4YSOA

Copper nitrite reductase from geobacillus thermodenitrificans - 0.064 mgy
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
295
structure length
295
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
source organism Geobacillus thermodenitrificans (strain ng80-2)
molecule tags Oxidoreductase
total genus 98
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ysoA00
1KDJA 4BK5C 1V55B 3UACA 4G7QB 1NIBA 1PNCA 3FPXA 1PF3A 1NIAA 1V54B 4BWWA 1AOZA 1KCBA 2QDVA 1L9PA 3CVDA 2UXGA 2PP8A 4PAZA 3QPKA 4CSPA 2Y69B 2PCYA 4G72B 1NINA 3OM3B 2DYRB 5I6PA 4KO7A 4GP5B 1DYZA 4A68A 4HIPA 1QHQA 2DY2A 4KNTA 5B1AB 3EH5B 4N8UA 4F2EA 3V9EA 3PAZA 1ET5A 1SFHA 1ADWA 3IE9A 1WA0X 1J5CA 3C75A 4NAJA 1B3IA 1JOIA 3NJKA 2PLTA 2XUWA 1IUZA 2AZUA 4HHWA 4KOBA 1XB8A 5D4HA 4P5RA 4FAAB 1AG6A 1HFUA 3WG7B 1XB6A 4YSDA 1PMYA 2XVBA 2GHZA 1SNRA 3UAEA 1XMEB 1T5KA 3ZDWA 2YQBA 3DKHA 4YSTA 3X2QB 4KO5A 2GI0A 1J9QA 1QLEB 3N55A 4QLWA 2HLEB 4YVUA 2BWIA 2PPAA 5ANHA 4EF3A 3FSWA 1BXUA 3IN2A 3N2JA 2VW7A 1JZFA 3ZX1A 4RH4A 1ASPA 1A3ZA 1A4AA 3QJTB 1BYOA 1FA4A 3OMAB 3NJJA 5TK2A 2YXWA 2FQFA 4M3HA 3GXUB 5B1KA 4DPBX 3FQ1A 1A4BA 1NIFA 1OF0A 4E9VA 1GS8A 4KNSA 4G70B 3NJMA 2IAAC 3NSCA 3UAAA 2ZXWB 1M9WA 1ILUA 3QJVB 1OCCB 1AZBA 1CURA 2R7EB 1IKOP 4KOCA 4E9XA 2RACA 1JERA 1N68A 1KYAA 1BQKA 4AKPA 1PY0A 1PCSA 2CAKA 3AY2A 3UADA 2J55A 2VM4A 4WTQA 3FU7B 1RZPA 2WO3B 4E9SA 3JT2A 1RKRA 3FSZA 1GW0A 2YAHA 2FT6A 3OD3A 1M56B 3NP3A 5AKRA 4M4RB 4HALA 5FC9A 2P80D 2XV0A 3GDCA 2CCWA 2YAOA 4E9WA 2PPDA 5B7FA 5B3SB 4KO9A 5D4IA 1IC0A 4E9YA 1VLXA 1L9TA 3FQYA 2VM3A 2CJ3A 2WO2B 1OE3A 1AZUA 6PCYA 1IBZA 2UXFA 3BQVA 3SBPA 3RYMA 2R7EA 2UXTA 1JZEA 3X1NA 1PLBA 5E9NA 3TASA 3QJRB 1JZJA 4BXVA 3CDZA 1OV8A 4DP7X 3IBOA 2VW6A 3NJIA 1JZIA 4HCGA 4UANA 1QNIA 4PCYA 2PCFA 4UF7C 3TBCA 2EIJB 1AAJA 2FT8A 1L9QA 1E5ZA 3WI9A 2IDTA 4JHVA 5I6OA 4YSOA 2FQGA 1PLAA 3SQRA 2YAPA 2BW5A 2XXGA 2OV0A 1MG2C 1OCOB 3NJLA 1SHXA 3DTUB 2GIMA 2DWTA 3CVCA 4YSPA 3T71A 3PPSA 4CSZA 2GSMB 3IEAA 3PLYA 4AKOA 2IWFA 4HZ1A 2VSKB 2BO0A 2H47C 2GC7C 3G5WA 3FSAA 2GBAA 3GYRA 2TSBA 1W8EA 3CZUB 4GXFA 3FYEB 2XYBA 3S3DB 3WIAA 8PAZA 1JXDA 1EHKB 4DP4X 3NT0A 2FTAA 3FU8A 3X1GA 4A2FA 3V9CA 2AZAA 2B08A 1JZGA 2OCCB 1E65A 2FNWA 1A4CA 5I6KA 3EH3B 1J5DA 2DV6A 1A8ZA 1UATA 2HX8A 2GC4C 2H3XC 2P80A 3X1FA 4DPAX 2IH9A 3NJFA 1NWOA 4GP8B 1SJMA 4YVNA 3S8FB 4GYBA 1AIZA 3OMIB 4YSSA 4A2EA 3FQ2A 3S8GB 1FWXA 4E9TA 1PZAA 3DIVA 4YSCA 1PZCA 1XB3A 2HX9A 2EIKB 3H4FA 1MG3C 2AANA 1AS6A 5A7EA 1OCRB 1TEGA 1L9SA 3UABA 3NSDA 2EIMB 2B3IA 3FU9A 3QQXA 4BXSV 9PCYA 3KW7A 2XX0A 2HX7A 4AKQA 2BZ7A 3ZIYA 5TK4A 5I26A 4UAHA 2J56A 1J9SA 4BWTA 3NYKA 4G71B 2IDSA 5I6NA 2IWEA 3CVBA 2XXFA 3EHBB 2ZONA 2J57A 3AG1B 3PCYA 1WAEA 1KBVA 1SDDA 1KBWA 3T6XA 5LDUA 3TA4D 1BXAA 2UX6A 1AANA 2XV2A 1GS6X 4AZUA 1I53A 1AS8A 3PAUA 3CDZB 3TBBA 4A2DA 2PPEA 1AS7A 1ASQA 1OOWA 1RCYA 3HEIB 2I7OA 2E86A 3NSFA 5F7AA 1WS8A 2LLNA 3WNJA 1W6WA 4X4KA 4HAKA 1BQ5A 4YL4A 4KNUA 2BP0A 3NJHA 1TEFA 1ZIAA 3NJGA 6PAZA 3PAVA 3D12B 2BHFA 2N0MA 3FSVA 1AZRA 4A67A 1JVLA 2FQDA 4HCFA 1NTDA 3ZBMA 3QJUB 1KGYE 2VN3A 4A66A 2YAMA 5EHFA 1E67A 1N70A 3AG4B 4DP2X 2Y1AA 4G7SB 2HRHA 3NP4A 4QKTA 2IDFA 1BEXA 4K9JA 4F7KA 5AZUA 3MX0B 1DZ0A 1IBYA 1WA2X 3HB3B 1AR1B 2FJSA 2JFCA 4DP0X 4YSQA 2XLLA 1GR7A 3BVDB 5IY5B 1NWPA 3T6VA 1NZRA 1JXGA 1PAZA 2W8CA 3X1BA 2FWLB 4DP5X 1ZV2A 2UX7A 4DP8X 1NDTA 1ZDQA 2CBPA 1V10A 1PNDA 2VW4A 3ABKB 3IN0A 1J9TA 1TU2A 5I5IA 3FPYA 4G7RB 3NSYA 2WSDA 4MFHA 2ZWNA 4NERA 1A65A 4NB7A 1NICA 1E5YA 1GYCA 1GY2A 1BQRA 1GSKA 1NPJA 2BP8A 1URIA 3ERXA 5B7MA 3NJNA 2GB2A 5I6MA 4A2GA 4AI7A 3MBWB 4BWUA 1SF3A 4DP9X 3SBRA 4W9ZA 2QDWA 3WKQA 3JTBA 1KCWA 1EZLA 1E30A 3T6ZA 1BYPA 3ABLB 5AFAA 4P5SA 2OJ1A 1ZDSA 4GP4B 4KO6A 1AZNA 1SDDB 2YAFA 5B1JA 1KDIA 2X87A 1SHWA 2FT7A 3PXLA 1L9RA 4BDVA 1AACA 1MZZA 2DYSB 1W6LA 4ZK8A 1X9UA 4JHUA 7PCYA 2I85A 2A3TA 2I7SA 1F56A 1R1CA 4DP6X 1BXVA 2Q5BA 1CC3A 3T9WA 5F7BA 1MDAA 4HCIA 2PPCA 3S3BB 1CYWA 3AW5A 2CUAA 1TKWA 2MRYA 2XWZA 2W88A 3AG2B 2BP0B 4YSEA 2YARA 2J5WA 3WNIA 4YSUA 4W1TA 2IDUA 1NIDA 1ET8A 2Q9OA 7PAZA 3QJQB 5I28A 1RZQA 3X1EA 4JKNA 2XX1A 4A2HA 2YAQA 5I5MA 3FYIB 3ABGA 1HAWA 4AX3A 1BAWA 1OE2A 3OQRA 4WKXA 1ET7A 2X88A 2QPDB 3ASOB 3EF4A 2BZCA 4L0PB 1AZCA 4Q8BA 1NPNA 2VSMB 5I5JA 3AZUA 5B7EA 1X9RA 2PP7A 2TSAA 4DP1X 2ZOOA 2UXVA 3WKPA 2XU9A 1KV7A 3KW8A 3AG3B 4F2FA 1FFTB 4HHGA 1CUOA 1MZYA 2PPFA 1JZHA 3SBQA 4E9QA 2IDQA 4YSRA 3H56A 1CYXA 5D4JA 2IH8A 1AG0A 2BW4A 3T6WA 3ABMB 4TXVB 1HAUA 1ETJA 1NIEA 2HXAA 1PLCA 1ZIBA 2JKWA 1M57B 1GS7A 1J9RA 1ID2A 3FT0A 2IWKA 4FA7B 1WS7A 1ASOA 2XV3A 3H4HA 2JXMA 4DPCX 2VMJA 2BP8B 1AQ8A 1L9OA 2YAEA 1SF5A 4GY4A 1GY1A 2AFNA 2EINB 4YSAA 2QT6A 2AVFA 3UGEA 5PAZA 2HZHA 1OE1A 5B1JC 3S3CB 2H5UA 2MTAA 3TU6A 3U25A 5I6LA 5PCYA 2CALA 4Q89A 1ILSA 2DWSA 2HRGA 2EILB 1YLBB 2BWDA 4ENZA 3FS9A 2NRDA 1JVOA 1ZPUA 3QJSB 3EH4B 3OMNB 5B1BB 1OCZB 2QPEB 1WA1X 3FU7A 3L45A 2PP9A 4N4YB 2YXVA 4BDVB 2FQEA 1SFDA 3CG8A 1PZBA 1JXFA 4E9RA 3ASNB
chains in the Genus database with same CATH superfamily
