3G04B

Crystal structure of the tsh receptor in complex with a thyroid-stimulating autoantibody
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
215
Chain Sequence
QVQLVQSGAEVKKPGESLKISCRGSGYRFTSYWINWVRQLPGKGLEWMGRIDPTDSYTNYSPSFKGHVTVSADKSINTAYLQWSSLKASDTGMYYCARLEPGYSSTWSVNWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN THYROID STIMULATING AUTOANTIBODY M22 LIGHT CHAIN
publication title Crystal structure of the TSH receptor in complex with a thyroid-stimulating autoantibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 215
sequence length 221
ec nomenclature
pdb deposition date 2009-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g04B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g04B01
3CX5K 5L2KD 3ZDZE 4G9DB 4HUXA 1ZWIB 4JRXE 4OCLC 4XZUA 2NY2C 2VLKD 5BQ7B 1IZJA 2YMXL 2AEQH 1JGVL 1BZ7B 4LIQL 1FG2A 3DV6B 2EYRA 3BQUC 4H25B 1NCDL 4S2SB 4TSBH 1N0XH 1VACA 3C60A 5B38G 5FO9B 4OLYL 1JNHA 1KCUH 2Z0BA 2E5EA 4WUKL 1T7XA 2IAND 3QUKB 3QUXB 1ZANL 4YIQB 1PD6A 1MEXH 3INUH 3QDGA 4BKLA 4Q97A 3QUYB 3QI9D 1DQDH 3O4LA 2XZQL 1UJ3A 2DM7A 5HYSB 3NFNB 3VD7A 3MRQA 1N6VA 3BRDA 3NN8A 2X40A 4PGBB 1VADA 3W9EA 3VFMB 1F02I 1I1YB 4GXVL 2IAMC 4WWID 5AAMA 3ARBC 1CGTA 4UQ2A 1CICC 1U8JB 3DUSB 5JQ6L 2VXVL 1ONQB 4HJ0C 4X7CC 3LQMA 3VXME 1L4IA 2BHZA 2HVKA 3TT3H 2FH8A 3TH3T 2MOVA 3CH1A 1IGJA 4RZCB 3FOMB 3UTSB 2P45B 3TIDB 5H35B 5L8LB 1U3HB 4HAGA 3BZDA 1BOGB 4IIQA 2IPKB 2FSEB 2IADB 2PKDA 3QXAA 3A67H 1VEPA 5C07B 2HFEA 4LLAA 2ZPKL 4P2OA 32C2B 5FKAA 4I2XB 1OQXA 2MHAA 4CDGC 5KSUA 5DVLA 5ADPH 4KRPD 5B38B 3BP6A 3LSOA 2IBZY 1MIEH 3ARFC 4NN5B 3KPPA 4KY1L 1FVDB 3DX7A 2ZSWA 3MA9H 4KH2A 1U93B 4GMTL 1IC7L 3DRTB 3CPLA 1A5FH 4N8VA 5B3JE 5IQ7L 1BZ9B 1NBZB 4GKNA 4UAOC 1S7VB 5SX5K 4J4PD 4KVNL 1MREH 4KQ4L 4M7ZC 4ODUB 1MJJB 1M7DB 2CXGA 5DZOA 4FQ2L 3TO4A 5KN5A 1AIFA 2JJWA 5CEXB 2YPLD 4QHUA 3TCXA 3MJ9H 5MEPA 1JWSA 1S9KC 1YJDC 5C2BL 1TJHH 2O26U 3QWRA 3WUWG 4RCAA 3PQYD 1YECH 3UTZB 1NCWH 4KK9C 3WS3A 3DTXB 5HI4D 4G6FD 5I2IB 4L1DA 1JTTA 3B9KD 1N64L 3AB0C 1INQB 1I8MB 2GSIA 3VFVB 3QB7C 2A74A 4U1HA 4JKKA 1RZKC 3FAXA 1AI1H 3D85B 5DD6A 5JW5A 1ZLWH 1WBZA 4I0CC 4M03A 1IGCL 2DYPB 3QFJD 4NUJB 2F58H 4UT9L 3EDJA 3LEYH 1D5IH 1A4JA 2NPLX 5ESAB 4WFGE 4X5LA 5MEQB 4XVSH 5C0CE 4N1EA 3S35X 4KTDH 4YZFE 3ULUL 4IDJH 3SDAC 1KJ2H 1WF5A 3QWQB 1A21A 1S9WB 3HAEG 3GEWB 2GK0A 3E6FB 4BFEA 4P46B 3MBEC 1BFOB 3SKNA 2FNBA 3OHXB 5E8OA 4ONGH 3ZHDA 5CSZB 3QO1B 2YUXA 3QDJB 3UJTH 4LLWA 3BKJH 1A9BA 5FGRA 2JCCA 1HOCA 3RIFK 4G43B 1U92B 2YA0A 4YK4C 5D7IE 3PWJB 1P69B 1KBGL 4LCUA 2QQQA 1DTUA 5GIRB 3T8XA 4KKAD 4PTTA 2WWKT 3I6LD 4IOIB 4ZTOL 3Q1SH 3MV9A 4MQTB 4Z7QF 2VXSL 4F9LC 2OXGA 1CE6A 1J1OH 4ZAKD 2VDQH 4S1DD 3HAEH 2CSPA 1MJUH 3VH8B 4JY4A 4C56D 3H8NA 4DZ8B 2QKIB 1OP5H 4JB9H 2ZCLL 1HE7A 4TYUA 1NUDA 4RFOL 1I3GH 5DZNA 5L2KB 1G1YA 5KJRL 5D1ZB 1JTOA 5EU6E 3BZFA 2VLKB 4WI2A 4QYOB 3IDNB 1R24A 4GRLC 3QG7L 4WEBH 4YBLC 5HJ3B 1DQQB 1RZ7H 4MVBD 3SBWA 4A2LA 3MLYL 2MKWA 1GCFA 3RWGA 3A6BL 3DVIA 2IANB 3HAEB 1FSKB 3OJMB 2Z92B 2VR5A 5EBMA 3Q0HA 4HGWB 3QI9B 3V9FA 3VDAA 2LE9A 1HILA 4MDJB 5K9QG 3U36A 2AI0L 3TV3H 5D2LF 3GBLA 3GNMH 1UM5H 4MAYD 4S1RH 5HPMA 2W0PA 1J0JA 5IFHL 2EYTB 4Z7WE 1Q1JL 1BWWA 3KGRA 3VDBA 3ARDC 4LSRL 4P3DB 1YYLL 4Z5RB 3WL9A 2AQ1A 3NPSB 4YHPA 5IVXA 1XH3A 5MHSE 4A6YB 4K3EH 5DJ8A 2OSLA 3ZYOA 3QQ3B 1T6WA 4RQQB 4JFDD 1XCTA 2XYCA 4RRPA 2ERJC 4QHNA 4KPHH 4QRTA 3C2AL 2DICA 1ZS8A 3FB8B 1SEQL 7CGTA 3CDFA 5GRXG 4ZXBD 1G9NL 3QBTB 5JDSA 3T2NL 3V4VL 1RIVH 4GBXD 1KPUA 1JPFB 3RX5A 1XIWA 2CKBA 2V5TA 3G5YA 5GRYA 4P4KA 1ZHNA 2X7LB 1U8IB 3QEQE 4YDVA 1QSFD 1J7VR 1AGEB 4JHAH 3ARGA 3EYFA 3QXDA 5T33L 5C86A 3L5XL 4GUPB 2X70B 1AO7E 5DC4B 4Z0XA 4DQOL 3SPVB 3OB0H 5M7QA 4JFFA 3FQXB 4TULL 5L88H 1FBIL 5TE4H 3HKFA 3AREA 1FLRH 3VXTA 3S35L 4UU9B 2B5IB 5I76B 2P8PB 1GOGA 2WIIB 3BWAB 1OPGH 3U83A 5C08A 1MCFA 5I8OL 4M9OA 3NCEB 1MFBH 3ULVL 4NQDE 5HHVH 1NMCB 3PQYB 1QBML 1LE9B 3OR6B 3T0VA 4PFEA 4G6FB 2DQHH 3HI5L 3B9KB 4OZGF 2VQTA 1HK6A 5KSBB 3SJVA 1JGDB 5INCA 3C6SB 5F7WC 1K5NA 4GKSA 3AUVA 5D8JL 4YFEA 5IGXL 1LNUA 5J3HD 1S5HA 3TP4A 4CRPA 2JJTA 3T3MF 3VU2A 4NKDB 4BFIB 4FFWC 4LLMA 3G5VA 5JORB 1HHKB 2WWMD 3OAUH 1A9EB 3B5TA 5IF0B 3JTSB 2W60B 3HNVL 5E4IA 4OIAA 2ZP0T 4YC2C 2PO6B 1MH5B 2AABL 1LEIB 5DFVC 2WM0A 2GJ6E 4LSPL 3MLUH 3ZZ1A 1T89C 1AD9B 3OKOB 1QBAA 4LRNH 4M1GH 1UYWL 4WCYH 3ZKNC 4FA8A 5MEOB 2CKBL 3EOAA 1WVZA 3CDGA 4JFEE 3BVNB 3C5ZA 5FUCC 1B0WA 3GMNB 3MNWA 4A2MA 3QT2A 4KTEL 3HA0A 1QSZA 5D72L 5JW3H 3TBYA 3BSZL 4XVUD 2Z31C 1D5MB 4G8FA 3DECA 4J8RB 5J4MA 2LV4A 4G9DA 3Q5YA 1ZWIA 1IMHC 1YMHB 2K1MA 5BQ7A 4G9FD 3LDBC 4YQXH 3WO4C 1FNSL 4ZS7H 5I1IH 4M48L 4LNRB 4HS3B 3DV6A 7FABH 4S2SA 4H25A 1INDH 5FO9A 5CGMA 3FMGL 4KVCL 3KPNB 1YPZA 1MCKA 3QUKA 2WV3A 3QUXA 4PJHF 4YIQA 5AZ2H 1IC1A 3KLAB 3HB3D 4RMWA 4ZAKB 5GGQL 3QUYA 2VERN 1BVKB 1ROWA 1X7QB 3DXAB 1J12A 3GBMH 2CIKB 1X6NA 1YYML 3GSNL 1M1SA 2WIMA 4OLUL 5HYSA 1N4XH 3NFNA 1CXIA 1DBML 2VNCA 4ODSL 2J3SA 2VAAB 4PGBA 2EDLA 3MXWL 3ESVF 2VZOA 2FIKB 4JM2B 4JFQB 1I1YA 2I5YL 2IF7A 1IE5A 2QQLH 4KJQC 2EEAA 4DGYH 5ALCL 3GIZH 3LN9A 2NY2D 5EUOF 4J3TA 5MENE 1CGYA 