PUBL 4X8GA 1QX1A 1VZGA 2BW4A 5E2JA 3N06B 1M6OA 4N9OB 5KVEE 1JWMA 4HKBB 3OAUL 2IOIA 1KTDB 4PRHE 5FDWB 2H6UA 5T3ZE 1USQA 3GMQB 5GJSL 3PHOB 3U46B 2YD5A 2ZAIA 4JDZA 3CQFA 4GSDL 4RGOL 5AYUL 3IBOA 4HBQA 1QRNB 4WW2F 3MOQA 5C71A 4OZIF 4J3TA 2GY5A 1TOXA 4OW6A 1I3GH 1TZAA 4NI3A 2H32A 5FUCC 3BKMH 5TK2A 4LLUB 1TTUA 3TO4D 1OK0A 3QNFA 4QXGH 4PCTA 3STBA 1YEKH 1QLEL 2QKIC 2K6WA 2XTSA 1PD6A 4IBYA 4LLMA 4PVMA 4Y2OB 4Z78A 5A6IA 4PRNA 2VRAA 1X4XA 2Q2EB 3P3SA 3EG9B 2ZP9A 3H4HA 3C5ZA 3BW9B 5HYEA 1SLVA 4LKXA 4K7PY 1GS7A 4NNYB 3V5HA 5J6HB 4E41E 3DV4B 3H6JA 4M6OH 2R2BA 3F7KA 2J73A