4G7QB 2PW2A 5DA0B 3QUMH 4PCSA 3RUGB 3UZEC 3G7TA 4TM9A 4KDTC 3APFA 4M6ML 1XF5B 3W39A 3GXMA 2O61B 2D7PA 3QXDA 1TZHA 4OGAD 2CXKA 2XN9A 4WK4B 2AXFB 3BAIA 4FLHA 4ZJ9A 1JGUH 4WI7A 2QPFA 2OMBA 2G4EA 2H1PL 4Y9CA 2LE9A 3LQZB 3MN8A 4UTAL 4X99B 3K81A 1AVAA 1JNHA 4PRPE 1KNOB 3O4LD 1JV5B 1AXIB 1JNNH 2V5YA 3IE9A 1ADWA 5GGSY 3IXAA 5MENA 3GMNB 3WXWL 3QDMA 2F5BH 4I4WA 5K59F 3M46A 1MOEA 1V3LA 1JOIA 5KUKA 2XUWA 1T7ZA 1CXLA 1XH0A 4TRPH 3X3FL 3KPOA 3ZRSA 1LYQA 2BLFA 4MS8D 1KBPA 4Y4HA 1JWUA 3A0OA 4ZDHB 2A0LD 3SQOL 2DDQH 4X8XA 1XB6A 5GGUA 4CADA 2AGJH 2GQHA 2DW5A 1NAKL 4LMQI 3NRQA 2ALWA 3HKZA 1MNNA 1BM3L 1T0NB 4Q2ZB 3S98A 1E5AA 1T5WA 2L7JA 5EU3B 4L1BA 1WD8A 4XNMA 1I1AA 2D3LA 3WLBA 1YEDA 3W5MA 3G08B 1INEL 4NWTL 3QEQE 4YVUA 3VGFA 1UA7A 2N4IA 1GJUA 1T2JA 3P73B 3VFNA 3CFBB 3POCA 2D9QB 5C0FB 2VR3A 2D9CA 4HJGB 2D7TL 4XPHL 1QBLL 3DX8B 4S0HA 3DX9A 1SXZA 5GRWA 3DUUB 3AITA 1HH6A 4ONFH 1DQIA 1NA8A 3KL3A 4JAMB 4PJIA 4RIRA 1KB5H 4DPBX 5L2KD 1RP8A 1MRCL 2F58L 1PEZA 4YHNA 3PIQB 2WJ7A 3TWYA 4P4RA 2F19L 2WXFA 2EEBA 2CBOA 3E3QE 2CJTA 5I1IH 4OLVH 4NM8H 3HAEB 2A77L 5FKPB 5J13C 4JFVA 1GHFL 4G83A 3PV6A 5I19L 1KXQE 5HTSA 1D7BA 4W81A 1R5WB 1HEZA 1XGQB 3NQIA 4XPGL 1S9WB 3F7LA 4KRPB 1U93B 4AMWA 2XYCA 1UG9A 4XVSL 4MJ6B 2Y7OA 3LH8A 3OXSB 1FZMB 2YAHA 4KKAD 2HTLD 1KN4L 1UJ3B 2E8YA 3L3OA 5HHME 4OCSL 2A83A 5FA4B 4KY1H 2XV0A 4P49A 1NGPH 3KLHD 4X5XB 4L8CB 4LARL 1PU0A 2KKQA 4WHYG 4I18C 4TTDC 4W9JC 1RZJH 4PJCB 2FX7H 3IDNB 3MLZH 1OAQL 4LSSL 4N0FA 3V6ZB 2VL4A 2OI9C 4JPWL 3WHXA 1ZJAA 3C6SB 5D1QD 4JFFA 5JNYB 5IR1B 3JWNH 4NSKB 1R3KA 1J1PL 4FQIL 4ZMVA 1QRND 4L8SC 5ESAB 3MBED 4HPYH 5AWNH 4IEFB 2F53A 2O6DA 3QJRB 2EABA 1FVEB 1NCDH 4Y4KC 4OZHF 3RY6A 1KBGL 2VN4A 2WZPD 1OGAE 3T8XB 1M4KA 1H3VA 1VZIA 5D96C 1TQBB 2EDYA 4GRMA 1U4FA 2WXMA 1I9IH 1XGRB 1PG7L 4K55A 1TZIB 3L4TA 3GS7A 4BYHA 1KLFB 4OLZL 3VG9C 4OM0L 3ZN6A 3CBJB 1NGQH 5BVJB 1WFNA 4I2XE 4XP9H 1I9JL 2YAPA 4F7MA 3ATDA 1QLRA 2B4CH 4HFUH 2DOCA 4XTRD 4LDCA 1TMQA 4Y9GA 4YSPA 3T71A 3AABA 1JDDA 4MDIB 5D5MA 2YD9A 2ESVD 1JHKH 4RFOL 5JHDD 3EJYD 5EO1A 1MAMH 3ZDXF 1KJMB 2IWFA 3U4EB 1ND0A 2YMXL 4IDLA 1N5AB 1OKEA 3BSGA 3WNOA 3M17A 2NY5L 2FL5B 3QQ4B 1DEDA 3QSKB 3C8KA 5IF0A 3VFRB 3ZTJH 5IW6B 1BF2A 1R24B 3FTWA 1EX0A 2X6MA 1IZJA 3GHBH 3S3DB 2ZCLL 1ONQB 2NXZD 4UTCA 3PXJA 3LKSA 5BJTA 1SEQL 2FTAA 4I0PA 4Q9RL 5J9PB 1MVUB 2BSRB 1OF2B 3QPQD 4PGBA 2OSWA 3SDAB 2HKHH 1J5DA 2DLTA 4XHJD 1ED3B 3VYOA 4GW4A 4N3TA 5A2CA 2X4TA 5F3BB 4WUUD 2X4UB 2MFNA 3V79C 2IH9A 3NOIA 1D7CA 2CXGA 4WLCA 4L1HA 5DFVD 3WFEL 2CUHA 1B4JH 3NJVA 5K1NA 5EB9A 4M48H 4YSSA 1IAMA 4RAUB 3MROB 5GSRB 1JCKA 1N67A 1J11A 4LKCB 3IJ8A 4X98B 4KRMB 1R3JB 3FO2A 1AO7E 1UM5H 5CIPH 5D7JB 1PZCA 5K93A 3LN4A 3ARFD 2ZQKA 1UENA 2WBJD 3WL9A 4NQDE 4QLRA 1EAQA 2W81C 2ZG1A 3D3VB 3H55A 3MBWA 4K94C 4RZCA 2BY2A 1WBYB 2W0FA 1AD9A 7FABL 3ZIYA 5I1KL 1NFAA 2HFEB 1CGVA 2FGZA 4QRRD 5E2WL 3ZPDA 2Z35A 2IWEA 4ONOA 5FEBA 3M6DA 4DZ8B 1WAEA 2OXGA 4H8WH 4L48A 1RUML 2FIKA 2X4OA 5HGDA 4KUCF 2ISDA 5F89B 1MH5B 2KH2B 3TA4D 1PKQB 1K6QL 1YNLL 1DBBH 3P0YH 4DGUA 1OD9A 3PAUA 1X44A 4OM1L 3CDZB 4HKZA 4AYID 1JZ4A 1VFBB 4L3EB 2PPEA 1WWCA 5CLTA 1NEZB 3B7UX 1D9KD 1NMAL 2H32H 3BH4A 3BGAA 3EOAB 5SWZB 3WS6A 4ZFFB 2Y07H 5DSCA 3VE0B 3D05A 3VGAC 2EDNA 3T8VA 5EU6B 3PABA 5HHQA 3ZHKA 4PGEA 3KJ6H 2YN5A 4WI0B 5BZZA 1FUNA 3IDMA 4HUMB 3PAVA 2N0MA 1LNUA 3T0DA 1AZRA 3C08H 2CGYA 4A67A 5DEFB 5C09D 1T0MB 3IKKA 4AJYV 2ZNWA 1MEXL 3AAZB 3BQUB 4CL7A 3NFNB 5FUOL 5I17B 3AS1A 5T1KA 4ETYA 2B7DT 1R0AL 1PBYA 5EHFA 1EXUB 3AG4B 5KBNC 5LCVL 3NP4A 3OGCA 1S5IL 3CLEL 2B1OA 4HGWB 3T6QC 1YEJL 3C5SA 3G6JA 3KPSA 3PHSA 3ESPA 1LO4H 2JFCA 3IE4A 5MERA 2XWTA 1SJVA 1P7QB 4RVBA 5JHLL 2FSEB 3RNKB 5KEZA 2WVUA 5IBLC 2XQYA 3QISA 5DURD 4H1LB 2WXHA 2AQSA 4IW4C 4XMWA 4ZS7H 1ZXKA 2PR9A 5F0LB 3G04B 3IRZA 1TQVA 4R7DA 4KQ4L 2BY3A 2QSTA 2DQ6A 3AQYA 3QARA 4WZ9A 4B0MM 5KSAB 1G9NH 1NICA 5IM7A 3L7EB 1WT5C 3NIFF 4UV7H 5FO7A 3C5ZA 5I0YA 4HKBA 4Z3HA 1NC4B 4ETQB 4NO0B 3ZDYF 1QBMH 3DXAA 2R29A 1WUNT 3GF8A 3IRPX 3OL2A 3VJ6A 3W81A 2IDCA 4M7LT 5CU9A 3PL6A 1X6LA 5CEZE 1XGPA 1QACA 1WFJA 2AJZB 3BWSA 5C3LD 4U6XB 1QABA 3LMJH 4AL8C 1E30A 2ZX6A 1I7ZB 3GIVA 2KQMA 4JGMA 5GJSL 2AEQH 1PJWA 3PFQA 3VW3H 1L9MA 5MI0B 3DSFL 3L2MA 1P4LB 1U8KB 1ZS8A 3FRUB 3BVWA 4YE4H 2GITA 4MB5A 4Y7OC 5EOCL 4AVJA 3DV4B 4L9LB 5H94A 4X8CA 1M71B 3B6SA 4UMGA 5C0AD 3UG3A 1YEWA 2AJYL 5CCHE 5JPMB 1KTDA 2W9EH 4RQQA 3LNEA 3F7YA 1R1CA 2SODB 1BM7A 1NUGA 3H9ZA 2Q5BA 1TTGA 2KLSA 2LVCA 1A7QL 2YPVA 5EN2A 1NDGA 2QMJA 2PPCA 3HS8A 3K3QA 4P46D 3AU1B 4AZ8A 3ILQC 3MODH 1UACL 3ZRCC 4XC1L 5LXGL 5D1ZB 2XFXA 4LPTA 4BFFA 4K2UL 3VXQA 4YSEA 3RWJB 3B9AA 1KGUA 2QLYA 2XCMC 4R4ND 2BFVH 3SJVB 2A6DB 1HZLA 2VB5A 3MCKA 2J2ZA 3GM0A 4TULH 2DIEA 4ZFOL 3VSTA 2A9NH 2MEJB 2YBRA 1QYGH 3CK0L 3NG5A 4JZJC 4QWWD 4XWOD 4H88H 5D7LA 5F1IA 3DC0A 2CDFB 2BS71 2UY6B 2ZOKA 5EOCJ 3U0WL 1UXWA 3IF1A 3FUNA 3KPPB 5FOJA 3HZVA 4YWGL 1AXTH 3BWUF 2HKFH 1WCQA 3PHAA 4KV5F 5I5JA 5B7EA 3W0WE 5LKNA 1A1NB 3Q9PA 4UUJB 1NJ9B 4PJGA 2V9TA 4IHBA 1TZGL 3EOBA 2NLJB 2XN2A 3V4UH 3DBSA 5GHWL 4WW2B 4LIQL 4PIBA 1IFGA 1JGVL 5KYWB 4A04A 3QXAA 5IJKC 3W56A 1H3PH 3Q5OA 3X12B 3D07A 4E5XA 