1U8JA 3DUSA 2H26B 3BQUD 1ONQA 1B0RB 1MCDA 4OZHB 1BECA 3MLWL 5TE7L 4HMCA 2BOBB 1AFVH 5CZVL 3FOMA 4PJFE 3TIDA 3UTSA 5H35A 1U3HA 3B4NA 1BOGA 4O2CB 4HKXB 4PBXA 2FSEA 2IADA 1U3ZA 4P99A 4M5ZH 1WEJL 5C07A 1VPOL 32C2A 4I2XA 1L7IH 4FMKA 4Y4KC 3EGSB 4WV1B 5B38A 4NGHH 3LKPB 3PG2A 4RMVA 5MP6H 3ARBD 1FVDA 2YRZA 3UX9B 1CICD 3D3VD 5DD0H 1NMAL 5IBTL 1U93A 4QRSB 3WD5H 4HJ0D 3DRTA 2WLZA 1BZ9A 1NBZA 1S7VA 3E3QE 4FQ1L 3EZJB 3O2WL 4JFDB 4ODUA 1MJJA 3KR3L 4U33A 5DYOB 2F15A 1LILA 4L4VB 1CQKA 1R3JB 3MUZ1 5FCUL 3I02B 4ZXBB 3C6LC 4KHXH 1HI6B 1VEOA 3UTZA 1QSFB 3MV11 2CDFB 3DTXA 5I2IA 2AEQL 4KUZH 4NC1C 1L6XA 4WUUB 4M4RA 1QSEE 2EDDA 1INQA 3ARFD 1D6VL 2XN9E 1N0XL 1I8MA 3VFVA 2Y5TB 4M7LT 3L3IB 1KCUL 4CW1B 1MRCH 3D85A 3N1PC 2EE6A 3INUL 1MEXL 4HD9A 3BI9X 4HT1H 2DYPA 4NUJA 4WEMB 3UTTD 1IILE 1QTYT 2YPKB 2I27N 3QFDA 2NZ9C 1WCQA 4XNZC 4NQCD 3VA2C 1ZXQA 4JHWH 5ESAA 5D6DC 4LLUB 5MEQA 2BVQB 3VMNA 2YKLH 4X4ME 3QR2A 4TVPD 3ILPB 1GGCH 1W72H 4QTIH 3FKUS 1S9WA 5TDOA 5SV3A 2KQNA 2HWZH 4D0CB 3CLEL 3E6FA 4TRPH 2WBJC 4U1SB 4P46A 1T3FB 3QDMD 4ELMB 1BFOA 4QY8B 2MWCA 5CWSA 2XG5A 3OHXA 1LP9E 3TT3L 2F8XC 3Q6FB 5CSZA 5DK0B 3QO1A 4OLWH 1DQJB 4QHKJ 1B0GB 3QDJA 1U91B 5CP3A 2FEEI 5KS9E 3L5WB 4G43A 1U92A 5EORH 3PWJA 3WUWA 1MCNA 1G7HB 5HI3C 2YD1A 3A67L 5GIRA 1MQKH 2ATKB 4IOIA 1QRNE 5DJAB 4HPYL 5ADPL 1PEZA 3SDAD 1MIEL 3PV7A 2APWA 6FABH 4HK0B 1J87A 4QNPF 2NZIA 3MA9L 1V3KA 4XX1E 4DZ8A 2QKIA 4R9HA 2H9GB 5D7LE 2XQYK 5D2NB 4U1MB 3MBED 2R0ZH 3DBXB 1A5FL 2XWBB 5L2KA 5EA0H 1X5IA 1MREL 1DVFD 1DQMH 3O6FB 1C16B 2EDKA 2NY5C 2VLKA 5HI5C 1JZ4A 4G9FB 3MLSH 4QYOA 3TWCL 3IDNA 2DJSA 3NFSH 1NFIB 3KPRB 5HJ3A 1DQQA 3WXWH 3VFTB 5IW1B 1BJ1H 1WTGT 3WUZA 1YECL 3CLFL 1TQBC 1NCWL 1MWAH 2IANA 2Z92A 3HAEA 1FZMB 2E7MA 3KWWB 5E24E 4HGWA 2WUBH 3QI9A 4FQIH 4JR9H 3ZDXF 1KENH 3DX9B 3PHQB 4MDJA 2OMNA 4QRRD 2VUOA 4KK5C 1HDMB 5CD3B 4EN3B 4KDTA 1XF3B 3VG0L 3G5XA 2EYTA 2YK1H 2ZCKH 2PUQT 4ZMAT 1IFHH 2F58L 4P3DA 2NTFB 2NY2B 1D5IL 4GRLD 3RQ3A 4H20H 2JJVA 4Z5RA 3ZE2E 1C1EH 3BQUB 3QDHA 4XVSL 2H45A 2GQHA 1H0DB 4PJ9C 4TSCH 5LKNA 4KTDL 3DO3A 4CBPA 4A6YA 4IDJL 1KJ2L 1UT9A 4I18C 3QQ3A 4HF5H 4RQQA 3F65A 5H37G 4PB9H 3MSPA 5C0BB 5IUSA 3FB8A 3KLHC 1MPAH 2FATH 3RP1A 1KYOK 1RUML 4ONGL 3SY0B 4LFHD 2KQMA 1XR8B 4NBXB 4L4JA 1JPFA 4KWUA 2XKUA 3UJTL 3BIKB 4JVPA 1A2YB 3HG1D 3BKJL 2UZXB 2X7LA 1U8IA 3MJ6A 2IAMB 3ARDD 3QCVH 1OTSC 4HK3J 4DFIA 2DI9A 1AGEA 2J6EH 3ARBB 5E95B 2YUZA 4JKWA 1CICB 5FB8B 2V2TA 3RWIB 1AE6H 1KJMB 4GUPA 2X70A 2J8UE 3SPVA 5C8JB 1OAZH 3FQXA 3Q1SL 4GXUM 4J4PA 1P9MC 1RZJC 2AP2A 4UU9A 1J1OL 3SO3C 1YEHH 2P8PA 2VDQL 3QIBC 5IJVA 1MJUL 2WIIA 5D7SH 2E7LC 3BWAA 3T0AA 5EUKA 4OZIE 4JB9L 5H37H 4CU7A 4ODTL 1I3GL 1CXKA 4QLRA 3PQYA 4JEGB 1LE9A 3OR6A 4KI5F 2BXYA 5F7EH 5I1EH 4M7LH 3B9KA 4WEBL 3QJHB 1S7WB 3SDCC 5KSBA 1JGDA 3ARFB 1NL0H 1RZ7L 2VZVA 3C6SA 4TVPH 1NANH 4RIRB 1EFXD 3MA7B 3RDTC 4I3RL 5DI8B 2AEWA 3K4AA 1MVUB 1KTDB 2X4RB 4UAOB 1II4E 3PWVA 3K4ZA 4NKDA 4BFIA 3UTTB 2KL6A 1CXEA 4M7ZB 1KB9K 3TV3L 2OI9C 1RZKH 3O3UN 1HHKA 3GNML 4HBQA 4JN2B 1A9EA 1UM5L 5IF0A 3JTSA 2W60A 4GG6B 4NQCB 2IG2H 4S1RL 1BFVH 2PO6A 3TNNB 1MH5A 2VLRB 1LEIA 1EUTA 5K93A 2P5WE 4NNPH 1E4WH 1AD9A 3OKOA 4D94A 5DWUH 4H5SB 4HPOH 4XMKH 5MEOA 1GPOH 3R8QA 4XNXH 3PNWB 3UROR 1TZIB 3AB0B 1UWGH 2GK2A 3IU4H 3ARSA 1ZMYA 3OX8B 2APVA 3BVNA 3KS0J 3GMNA 4LARH 1ODAA 1DUZB 2GAZB 4O02H 4JCMA 4OSUH 3I3BA 2C5DC 5E1HB 1D5MA 4J8RA 4AYFA 3LKOB 1YMHA 1P1ZB 4FFWD 3FT2B 4KPHL 1TETH 5ABDE 4LNRA 4HS3A 1F97A 2BVYA 4E41E 3RPKA 1KLGB 3Q3GB 3DYMA 3KPSD 5DFVD 3KPNA 4WIQA 2NLJB 2ZUUA 2IC2A 5KOMC 2HFFA 3SDAB 3TYFB 3KLAA 4JHAL 1FV1B 4H1LH 1EERB 4ZAKA 2I26N 4C56A 3WDIA 3TN0C 1BVKA 1X7QA 1C5CH 3PF2A 2CIKA 1SVZA 3MBEB 3N1GC 1FE8H 3KNBA 4WFEE 1X5YA 4GAGH 1H5BC 5L88L 1QFWI 5TE4L 4RGMC 3BMWA 1X4ZA 1FLRL 4V2BA 2VAAA 4JM2A 2FIKA 4JFQA 4LFHG 1OPGL 4PJ5E 1OGAE 1BF2A 4YK4B 3ZKXC 1H3TA 3WNNA 2X4QB 3VW3H 4OIBA 2H26A 2DQJH 1DEEB 5ISZD 1B0RA 1JZ8A 4OZHA 2ZG1A 2DQHL 3MV8E 4WU5B 4DWHA 2BOBA 4F9PC 1RV6X 4QRRB 4M62H 5J8OA 2Q8BH 3K80A 5FDWB 5JXAH 1UM6L 4O2CA 4HKXA 1R0AH 4RGNE 3ZDYE 2PTVA 5BS0B 1QLEH 5IWLC 4HWBA 4G6KH 1EZVX 1ZVSB 5F6HJ 4FQPA 1BD2D 5C9KA 3QUMH 1G0XA 2YD7A 2DQCH 3EGSA 4GRLB 4HK3N 4WV1A 3RI5F 4X7TA 3LKPA 4NJ9H 2E9JA 4YBLB 4PS4H 1CDCA 3I2CH 4X6DB 4GQPH 3P2TA 4P2QD 4QRSA 3MLUL 4OB5H 2AEIT 2J1KA 4LRNL 4WCYL 5D1QC 4NSKB 2OZ4H 4JFDA 2Q76B 2PYEE 4LRIA 5DDHB 4PRIE 4DVRH 3T1FB 1P84J 3QIUC 5DYOA 4C83B 4P2RE 1R3JA 1UKQA 5GS3A 3GIVB 3I02A 4ZXBA 3PE9A 3ARYA 1HI6A 3H9SB 3ARDB 1QSFA 4FTVD 2CDFA 3GI9H 4YQXL 4ZS7L 1IC5H 4Y4KD 1BJMA 4WUUA 4FOMA 2OR9H 4WHTA 1G9EA 5GSVA 1ITBB 2DBLH 4L3ED 3B2UC 2BXZA 2DIBA 2Y5TA 3SO5A 3L3IA 4WDIB 5TE6L 4U6YB 4CW1A 5CKAA 2CH8A 4YZFF 5BOZG 5AZ2L 3QHZL 4G8IB 2X4UA 4RAHA 2EZ0C 2IPUG 3GBML 2OJZH 2Y36H 1RZ8B 2ERJB 2YPKA 1OWRM 1N4XL 5BMFH 4YHMH 1OTUC 1I4FB 4LLUA 2BVQA 1CF8H 2P44B 4GRWE 3JXAA 2EICA 3ILPA 3BD5A 3B83A 5D7IF 4DGYL 2R1WA 4PJDE 3GIZL 5IHLB 1T5WB 3N9GH 3IGAB 4K3HA 4QRQB 2Y9RT 4D0CA 5EU7C 5FGCB 1EFXB 4U1SA 2IMMA 1T3FA 4ELMA 1GC1C 2WAHA 4QY8A 1QR1B 5CD5C 2OTPA 4KMLB 2P47B 1NCBH 3Q6FA 3EJZD 1B0GA 1IAKA 1U91A 3U9PH 3L5WA 2EKSB 1E6OH 