2Y1VA 4TXVB 1MCWW 2DJ4A 2WWNA 4EI5B 1GS7A 1RZKH 3GDBA 3H4HA 3MJ7A 2A2QT 4ANWA 1J8KA 3OHXA 5IMKB 4Q4IA 1FORL 3MGTA 4JM2C 4WQOA 1Z9SB 1JZ8A 4NBXB 2AFNA 1JK9A 3DMMD 4GXUN 4A55A 1S78C 1RJLA 1YEIL 5EZOL 1IILE 2WIIB 1BLNA 4CJ0A 1UT2A 1X5YA 3GMLB 3ZUCA 4EOWL 3QFJA 4FZ8L 5GQBA 4MXVE 4POYA 2JCCB 3SSGA 1EAPA 3OLDA 3CH1A 2AJUL 5AVZB 3GBNL 2NRDA 4NRZA 1KOAA 1ADQL 3V6FA 43CAA 1I1FB 2BSSB 1ZE3H 1XTLA 2HVBA 2DMBA 2ZX8A 2RGSA 5DRNB 4YHYC 2HT4C 4W4OA 4DUVA 4NYLA 2Q76B 3FOMB 3MNDA 5D1XB 1JRHL 4EN3D 1F86A 5H2BA 2ZF9A 3L81A 5B38A 3ZR5A 1IB5A 3UTOA 3FPXA 3O11A 2CLRA 3MV11 3UAFA 4BZ2A 3GKZA 2EICA 3IDYB 4AT6B 1BZ8A 3CVDA 3QPKA 1R5VA 1OW0C 2VE6A 4N24A 3FQXA 3RL1B 5ISZB 4X80L 4OLYH 1MLCB 2IJ0C 4QXUL 4IGBA 4ZOCA 2ZJSH 1TKWB 4XNMB 4ONGH 5EUOB 3V4VA 4HWZA 4OLUH 2BY0A 1F1GA 3LKOA 1UGNA 3NN8B 1A6VH 3V4PA 5HPMB 3RIAF 1Z5YD 4FXTA 1FLTX 4PJ6A 2CR3A 4R4FH 3MACL 4G6FB 4TN9A 3FUKA 4GKOA 2UYLB 4Y4FA 3BUPA 4LHUB 2NSQA 1ORSA 3WYRA 3NJKA 2N7AA 3QEQA 4K94L 5J12B 2AZUA 4IYKA 1NL0H 2AV7B 3QS3A 5SWQA 43C9B 4WHTA 4JDZA 3GS4A 2Z92A 2KLRA 2WUBL 2H0JA 1CFMA 3D51A 4EUPA 3AXLA 2D2CC 3SPGA 5KBKA 4XMPL 3JWDH 4ZTPH 3O3DA 2E59A 3SKMA 1I1YB 3VFTB 1EJOH 4HLZG 3H9SE 1OT1A 1QLEB 2PF6A 2W9DH 3PV6B 1R33A 1I7TA 4F15B 2GSIA 4MD0A 1IAIM 3ESOA 2VO8A 4AMKH 5FYJE 1ECZA 1UKQA 4Z7UE 4DO5A 1IIIA 3OJMB 1MCLA 4TNEA 1T1XB 2CO7B 1CDJA 4OFYD 4WW1A 4EKXA 2P9RA 2O4EA 2CKBL 3K2KA 5CP7A 2R1YB 1X5FA 3EIFA 3QDHA 2Q8AL 3WJMB 4OZIE 3MRPB 1THCA 5I0VA 1BPVA 1CG9B 5D7SL 1J88A 2EVFA 5IHUH 4QIRA 4JVPA 3UCQA 1NMBH 3MLWL 3ELAT 1MJUH 4LLAA 1Z1WA 2IAAC 2WLJA 3CVHH 3V0AC 4DJMA 4IU2B 4D0DA 1XAKA 3IDJA 3RPIA 2XPYA 1TJHH 1MLBB 2JI2A 4OF5A 1ZMYA 4PBVC 2R0KL 3LAFA 3OX8A 4D9LH 4EXKA 5I0XA 1R3KB 3AACA 1X4ZA 1EO8H 3QCTH 2F53B 2ZPKL 3NA9H 3FCUB 5KVDH 3BKYL 5DJ2B 3QP3A 3ZZQA 4N25A 3RUGF 3VRLE 3D4GA 1YC7A 3IFOA 5C0RH 3BPLB 1T3FA 4TUUA 4CVUA 3EO9H 1ACYL 3RB7A 1SJHA 1KCVH 4MAYB 1KTLB 4A7UA 5C0DB 1XVSA 5AKRA 1S7SB 2H7WA 2DQMA 3R8QA 3R7RA 3TBSB 1F90H 4E9WA 2A9DA 3J8F7 4JJHA 3VB8A 1IC0A 1OP3H 1BREA 1TO4A 4GIOA 5BVPH 4XNYH 1JGEA 1OGAA 2QVTA 3TCLB 1ZT4B 2EQDA 4N5ED 1UM6L 2NUTA 4EZJA 1YYLL 2Z0UA 2LU5A 4GRWH 2QGBA 4Y1AD 3DTXA 2WVSA 3EOYG 2BPBA 3LS4L 4YDKL 4K71C 4I2XA 5HHVL 1MJ7H 4MQXD 3TEZA 4LLUA 4UBDD 5TFSH 1SM3H 4JB9L 1GOHA 2K4AA 1U3HD 4NUGH 2Q2EB 2VW6A 1REIA 4Y16D 2OSLA 4UANA 1DCLA 2HFFB 4G9FE 2W0LA 3K72A 1G4MA 3U4BH 3WMQA 3TT3L 1SUJA 4Q7DA 4PVNA 3F00A 4ZNCD 4I0PB 4Q9QL 1S7VA 3FQRA 2APFA 1EVUA 5EU5A 4JPVL 4AL8L 3BH8A 1N3NA 2BW5A 2DL2A 4PJ8C 1TTFA 2XXGA 4W9CC 4Y19E 1OCOB 2QV2A 4RISL 4X6DB 4FI7A 1T1YA 3NJLA 3POHA 3P2BA 3M07A 4H25B 1NBZB 2EADA 2AK4E 2EJ1A 1HVXA 1XHHA 4PRIB 2QADD 1OB1B 3TO2B 1BW8A 1UXLA 4M43H 4AW4A 3BP4A 4QXWA 1PG7X 4LASL 4KITB 4MCMA 4E42A 2R2HA 3ZGIA 3E2HC 4LFHD 2H2SD 2G5BB 4NBYB 5DS8B 2V8MA 3DK0A 2W0FB 3GJFH 2DI8A 4RRPG 5JW4N 4JY4B 2Y6SC 3E6HB 2GJRA 5BZDA 1YMMA 2B08A 2X4NA 1GCYA 4Y2NA 4YO0B 3VGBA 3BWAA 1E65A 2FNWA 4G9DB 1AO7A 3WHE1 3DURB 5DC2A 3QXVA 3L5HA 2OPCA 5DD1L 3IDGB 1H3TA 5D7KD 4IQHA 3JXAA 3K2IA 4NQDA 3DVGB 1H3WM 3SGDI 1ROCA 3GSWB 2ZOLA 2ROXA 4K9EL 1AXSB 2F15A 3ZMEA 4OV5A 4I77L 1B6DA 1P5VA 3ARBA 2XA8L 5J6HA 4HKZB 1PZAA 2AEIT 1IGMH 3TFBA 1RZ8A 2HVJB 3TN0B 3ZSSA 2AANA 4AQ8C 4MJIB 4RX4D 3B9KC 4Z7NE 2DQGH 3GI8H 1W16A 3QQXA 4HD5A 5DSCB 4DVBA 1ITCA 2XWCA 4EI0A 1FE8L 1E6OH 1VRSA 2XTJC 3Q44A 4M1DH 5E5MB 4EZLA 1OQXA 4NUQA 1LO3L 4OCMC 2ADFH 3NGBC 3VG0L 1N0LA 2J57A 4M00A 3GMPB 3MJGX 2UZPA 3ZKNC 5KWYC 1DQJA 3IJ9A 3WBDA 4OGXH 4IMLB 2Q6WA 1N12A 4JRFA 1F13A 2EH8H 3H42H 4FKEA 3ARFC 4HBQA 4KXDA 3WFHA 2UX6A 3TCTA 4AZUA 3FONB 1T80A 1AS8A 4EDXA 3Q8CA 5AENA 4KROB 5ITFA 5H4YA 4A2DA 4OCYL 1YRKA 3OGCB 2ZP9A 3MUZ1 4BA8A 5J13B 3Q6GH 2I7OA 3C5SB 1YEKL 5DMKA 4MJJA 2MJWA 1X6NA 1JPFA 1YPZE 2IQ9H 3BH9B 3LN5B 3IJYA 4MZIA 2ORBH 5HHXH 5J89A 1AKJD 4B9GA 1W0WA 4PS4L 5IBTH 4J8RA 5C3TA 5FO2A 4PS8A 1EGJL 1CGSH 3CQFA 3RB5A 5EIIA 2F54E 1XF4B 1HS6A 2ZD0A 5LBSA 3T0EB 4JRXD 4DEWA 2PCXA 2V17L 2NY3B 5BUAA 3HB3C 3NCEB 1X5XA 4QJ4B 3QORC 3TV3L 2DLEA 4F7TA 5C97A 3HS0C 1G0XA 3C5ZB 1JUFA 4A66A 2X6AA 3SOBL 3RNQB 3DX0A 3RTQD 4YUEL 1X3DA 2OI9B 4LU5L 3U9WA 5ES4B 1JI1A 4JLRB 1Q1PA 2C3GA 4K9JA 3K7UA 2BERA 1MHEB 1KLGB 1RK0A 3WIIH 3PL6B 3C6LD 4JDEB 5CZXD 1XGPB 2QHRL 3CD4A 2D2OA 3H9HA 3L1FA 3M7OA 4RWHA 5JPNB 1Q9WA 2Z93B 5CO1A 4Y4KB 3MCLH 3KWUA 3QUYC 1TEYA 3ZZLA 1IE5A 4MJ4A 2I9TB 3SKUD 5DVMA 1BQUA 3SDYH 1PNDA 1J9TA 1MF2L 3BRFA 4N3UA 1K5NB 1EMTH 4FHJA 1ZS8B 1N59B 5JXEC 3GIZL 3BFWA 4HXAH 4DW2H 3TYGL 3O3BB 4KI5D 1A65A 2WYTA 2I9LA 2IPTL 3IDIA 3LH2L 2NY0B 4OF7A 3G6DL 1UH4A 4RQQB 1YEEH 2BP8A 5IMOB 3RVUC 5C7XH 4YK4B 1BSIA 3DBXB 4JCMA 4G43A 4DQOL 1XR8A 4AIZA 2WINA 3MJ9L 4X42A 1A5FL 3OPUA 3U2SB 3FJTA 3TJEL 3AJ7A 3SBRA 5CINL 4WIQA 5GZND 2TRHA 3DYPA 1FGNH 4QHUA 4WCYH 3SDCD 4EIZC 1HXYA 3VXQB 5I74C 1FPTL 3ELQA 3O45A 5FM8A 1UGKA 1W80A 2BOCB 4R26H 2R4RL 4XNAA 3N1FC 2ZOWA 3MCKB 4KO6A 2ZOTA 4QTIH 4UQEA 1GYUA 3NCXA 1UWGH 1LE9A 2AHIA 4LLVA 1EO5A 4L4TE 5F6HI 3B3BA 1O9ZA 1I8AA 1G7MB 2WMPA 3MHZA 5D1QA 4CW1A 2VJXA 1MUJA 4I85A 1F18A 3CGTA 1ZHBA 1L4IA 4NT6B 1GOGA 4ZAKA 1L7IH 5T5NG 