1G7HA 2EDFA 4KI5C 3WFHB 1V3JA 2NZ9D 5HHPB 5FM5O 4M5ZL 2XTJC 5FK9B 3L7FB 1ED3A 2ATKA 1L7IL 2R56L 3BAEL 5DJAA 4X5XB 3VWJC 4NGHL 4AEHH 4IJ3C 5MP6L 5GSRB 3VXSE 4HK0A 4TUKH 4YGAB 3JWNC 4UQ3B 4F80A 5IHUH 4UT6H 5FM4A 5DD0L 2H9GA 2WBJD 3CSPA 5D2NA 4U1MA 3WD5L 3GUTB 1MSPA 2G60L 2Z8RA 3DBXA 2XWBA 3V4UH 4OZFH 2BVUA 3FL7A 4U0QB 3B9EA 2XQBL 4OM0L 5DHVB 3DVGB 3EW3B 4R97C 3O6FA 1C16A 2VL5B 1O5DT 5IK3B 3DETD 4G9FA 2VLME 1C7SA 3DWTA 5DURD 4F58H 1NFIA 3KPRA 4OF6A 4QO1A 1T04B 1CS6A 1DL7H 4YC2B 3VFTA 3WIHA 5IW1A 4Z7WF 4KHXL 3KPSB 5HI3D 4HULB 1QKZH 3E8UH 4J3UA 1HIMH 2QQKH 1FZMA 3KWWA 1LO2H 1AXSB 4KUZL 3BEVA 3DX9A 3PHQA 4OCXH 2XNAB 1NC4B 1YEGH 2RR3A 2KH2B 5I1HH 1SVCP 3SOBH 1DANU 1EHAA 1SYVB 2LVCA 1MRCL 1T7ZA 3TEUA 1HDMA 4ZSOB 5CD3A 4EN3A 1XF3A 3MJ8B 4YFDB 3LHPH 4PRDB 5F9OH 2Z31B 1D5ZB 5FOBB 3EYQC 3G5ZB 3T04D 4QEGA 2NTFA 5HI5D 3WO4B 4NT6B 1M05B 4JHWL 5L6YH 3VXRE 3BQUA 4CN6A 1ITCA 1H0DA 5ISZB 4MCYB 2VJXA 5I0ZA 1A7NH 4LHJB 1QFWH 1ZT1B 1GGCL 1W72L 3O3DB 1T1YA 2SEBB 4RMRA 5FYKU 2HTLC 2M2DA 5LQBL 1JNLH 4U6HB 4TRPL 4P4RB 2Q3ZA 4XCEB 5C0BA 4LEOA 2XWJB 3IJSB 2MTPA 5EO0B 5F9WC 4L4TB 3SY0A 1X9QA 4OLWL 2V2WB 1XR8A 1YDPB 1Z9OA 1BD2B 3BIKA 3S9DB 1A2YA 3MRDB 5F7HA 4WTWA 2MCPH 3D25B 2IAMA 5EORL 3ARBA 3GKWH 3F7VB 3TGXA 5I1AB 1CICA 5FB8A 3RWIA 5I15H 1KJMA 2WQRA 1EHNA 3FQNB 4P2QB 1KTKE 1MI5D 1ZA6B 4QCIB 2Q86B 1DZBA 5C8JA 4U3CA 4QRUA 1JYWA 1WUNT 3OKNB 2RB8A 3MX0A 4G6MH 3RWEB 3S7GA 2R0ZL 1Z3GH 1P84K 5IBUG 2HJKB 3BO8B 4NDMB 3KLHD 5EA0L 4OCSL 1WC7B 1DQML 4MXVF 4FTVB 1TTFA 4LDLB 2VABB 3MLSL 1X4YA 3K74B 1NCUA 4Y4KB 3V7AG 3NFSL 3QJHA 2BSTB 1S7WA 1OTSD 5DJYB 3UO1H 3ARFA 4L3EB 1ZSDB 1EAJA 4DFHA 3MA7A 5DI8A 5HYJE 3LAFA 3MUGB 3RVWC 4UDTB 4POZC 1MVUA 1KTDA 2WUBL 2X4RA 4PJIF 4FQIL 4JR9L 1KENL 2YS4A 3UTTA 1IGTB 3WLBB 4ENEC 2EDNA 1NGYA 1RUAL 4X6FB 3QIBD 4JN2A 1YY8B 4NQCA 5DQDH 3IDXL 3C6LB 3F8UB 3TNNA 2YK1L 2VLRA 5CEZD 3KYNB 4WGVB 1IFHL 1JGLH 4OCYL 1NLBH 3MO1B 3DGGB 4H5SA 4K9EH 1FVEA 3SGJC 3PNWA 5DUPH 1TZIA 3SDCD 5LBSH 4URTB 4TSCL 3OX8A 2VXTH 4MZ3A 2VDPH 4MD0B 3KLSA 1DUZA 2GAZA 4WO4C 4WW2F 4BSJA 3T2OA 4LVNC 1FNEB 3LKOA 1P1ZA 4UTBH 3MRRB 3FT2A 3ECBA 2W38A 4DZBB 3GI8H 5LGKA 1G9MC 1B6DA 1B3JA 5EZLB 1MPAL 1IGMH 3G9AB 4HC1H 4XNZB 2C3VB 1DDHB 1KLGA 1OTTC 3Q3GA 4HUKB 3QNYB 4TNWK 2NLJA 3QCVL 3SDAA 3TYFA 3TPKA 3LKQB 2J6EL 2BX5A 4WI8A 5DHYB 1I85C 3KG5A 2HH0L 3SE9H 1AE6L 3V2AR 3W0WE 2OQJB 3S5LG 2WBJB 1G1CA 3MBEA 4JRYB 1FFRA 1OAZL 1YY9C 3GMQB 1S78D 3P11H 2BC4B 35C8H 1YEHL 5JOEA 5D7SL 1JZ6A 5B4MC 3ZHLA 3DX8B 5DURB 2AK4B 2DQEH 1WQVT 2I24N 4QXUH 5C6TH 1N7MH 1HCFX 2FBOJ 4JQIH 3BPOC 3UBXI 1DEEA 5F7EL 5I1EL 2Y25A 1FFOB 1AHWC 1NPUA 4M7LL 4WU5A 1OAXH 5GXBB 1CU4H 1NL0L 4F9LA 4QRRA 4TVPL 4X7EC 4HUMB 4HMEA 1MCLA 5E2WH 1KJ3H 5FDWA 3LS4H 3IRPX 4P9HH 4LCIH 5BS0A 5T5FL 4EVNB 3CSYB 1ZVSA 1RZKL 4KXZI 3D9AH 3AMKA 4GRLA 3PGFL 2IG2L 3ORJA 5EZJA 1BFVL 5BZDB 1KCVH 3R06B 4X6DA 4JZOB 3IXTB 4JQVC 1TQBB 2IBGA 1E4WL 3L3HB 5DWUL 3S5LB 4HPOL 4XMKL 1X6LA 4NSKA 1GPOL 2F8VA 4XNXL 2Q76A 1DBJH 4FQJH 5DDHA 3T1FA 4C83A 2F19H 4KQ3L 5C0EA 3L95B 1CFQB 1ADQH 3EBAA 4HUVB 3GIVA 4TUOB 4LARL 3DMMD 3M8OL 1WFTA 4O02L 4XI5C 4OSUL 5JOPD 4PREA 1FRGH 1W0WA 4AG4H 2BY1A 3D48R 4PJCF 4WFFE 5GRUH 3H9SA 3ARDA 4S0TD 1RUKH 3KYAA 4M4PA 2F54D 3OG4B 2D7QA 1KEML 1C5DB 1XMWA 1KOAA 3GJFK 4PJ9B 4WDIA 5IHZB 3VGAC 1BM3L 4P0DA 2K7QA 5T3XD 4HMDA 3FT4B 3CVHH 4O9HH 4NJAH 5DVMA 4I18B 2FEEL 3GGWB 5D1QD 3TBVA 1C5CL 3UMTA 1FE8L 3QIUD 1RZ8A 3TCLB 3OAZH 4GAGL 2K9UA 3U4BH 1I4FA 5EZOH 5C7XH 2HVJB 3KDMB 5HGBB 4FQCH 5CEZH 3MRPB 2A6KB 1T5WA 3IGAA 2YZ1A 3VW3L 4EI5C 1EFXA 1EO5A 1CDIA 3WFDH 1MJ8H 1QR1A 3VDCA 3B2UD 4I0PC 3KYMB 1JP5A 1BBDL 3GJEB 4BK4A 4M62L 2C1PB 1F3DH 3SO3B 1OP3H 2EZ0D 2Q8BL 2EKSA 2C1OB 2CRYA 4OFIA 3B43A 1R0AL 3WFHA 3FN3A 5HHPA 1QLEL 5DQ9B 4G6KL 4KJPC 1OTUD 3L7FA 5KZCD 1K85A 2D9CA 2FGZA 2NXYD 3QUML 4X5XA 1U42A 2DQCL 4OCRH 5EIIB 4NJ9L 5GSRA 3SDCB 4PS4L 2R29L 3OAYH 4UQ3A 4XPBH 3FONB 1P53A 4JGUA 1R3KB 1YMME 4FG6C 5EU3B 5J13C 3RDTB 3GUTA 4YXLH 5CD5D 4M7KH 2YZ8A 3KYKH 2OZ4L 1IC4H 2C7UB 3DVGA 5E2UH 4DVRL 2VL5A 2OI9B 1U41A 5IK3A 2CDGB 2AJSH 2C4FU 5HHMD 1XGTB 1T04A 3OKMB 4D8PB 5ESQB 4KI5D 5GZOC 3V52H 3KPSA 3I9GH 3EOTH 1RIHH 3P9LB 2HRLA 1P7HL 1T89A 1AXSA 3GI9L 3H9HB 1IC5L 3NFPB 2XNAA 1NC4A 3RL2B 4H26B 2DBLL 4OF8A 3RGVC 3QULB 4WW2C 2F74B 4ZSOA 3V7MA 4EXKA 2XKNB 4MNHB 4PRDA 4FN0A 1GGBL 1BF8A 2FZ3B 1D5ZA 2QHRH 5FOBA 3G5ZA 4EDWH 2Y36L 3RWHA 5FIEA 5DFWH 5T1MB 1UWXH 3NIFF 4NT6A 4YHML 1M05A 2LVEA 3AAZB 4JRXD 3VD4A 2V5RA 3W9DB 1CF8L 5ISZA 4MCYA 5SWSE 1QO3B 1NFDB 1IT9L 43CAB 4WWKC 1ZT1A 3O3DA 3T09A 1F6FB 1WLHA 4HWZB 3N9GL 4LCWE 3PDOB 4LBEB 4ZD3H 2AJYH 2X44D 4PJXE 3TN0B 2QBWA 1MCWW 4U6HA 1OD7A 4P4RA 4XWGH 4MXQD 4XCEA 2J8UF 2XWJA 3IJSA 3WJJC 1NCBL 1H5BB 5EO0A 4RGMB 2V2WA 4RWHA 2MNUA 1YDPA 4XBPB 2A9NH 1BD2A 4LF3B 5F71A 3MRDA 1F5WA 1S3KH 4C59B 1OP5K 2EIBA 3D25A 3ZSSA 1V05A 5BRZD 1IEBB 3ZKXB 1NEUA 2AAVA 1RFDH 5I1AA 1FQ9C 4P49A 4OLXH 2UWEE 3FQNA 4P2QA 1ZA6A 5GGRB 4QCIA 2Q86A 3NBNA 2AXFB 3QQ9D 3WV0A 5T3ZD 4DOHE 3X3GH 2KZ1B 1BREA 4QRPD 3OKNA 1O0VA 5FYKE 1EHLH 3GRWH 2HTLD 4TUKL 4F37K 4KXZH 3S4SG 5IHUL 1ND0B 