4AGMA 1RK1B 1A3QA 3FT4A 3L1OL 4E68A 3O2WH 1D2PA 1CU4L 3LZQA 2WZPA 4ALAC 4PB0L 1HT6A 1FBIH 4KHTL 4U7SA 5KJRL 3D4ZA 3DYMA 3S36H 3ZVVA 3VXSE 4BK5A 2OJEA 5I75B 3NBNA 2PYEB 3WNIA 1EHNA 2FUQA 2YRLA 1G9MC 1XSIA 4NQCE 2BK8A 4RBPH 5F8QC 3FO9B 3I3DA 3ETTA 3W0WA 4IKLA 4NDMA 4E5XB 5C0GB 4N2FA 3L6FA 3SCMD 4IU3A 3MKGA 4FQXD 3ECBB 3CSTA 3WUWG 4TUOA 4GIAA 2J43A 3PWVB 4NQVA 4CN4A 1M2VA 2EUXA 3K80A 4HH8A 1EEYA 4KJWC 4BFIA 4JQXA 2WXIA 3V4LA 4ABUA 3OQRA 2Y4SA 1W72A 2JJWA 3FSOA 2R1WA 2ZUUA 4DGWC 1EUUA 4JM4H 4AE1A 1R19A 3VCLA 3QB7C 2ZE0A 5I1AA 1NAMA 4CC4C 1VGEL 2WWKO 3CU1A 4NUJA 2VSCA 3FT9A 3QFJB 2EDQA 4JKPH 4BHUA 3BGFB 3B7RL 3BEWA 1MCJA 3BKJH 5DD0H 3SBQA 1F4XL 3CH1B 5BV7B 1QFHA 2VMCA 3FMGH 2IDQA 4YSRA 1FH5L 5L6YH 2VABA 4ANVA 4MCZB 1C7TA 4MRCA 4N9GA 4OZGE 1L0PA 1WJ3A 2BW4A 2QZ5A 4J4PD 3CH8A 4X6BA 5HVWA 3ABMB 3HBPA 5AD0A 5I1EH 4FQPA 1ETJA 1CFTB 3KYOB 5DT1L 1FL6B 4WUUA 5GISH 1WS7A 2XV3A 3HCVB 4CBPA 4RSVA 4PJ7B 3MLXL 4JO1L 3G9VA 2CLRB 3GXNA 1NFDA 4N6RB 4YSAA 4XR8C 4UAOB 1R5VB 2X6CA 2VE6B 4ODVH 3P9LA 4WO4B 1FVDB 3FQXB 1KB9K 3WS3B 3MREA 1FG9C 3L3GA 4RA0C 1PS3A 4OJFH 3LZRA 1Z32X 1MREH 4AYBA 3LKOB 4J28A 4HUXA 4EQ3A 4ENZA 2IFFH 2R0WL 1WTLA 5F7DB 1Y6KR 2OX5A 5I30H 4J2XA 3TLRA 4NZFA 4DK5A 3B3IB 4MX7B 4QRRA 6TAAA 3V5DB 3WIHA 3LNFA 3RLSA 5CSZB 1Y18B 3BIKA 2CO4A 1QO3B 4B9IA 4U7KA 4WNSA 4DN3H 4AH2B 1CBVH 1MI5E 2E27H 1DJIA 3NRPA 3IJHA 1ZGLP 1S7TA 4DPRA 4U1NB 1H3XA 1O6SA 2J1KA 1AGDA 1L9PA 4YBQC 5DJYA 3UTSE 2R8SH 2VAAB 4PJ9D 5EZJA 4JRYD 2VR7A 3O3DB 1IQDA 4P4KD 1LVEA 4HLEA 5IW1A 3GXPA 2J6WA 4YHLH 4U6TA 1D9KA 4LBEB 3TTSA 2FJGB 4JK0D 3WFCL 1XSKA 2DY2A 2FWSA 1QD0A 1NLDH 1V3JA 4LSDA 5K9OA 5E94A 2CLZB 4KJYA 5ICXB 2GBVA 1OCWH 1H3GA 5HJGA 1M3JA 1YN6B 5I1LA 4ELMB 1UJTA 2W07A 5D2NE 5DEJA 1A1MA 5HJBA 4PN6A 3FTUA 1XB8A 4GT0A 5DR5H 2F7QA 4M5YL 4G82A 5IMMB 4PVLA 4NQED 4OCRH 4X6FB 1QI3A 4LCWD 2YMOA 4Z7UA 2FJHA 2XQ0A 2HLFC 2WQSA 5DZLA 4X7SH 3OX8B 2WVTA 1TITA 2PW1A 5CZKA 4ZNEE 1BD2D 2R56L 5DHEA 4AYEC 4Z7OB 3HC4L 4ORZC 2ICEC 2HLEB 1ZVYA 3MZTA 3O6FD 3QUXB 3S35L 3LEYH 4EF3A 1DQLL 5F6IB 3VFMB 2IAMC 5DHYB 2JELL 3I6KA 4Z76B 4PS7A 3ZX1A 1TVBA 3GSRA 4MNHB 1B4TA 4XCYB 2E9IA 4HS3B 2XV6B 3AWFA 5KANI 1UYWL 1BZ9A 2B0SH 3OMAB 1Z3GH 3NJJA 3EJPA 2NY1C 2ZCZA 3GXUB 4UT9A 4XN9A 2W91A 3QWNA 3HFML 2Y22A 5EEUA 3MRDA 4YHOL 4F8LA 4QOKB 3G5XA 2XVGA 4KNSA 3ULUE 5KSBE 5HYJD 3VNYA 2BCKA 5TE6L 4OCXH 4JZJB 2VLRE 1IGJB 4F91B 3Q1SH 3APMA 4LSTL 4WUKL 3WNKA 5IB3B 2BIPA 2BZDA 2F7IA 1HNFA 3CX5K 4QRPE 1G1OA 4G7YL 3TJPA 4GUQA 5T1JA 3OKKA 1E9OB 4LLUB 2DQEH 3KLDA 5MP6L 2NDFA 3PGCA 4UM9A 2WP3T 4LPCA 3ZR6A 2WO3B 4KMTH 2JQAA 2YKKA 3FSZA 5HHNA 3LRHA 3FOLA 1AHWB 1FVCA 1TNMA 3BC9A 3AS2A 3OR7A 2J88L 5DUPH 4DTGH 3FQRB 3TO4B 3VWKB 3CFDA 2OR8A 1JHTA 4FQCL 5IFAH 3TNMA 3J27A 3PPEA 4KO9A 5D4IA 1LWRA 3BH8B 2VM3A 1QFUH 1AE6H 5E6UB 2FJUB 2OBGA 1BJ1H 3Q2VA 1OE3A 1HQ4A 3B2UC 3OF6A 4FHBD 1EEUA 3HLAB 4G9FA 2GW5A 2PTVA 1I9RL 4HQQH 4W4NA 4P46A 4JM2B 4PJIF 1PLBA 5E9NA 1JZJA 2WV3A 4PY8J 4Y19A 2RIKA 1OV8A 2WUCL 1FCGA 4QR7A 1XEUA 4H26A 4EN2A 2KUTA 2R2HB 2B5IB 1UD8A 4RETB 4FFZL 4LGPB 2QTVA 1OGTA 4Y2DD 2AK4A 3BXNA 5I1HL 2G2PA 4XMLL 3SKNB 5BZDB 5K69A 4O02B 4FNLH 1UD2A 5HHOE 3VTAA 2L4OA 1NOAA 4KMLB 5JIQA 3CZEA 3LY6A 4C83B 3U1SL 2Z4QB 3F85A 4PWFA 1U91B 1V27A 3MRRB 4LEOA 4P48A 8FABA 1KCUH 1BF5A 5JW3H 2Y3AA 2XOTA 2QVKA 5IROD 3UH8A 2A73B 2Z7YA 3C60D 4KTDL 1D5IH 1RPQA 1KN2H 3PLYA 4PRDA 3QNZA 2LTQB 1LP9E 4JCWA 4PRNB 5CBEA 1E4XI 2XN1A 1QAWA 4H8WC 5J6HB 4MTMA 4GO8A 3KBPA 4HU2A 2C5DC 1HILA 3G5WA 2Y3NA 2QTEA 2DD8L 1FNEB 4RFNB 4S1SL 3AUVA 5D71H 4I13B 1M3IA 1UC6A 4EIGB 1JF1A 1LGVA 2VXQA 4KC3B 2BNQD 1JXDA 2NYKA 4YLBA 2BRQA 5IVNA 4PB9H 2FK9A 5I1JL 5I71B 1JZGA 1E0OB 3RIKA 2L7UA 3APNA 1OQOA 1QWNA 4DUWA 2Z31A 4B5EA 3BAEL 2P80A 2MCAA 2GFBB 4I48A 4DPAX 1A4KA 3T65A 5LVEA 1G9ML 1K4CB 1E9QA 4YNYB 3L3OC 2A74B 2BDNH 3EJCA 4H40A 5IVZA 1MNUH 4X0KA 2WPGA 1C7SA 1SLVA 4S2SA 1CYGA 2YA1A 1T03H 3BP5A 1QFOA 4DGIH 3BUYB 3SGKA 3HZYA 4MMZA 4DF9A 5L0QC 1G87A 3H4FA 4C56E 3O4LB 1UZ8B 3INUH 1E28B 1KELH 3N85H 2CBTA 4XP4L 5E1AB 1KPUA 3UBGA 4CILA 3QNXB 3FU9A 1A3RH 2YKLH 1JPFB 1QNZH 1MIEL 2VQTA 2DYPA 2E9WA 2IQAB 4S11A 1FZJB 2XWBA 3MLYH 4U7MA 4YN3A 5D5MF 3VFOA 5DQ9A 3RFZA 4JFEE 2D7MA 4G71B 3THMH 4J8RB 4U1HA 4PBDA 3V5KA 3DETC 3ARQA 4Q4EA 3RY6C 2VDRL 3I84A 2QV4A 1W8OA 3KL0A 1DTUA 4NKIH 4BSJA 1FC2D 4N0RA 4M8RA 1YPZA 5ILTL 3FFCD 5L4FA 1BXAA 5G2NA 3QWOA 3OZ9H 3WNNA 5KW9H 4JFPA 4DGYL 3FU3A 3IS1X 2ICCA 5GRZA 4P23D 4CSSA 3CMOH 1DVFD 1N0XH 4TLSA 3FUIA 5F9OL 5GGRY 2X9XA 4XE5B 4QRSB 3UTZA 2BSTA 1X5GA 5FCUH 4OZFH 4WWKD 5IQNA 3QULA 4Z7WA 2LGNA 3IWVA 1VACB 2Q7AA 4KK6C 4XCFH 3BPOB 4QPEA 5HYIA 5KTEH 5L2KB 3CZSA 3KM1A 4OI8A 6PAZA 4YX2H 4LCCA 2AKRA 5IOPA 1WH0A 4DKEL 2DQTL 2KYIA 2PWFA 4TLUA 3RP1A 4H8QA 5KBMA 3GSOB 2XZCL 4H8PA 4QAWA 4GBXD 3ZT7A 1F8TL 4WI3A 3D34A 1MCKA 1DDTA 2BNUA 4XXDB 5JZ7C 1CFNA 5CCKL 4F58H 1KGYE 1KJVB 2Y2WA 2LLGA 2O5ZH 4GT7A 4NGHL 4DSYA 1BA9A 3OLGA 3HC0B 1XGYL 4QT5B 2W95A 3D52A 1BEXA 1CF1A 2EIDA 1KG0A 1Q9LA 1XSJA 3FCGA 3P77B 4K7PY 5F9WC 1IE4A 4I9XA 2WIMA 5D70H 1W8NA 2DKSA 3L16A 3BVDB 3P0GB 1NCHA 3Q2NA 1PX3A 5K1VA 1HNGA 3KWTA 2W8CA 3X1BA 4D9RE 1AQKH 3QDJE 1E7UA 2HT3C 1NDTA 3FRPB 4YHML 4YZWA 1ZVSB 3VACA 3VGHA 2R83A 3OBAA 1EFXB 1NH6A 3D08A 5FHBL 5ALBL 4G42A 4LEXL 4NNYA 3FU6A 5DHVB 4O2FB 4MFHA 5D1QB 4TUJA 4P3WA 1A0QL 5TF1H 4X5RA 2VMFA 1GY2A 1QRNB 1LE5A 2F8IA 1URIA 3MBEB 2F7PA 4KMQA 1KPVA 4HC1L 3KEHA 3P11H 1TDQA 5I1GL 4BWUA 3KBEA 1A2YA 2CRMA 2WYZA 4L4TA 1TQCB 3L4ZA 2HAZA 3DVIA 1H0DB 3LIZL 1UUSA 3F7VA 3KWVA 4W9GC 4XN5A 1KEGL 2MNJB 3KDPB 1A6ZB 3AY4A 4RMBA 5T1DH 4I0CC 3AGWA 4YXLL 1H6UA 3HUJB 1OWWA 4IU3B 4G80A 4TUOB 1KZYA 4YFLI 3PXLA 1L6PA 3WS6C 3O0RH 3QEHA 4KDWA 5CJQL 3FO1A 1HINL 2A6IA 3G6JF 3KVQA 5FGRA 3VXSA 3RWIA 5AKSA 2ESVB 3FN3A 4HMEA 3KPLA 3O9WD 3U82B 4DETA 5JHDB 2R1WB 4NQCA 4JL1A 4GO6B 2XG4A 4KPHL 4NN6C 1RZKC 4TSBL 4UB0L 4RMWA 3VCLB 1NSNL 1ZS2A 1CGYA 1V8HA 4GG6B 2B59B 2Z64C 4HUVA 1U3HA 2F6AA 2WB7A 4FFTA 5DVNA 1EZSA 4M5ZL 2Y7NA 4XVTH 4XNUH 3DOSB 1T1ZA 3BEWB 1I8IB 4PJXE 3KCPA 5IEHB 2NXZB 1BBDL 4LSUL 1FZOA 1J1XH 4HKXB 4UDTB 3DRTB 5F21B 1KY6A 4B96A 1DJSA 1TENA 3IU3B 4OF6A 3BN9D 4WWID 2P5EB 3GI9L 3CNKA 3K4AA 4JKNA 4PW4A 4UT6A 3SY0B 1W0VB 1ACXA 3P4OA 4GAAA 1YNKL 2W0KA 4HFWA 3EG9A 3OKOA 4OCNC 4AX3A 3LZFH 4PSRA 5DRZB 3NGBB 3MBXH 1SBBA 5IVXA 2X88A 2QPDB 4LOFA 2NSMA 4OZGA 1NFDB 2H6PA 3VXMD 3CN4A 3REWA 3MRMB 5E8OA 2YSSA 4BZ1H 4DIXA 3ARFB 3IJEA 2WBJB 4X5PA 3OKEB 3H54A 1RSFA 4QGTA 3ETBJ 5FLUA 4JE4B 4QTHB 3BWZA 2QJDA 3KZ8A 1YQVH 3O3EB 1JYWA 1MJJA 1IMHC 1HHKB 3B5TA 1N64L 2IH8A 4ORGB 1WCBB 4QRRB 4FXGA 1EEZB 1LMKA 5BW7A 5I16B 4BKTC 4EI6B 3HVNA 4OFVA 3WY2A 1OWRM 4JPQA 3VX1A 4OT1H 2VLKD 2CDEA 5A6IA 5IG7A 1KJ3H 3ML8A 25C8L 3A4DA 2FYYA 2BNRE 2HJFB 3PGFL 4NZUH 4KZDH 1S7TB 2VMJA 2B8OT 3BSHA 5FHAL 3EDEA 1A6AA 1JK8A 1TCMA 2J3SA 2DZEA 5HDBE 3V0IA 1FNGA 4YXHH 1RL1A 2AC0A 3TFKD 2PTTB 4N0CD 3H0TA 5J3HC 1BAGA 2WQRA 3F58L 4LPUA 2YEQA 4UTBH 1FNFA 3WKMH 3GQFA 3FUDA 2F1BA 4LEBA 5AYUH 3OXRA 1WZMA 4LL4A 4O51A 4DHLA 3K8MA 2FD6H 3GSNH 3ILPB 2UZYA 3EH4B 1IGYB 4KJYB 3UTSA 3FTGB 4CVZB 3MV8E 4ZUWA 2QQLH 4PBXA 2FB4H 4K7PL 2YXVA 4EZKA 2KL6A 1JGLL 5LGJA 3N43B 3CG8A 5FGCB 1G4RA 3Q05A 3MRCA 2AI0H 5C09B 5LWYL 3X14A 3FT2B 4UV4L 5GIRA 1G94A 4HUWB 2EVIA 1QSED 4HEPA 1OTSD 4JFQA 4ZD3H 3M1CA 2ALAA 4OKVB 2FJHB 1AOZA 4TPRL 2PP8A 4N8VB 3FHQA 2PCYA 2ZUYA 3UBHA 3DYOA 1VZHA 5D2NA 4MAUL 2EEXA 1IEAB 2DYRB 3WJJC 4P9ML 1AP2B 1K8IA 1LTXA 3B9EA 1WITA 1V7MH 3KAAA 2ZX9A 3VDCA 2HG5B 4MHHI 2ZXCA 1C08A 1XL4A 4TNGA 5E8EB 1AKJA 4YDLC 5GRVL 4L23A 5DURB 5IOKA 4NO2B 3F6LA 3KD4A 3I9AA 4ZNEA 3EGSA 4GSUA 4UYPA 4YHIB 5T3ZH 2YFOA 3MRKA 4JRXA 2XWJA 3KWWA 1ZLVK 5TE4L 2JKSA 1NEZG 1ZTXE 3I50H 4OZ4A 2AV1B 5L7XH 3FQWB 1H5BA 1OSZB 3WG7B 4HJ1A 2ZCHL 3EDFA 1XMEB 3RTQA 4H0IA 2GTZA 3U30B 1D6VL 4U1LB 5E9DE 2F0CA 3QQ9C 1NGYA 4MCNA 5C0NC 1M7UA 4FJYA 1VFUA 2BWIA 1RHHB 2APXA 3TBWA 5J11C 3IN2A 1G7PA 4PJ7F 1G7JA 2FBJH 3UP1A 1XH1A 1KIRA 4G8FA 1IL1B 3SKOA 1QTSA 2WYIA 2VLRA 5AW2B 4APQC 4IIZA 2VXSL 2MQ3A 2GKIA 1Z0MA 1FA4A 2X7LB 3FOLB 5JUEL 3MLRH 1SQMA 1ZJBA 4MQ7A 4QRPA 1M7IB 2WLIA 4E9VA 3KVDD 4P2RD 3BMWA 5E6IC 4KQ3L 4N28A 2XKUA 4K15A 3SDDA 5C0AB 3OC5A 4OIIH 3NSCA 2J8HA 5CZVH 2GVYA 35C8H 2Q10A 3MRJA 3S35X 1RSYA 2UVFA 3V95A 3VX0A 4H1LG 1AGBA 4F3FA 3BGMA 4HK3J 1E4KA 4M6AA 3MLTB 3AC0A 4ATWA 4MMXA 3HPLB 5C0CE 4L8BA 1LLAA 4KRNA 4KZCA 3CVIL 4WTQA 5JOPD 5BS0E 2WC7A 3KGSA 3QUMB 3ULVE 2XVLA 3JT2A 4GXVL 1CL7H 5KSVB 4GKZA 3MR9B 5F88A 1DLHA 1PCXA 3GDCA 1N6QH 5B7FA 1QPKA 2B1AL 2YC1A 2EUZA 5LBGA 3JTTA 4CN6A 1NUFA 3BQVA 5C07E 1GGBL 2DH3A 3CUPA 4TVSa 2EYRA 3MOAL 2VJ0A 1FNLA 4XPBH 3MA9L 1GGIH 4WK0B 1GKEA 4X5WA 1OP5H 4AQEB 3QNZB 4ELMF 1BFVH 1I7RB 1DSFH 3II2A 4YHZL 1CE6A 3MLUL 1WK0A 3N1GC 4IOSD 1ZLWK 4AUYA 2GCYA 2IF7A 5C2BH 2GUYA 4PWEA 4UQ2B 2FT8A 4OF8A 1ZEAL 4FQXA 3TVMA 4EMZA 1LP9A 1ZRUA 4HIEB 3ULSB 5I6OA 4MDJA 1T66D 3RJOA 4Q6IB 4TVPE 3MFFB 3E3QC 3TZVC 5C8JA 1SMDA 4G5ZH 3LNIA 3N1QC 5B8CC 1SHXA 1SOSA 3DMMB 5FKAA 3IGLA 2WOYA 2GAZA 1FDLH 5IVZB 3IFPA 4CSZA 5I8KH 1QI4A 2WVVB 4HIIB 3RVXC 4NN7C 1HWGB 3FUJA 3UJJL 3HE6D 1EBAA 1KB5B 4BSVB 4GAJL 1YEFH 3GGWA 3MRNA 3UX9B 3VDBA 3E1F1 3S5LB 1I3GH 1CL7I 1OAXL 4KJPD 4R8WH 3GYRA 3GC3A 4AK2A 2HCZX 5ALCH 2X38A 2CIKB 3BP6B 1HXMB 4D94A 4ZO8A 2OM5A 1OO2A 5BOJA 1FSKC 3MXWH 1WDAA 3V9CA 4C58B 4XMUA 5EV7A 4EN3B 4U1HB 5AYTA 3RGVA 1BVOA 2FZ3A 2WXPA 4C56A 1NQBA 2NQCA 2OJZL 5DFAA 2G5RA 3DJ9A 4FQ1L 4F7CB 4UNUA 2CJUH 4KXAA 1SJMA 4XNBA 3JV0A 1HHJA 1I8UA 1HH9B 2FLMA 1RZ7H 3FW6A 3MJ8A 3F12A 3QPXH 4JFEA 4M7KL 4XCEB 4LLQA 3C6EA 4O2CB 3RAJL 5LJYH 5EMYA 1BV8A 3F83A 1JYVA 2JJUA 3UTZB 2V5TA 5AW6B 1H15A 3MLSL 3ULUH 1B0GB 1TEGA 1L9SA 2Y7QB 3NSDA 3QULB 5ESVA 4Z7WB 2BMKA 4ZBJA 5G5DB 4ZODA 3QO0B 4M1CC 1Z3RA 3S9DB 4AKQA 1OANA 1RIHL 5I26A 5DRXB 4PGDA 2AK1H 2OL3A 5DTFB 2CDGB 3W5NA 2PUQT 3K6FA 1ZHNA 3AG1B 3Q6FA 4V1DE 4HX1A 4Z95H 4NKOA 5DJ8B 1RLWA 1KBVA 3II3A 2R29L 3U0TA 3SE3A 2DTML 1MFMA 3NESA 4JRYA 3PWNA 3SN6N 4PRBB 2YZ8A 2D0FA 1BVNT 1XBDA 2QQNL 1I53A 2DM2A 1LD9B 3GMRA 1YMHB 4H2AA 2FH8A 1CVRA 2VDNH 1UB6A 5FYLE 3MAWA 3JUYA 1KG0B 1BVLB 2XZAL 4KJQD 5JA9A 3FCTA 2P5WE 3JT0A 3QCVL 2EDRA 5EEWA 3FBQA 2WWMD 