4UT6L 15C8H 1WZMA 4LSTL 3E3QC 2YPVH 3RWEA 3KPOB 3V4UL 2HJKA 2AJXH 3BO8A 4NDMA 4OV6F 3HR5B 1WC7A 1CG9B 4JLRB 4KMTL 5JDJA 4FTVA 2VABA 4Y4KA 3LKNB 2FBJL 3PDDA 1YQVH 4L8SC 4DAGH 4F58L 5HHXH 2BSTA 3JBG7 5DJYA 1DL7L 1U8NB 3JV6B 4L3EA 1NUFA 4KKCC 1ZSDA 4PJBE 2VDMH 1QKZL 3E8UL 1HIML 1NSNH 2QQKL 1RULH 3MUGA 1LO2L 3RTQC 4UDTA 4ZDHB 5HHOE 3T0EE 5D1QB 4OCXL 3MCKB 1YEGL 1IGTA 1P4LB 3WLBA 5I1HL 2YA2A 4L8DB 2H1PH 3QIUB 4X6FA 5D6CB 3SOBL 1YY8A 5KW9H 1Z9LA 2G9HB 5E6ZA 1ZHLB 5AZEH 3C6LA 3LHPL 5DRNB 3BP4B 5F9OL 1J0ZA 5ID0B 1GHFH 3KYNA 1FZKA 2LABA 1X5HA 2I25N 3TFKD 1FLTX 4OUUB 2WUCH 5L6YL 2JK5A 4X8XA 5IB2B 1CDHA 3OJ2C 1MHEB 1A7NL 3TJHD 1QFWL 4MD0A 4U7KA 3N1MC 1QACA 3O6MH 1UGNA 1QOKA 4J3OC 1LGVA 3RVWD 4POZD 2FLBT 3FO9B 1JNLL 4LU5L 3AFLA 1TVBB 2NX5E 4NZTH 1FNEA 3V95A 3MRRA 3UPRB 4DZBA 2Y23A 5EZLA 1U8HB 1LEGB 5BV7H 2C3VA 5J11C 2L7JA 4X6CF 1DDHA 2LFGA 5F8QC 5B21A 3QNYA 3L9RB 3VG9C 4O2FB 2MCPL 1MCRA 4ESKA 3LKQA 4WFGD 1QR4A 5GGTH 2BNUB 5C0CD 3GKWL 2DQGL 2VLJE 1T03H 1KELL 2YHGA 4MNGB 5I15L 2MQCA 4LHUD 4PRPE 4PTUA 2WBJA 1KG0B 4JRYA 2EH7H 1UADC 4NCC1 1FJ1B 2PW2A 2QJDA 3GMQA 3LZFH 4U1GC 3K2MC 3CZJA 4HC1A 2BNQE 4WO4D 3OWEA 1IM9D 4G6ML 3MR9B 3DX8A 1Z3GL 1I1FB 5E70A 1MNUH 3ZKSD 1A6VH 4I8DA 2XTJB 4HFWB 1CLYH 4LDOB 5ALBH 1OTTD 1JIBA 1FFOA 4DCQB 3PP3K 3VWJB 1N0LA 1HHGB 4IJ3B 2BZDA 2HTKC 2NY7H 5ESVB 1WGOA 3UAJC 1FORL 1YY9D 5FYJU 4K8RC 1VFBB 4EVNA 3DLQR 1MCEA 4R97B 5F7NC 2FX8H 2FR4B 3G08B 2DTMH 2P1YA 3MFFB 5B4MD 1S9VB 2ZNXA 2X1PA 3HCVA 1TJGH 4JRXB 5BZDA 3R06A 4JZOA 3IXTA 1WWBX 1JGLL 2AJVH 1NLBL 3L3HA 3S5LA 4LIQE 3TLRA 4JM4H 4F57H 1BJ1J 5DUPL 5T3ZH 1XAUA 5LBSL 4XBGB 3O2VH 3QCUL 4TUJB 4ETYA 1FYTD 3NCBB 2D7MA 2VXTL 3EHBC 3L95A 1CFQA 3DX6B 4HUVA 1EEYB 4NOBA 4TUOA 1I9RH 4YUEH 3B9DA 1Q9WB 3T2QA 1FDLH 1V7ML 5GGSY 3A0OA 1RY7B 3EO1B 4UTBL 3GI8L 5DK3A 4F7TB 1IGML 4HC1L 4BUHA 1MFCH 1C5DA 5IQ9B 4PJHA 4S11A 4W6WB 4PJ9A 5IVXF 2GTWB 5I1KH 5IHZA 1GXEA 5HD8C 1T66D 4QRPB 2E3VA 3FT4A 2MKLC 1ADQA 3WNKA 2GI7A 4I18A 3VXMB 5HVGB 3SE9L 3GGWA 2BCKB 3BPCB 3ZL4H 3TCLA 5T1KD 2AV7B 1RIUH 1BIHA 3N1QC 5F9WB 2KKQA 35C8L 2YD6A 2HVJA 4BA8A 4K7FA 3KDMA 5HGBA 4ERSH 3C09C 5H94B 2DQEL 3MRPA 2A6KA 1LK3H 1E28A 2XXMB 1N7ML 5C6TL 4IM8A 4QHLB 2NY5L 4JQIL 4RGOH 1A8JH 4AZ8A 1J05A 4OM1H 4Y2DC 5I74C 2AGJH 4XAKD 4LHUG 3KYMA 1OAXL 4HS8H 1HZHH 3GJEA 1P9MA 3MMEB 5FV1L 2C1PA 1EMTH 3QIBA 3HPLB 1FPTH 3RUGE 2E7LA 5E2WL 1KJ3L 2C1OA 2VL4A 1KSRA 4LCIL 4MQ7B 4N8PA 4NHUB 5EPMB 5DQ9A 4K7PH 5E1AB 3QA3B 3QDGE 3D9AL 4ZUWB 4NQEE 5EIIA 2P43B 3B5GA 1GZPB 3B8YA 2A83B 1I1RA 3RVTD 3SDCA 1MHCB 1VFAB 3FONA 1R3KA 5EU3A 3GDBA 3CIQA 3RDTA 2JLLA 3ETBF 1DBJL 2C7UA 4FQJL 3DPBA 3KLDA 4LSSH 1XF2B 4MB3A 1E4JA 2CDGA 2F19L 3FCTB 2A6JB 1ADQL 1F6LL 1GGUA 4HIEB 4LNVA 2X89A 4F2MB 1XGTA 4MS8D 3OKMA 4D8PA 5ESQA 1F3JB 1CD9B 1FRGL 4QGTA 3P9LA 4YHKH 4AG4L 1BFSA 5GRUL 1IAII 2MQ0A 1WFUA 1NGXA 1JI1A 4I3SH 1RUKL 4ONFL 5C0CB 3NFPA 3WHXB 3T08A 4LHUB 1QFHA 3MFGB 1INEH 3RL2A 1OLZA 2VQUA 4H26A 3S37X 3ULUE 5LAXB 3O3EA 1JUFB 4I13B 1QFUH 2F74A 4FG6D 4BELD 3MLTB 3ALPA 3CVHL 4MNHA 1UQSB 4NJAL 1FAKT 4O9HL 1I3RB 1KLUB 1P7QB 2WQ8A 4WO4B 1IM9B 2BNRD 2FZ3A 1BFTA 4J3VA 4LVNB 1KPRB 1D6EB 2I9LB 5T1MA 3HZMB 3T0DA 3BE1H 3U4BL 3AAZA 1ULVA 5D7IB 5C7XL 2X4NB 3W9DA 3F7QA 5GZOD 3RIFF 1QO3A 1NFDA 3MOAH 1C08B 4PJ8D 43CAA 3NIGE 4C4KT 5GQBA 1B90A 5CEZL 4HWZA 2YRLA 1LO4H 4LBEA 5HHNB 3TN0A 3DO7B 3U0WH 3WFDL 1MJ8L 1VHPA 3RGVD 1SQ2N 4BSWB 1K4CB 2OX5A 2C9AA 3NA9H 4KK6C 1H5BA 4PV8B 2CMRH 4BQCA 2VKXA 5CLWA 4XBPA 3D69B 4LF3A 4RGNC 1XGQB 1SEBB 3VFOB 2EO9A 1U95B 5HSFA 4M6MH 4NOFA 5EU6B 1IEBA 2NNAB 1PJ9A 2X4TB 3BPOB 5GGRA 2V17L 1QP1A 1B6UA 3BPNC 1OSPH 2AXFA 4CMHC 3KAAA 1AHWB 2CLZB 5AEAA 4WWKD 3FFCD 4OF3A 4F9PA 4XNYH 3VXUD 3WKNA 4XPBL 3CUPB 4N5EC 3O6LL 5FYLH 3KPOA 3NH7H 4M7KL 4N0YH 3KYKL 5CINH 3HR5A 2V2XA 1HXYA 1CG9A 1KGCE 5IWLA 1MLBB 4JLRA 2AJSL 4PBWD 3SDXF 4Z7WB 2F54A 1E4KC 3LKNA 1ZT7B 4HWNA 2GIYA 4JAMB 1U8NA 3JV6A 3WHE0 3I9GL 1RIHL 3GRWA 1SJVA 3CDCA 1P4IH 4UT7L 2O61B 4B0MM 3UDWC 5GS2D 4D9RE 5BZWB 4ZDHA 1PG7W 1WWCA 1EBPA 1WT5C 4Y19E 5D1QA 3MCKA 2CRZA 1P4LA 1A3LH 1XF4B 4L8DA 3QIUA 5D6CA 5T1KB 1ZHKB 3WNOA 5A2KH 4I9WE 4M02A 2G9HA 3HC3L 1ZHLA 2ESVE 4KV5E 4MA3B 5DRNA 3BP4A 3ZYIA 2BDNL 4X4ZA 3LEVH 2QHRL 3BUYB 3MV9E 3VWKC 2ZNWA 4EDWL 4XCYB 5DTFB 4OUUA 5EIVA 1EEZB 1A3RH 1AD0B 3ARQA 1ZA3B 5GZNC 5KTEH 3QEQB 5IB2A 2ICEA 5I19L 1MHEA 4OLZH 3VGAB 4PRAB 3S36H 5F7LB 4XVTH 2CUMA 4MA8H 2XN9D 4HIHB 3RTQD 4ZD3L 3WCYA 2AJYL 1RK0B 1BQSA 3FO9A 4OFDA 4G7YH 4XWGL 1TVBA 3VRJB 3PXJA 3UPRA 3KPLB 1ORQA 5HGDA 1G6RB 1U8HA 1QG3A 1LEGA 1KTLB 3X11A 3S37L 1RSFA 3H6JA 3JWOH 1QQDB 4JG1H 2WINB 4E5XB 1FO0H 4J23A 3L9RA 4KDWA 1S3KL 5IBLC 4O2FA 4ZYKB 4NQDB 2AW2A 1QHPA 1J1PH 2IALB 5GGUA 2BNUA 5E9DE 4XB7A 5ACMA 1RFDL 4MNGA 4MNQD 1X5XA 4EI5B 1KG0A 3QRGH 2Z8WC 1X5AA 4NNXB 4I0PB 3HFML 1FJ1A 1KEGH 5B39G 1GGIH 3SKJH 4WY7H 1WAAE 3GRWL 5T3XL 15C8L 3MR9A 2YPVL 3MRGB 1PFCA 2FHCA 1I1FA 1WFNA 2BFVH 2AJXL 2CUHA 3MGTB 4HFWA 4L8CB 3G6JF 4WI5A 4F7MB 3CFBB 4DCQA 4NN7C 2R0WH 1YQVL 3PGDB 5HHXL 3VWJA 4DAGL 5BVJB 1HHGA 2CK0H 4UI2A 2VDML 1MAJA 2CPCA 3QXUA 5GS0C 1NSNL 1BZQK 2HT2C 1RULL 