3VH8B 4F57H 1T2QL 5E2VL 3O6LH 3T4AA 4PJHB 4PJEE 1A22B 4LCWA 3GINA 4G42B 4R90H 1DVFC 2NYZA 2YPVL 4IBZA 3OKNA 3AT9A 5LGYA 1FYHB 1BD2A 1VFAB 3KXFD 1P0SE 1V05A 3H3BC 3PXHA 5MEPB 3PUUA 4DZBA 1I8KB 3O6FA 3L95A 1E67A 4LHUG 2VZUA 4NQXB 1II4E 3RY5A 2CE6A 2IDFA 3WFBL 1JNLH 3AUWB 3OWEA 2E4FA 2NT1A 3O2DH 4RMUA 4YEEA 4X9FA 2AJXH 3R1GH 5FR3A 5KYNA 2XLLA 3NABH 4JZOB 5IY5B 2GJPA 1X4YA 1WZ1H 4GAGL 1G6RH 3ARBC 2FE0A 3CBKB 2NTFB 4HCRH 5EH1A 3JV6B 2IG2L 2FWLB 3UBXI 3QG7H 3GK8H 4OLWL 3CZGA 2ZXGA 5JOEA 1ANUA 3PDDA 4LGRB 4O58L 1SXNA 5E8PA 4B95C 3RTLA 5CIPB 3SE9L 3W9DA 1HIMH 4AEIL 4Z7IA 4S1DD 4UQDA 5BZWB 1AJ7H 1HOCB 4ZX3A 4Y1AB 3KPLB 1E5CA 3IB4A 4MJ5B 4OFKA 4BSWA 3BVUA 4X5QA 4HS6A 1KJ2H 3GB7B 2Q0ZX 4Y16B 2E9JA 3Q8EA 1QVOB 3O8XD 1YYMH 3V0FA 1CGWA 5B3JF 2HFGL 2OXHA 1AHKA 2EYSB 2H9GA 3GPSA 3T6ZA 3CE1A 4HU8A 5FFLA 2OJ1A 4XZUB 5FK9A 5LB1A 5GGQL 3C5JA 4JFDD 3WSQL 4JHWL 3GBLA 4GMSL 3P4OB 5JHMA 1J5IA 4V11A 1KXTB 2IH3A 4NI6A 2ITFA 4PJXA 1UVQB 2H32B 3L3DB 1W6LA 4TKWA 3MYZA 1EUTA 2V37A 1DE4B 1R17A 3MJWA 4M1GL 1CLZL 2G75A 4M7LL 4PGJA 3DRQA 5E8OB 1ML0A 4TNWK 5EZLA 4JHBA 5F7YC 2WXOA 3SDXA 3IJEB 3MU3A 4XNXH 3S3BB 2G9HB 3KPMA 4QO1A 3T2NL 1Q9OB 2NNAA 3SGEH 4A7QA 4U1JA 1CDCA 2C9UA 2IH1B 4HSAC 3CHXA 2K7QA 5L0QB 4Y2DA 4JREB 1MVFA 3K8LA 5LNDA 3BZ4B 5T3XD 2E9BA 1FAIL 4WNQA 4AV5A 3QJQB 1UOVA 4I3RH 4BZ2L 2YHGA 2G4GA 3MLVH 5SV4A 2HN7B 3EYVA 5I5MA 3KPNB 5C0IB 3FTZA 4W6YB 2FYYB 2ITDA 2AXHA 5IROA 3ZE2F 1BAWA 2PN5A 3V4VL 4NO3A 5IK3A 5E56A 4WU5A 1A6AB 3GWJA 3S8WA 2JKRM 3T08A 1FNGB 2DMCA 3RI5F 3V4PL 2NOYA 1XGUA 3H3PH 5IB4A 1OP9A 3WU1A 2W60A 4GRLD 5I66A 2FYVA 3TWCL 2XU9A 2BNRA 5TTRA 2UWEA 4F2FA 4HZAA 5T3ZD 4NO5B 5LQBH 2BNQA 1CTNA 3IDXL 4YGVA 3H56A 3IKCA 2BINA 2NZ9D 5H37A 1TU2B 3RWGA 1RUPH 1M57B 4DEPC 3FT0A 1Q4NX 1MY5A 4MXQC 1FL5A 1BMGA 3D85A 1D5ZA 2E74C 4HD9A 4L5FE 4ZX6A 2YAEA 5C0BE 3ESUF 4JFQB 2BOBA 2BVYA 3MV8A 4I3SL 4HPHA 4WKZA 3CFEB 3SGEI 3ZMNA 1DHKA 3HUJF 3WELA 4BE6A 3WN5A 2SEBB 3UO1H 5JHAA 2HRGA 3ZDXE 4KAQH 2GTQA 3KBHE 2EILB 3CZFB 2R0ZH 3N41F 1AKJB 3DK2A 5DRWA 1IGTB 4JX0A 3ZL1A 1U3JA 1OCZB 1BP3B 4WI8A 1TJXA 1PYWB 1YJDH 2QVIA 4JGNA 2BX5A 2I07B 3KWWB 3GT6A 2PO6A 4QD2E 1C1EL 5DQDH 4BK5C 1NIBA 1QQDA 2CO3A 4NRXA 5FECB 3RIFK 4GG8A 4CMMA 3VD3A 3EJZD 4LO9A 4F2ME 2ITEA 1JHLL 2BC4B 4FLQA 1HCFX 5A3IC 5ITBH 4RGMB 5AOMA 5HI5C 3HHSA 5GJTH 4KKCC 5A2AA 4WWKA 3C6LB 4PPTA 4ADGA 3TS8A 4MXVF 1GTFA 3HNSH 3NH7L 3NIDB 4ONHA 1CO1A 4G8FB 4K7PX 4F2EA 5I8CA 2G5UA 1T7WA 2W94A 4K3EL 1BQLL 2F5AH 4OY9A 1NFDF 2AJ3B 1D5MB 2C3VA 3BKCH 3FFDA 4JO4H 3VFSB 2O5XH 2PLTA 4N6QA 4HS8H 4Q0XL 1CDUA 3GEWB 3S37L 1MI5D 2J7LA 4N2LA 2HVKA 3MRFA 1U8QB 2QSCL 2QELA 3B4NA 1IGFL 1O9VA 1P6FA 2IPUG 2WN3A 4J3OC 4B41A 5EEZA 2XQYG 4MNGB 1BAFH 1AGBB 5EORH 1HHGA 4MMXB 3RVVD 4IRSC 5DD3H 2DWEB 3SDCB 3NQKA 5E08L 4OAWA 5E4EB 1P7HL 4ABVA 1A14L 2ADJA 2K78A 1BG1A 1EK3A 4JHAL 4ZPVA 1OY3B 3BE1H 2VDOH 1MCFA 1NCUA 1BVKA 2B77A 4WJKB 1NCNA 2CGRH 3FQNB 2OTWA 3DROA 5DK3A 4CDHA 5C0CA 2JB5H 1P6WA 1ZLVH 1Z9LA 3MO1B 3HJEA 1CICA 1M9WA 1BYNA 4TYUA 1L5GB 4J39A 3CZNA 4E9XA 4JN2B 2HMIC 4X6CA 4KKQA 4R4BB 4IMKA 1CE6B 1T6BX 3TEWA 3EUDA 4ZZKA 3PY9A 4XRCB 1E3ZA 1SXAA 4OD3L 3LVEA 1AR1D 1RZPA 1B3JA 3A23A 4M6MH 2D3NA 3M88A 4Z7UF 2IGFL 1A1OB 2FR4A 3PQYE 2XICA 3SCMB 4FQXB 2CM6A 4M4RB 4Z7AA 2QPUA 4NKDB 4AUUA 3V5HB 1G1KA 5INDB 2C9QA 4ZYKA 3HG3A 4FKHA 1J86A 2H1PH 3CX2A 2DMHA 3L7FA 4M61A 4UTAH 4BH8B 2ED8A 1MCDA 3N50A 4W93A 1SOKA 3US9A 3D06A 4EVNB 3IFPB 5CJ8A 3WXWH 4IS6B 3EYUL 4AXWA 1CQKA 3APCA 1JMXA 3I02A 3NIFE 3B43A 3RPBA 4KNQA 4BXVA 3H7BA 3HMWL 3X3FH 3ZDYE 3PF2A 2E7MA 1RZIA 1QHPA 2P7TB 3SQOH 4MXWL 2P8PA 2PCFA 4HUCA 3V8OA 2IV8A 4RWYL 5I18L 1NAKH 4C4BA 4A39A 3MRLA 5DEGA 5J56B 4MVBD 3QUHA 2NW3B 3BLKA 3ZE1B 3FB7B 4IKJA 1INEH 2C26A 4NWTH 3EYFB 3VFVB 3R06B 2J1ZA 5E2TL 5E2JA 4A7GA 1FH2A 2BIMA 4ODBD 1L0YA 4HWBA 2YR3A 2WQXA 4BBWA 2DWTA 3QCUL 2D7TH 4XPHH 2IC2A 1QBLH 3DVNA 3WDIA 5IWLA 3O41A 5J1AB 1FN4A 1DN2A 3MJ8B 4UM8A 4E5XG 4R96A 4HZ1A 3BP7B 4Y9BA 1MRCH 2F58H 3EO1B 5D2LE 5GZOD 2BIHA 2D31B 2JIXD 1BF8A 1CXEA 2F19H 2G3MA 4RAHA 4P2QE 1MWAA 3CZUB 1BVZA 2XYBA 5LBSL 4U33A 1PKOA 3CVHB 5I76A 4UDUB 4DP4X 3DOHA 2A77H 1GHFH 2YPLD 4ZMLA 4YDLB 3A22A 5I19H 2VRKA 4LRIA 2Q86B 1A8ZA 4XPGH 4LPVA 5D1ZI 2MWCA 3CHRA 1IM3A 2K9FB 4OSUL 1OAKL 1YECH 5ABAA 1QUNA 4XVSH 4PJ9B 5TDPB 5F1NA 4JRYB 5E2UL 4B9JA 4P4KB 4GYBA 1HYSD 1U95B 1KN4H 3C2AL 1XIWD 4KJPC 1AGEB 3QIBD 4K3JL 1K2DA 4OCSH 3L5XL 3K6SA 1S5HB 3GMMA 2J72A 1Z7JA 4ZSOE 1LDPL 1SBSL 5EC1A 3RVWD 3EHBC 1MG3C 1T0OA 2AVGA 2EDKA 4LARH 3B37A 1P4BL 1CFQA 4LSSH 3DX6A 1OAQH 1GIGL 3GMQA 1J0ZA 2VOTA 3CCHA 3GLZA 3U4KA 5J11B 4F92B 4JPWH 5CEZL 1BQSA 3MFGB 3SQBB 1E3XA 2J56A 1AY1L 3QYCA 3SBWC 1J1PH 4FQIH 2GSGA 3LB6D 2XXFA 4GRWB 3RWFA 2JKTM 5IHBA 3BHBB 4NQEB 3RA7L 1GMEA 2VISA 4DVRL 1KBGH 4K07A 5KVEL 4LVNB 3WEBA 4UZUA 1YN7A 4X9YA 2P5WA 3CFJA 1Z5LB 3TBVA 1BD2B 2H8PB 2YGPA 3GPEA 5DZJA 3RL2B 3O6FB 4UOZA 3QO1A 3GTVA 4OLZH 4KTEL 4OM0H 3BVTA 3E6FA 1I9JH 3VUAA 3KLAA 4HF5L 5I73C 2ZUWA 3L2NA 3RKDC 3KYAA 3STZB 2O5NA 4Z5RB 2MMXA 4HOZA 3QI9A 4Z7NF 5IEKB 2A9BA 3MNZA 1D5XB 