4Y8DC 5J13B 5ESVA 3ILQC 4KZDH 4YE4H 2E6JA 2BNRB 3VI3F 1IAIH 5D7LD 1TIUA 1VFBA 4K55A 2H1PL 5F1OB 2FR4A 3G08A 3MFFA 2ARWA 1S9VA 2P8MB 1V8HA 1X5LA 5AZEL 4JRXA 5DD3H 1AQDB 4Y5YC 4GOSA 2MFNA 3QPXH 4MGXA 2WUCL 4K3GA 1U8LB 2YN3A 1R3IL 2AQ3A 5EO1B 3O8XC 4TUJA 4Q58C 4D3CL 1XZ0B 5B39B 4NKQB 2XIDA 4WW2B 2V5MA 3DX6A 1EEYA 2H32B 5CSGA 3O6ML 3UAJD 1Q9WA 4K8RD 4NZTL 3EO1A 5HYEA 3SJVE 1MJ7H 1IQDB 1HYSC 4F7TA 4GW5B 5F9JA 5BV7L 1PYWB 5IQ9A 5FGBC 2LTQC 4YDJA 2JIXD 2GTWA 2FCBA 5JZ7C 4PRBB 4HEPG 4WWKB 4QRPA 2ICWI 3SN6N 5GGTL 1L9NA 5BW7C 1T03L 3VXMA 2BCKA 5GS2H 2PXYD 2VXQH 3BPCA 4K7PX 2AV7A 2EH7L 2ED9A 4GAJH 3EHBD 2DQTH 2GFBB 1TPXC 3LZFL 1WFOA 4PJFB 3IAGC 1A6ZB 3TZVC 1OWWA 3SGKA 4U6VH 1PW3A 2BVTA 5H94A 5HPOA 4Z0BH 1MNUL 4QXTB 1KJVB 1A6VL 1U8QB 4CU8A 3C60D 4QHLA 2B20A 2VDRH 1CLYL 4L5FL 5ALBL 5IW6A 1S5IH 5HD8D 3OBAA 3MMEA 4HEME 4XMPH 4YX2H 3BDYL 3IU3B 4R8WL 3HPLA 4LMQI 5INDB 1JZ5A 2NY7L 4OKDA 4MQ7A 2XI9A 5EPMA 4OBRA 3S3PA 1AGDB 1YPZE 3FZUD 5E1AA 5MI0C 3QA3A 3P0VH 4ZUWA 1EV2E 5I18H 2DTML 5E4EC 5D71H 1GZPA 1IGIH 1HNFA 4L8SB 2A83A 1TJGL 5FF6B 3DHMA 3MYZA 1VFAA 3HNTL 1VCAA 2VB5A 5D93C 1AJ7H 4MCZA 3OKEB 1QSEB 3CXHK 4N5UA 4Y2DD 2XN9B 1K6QH 3RBSA 4JM4L 4F57L 3D18B 3OMZA 2NY0C 5T3ZL 5KVGH 1XF2A 4XX1G 3O2VL 4XWOC 1NCAL 2EE2A 3FCTA 2A6JA 4HIEA 3ZT6A 3C8KB 1K3IA 4PJCB 4F2MA 4YUEL 1AKJD 4OJFH 1GGYA 3LEXB 2HT3C 1EAPB 4P2OD 4C55A 3DROB 1FDLL 4Y5VC 2QSCH 2YD2A 5C0CA 1AGFB 1DP0A 3EYOB 3DOSA 3I6GB 5T1DH 3WHXA 3KXFE 3SGJA 4LHUA 4MMZC 1MFCL 2P5WD 4LASH 3NIDE 3NPZB 4PRHD 4IRZH 5LAXA 5I1KL 1JUFA 5ENWB 5C07E 3TO2B 3MLTA 3ESUF 3D1MC 1UQSA 5A16A 4I2XE 1I3RA 4WO4A 3V0AC 1IM9A 4OQTH 2OTWB 5SWQB 3ZL4L 2I9LA 4PD4J 3U1SH 3HZMA 3V5HB 3ZE0F 5HDOA 1QLFB 5BJTB 3M1BB 5J11B 3C5SB 5D7IA 4PJAE 4FZ8H 1C08A 1TMCB 4Z8FH 3VG9B 3SHSA 4ERSL 1IBGH 4E41D 1T2QL 1ACZA 1PSKH 3V5KB 1I85A 5HHNA 3DO7A 1QRNB 4RGOL 2COQA 3MBXH 4OM1L 1HKLL 2AGJL 5TJWK 3WIFB 1K4CA 4HHAB 5K59F 4PV8A 3R0NA 4O51B 4HS8L 1HZHL 5D7LB 3D69A 5JOFB 1EMTL 2AXGB 1FPTL 3S3SA 1XGQA 1SEBA 3VFOA 1U95A 4JM2F 1T6VN 2GEEA 2X09A 5ITBH 5EU6A 3BFOA 2D03H 4K8RH 2XFXB 2NNAA 1Q9KB 4YHNB 2X4TA 4K7PL 4NIKB 3RVVD 5JLZB 1AHWA 1A7OH 4OZHF 1JK8B 4YHLH 1JMXA 2FL5B 1FYTA 3CUPA 8FABB 4PJBF 1JN6B 5D1ZC 3D0LB 4KK6D 5I75C 1MLBA 3DSNA 2A6IB 4D9QE 4LSSL 3IDMB 2NY4C 3P30H 4Q7DA 2B4CC 1UEMA 4Z7WA 4OV5B 4KY1H 3GSXB 3F62A 4JAMA 4GQ9H 4S10A 5CKGA 3S36X 1QLRB 4LLDB 1W8NA 3DURB 2IH1B 4OIIH 1IC7H 1Q94A 5HDBE 4JQVA 5IQ7H 2O61A 4PPTA 4I3SL 5HY9B 5BZWA 2N4IA 3HZKB 4LDEB 4FQ2H 5FA4B 3CU7A 1TVDA 1INEL 4GSDH 2VDKH 1XF4A 5C0AD 5T1KA 1ZHKA 3ARWA 4N90E 5ACLA 1QFUL 2CKNA 2PYED 4MA3A 4BSVB 5BOPA 1CGVA 4P2RD 5HGGS 1MVFA 3BUYA 4HUUB 5CFHA 4LAQL 2G5RA 3IFOB 4XCYA 5DTFA 5IMOB 1EEZA 2P4AB 4ZUSB 3BE1L 1WK0A 1ZA3A 3J7HA 3QEQA 3QNZB 3JUZA 1MCWM 3MOAL 1NKRA 4U7SA 4PRAA 4KUCF 5L2KE 3O6KH 4HV8B 1LO4L 4HIHA 2J8UB 2VLKE 1RK0A 4WFHD 3B3IB 2PN5A 4RBPH 3U0WL 3VRJA 3RU8H 3ZTJG 3KPLA 4V2CB 2P42B 5EN2B 1DCLA 1OLLA 2ICWB 3NA9L 1TCRB 1KTLA 2CMRL 2IWGA 5JQHC 4JFYA 1QQDA 2WINA 1AR1D 1PVHA 4ZYKA 4NQDA 4K3JH 4M6ML 4RAUA 3C09B 5CLTA 3VWKD 4WTZA 2IALA 4LKXB 1MRFL 5HGAA 4P5MB 4EI5A 1HINL 2YN5A 5GZND 3HZVB 3T0BA 3RBGA 1T2JA 4K94H 4Y2DB 5I74B 4JJ5B 3T0XA 4NNXA 4Q6IC 1T5XB 4I0PA 4X7FC 3UJIL 1WWAX 2YUVA 1FFQA 3X17A 2AJ3B 4XNYL 1LO5B 1UA6L 2BP3A 3CFKB 5ANME 4UOJA 3W82A 3RY6C 2VWEE 3C5JB 3MRGA 4P5KB 5ETUB 3NH7L 1AKJB 4N0YL 5F89B 1F3DJ 4KFZC 5HBBA 1XIWD 3MGTA 3CD4A 4ZTOH 4L8CA 3O81A 1CTNA 1I1AC 4F7MA 3CFBA 3PGDA 4R4FH 3X14B 5BVJA 2P5WB 4PRHB 2GSGB 8CGTA 1CDBA 4IMKC 3V6ZB 4PJIA 3IFNH 4JFFD 1P4IL 3VFSB 5EBGA 3VXSD 4W81A 2BNRA 4P59H 1KXTB 1QBLH 1XF5B 5F1NB 3BD3A 2IQAB 4DUXA 4IS6B 4O00A 2V7HB 1CQYA 2P8MA 5IT2H 3MLYH 1FNFA 2BY0A 5M95B 1AQDA 2L4OA 1ZK9A 3LEVL 2E7HA 5E56A 2B1AL 4E41B 3QXVA 1QD0A 4HH9B 3VFRB 2PF6A 4LCCC 1U8LA 2YPLE 4TSAH 5EO1A 4YR6B 3RGVA 1XZ0A 5B39A 4PIRF 4WW2A 3JWDC 3BIBX 3S36L 5IFHH 4CVUA 3QNXB 3PQYE 4XVTL 3WFBH 2H32A 5D96C 3S88H 3E1F1 3J8F7 3IETA 4MA8L 3TA3C 1HCVA 2H2SD 4G7YL 3TBTB 1FIEA 2Z4QB 1YYLH 3L3JB 4X6CB 5KSBE 1IQDA 2OJEA 2FO1A 3P9MB 2VQ1B 4PJ5B 1PYWA 1KACB 1OGAB 3JWOL 1TVHB 4JG1L 3EYUH 4C58B 1FO0L 2R69H 4IRSC 4PRBA 4WWKA 1H15B 5D5ME 2ICCA 3QFJE 1J1PL 2QSTA 3BKMH 5F1KC 5CIPB 3VXRD 4FZEH 2BK8A 4N68A 1Q8MA 1RURH 3I75A 3UP1A 3MV8B 2F5AH 1SEQH 4ELKB 3O8XD 1UXSB 2GFBA 3WJJA 4CU6A 1KEGL 3EAKA 4GT7A 4J12A 4MLIA 4PJFA 1XF1A 1GGIL 3SKJL 1A6ZA 5HTSA 1PKQE 2DM2A 4RGNB 4FFVC 4WU7B 1DBBL 1KJVA 1HYSD 1DFBH 1QUNA 3EZ8A 1GOHA 3BPNB 1H3UA 4CMHB 3DRQA 3QUXD 5JZ7D 2R0WL 4ZFOB 1S7RA 4QXGL 3AC0A 1QNZH 5INDA 3ULVH 2RJMA 2PYEB 3LQAC 1R5VB 1CTOA 4KZDL 4P2RB 4YE4L 1Y6NR 3I6LE 3IDIB 3PWUB 3OKLB 5DQJB 3UPAA 1IAIL 1AGDA 3TZVD 2IBBA 3LKRB 4C56E 5KVDL 4L8SA 4EUPG 5FF6A 2N7BA 5DD3L 3LPFA 5D8JH 4NHCL 4HLJA 2LAAA 3U7WH 3H3BC 1DLHB 1HN1A 3OKEA 1QSEA 3SDDC 3QPXL 4LPVA 3I3EA 2XN9A 2BRQA 2VR9A 4AT6B 3RTQA 4EJ1C 3R4DA 2Y6SC 3H3PL 5IG7B 3D18A 4XAWH 4ZO6A 2PCPB 3UTSD 2XPGB 5ICXB 3ULUF 3MLVH 1X5ZA 3C8KA 3EOBB 4PJCA 4WTXA 5A40E 1WIOA 4GG6F 3ARZA 3QCTH 3LEXA 1NGQL 1EAPA 3I6KB 3DROA 4WEUD 5DVNA 1CLZL 3E0GA 3VWKB 4GW4B 1V5JA 1MJ7L 3EYOA 4N0CC 3VFGH 4D0DB 2L7UA 4MNQA 4EUPH 1PX3A 1R6VA 4PJDB 4KTEH 4XP5H 5D72H 2WANA 5ENWA 4IEFB 3TO2A 3NIGF 3M45A 1K3ZA 3W5NA 5KSVB 1GIGH 2OTWA 2NY0D 5SWQA 2VXQL 5JXEC 2YWZA 4XWOD 3ZE1E 4GAJL 3V5HA 2DQTL 4CVZB 2Z93B 3K8KA 1QLFA 3FMGH 1CLCA 3M1BA 4LP5A 3C5SA 5C09D 5H8DA 2HT3D 3EIFA 4EUPB 1ZHBB 1JPTH 4U6VL 1OP3K 3MROB 3ARRA 2VZSA 3CH8A 3FRUB 3LB6C 4Z0BL 1KF9B 1YYMH 2ED7A 2GTZB 3P4NB 4YHIA 5J6GB 1OCWH 1QRNA 5DJ6B 1H3VA 2VDRL 3MZTA 3TJEH 1DBMH 2AJUH 4UV7L 3VXSB 1S5IL 4HHAA 2VAJA 3Q5OA 3W0WD 4O51A 5D7LA 3V6OA 4I1NB 1ZGLB 2DYPD 4XMPL 4YX2L 5JOFA 2AXGA 3OAYK 5EB9A 2RHEA 3KPMB 2XFXA 2R2HB 5FO8B 1Q9KA 4YHNA 5JHDE 3RY4A 2VISB 1F90H 5TE7H 3P0VL 5I18L 5JLZA 2O5YH 5D71L 1IGIL 3VXPB 4JY5H 1TENA 1JK8A 4WRLA 2FL5A 5E2TH 4P46D 1RJYB 2GJZA 2EE9A 8FABA 3VGHA 1NLDH 1AJ7L 4JZJC 2VN7A 3VRIB 1K6QL 3D0LA 3BMVA 1F42A 5FKPB 1RQ5A 2X2YA 4PV9B 3IDMA 4GKOA 2E27L 3GSXA 1DLFH 3IB4A 4KV5F 4OJFL 4ELME 1QLRA 4LLDA 5IBTH 2JIXA 3DURA 4RA3A 2IH1A 4Y5YB 5C2UB 3UC0H 2QSCL 5SX4I 4NRYB 3VXRB 2D31B 1PKOA 2X41A 3HZKA 1UM4H 5T1DL 5FA4A 1CFNA 4TTGA 5IEKB 4LASL 3O8XB 1T83C 1UKSA 1NUNB 4WHYG 1RZIB 4IRZL 2WWKO 5JA9A 2NY3C 4KKLC 4MQXD 4X80H 2XOTA 1CK0H 5JW4N 4BSVA 25C8H 5D1ZD 4OQTL 1ZGLM 3R1GH 4HUUA 3IFOA 1H3XA 5IMOA 1ZLUK 3U1SL 3OKYA 5CHNB 2DN7A 3UEZA 4BM7A 4HG4K 2AK1H 1D6VH 4M1DH 4ZUSA 5DEFB 3G9VA 4WFFD 3QNZA 2LTQB 4FZ8L 3VD3A 4MSWB 4Z8FL 1T7YA 4ZQKA 1IAMA 1IBGL 1NAMB 4HV8A 1PSKL 1EH9A 2J8UA 3O45B 4G9FE 1RMFL 4FQLH 3MBXL 3B3IA 5E5RB 5EN2A 1JGEB 1YEKL 2ICWA 1TPXB 1A6TB 5K9QI 3TZVB 1T20B 3RHWK 5L2JA 3IDGB 4Y1AD 4LGPB 2HMID 3ELAT 5ITBL 3SE8H 2D03L 3CLEH 4K8RL 5HVHC 4UNUA 5BO1H 2H8PB 4JVUA 4FMFA 3HZVA 2DAVA 2X1QA 1BPVA 2BRRH 1UJ3C 4Y2DA 4JJ5A 1A7OL 1UCBH 3QEGH 3F58L 4G6AC 2AJ3A 4YHLL 2BERA 5HYJB 1MAMH 2UUDH 1LO5A 3CFKA 4NRZB 3RNQB 3OQ3B 3MRCB 3C5JA 1OOAA 4P5KA 5ETUA 5I6XC 5TQ2H 4F7CB 1AKJA 4OZ4B 1N6QH 5F89A 2HJFB 2ZUWA 3SDXB 4QF1B 5ITFB 1GYAA 3PHSA 1G7MB 4HPYH 2X4OA 5MI0B 1H8OA 3P30L 3NVQA 4GAYB 4AY0A 2MPAL 1MCJA 2YR3A 5E4EB 4GQ9L 5ERWB 3BH8A 4TOYL 2P5WA 1OVZA 3VXNB 4PRHA 2BVOB 2GSGA 2DLIA 4OIIL 3V6ZA 2ENYA 5D93B 2HP4A 2W65B 3VFSA 3VGDA 5F7MC 3ULUC 1I7TB 1XF5A 3TWCH 3KYOB 5F1NA 1YMMD 2NY0B 4GSDL 2VDKL 2F5BH 2IQAA 4IS6A 1KN4L 2V7HA 3CVIH 3K0WA 5L9DH 3BPLC 3D3VE 4NP4H 3OL2A 5C09B 3CLFH 1J88A 4Y5VB 2DLTA 4NO3B 1KNOB 4E41A 1I1AD 4HH9A 1ZLVH 3N0PB 4TQEH 3UYRH 5IR1A 4TVSa 4TNWF 4YR6A 2ZUQC 3VH8G 2R1XB 5EOTB 3VG0H 1WTLA 1FG9C 3QNXA 3W0WB 2W9LA 3O6KL 3VFWB 3VI4E 2JJUA 4GG8B 2CJUL 2EDHA 3QZWG 3TBTA 2Z4QA 3L3JA 3MOBH 3C9NB 4X6CA 3RU8L 2R4RH 3ARPA 4FQHB 1HWGB 3VJ6B 5CP3H 3P9MA 1KB5B 2PO6D 4PJ5A 2F8OA 3L3DB 1TVHA 4APQC 2E9WA 5IV2B 4Z7OF 1H15A 2E9IA 4K3JL 4K23H 5CIPA 1OSZB 1F6AB 5DEZA 5B22A 1IAOB 3MV8A 1PZUB 3H0TB 5ICYB 4NQVA 2A73B 4ELKA 1RUMH 4K94L 1UXSA 4E42B 4JY6B 4EIZC 3BZ4B 4TVPE 4NKIH 3CMGA 3TA3D 4KZEH 2QSQA 5CEYB 4I0KA 4B53A 3DI2B 4WU7A 5GGSB 3G6JB 2EKJA 3AM8C 5T1LD 3QDME 2H2PC 4OCWH 4U1NB 4Y4HC 2B4CH 4XHJC 2JELH 5TF1H 2ZJSH 3TNMB 4R4FL 5GRJH 4IRSD 2DB8A 4P48A 5BXFB 3DXAD 2MSPA 5C0AA 1YNKH 1CGUA 2GKIA 1FZJB 3IFNL 4YDKH 4ODTH 4Q9RH 5C0RH 4UILH 2PYEA 4U05A 3QZWB 1R5VA 4P2RA 2OR8A 1IKNC 3PWUA 3IDIA 4P59L 3OKLA 1QBLL 5I75B 4JM2D 1DJSA 5SX4H 3T3PE 5DUMH 2NY4B 5TF0A 1I1CA 3LKRA 1E4KA 4PJ7E 5IT2L 5FV2A 1LEKB 4I3RH 5K9JH 2NQCA 1G9NC 1DLHA 5TH2B 2FEDC 3NCJH 3QIWC 5J89A 4AT6A 3UDWA 5AYUL 1J8HD 4A6YH 5IG7A 1DSFH 1WT5A 2P8LA 2PCPA 4TSAL 2XPGA 5ICXA 3TM6A 5IMMB 4PR5B 3EOBA 3WFBL 3S88L 1EGJH 3HUJE 4HW6A 3V0WH 3Q5TA 3I6KA 3CCHB 4Y1AB 1A47A 3VWKA 4GW4A 5IMKB 2RCSH 4NQUA 4P2YA 4QRRE 3GSWB 1TFHA 3MRKB 1IGYB 4D0DA 4HH8A 1GGTA 3EYVB 4HIXH 3UTQB 5I9QC 1TTUA 1V7NH 3BGFB 3EYUL 4PJAF 2R69L 4C57C 2R2BB 2R23B 3BKML 2CDEA 3G6AA 4FZEL 1S7XB 3OB8A 1RURL 5F93C 2Y6SD 5KSVA 4L4VD 2F5AL 5F7FA 1J5OH 4Z76B 1RK1B 4DKAA 4CVZA 4KROC 2Z93A 4X6DE 5AAWA 4HUWB 5J0BA 2FHFA 4Z7UE 1HHIA 2NX5D 2QR0B 4LAJH 3MRMB 4BFGA 1CFSB 4EUPA 1ZHBA 3MROA 4BK5A 3SE4C 3FRUA 4GLRI 4WUUD 3BESR 3IKCB 2GTZA 3P4NA 4N0CD 1DFBL 4KUCD 5DJDB 3GHBL 4XH2B 3VXSA 2A0LC 5E8EB 4Q6IB 3HG1E 1YMMB 1ZGLA 1MFNA 1QNZL 2FD6L 4MJ2A 5LGHH 4XC1H 1DQLH 3WFEL 2YD5A 1RJLB 2EC9T 3U6RB 5JXED 3KPMA 4HSQA 2R2HA 3WE6B 5FO8A 4HKJB 4K71C 4TPRH 4NPYA 4P3CH 1R5IB 2VISA 1I1AB 2D4DA 3MGAA 4PLKC 3MV7E 3LOWA 3VXPA 3MXVL 1RZFH 1NBYB 1RZGB 1RJYA 4OI7A 3AS2A 3U7WL 1UM6H 3QWOA 5HHQB 3EDFA 4IOFD 3BN3B 3VRIA 3CXDL 3UTPE 4PUBH 4ORZC 1JHLH 2PYFB 1KCRH 3GFUA 4XAWL 4KRNA 5FKPA 4PV9A 2XQYG 1U2HA 4KI1A 4X0KB 3MLVL 1JNJA 3QCTL 4Y5YA 4Y4FC 2C26A 4U4BA 4NRYA 4J6RH 3VXRA 2D31A 4J1UB 4JQXC 2Z35B 1Q9LB 3VFGL 4YHOH 4ZOAA 4LCCB 5IEKA 3H9ZA 4LVOC 3O8XA 1RZIA 3OZ9L 4LCWB 4M7JH 4XP5L 4ZPTB 4PJXB 5D96B 4M3JA 3TA3B 1S8DB 1EZVY 3O6FD 4HKBB 5A1AA 3U30C 1GIGL 2FHBA 1HHJB 1BZ7A 5CHNA 3KPRD 5T1LB 3ARTA 5DEFA 3VGEA 5TE6H 5FGBA 4GW1B 2LU7A 3QHZH 1KIUA 1JPTL 5CGTA 1U2CA 5D7KD 4IRSB 3CSGA 1LVEA 1RHFA 4JHZA 2UWEB 1NAMA 4R7DB 2OMBA 5BW7A 4XP9H 4EQ2A 5IEHB 3O45A 4JG0H 3TC9A 4CVXB 4DOHB 1OCWL 3GO1H 3S6CA 3RWFB 3TJEL 4PJGE 4BFBD 3EJYC 2AJUL 4EN3D 3GMOB 4OF5A 4AIOA 1JGEA 3KPSE 3VFMA 2NY3D 1A6TA 1EXUB 1BAFH 4KKLD 4F37F 2CGRH 5JPNB 2XV6B 3TZVA 2Z91B 1XGPB 1MELA 3LRHA 