4RFOH 1Q94B 4BCYA 4XH2A 2E75C 3NJGA 3UDWA 2YMXH 3QIUD 4MA1B 3ZKMD 3O6ML 2IVFC 4B97A 2WWOA 3DGGA 3J2PA 5HYJB 2NY5H 4PJAB 3G5ZA 1EHLL 4LF3A 2Y0SA 2F18A 4F27A 5AOKA 2ZCLH 4BKLA 1SEQH 4M6NL 2CH8A 3GJFB 4Q9RH 4Y5VC 1J8HE 2Z31C 4BSWB 3HPJB 5IQOA 3N42F 4ODXB 5EZPA 4JFHE 3QG6B 4JDVB 4N90D 4DP0X 5IJVA 4XBEL 1DUZA 4ZMXA 4HMDA 2VLMD 3WFEH 2EECA 1YPZF 2ENPA 3D6GA 4XAKE 2OMZB 2WXKA 2UX7A 1V3KA 5CU5A 1W72L 4MMZC 3AREA 5LGKA 1O6TA 3EH2A 5LAPA 1A6TB 4Z77B 1NAML 4G7RB 3KS0J 1PSKL 2FECL 3NSYA 2YD2A 3BD3A 4Z7WF 2XVKA 4ZS6C 3TZVB 1NPJA 2A6KB 4U3XA 5INCB 7FABH 3F7PC 2NW2A 1ZVNA 3F8UB 5I1KH 4TNFA 4LXFA 5E2WH 3FK3A 1XFPA 3CSGA 4ODWA 3O3AA 3OR6B 4U1IA 3VFPB 1RUMH 4WTZA 3OSKA 1QRKA 1TJGL 2Z34A 4O2EA 3BPNB 4Q9BA 1NGXA 2NXYD 3SKJL 3HNVH 2GK0A 1NPUA 5TPWL 1YNLH 1K6QH 5DD6A 4F7EB 3CFMA 5FX3A 2EUVA 2ROYA 3CDGA 4OM1H 2CBMA 4NWUL 3MUGB 5HHMB 2YLHA 3IRCA 2P44B 1T4KA 4I8DA 3QRLA 1FNHA 1FO0A 1FSKB 3I74A 3PWPD 1NMAH 4WDIB 1WBXA 4P5TA 1Q9KB 4ZMAT 5CEXA 2X9WA 3C60B 4NO3B 2NY2C 4ZK8A 4KI1A 3QIWD 4YBHA 4CVXA 2XRAL 1E8WA 4LCCC 3GUTA 2OMWB 1TTUA 1SDYA 4LNRB 3KGTA 1E6JL 4GQZA 2FRGP 2QGDA 4XVUC 3WIHL 5IB5A 1VCBC 5E7FA 3KLLA 1DJXA 4E41E 2UWEB 2WBKA 4IOFC 5AB0A 5FGBA 5CMAB 2BNQB 2YARA 1MEXH 1HZKA 4R2GC 3LKNA 4GMTL 2FO4A 3RUGE 3I6SA 2HH0L 3N44F 4HWEL 2ZG2A 4L37B 1OGPA 5LCVH 2F1EA 4PLJD 1S5IH 3CLEH 2PWHA 1RJYA 4FQ2L 4JFOB 3EO0B 3M7FB 3KMDA 1YEJH 3T2PA 2Z91A 3VFWA 1ZLUH 4AUJA 1F6LL 4LOUC 2N7SA 3II1A 3CFKA 5JHLH 2AS5M 1OB0A 5KVGH 1QFWL 4GAFB 1NMCB 4P04A 2DKUA 4TQIA 3TIEA 2P5PA 1U4EA 2ZKHL 4WY7L 1PY4A 5T1LD 1FFOA 2O30A 2Z7WA 4N68A 2Z7UA 3BAKA 4JFUA 4JFSA 2EH7L 3BMVA 2X4RB 3FQUA 4FLOA 3RVTC 1T1WB 5C0BA 1CIUA 2V2XB 4PYGA 1EDYA 2VJ8A 4CUCA 5FYJL 1NIEA 1ZIBA 3D0VA 3J7HA 4BFNA 1NC2D 1MFEL 1SZNA 5D72L 1N7ML 2ODHA 3FTXA 1CT8A 5F3HB 2JXMA 4LL1A 4FQHA 1Y0LB 3FFCB 5EU4B 1OARL 3AY4C 3MNWA 4Y5XC 1SF5A 1ZA3A 3EFOB 2DQDL 3P4MA 4PLKD 4MBRA 3UMTA 4D8PB 4ENED 1CLYH 1PL3A 1D5RA 2EE9A 3HRPA 1DVFB 4P23B 5GJSH 1MN4A 4ATTA 5EPMB 1YAIA 3DSFH 2AXWA 4NN5C 4YPJA 5CWSA 4JJ5B 2VLJD 5DCCA 1YNTB 3U9PL 1B0RA 5ADOL 1YLBB 4YHKL 4UT9L 3RZCC 3L4CA 5EOCH 5LN8A 2PTUA 3SD5A 3QJSB 4PYHA 5IVXF 3LRKA 2AJYH 1DSWA 4OZGF 3BJLA 3MRGB 2QPEB 5C71A 1WA1X 4I1NB 5ICZA 3EOTL 3E9TA 3EJJX 5F71A 1A7QH 3U2IA 5ICYB 4BFOA 1B90A 2ARJQ 4GBXB 1WICA 4B60A 5E1QA 1UACH 4PCKA 2ERJC 1MXDA 4XC1H 1PF3A 5LXGH 4MWFB 3BEVB 4G8EA 1KFAL 2HVKB 2Y69B 1IQWL 2I32A 5L88L 3NCBB 1G7LA 1KT2B 5DLML 1VKXA 4ADJA 4ZQKB 5E8DL 3QJHB 3US1A 2C3XA 3CK0H 3WO3B 1UQSB 4HIPA 4OTXH 5EIIG 3N5AA 3S3SA 1RXLA 2VZOA 3NCCB 3WUWA 4RNRA 3U0WH 5CD3B 3IYLW 4NX0A 2R2EA 3DNKA 4R84A 5H35B 4PWJA 2P43B 4XMKL 4EE2A 4PJCE 2IEPA 2EVGA 2GBTA 4JY6A 1BVKB 2N0KA 3OKLA 2VDQL 4XVJL 2IO5A 2UUDK 4MZ2A 1TZGH 1AG6A 5GHWH 5DO2D 4LIQH 3U0PA 3OKDB 5E0QA 3HA0A 1R5IA 2NMSA 1JGVH 3NEOA 4KK5D 2UZXB 4JFYA 2BVPA 3BD4A 4YSTA 4WFED 2GK2A 4QUOA 1B88A 2ZKMX 5DK2B 2IXQA 4X6CB 2OMTB 3FCSA 3FSWA 1EWHA 3N2JA 2EDEA 4OR1A 1MW0A 3K1DA 4LCIL 4RH4A 2KLTA 3T4YA 2ZX5A 5JORA 4YAQB 3CSFA 1BYOA 3LVTA 4WJ5B 2RCSL 1T5XB 1YEIH 4F5CE 4UNVA 4ZUTB 4ELKA 3ZTEA 5BXFB 1NIFA 5IQLA 3S37X 3B7SA 4G1MA 2OMYA 1UT9A 4FZ8H 1GS8A 2EE0A 3MA7B 4ZYKB 2YQ3A 4N1HB 1NGZA 4PREA 4A37A 3VWJA 3VI4B 2AJUH 3O9WB 3GBNH 4M3KB 1ADQH 2B9AA 3PQYA 4V33A 5F1OB 1ACCA 4PVMA 2OP4L 2X1WL 1U8IB 2EDHA 5CSGA 3IGUA 4PV8A 5IHHA 3STLB 2DDQL 2VXQL 4HUUA 1AGCA 1I4FA 1JRHH 1U8NA 3WIFA 2RD0A 3IWUA 4KWUA 4KK9D 1RZIB 2H3NB 4YS4A 4ZXBA 2PCFB 4L4VD 4OBSA 5D2NC 1B2WL 4ZMWA 1EFQA 2F61A 1DANT 4X80H 2K0RA 3WFDH 4QXUH 3ZU8A 4GAYB 2YAOA 4HJIA 4IM8A 5LBVA 4HH9B 3IGFA 3QHFL 1L9TA 2L3BA 4LLYA 4KVNL 4PEEA 1CDBA 4DEPB 2GBUA 1RMFL 3VXMB 4BH7A 1IM9D 2GT9B 3LYRA 3MACH 3RYMA 4WFHE 2UXTA 3D3VE 2Z4TA 1JWSB 3L4XA 4PWHA 5K9JL 4UM8B 1K4DA 4A38A 3LEXA 1RPKA 2DH2A 3EGXA 1S3KL 4K94H 3VXPA 4NZTL 4S1RL 2ENYA 1H5BC 3PUCA 4ZUUB 5J5EA 1E90A 1YY8B 1A4JA 2VDMB 4UOW1 4DP7X 4KI5F 3INOA 1YUHB 2GPZA 2WOBA 2WUBH 4MLSA 3HHMA 5I76B 2DQHL 1LO5A 3IAPA 2NR6A 4XMPH 2YOAA 2VLKB 4DH2A 3QFDB 4UU9A 3T77B 3ULUC 5D2LA 1WPCA 2XBDA 5A16B 4KKLD 1F3JB 1XT5A 3F7QA 2LU7A 1AD0A 1HI6B 3HR5B 3O4OB 4G8GD 2E6JA 2DLFL 4G59C 4L3EE 3BSZA 4M8QA 4P2QA 1HJCA 4W9DC 1F4YL 1T0PB 1FJ1B 3W37A 5SWZE 1H8OA 1CD8A 1JRHI 4AKOA 1RFDL 3BW9B 4KX7A 2CKBH 4WGVB 2Q8AH 1R3LB 3VI3B 1E9PA 2C9XA 5D7SH 3ARDD 1T21A 3SDDC 5EC1B 5EU6E 3MLWH 4IBQA 3T3PB 2Y7SA 3OAWA 4GXFA 3NSXA 3B34A 5IFJB 2R0KH 3PHOA 4XB3A 1CK0L 2IAND 2OCCB 1IVTA 1T4WA 1K85A 4HJTA 4MRBA 1KIPB 1S8DB 3OWRA 2R9HC 4ZSOA 1TJIL 5FDWA 2ZPKH 2O6CA 3D25B 5JYLA 3HRZB 5AKVA 3BKYH 1QSEB 1A9BB 4MCYA 3F7RA 1DLFL 3K6DA 2ADIA 3QJOA 5GGVY 3CFJB 4XP9L 2WAQA 3D30A 1ACYH 2PNDA 3TBVB 1IGIL 1A3LL 1PZ3A 4GW1B 1L0XA 1LP9F 1MCNA 2B3RA 3NEXA 1ZANL 2WNGA 3DX7A 4FEMA 5A7EA 1OCRB 4PRHD 1UASA 3KLAB 3QYMA 3OZKA 5E1HB 4EZMA 1HCZA 3GS0A 4NP4L 1IARB 2OCJA 4J3BA 4IRSB 1UM6H 2QKIA 1IEBA 4K0OA 5DK0A 1UD4A 1DEEA 1YYLH 5GRXG 5BO0D 3UYPA 2X0UA 3LS4H 4YDKH 1JV2B 1FC1A 5HHVH 3QDGE 5IMLA 4E36A 4JB9H 1U2YA 3WEOA 3WTUA 5CILL 1KBWA 3T6XA 2XZQL 3VSUA 3VXUD 4D7PA 3N1PC 5FA3A 3Q2LA 1LEKA 3TNNA 3BZEB 4QRUB 5DEZA 4PP1C 1F3DJ 