3QRFM 3IDGA 5SWZD 4HWBH 4MDIB 5EZIH 3LQAH 1FHGA 5EOCH 2ZUYA 3MJ7B 4DGVH 2H8PA 2YEZB 2W0LA 1VFMA 4ZSOE 1F90L 2KDGA 4BJLA 3VFPB 4UOW0 2O5YL 1J8HB 3HC4L 4PJBB 4RZCA 4JY5L 1XGRB 1FFPB 1BMGA 5DRZB 4ODBD 5HYJA 5E2TL 1A1MB 2PTUA 4NRZA 3RNQA 3DIFB 1NLDL 1ZTXH 5C0BD 2IPKA 3MRCA 5HHOB 2VR4A 4PYGA 4X83A 1UACH 3H3KA 4F7CA 4OZ4A 1DN2A 2HJFA 2RGSA 3SDXA 1HQ4B 5ISZE 4QF1A 5ITFA 2R56H 1ES0B 1G7MA 3BAEH 3GSUB 4LPXA 2IAMD 4GAYA 1DLFL 5ERWA 3AS0A 3SQBA 1FCCA 3VXNA 2BVOA 2YBRB 2G60H 4PG2C 4NQED 5FO7B 5C6PB 3UC0L 2W65A 2RQ8A 5T5NF 2XQBH 3L7EB 3BH9B 4OM0H 3SDDB 4Q6YA 3D2UB 1BD2E 5KANI 1M7DA 1UM4L 3HMXA 3KYOA 2VSCA 3O0RH 4MJID 4G6AD 5CEXA 4YO0B 4CGTA 3S98A 4X80L 1CK0L 2NX5B 5C09A 4Z7QE 25C8L 5CMAB 4ZS6C 2VYRE 3R1GL 1SJXA 4Y5VA 3MNVB 4NO3A 1KNOA 4PBVC 1D9KC 3KVQA 2AK1L 4M1DL 4JPIB 4Z7NE 5L8KB 4NC2B 1UB6B 3MRFB 3OV6A 2R1XA 5IROA 5EOTA 2B39A 4HBCH 3W0WA 5D5MF 4PRPB 2JKXA 4GG8A 2JTDA 1C5BH 3NAAH 4FQLL 1CDUA 2DLHA 3C9NA 2PR4H 1YC8A 4FQHA 1K2DB 4GLRH 3VJ6A 3IKKA 1KB5A 2EDEA 3AS1A 1KLFA 5C3TA 2VLRD 3L3DA 2NW2B 4FXKB 3VRLF 3LCYA 3CGTA 5D2LE 5IV2A 4KK9D 2B1HH 1NFDF 5LQBH 4M3KB 5JNYB 1Q0YH 4LP4A 4U2YA 3SE8L 1OSZA 4J7RA 1F6AA 5IFJB 4TNVK 5BO1L 2FYYB 1IAOA 1X5KA 4DKFH 3H0TA 5ICYA 2A73A 2BRRL 1BQHG 4K2UH 3IVKB 3MZGB 4CUCA 4JPWH 4E42A 4JY6A 1UCBL 3QEGL 2HA1A 3BZ4A 4OFYA 4UIMB 3WYRA 1MAML 4NQXB 5CEYA 2D0GA 1RUQH 3DHJA 1GSMA 4NC1E 1SMAA 3G6JA 5TQ2L 3HMXL 1X4XA 1TXKA 4U1NA 1N6QL 5L7XH 4AENB 3U4AA 1KC5H 1PEWA 3WIHH 3F12B 3TNMA 1CFVH 2DJ4A 4HFUH 3VH8A 2D0FA 5BXFA 4OGYH 3PIQB 1VSCA 2G75B 1FZJA 1GAFL 4JZJB 4OCSH 3QZWA 2GW5A 5D1ZA 3ZKQD 1I7UB 3IS1X 4KDVA 5TFSH 1A1NB 1T2XA 4RDQF 5E6IC 4I48B 2F5BL 1TNMA 3I3DA 3WNLA 4LCYB 3CVIL 4NKOB 5L9DL 3D39D 4NP4L 5BVPL 2H2PD 1LEKA 4Y4HD 4RFNC 5TH2A 4XHJD 1X5GA 1MLCB 3IFLH 5JIPA 1C8PA 4YBQC 3P4LA 3UYRL 4TQEL 3VGFA 1A0QH 1RUAH 1BQHB 1XR9B 5DEGB 3IDXH 4NYLB 4OGAC 3JZ7A 5C92A 4PR5A 4LSQH 3QXTA 4LPWA 4BQ9A 2HKFH 2NY3B 4RFEB 3S96B 4OZGE 5BS0D 1L6ZA 4Q0XH 4U3HA 4OCYH 2DM3A 3PABB 3CCHA 4XPGH 5SWZB 4Y1AA 3MOBL 2EXWC 5DA4A 2ESVD 2R4RL 5IMKA 1KIQB 3ZE1F 5EU5B 3GSWA 1IGYA 4PGEB 2XA3A 3B8SA 3EYVA 3T3ME 3UTQA 3L1OH 2ICWJ 2W91A 3P3YA 4MB5A 2R2BA 1KPVB 2R23A 4K23L 3STZB 2FEDD 3K1KC 1J18A 2ADFH 2X4SB 1S7XA 5DJXB 4WI6A 1EGJA 4YWGH 4AEEA 4JPKH 2DKMA 2OP4L 4PJEE 4Z76A 5J57B 5LWYL 2DQUH 1RK1A 4XPFH 2F9BT 4HUWA 1CDGA 4KK8C 3RUGB 2VWEC 4S1SH 1AC6A 4NKIL 2QR0A 1BX2B 1N59B 1UEYA 3MRMA 4KZEL 3H9SD 5KANG 1JNHB 2HH0H 5IVNA 2EIEA 2OK0L 3IKCA 3RY5A 2W59A 3QDGB 4OCWL 1J1XL 5HVHB 1GVIA 3SCMC 4NQEB 3OGCB 2B4CL 5DMJB 5DJDA 2JELL 4XH2A 5TF1L 1UJ3B 2ZJSL 5E8EA 5E9DD 4Q6IA 5GRJL 5I76A 4U6TA 2HN7B 1YMMA 4MJIB 1YNKL 4ALAH 4UUJB 4WJ5B 5EULV 4YDKL 2UZYB 3W9EB 5M94B 3THMH 3RY6A 1YN6B 4Q9RL 2QSVA 5C0RL 1RJLA 4UILL 3U6RA 5I6XB 4DW2H 1MI5E 4PJHE 3OXSB 3WE6A 4JO1H 2I07B 4HKJA 1R5IA 5IB3B 1YJDH 5DUML 1JHKL 1I1AA 3WKML 1EVTC 4L3AA 2GUOB 3QUZC 3HN3A 1NBYA 1RZGA 5E2JA 5JO5B 5K9JL 4IMKA 5HHQA 1JWMB 3VFUB 3OF6A 3NCJL 5T5FH 4LL9A 2BSSB 5EUOE 2PYFA 3HE6C 4ZUVB 4A6YL 3LQZB 2BY2A 1DSFL 5JORA 5FFLA 3LRSB 3PGFH 4HGMA 4X0KA 5KSUB 1EGJL 3BPLB 4X9IA 4F7PB 1OB1B 3V0WL 1DUYB 3ZDZF 3U46B 3PDGA 4DGIH 1CGWA 9CGTA 4LKCB 2R1YB 2RCSL 3DYPA 4J1UA 2Z35A 1Q9LA 4PLKD 2QQNH 4KQ3H 4HIXL 4LCCA 1V7NL 3C87A 2ZUQB 4LCWA 1Q9OB 3M8OH 4XBEL 4ZPTA 5KN5B 4PJXA 5CJXC 5CEZE 3SE3C 3VXOB 4QHUB 1J8KA 5MEPB 3TA3A 1S8DA 5DHXB 4HKBA 1HHJA 1J5OL 1NBVH 1KEMH 5T1LA 5CGYC 2DMBA 2YSSB 2EDJA 5FYJD 2WLYA 4I5BB 3BZEB 4N8CH 4X7DC 1J0HA 1BM3H 4GW1A 4APQB 43C9B 1JBJA 4RWYH 1MCBA 4S0SD 4IRSA 3CFIC 2UWEA 3ZKND 3DXAA 4R7DA 1NC4D 5JW5B 3O9WC 5IEHA 1A6UH 4FABL 5IIEB 3IT8D 2B0SH 4W4OC 3SKMB 3GMOA 3UYPA 1UENA 3O41B 1MCQA 1EXUA 2Z31D 4EBQL 5JPNA 3T0WA 1A6PA 1J0YA 2C3HA 1XGPA 2Z91A 4HGKC 4BQ8A 1I9JH 1MFEH 1RI8A 1DQLL 4J3WA 4XC1L 4MDIA 3S34H 5LGHL 2FJHB 3LIZH 3D39B 3MJ7A 3OXRB 1WIPA 1NDGB 2YEZA 2VE6B 2Y5EA 2HRPH 4S1DC 4TPRL 4Y4HB 4P3CL 2E8YA 2FRGP 1SM3H 1BBDH 3VFPA 5A43C 1J8HA 4PJBA 2Y1VA 1XGRA 1FFPA 3WMSA 1MCPH 1RZFL 5DRZA 1A1MA 3DIFA 5HHOA 2EDOA 4Y19B 1CFTB 5CBAB 5B3JF 2Z9TA 1OM3H 4L4TD 4PUBL 3RJDA 1JHLL 5D70H 1KCRL 1HQ4A 5EIQA 1ES0A 3GSUA 2ESVB 3T8XB 4OCNC 4G8GE 4KJQD 3GM8A 3ZKMC 1WWWX 2R29H 2D7NA 2VSDA 2D0HA 3GBNL 2YBRA 5DK2B 5FO7A 2D3VA 4MAYC 1WZLA 4J6RL 3SDYH 3QIWB 3L7EA 4UOW1 1HH6B 3BH9A 3SDDA 4DUVA 4W6YB 4MB4A 4YHOL 2FDBP 4L4VA 4UZGA 4NZUH 5FGSA 4YO0A 4EQ3A 2IPTH 4M7JL 1U3YA 5I1LB 4XCCH 2NX5A 3LPGA 3RRQA 1ZGLP 3FN9A 5CMAA 1DBKH 4H0HB 3MNVA 3QEUB 4RBPK 1N8ZB 1VDGA 1PGRB 4MHHI 3P4OB 1TLKA 1JYXA 5I9QB 1HILB 3O2DA 1UB6A 3MRFA 1JTPA 4BZ1H 5E9DB 4DVBB 1GGBH 2KUTA 3KXFD 2ILLA 4PRPA 4GRMB 4OUOA 5JW4Q 4XP9L 4GBXC 4JG0L 1TZHB 4LGSB 2F54E 3GO1L 3WFZA 1HH9B 1FL5B 1N5AB 2EDXA 1K2DA 5JXEA 3CSBA 4PGCB 2ZKHL 3C6LD 3U2SB 3EFDH 1LO3H 4KROB 4YFLF 1X5FA 4G3YH 1BAFL 2CGRL 1IT9H 4U7MA 3ZDXE 2NW2A 4FXKA 2FECI 3QSKB 3K4DA 1CVRA 1REIA 3QQNA 4DN3H 3MLZH 4HWBL 5EZIL 5SV4A 3LQAL 3RVXC 5EOCL 2AQ2A 5JNYA 4F15C 2ICES 4DGVL 5IFJA 3F7PC 4YDIH 3VGBA 2FIRT 2W9DL 2YXMA 2FYYA 3GMLB 5EBLB 1SYSB 3IVKA 5DK0A 1DQJA 3FQTB 3NCYP 2NY6C 2J8HA 4UIMA 1ZS8B 2XY1A 2W07A 1BLNB 4NQXA 5GHWH 4XCFH 1MCHA 4U0RC 1ZTXL 2CKBB 5HYIA 5DHVH 1UKTA 2KPNA 4M1CC 4RISH 2JB6B 1UACL 3EYSH 4JDVB 4LQFH 4YPGB 4K71B 4V1DE 4GH7B 2BMKB 3F12A 5FYJH 3T4YB 5J3HC 4PJ7F 4LSTH 3PIQA 2VUYA 2G75A 3K8MA 4JRYD 4WENB 4JZJA 4KMTH 2D2OA 1I7UA 1YEIH 4OFPA 3P40A 1A1NA 1G7JB 2DRUA 3O0RL 2XACC 4I48A 1WJ3A 2FBJH 4LCYA 2AK4D 4NKOA 2X10A 4J3XA 1IJ9A 4MNGE 3GSNB 5EU7E 3HUJF 4D9QD 4Y2OA 2V5YA 4Y4FB 3PWPE 5F3HB 1FVCB 3H7BB 1MLCA 4U1JB 2OBGA 5ADOH 4PLJC 3QEHB 1BQHA 3VMPA 5HHME 4R90L 5DEGA 4LVOB 1T83A 4KI5E 4NYLA 2J5LC 4X9GA 2V9QA 4HBCL 4RFEA 1FIGH 3S96A 2CK2A 1JF6A 3N50A 3K2UH 4LPTA 2Q8AH 1C5BL 3PABA 1ZT4B 3NAAL 5SWZA 3U30B 5E6ID 4YEFA 1HYRC 2PR4L 2WBKA 4OLVH 1MRDH 2Q7YB 3W11C 1KIQA 3NGBB 3VGGA 3HB3C 4PGEA 4EZMA 1A64A 1S7QB 4Z7UF 1X44A 1RD6A 2V6HA 1CR9H 2B1HL 1KPVA 4X98B 4XNUL 3STZA 2VN4A 1Q0YL 2X4SA 4LU5H 4W70A 1JZ3A 2Q6WB 4NC0B 5LCVH 4DKFL 1R5WB 4KK5D 1R3HB 4K2UL 4JPWL 1OAUH 4JO4L 4OGAD 1CDJA 3RUGA 3WDJA 3SKOB 1BX2A 1N59A 5DC9B 1RUQL 2UYLB 2DQGH 2EXWD 1YEFH 1DEDA 1KELH 1YPZB 2A9MH 5L7XL 4PJ9D 4NQEA 3OGCA 3GSOB 1F3RB 1AY1L 4FQQB 1KC5L 3WIHL 4ZNEE 2FLRT 2XWTB 3H42H 3SQOH 1CFVL 4HFUL 2P49B 3FRPA 1PLGL 1CE1L 2P24B 2HN7A 4MJIA 4OGYL 1L7TL 4UUJA 1NC2D 5BRZE 4WJ5A 3GJFH 1YN6A 4MHHG 1NEZB 4XTRC 3OKKB 4UTAL 4MD4B 4Y89A 3OXSA 2I07A 5TFSL 5T3ZE 1JNNL 4KK8D 3RWCB 4R4NC 2YD9A 4MMXC 1HQRB 5I0DA 5IB3A 4QRPE 1P4BH 2H6PB 2NTSP 2GUOA 1W0VB 4LPCA 4RIRA 2PW1B 2XXCB 1RVFH 3IYLW 5JO5A 4B7IA 1R3LB 3SCMD 1JWMA 12E8H 3VFUA 1FORH 3KXFB 1ZLSH 3GJFB 3IFLL 2BSSA 4HIJB 2BHUA 4W4NA 4ZUVA 3LQZA 1A0QL 4M93C 3LRSA 5FCSH 5E03A 1ZV5A 4GG6A 5IVZB 4LSQL 2HKFL 4UB0L 3UZQA 4CDHA 4F7PA 1OB1A 1DUYA 4Q0XL 3U46A 1FGNH 4XPGL 5D7JC 2XKSA 4LKCA 1GL4B 2R1YA 4PJAB 1D9KB 1TITA 4LEXH 3QCUH 1EBAA 3QUZD 3L1OL 1RU9H 3RDTD 1Q9OA 2WP3T 2IEPA 3VA6A 4G7VH 3VXOA 4EDXB 2ADFL 4XP6H 1V7MH 1NCTA 4YWGL 3HE6D 5DC0A 2BHYA 4NM8H 4JPKL 5F97E 2X89D 4PJGF 2DQUL 4XPFL 3WO3B 2YSSA 4I5BA 3BZEA 4S1SL 3M07A 4APQA 1IEAB 1FN4B 43C9A 3GSQB 3MTRA 1FV1A 2E6PA 1SJHB 1O7VA 2LAGB 2R8SH 3CDYA 1YUHB 4OQ1A 3AY4C 4JDTL 5IIEA 5I8KH 3SKMA 4XB8A 4YJZL 1KT2B 4O58H 3BN9C 3O41A 3QFDB 2DQDH 4FFYL 3BRFA 5AD0B 4XCNB 4PJFF 4ALAL 5I30H 1O7SA 1JWUB 2HLFC 3THML 5F7YC 2FJHA 4GS7C 3D39A 2X4QA 3OXRA 2NY5H 5F70A 4DW2L 1NDGA 3AM8A 4X9HA 2UZIH 5CGYD 5E99H 1IGFL 1OD9A 4JO1L 2VE6A 5E94B 4Y4HA 1G7PB 4OKVB 5TDOB 2AERT 5IJKC 1YJDL 2Z8VC 2HFGL 4KHTH 4NQSB 3MREB 1JHTB 5CWSB 3DARA 3QQ4B 3TN0D 4KAQH 1CXHA 1DVFC 1F2QA 1D3CA 4HJJH 1LWRA 3O9WD 1JYNA 4Y19A 1CFTA 3F7YB 5CBAA 3WUWB 1EFQA 2N56A 1CI5A 1IKNA 1KJ2B 5E6IB 1AP2B 2ESVA 4XNQB 1UWEH 2VZTA 1YN7B 1M7XA 1B9ZA 1A6AB 2EDQA 1YEEH 4DGIL 5DK2A 4RFNB 3OTTA 1EJOL 3QIWA 5ILTH 1HH6A 4CL7A 2FX7H 4NWUL 3WEXB 2QQNL 1F4WH 1WBYB 4N0UE 4Z7NF 5F8RC 1XCQB 4RMUA 5I1LA 3REWB 4L8BB 5F3BB 2I9TB 4ONFH 2CO6B 3QEUA 4Z7VE 4PB0H 1NBVL 3X3FH 3PWLB 1N8ZA 4WGWB 3ZKMD 1FYTE 5LXGH 2C3GA 4JPVL 4N8CL 1T1XB 1NJ9B 1W0YT 2A38A 1F4HA 3P4OA 4U6YA 4JCLA 4RWYL 5E9DA 4ZPVB 1MAKA 4DVBA 5T5NG 3AGVA 1PQZB 4G8IA 3BEWB 4GRMA 4CMMB 3FAWA 1NC2B 1A6UL 3ET9F 1TZHA 3G5XB 3I85A 4M61B 1HH9A 1FL5A 1K8DB 3N85L 2B0SL 1N5AA 1LP9F 1RZJH 1WAAA 3OPZH 4PGCA 1ZVYA 3DI3B 3U2SA 1H3WM 2DLEA 5ANMB 3TT1H 1RJZB 5GGRY 5KS9F 1JL8A 3RVUC 1H8SA 2UUDK 5FYLE 5EC1B 1I9JL 1MFEL 4HDIB 3S34L 3O3BB 4QRQA 3LIZL 5DJZB 3SE4A 1FL3B 2X05A 4JRWA 3ALWA 4KKNA 2DF3A 2HRPL 2NXZC 3GMLA 3SCMB 5EBLA 1SYSA 1QBBA 5F9AC 1JVKA 1SM3L 3V4PH 2J4WH 4YHZH 3FQTA 1MCPL 3U0TB 4X99B 1BLNA 1ERNA 4NUGL 3TVMC 4YPJA 2BY3A 2JB6A 4KRPB 1OM3L 5FK9A 4JDVA 1U8PB 5E8NB 5D70L 5CZKA 2V17H 4XAKE 3HTLX 4YH6A 4YPGA 4DKEH 2BMKA 2V2TB 2E7CA 3T4YA 2WZPD 4BQ6A 4JZNB 3RVXD 3MUHL 5JHDD 3QUZB 1MHPL 3PUCA 3O6LH 4L1HA 5C6WH 4U6XB 3BKCH 1H3PH 5E7FA 5IJVB 4OAWB 4ZG1A 5EUKB 3SDYL 2ADIB 2YPLB 5DHVA 3LS5H 4FP8H 3LPWA 3HE6B 5JA8B 1N6UA 1ZLVK 2NY6D 1G7JA 4DTGH 4AQ1B 4NZUL 2X9YA 1PAMA 2IPTL 3JTTB 1ZLWK 3GSNA 4M1CD 4XCCL 2XTJD 3GKZA 4QOKD 4UT7H 4Y4FA 5F3HA 5JR1H 1DBKL 1FVCA 3H7BA 4Q9QH 1P2CB 2EDTA 4U1JA 3VWJD 1LQSR 4PP2B 3ZE2F 5C9JB 4JQXA 3QEHA 3BT2H 5C0JB 4F7EB 5D5MB 1SYVA 3PWVB 3QFJB 4MXVE 3HC3H 4M6NH 4BZ1L 3MJ8A 3RIAK 2BDNH 1WCBB 3PP3H 2Z31A 5AWNH 1OY3B 2RIKA 4RDQG 5I1JH 4XPTH 1CGSH 2ZSVB 3KJ6L 1ZT4A 1JJUA 4UBDC 2Q7YA 4PJEF 2XZZA 1PKQB 3OG6B 3EFDL 1LO3L 4PJIE 2YUWA 4G3YL 5I19H 1S7QA 3L5IA 1EA9C 1RPQA 3BRGC 3RA7H 4DN3L 2SEBA 3MLZL 4P2CG 2BNRE 3LN4B 4X98A 5DJ0B 4Y5XC 1OL0A 4PG9B 5F7UA 4MX7B 2J2ZA 4YDIL 3O9WB 2Q6WA 4PLJD 4PLOB 1R5WA 1R3HA 4L4TA 5HDLA 3S37H 3IF1B 4ONHB 1I8LC 4P23C 2UVEA 3SKOA 4OZIF 2XTLA 5GHWL 3EYQD 4XCFL 4AM0B 1UFUA 2UYLA 3F7VA 4RISL 4RMQA 3W11D 3EYSL 2HFFB 4ZOBA 2GY7B 3B5HA 4LQFL 2CO7B 4PY8I 3KHOA 4C56B 3GSOA 1A7BA 4FQQA 2XWTA 5EOCJ 3HFMH 5FYJL 5I17B 4DK6A 2MCG1 1C12B 5CSBA 2P24A 5T3XH 3KNBB 4MAUH 3VXMD 3MQIA 1ORSB 2NY1C 2WNGA 2IGFH 2AS5M 2V9RA 4LGRB 1NEZA 3OKKA 3H2WA 3HPJB 4M5YH 4MD4A 1YEIL 4N9OB 2P5EE 4M6AA 3RWCA 4LLQB 1HQRA 3PWNB 3MGOB 2YC1B 3FFCE 4AMKH 2H6PA 3VXUE 1W0VA 1ACYH 4XRCB 2PW1A 1S7SB 3EUUA 1R3LA 3B9AA 4PG2A 3KXFA 4MAYB 3GJFA 1KYOJ 2O5XH 5ADOL 4HIJA 2ZWLT 5IVZA 2CIIB 4NN6B 1FIGL 1MF2H 4XTRD 5J1AB 4X7TB 3K2UL 3UXFA 2Q8AL 4KJWC 3MO1A 3DGGA 3QAZC 2DLGA 4R4ND 4G42B 4OLVL