3NA4A 3TT3H 4MA3A 1WBZB 3TBBA 4Q9QH 4NCC1 5KYXB 1IBGL 4JPVH 1BFSA 3ZE1F 1B4JL 1VADB 3G5VA 3RX5A 4AL8H 3DX1A 5FLVA 1ZT7B 4RISH 3W11C 1C8QA 4XPFL 5F7AA 5TDOB 2C7UA 3PWJA 3M1BA 2JWYA 1D2OA 2NNCA 1LEGA 4B53A 5IFHL 4N8VG 4NCDA 4RAVA 4FA6A 2BP0A 4AITA 1J8HA 3NJHA 5MEQB 4P2RB 5AW3B 5CD5C 3TBYA 5BRZE 5FUCE 4LASH 4YZFF 4ESKA 2YRZA 3L4VA 3WNLA 1JGDA 3QXUA 1U8HB 5ESQA 5J6GB 3QS2A 3CLWA 2WBWB 2X6UA 4Y7MA 3ZBMA 4OIBA 2ZXQA 2EDLA 3RGVC 4JANB 4FFVC 2K70A 1OTUC 2WNKA 4G7SB 5DJDB 2I5YL 3RWDA 3H9SB 3S5YA 3SJVE 4ODWB 5DD1H 3UJTL 3P0YL 3BIAX 5L2JA 1WA2X 2YD5A 4UT6L 3ZE0B 4WV1A 5FGSA 2VDKL 2GUOA 3MRBB 5IUSA 4K9EH 1NGXB 2F8VA 4A6YA 1FV1A 1QWUA 4I77H 2Q20A 4DP8X 2XA8H 1FHNA 3CDGB 1YEHL 2Y07L 4XNQA 3L4WA 3PWLA 5C0EA 4OZIB 4A63A 4OQTH 5DJ0B 3A4AA 3WFDL 1ZT1A 4CGTA 3B7YA 1TCRB 3T0BA 4E9LA 2APBA 3HG1D 5TGBB 2R2BB 2X6BA 1FE8H 3O2VH 3C08L 3SGJA 1HWWA 3D0AA 1LO3H 1ZHKA 5ANMB 5KJ4A 3VG0H 4KXCA 4IHOA 1Q8MA 3RRQA 3SE3C 2VUOA 3QEUB 1U42A 2PXYC 1QZ1A 1U8JA 2J21A 3BPCA 2N56A 1M9SA 1N10A 4HT1L 1LEIA 2DRUA 3QDAA 4RLDA 1QA9A 3QAZB 2CU9A 5D6CB 5ENWA 3UTQB 2KT6A 1NKGA 5LNGA 2IPKB 2DQUL 1YEKH 2X2HA 2Z91B 4OZFB 4ZS7L 3FT3B 3VFWB 4NQTA 1EQWA 2JCCE 2PWGA 1X9UA 1YDPB 2I7SA 2NY7L 3CAFA 4G7VL 4JG9A 1B9ZA 3HE6B 5GGTL 1SPDA 4PS4H 3T4AC 1XF5A 5KBDA 4JPSA 1WQVT 3ARGC 1V7NH 2O61A 5IT2L 2WSKA 5GGVL 4PJAF 1OPOA 2FO1A 2AXFA 5D1XE 1D6EB 2V17H 4Q56A 3LQZA 3CSYA 3TV3H 4X99A 3NZSA 2P28B 3D5OF 2ZF8A 1KNOA 1NIDA 3EGDB 3K6OA 4LLDA 1JV5A 3WDHA 4Z3FA 3SOBH 1RZQA 4NOFA 5C6PB 4YUEH 1BBJB 5E6RB 4PRAB 3GMNA 2EO9A 2ZT9C 1KXVA 5ISZE 4O5LH 3VTTA 2X9YA 1TZOA 3ARUA 4L3FA 3OJDB 4L8DB 4OLEA 2JXMB 4MAZA 1Z9MA 4R9HA 5EUOE 4WKXA 1W0YT 4FQHB 2QHRH 3VW3L 4NLHA 3NK4A 1DFBL 4D8OA 1F02I 1AZCA 3P4MB 1VDGA 4ZDHA 3LH9A 2F8XC 1X9RA 5GZOA 3JBG7 4AYGA 1GGCL 5I9QB 1T0NA 1BWWA 4Q2ZA 1MF2H 5EU3A 2Y1YA 4HHGA 3LJ3A 4PJIE 5E5UB 4NUMA 4TTDD 1SYVB 3GIZH 3G08A 4X50A 3EAKA 3TYGH 3Q5TA 1NCCL 2IALB 3P73A 5C0FA 2IPTH 3LH2H 4TVUA 3Q06A 2XXMB 3G6DH 1KEML 2BIOA 4HJGA 5F96L 5ICZB 4K23H 3DX8A 1J9RA 3WJLC 5E6SB 3DUUA 3HI5L 4APXB 4DQOH 3F65A 3MJ9H 4IIQC 4JAMA 3SDXF 1A5FH 4ZTOL 2Q7YB 3FUHA 4Y4KD 3TJEH 4YMPA 3Q48A 5CINH 2EDDA 3PIQA 3EADA 4YFEA 3S5LG 1GL4B 1UADC 1XIWA 1FPTH 4XBPA 1ZWIA 1XZWA 2WXNA 5CR1A 3DX3A 1OE1A 2X4QB 2R4RH 12E8L 1G7LB 2ARJB 3H2QA 4QHKJ 4FQLL 3RWEB 3MTRA 3TIDA 3CIAA 2F7OA 4XC3L 1C5DB 3BAJA 3HAEA 5FKPA 4J8QA 4AC2A 5JIMA 3V7AG 1YAZA 3QZPA 1AQDB 3N40P 4Y5VB 5HSFA 3MUUA 3QRBA 1R5WA 1XGQA 5DZVA 4ODHL 1S9WA 3ARVA 5FB8B 1U93A 1XBRA 2DIAA 5B1BB 4AG4L 4LVEA 4MJ6A 4NQSB 5HYSB 3L1OH 2HWZL 3OXSA 1FZMA 2GYSA 4JFFE 3OKLB 1CU4H 1UJ3A 2BS9A 3OSVA 3QZWB 4YLCA 4PB0H 4XOEA 5AAPA 3UACA 1KF9B 4KHTH 5FA4A 2UWEF 3GZOA 1RIUL 1D7FA 1SN2A 3KXFB 4EPSA 4LCUB 3A67L 2F53E 4X5XA 2RQEA 4L8CA 3UERA 5HDBF 3T09A 2UXGA 1JDCA 3CC5B 2BVPB 3IDNA 2VC2L 1Q1JL 4KU1A 4PJCA 3V6ZA 3WEXB 5IHZB 2EO1A 3OM3B 3C6SA 3IM1A 3JWNG 5JNYA 5IR1A 2IXQB 3BYTA 4NSKA 4A68A 4AEFA 2D03L 5ESAA 1LMIA 4IEFA 5HGBB 4RSYA 4LVOB 1CQYA 1FVEA 5E24E 5T8IA 3TT1L 3SZ6A 4AMXA 2RALA 3T8XA 4CMHC 4O4YL 3S96A 3VGEA 1DR9A 5CGYC 3PDOA 5DC9B 1LK2B 5F0MB 4E0RA 1F4AA 1VGEH 1IKNA 1XGRA 3P2DA 4NNXB 2DWDB 3UG5A 4PVBA 1PIGA 1TZIA 1AZZC 4FI6A 2OMYB 4G1MB 4LHQB 1H6FA 3Q0HA 4WI9A 5D4HA 5F7LB 1KLFA 4A7TA 5BVJA 1F4XH 2CNZA 1FH5H 4F5CA 3DKHA 2E7LA 1MCWM 2JKJA 3CXHJ 2Y5EA 5DT1H 3LV3B 3M8OL 3N55A 4MDIA 4PV8B 4U6VL 3DVFA 2XA3A 3VYNA 2K9UA 4PD4J 1KJMA 1TQSA 3O8XB 2H26B 3Q43A 4NHUA 3U4EA 2VIRB 4TL4A 1QKZL 2VW7A 3MLXH 1N5AA 4JO1H 1F41A 3QUZD 4DCQB 1S9KC 1QLFB 1ASPA 2FL5A 3QQ4A 4DO4A 3ZTJG 3K4DA 4HKJB 5D7EA 1JTPA 4JFDB 4X6DE 3VFRA 4AGNA 5IW6A 1R24A 3X17A 3SPJA 4CU7A 1S7UB 3WN5C 1ONQA 1WRFA 4GW5B 1A4BA 1OF0A 2O6PA 1QSFD 5EO0B 2GTWA 5J9PA 4Z7QF 1MVUA 1WF5A 1OF2A 2BSRA 4NRYA 3NJMA 4PRIE 2R0WH 4LLYB 3SDAA 5IQ9B 1UKTA 1ED3A 1T20B 3H6JA 1ILUA 3Q9QA 4BH7B 5F3BA 2X4UA 3GSNB 4BFBD 1A6WL 3ZTDC 5CJBA 3SE8H 3QNYA 2B39A 2PO6C 2FHCA 2ZYIA 2CG9X 4RAUA 4R7XA 1A7RL 5GSRA 1XH2A 4LKCA 5DQJB 3VXPB 3JWDL 4X98A 2CAKA 5KYUB 1JL8A 2J6EL 3FZUC 1Z9PA 5D7JA 4K7FB 3KPRD 2J5LB 5FYKE 3JTSB 4N86A 2KPWA 1KTCA 1WBYA 1CDYA 3PWPA 5MHSD 3SYAA 3P0VL 3R0NA 4XZ4A 3TGXA 2HFEA 4XXWC 5KZCD 4ZZFA 4MQSB 3WFCH 3A6BL 3MV9D 4P5MB 4FQQB 1RUKL 3BUDA 1HX0A 1DO6A 4DZ8A 2FGWL 4MJIE 3UPRB 4QHMA 1T7XA 5IBLD 2D4FA 1L7TL 4GRLB 5F89A 4H8HA 3K4ZA 1MJUL 1MH5A 1VPOL 3MV7D 4Y5XB 1PKQA 5ETUB 1F58L 3TASA 4U3SB 4D9LL 3CDZA 4K3DL 1H3UA 2OL3L 1VFBA 1E5UI 1IVLA 2P45B 4RESB 3UYOD 1JSYA 3N9GL 5BQ7B 3U6RB 1NEZA 1BFTA 1DVZA 2GJ6D 5SWZA 3EOAA 3LD8B 3ULVF 4D2NA 4QRFA 5ID0A 4ZFFA 2YD0A 1RURH 4TS6A 4Y1TA 4L29B 1V3MA 3VE0A 2R56H 5CHNB 3KYKL 3RDTC 3HC4H 5EBLB 4X6CF 5EU6A 1A7BA 2APTA 1AR2A 1IC4L 2YJLA 5FDWB 3S35H 1DQLH 3ZQXA 2WCPA 4WI0A 4LFHG 2JELH 1TT6A 5DJZB 3VD5A 3PPSA 2VN7A 4XP5L 3FUEA 1UYWH 4KH9A 5DEFA 2GSMB 5T1LA 1T0MA 4I3GA 2MCPL 4XHQA 3NFNA 1JPST 4LVHB 5I17A 3SEPA 2R59A 3HFMH 4YHOH 2HG0A 4ZX5A 1NKRA 1EXUA 1S6NA 3CDFA 3OQ3B 3FSAA 2I25N 2JTDA 1CICC 4HJUA 4JQIA 1KGCD 4LE8A 3ULVC 2NDGA 2WM0A 1KTJA 2CHDA 3WHE0 5TE6H 1W8EA 8PAZA 1UTDA 3T0EE 3ARRA 1J0JA 2YD8A 1PLGL 2MPVA 4HG4K