3G04B

Crystal structure of the tsh receptor in complex with a thyroid-stimulating autoantibody
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
215
Chain Sequence
QVQLVQSGAEVKKPGESLKISCRGSGYRFTSYWINWVRQLPGKGLEWMGRIDPTDSYTNYSPSFKGHVTVSADKSINTAYLQWSSLKASDTGMYYCARLEPGYSSTWSVNWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the TSH receptor in complex with a thyroid-stimulating autoantibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HUMAN THYROID STIMULATING AUTOANTIBODY M22 LIGHT CHAIN
total genus 40
structure length 215
sequence length 221
ec nomenclature
pdb deposition date 2009-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g04B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g04B01
2C3VB 4YDKL 3EO1A 4PGEB 3FRUB 3HNVH 3GB7A 3HE7A 3IFPB 2DM4A 4OLWL 4DUWA 1KFAL 3T09A 3U7YH 4Z7UE 4ZAKC 5A3ID 4JRWA 5DHVA 2QSTA 3GK8H 4JO2H 1OGTB 3BYTA 3HE7D 3GGWA 1S7QB 3KJ4C 2KBGA 2R56L 5GS3A 4B5EA 1DQML 5J3HC 4G9FE 2EIEA 4J6RL 2X4UA 5D7JD 4KUZL 3SKJL 2DLIA 3VRIA 1G84A 1NCAH 1AGDA 5AAWA 5KSUB 1BAFH 1MCRA 5ID1A 3VD7A 4FFYL 4UUJB 3B8SA 3EAKA 5IHBA 4NNYA 5KZCD 3QUXB 2Q86B 1J88A 5LBSL 1DE4B 1F3JA 4X9BA 5E9DA 1K3IA 3LKSB 5TE7L 1XT5A 1WC7B 1D5BB 3VI4E 5BZDA 4PJDB 1OHQA 5DD3H 2BZDA 4JPKH 3S5LG 3QDGE 1N64H 2X9YA 1U8QA 1NCWL 4XHJD 4Q6IC 4QLRA 2XG4A 4NQEA 5D1ZA 1BQHG 2ZG2A 4K9EH 3RGVC 1NC4A 4M6OH 3V2AR 5F9JB 1KB5A 5DR5H 1MCPL 5D8JL 4RMWA 4OIIH 2EEBA 1MFBL 3FQNB 4WHYH 2WLZA 3CAFA 5SWQB 4NQUA 2OYPA 3O2DH 5IKCA 1A3RL 1KJVB 3O6LL 4KRPD 5IR1B 3M07A 4MVBD 1S8DA 3Q5TA 5IR1A 2O5XL 4LPWA 4NKDA 1MCSA 2ED9A 4CMHB 3T8XA 4OGXH 2XIDA 4JQIH 4OZGB 2G9HB 1RFDL 1S7XA 3QXTA 2K3TA 4YDVA 1P4IH 3UTPD 1UM6L 2EDOA 3GSNA 2YMXH 3MX0A 3LKOA 1OP9A 5JOPE 1RHFA 3KNBB 3HPLA 3OV6A 1AGEA 1TCRA 4ZNCD 1UB6B 3UTSB 4XB7A 1RUAH 3MLZL 4ZUSB 5EO1B 2P7TB 5TGBA 5E2WL 3CC5B 4LL9A 3G5YB 1BX2B 4ODSH 5MHSD 3T4YB 2D4FA 3V6BR 1I1AC 1RK1A 3T3ME 3D39A 4XCNA 2NX5B 5GRZA 4KZDH 3TC9A 4R8WL 4YHYC 1EXUA 2IG2L 4LSTL 3SCMA 5ANMA 1RIHL 1FH5H 5JDSA 2EDKA 3SQOL 3KYMB 3QNYA 5D72H 2ICWA 3FQTB 3B9AA 3QIBA 3DROB 2BSRA 3VWJD 4NHCL 1FO0L 1XGRB 4Y4FD 4HIEA 4ODBD 2Y36H 5EO0B 1EZVX 5EU6B 4JFDA 2P5ED 3VXMA 3CFCH 3CVHA 3BN3B 1UKSA 4AIOA 4ZS7L 5I19H 1ZEAH 2B5IB 5IMKA 4Z8FH 4KRMB 4ZS7H 5I19L 4UDTB 3MRNB 3OB0H 1IGJA 4L9LB 4Y4FB 1UB6A 4XNUH 4OCMC 1AY1H 4ONFL 1GPOH 1DUYA 3HC0A 1G7PB 3NFNA 5DRWB 5FUCE 4BSWB 1CYGA 1TVHA 1GL4B 1IL1B 1XMWA 5F71A 4U6YB 5T1LB 3OKOB 3TN0D 4U2YA 2DL2A 4R6UA 2BSSA 3U2SA 5GS0C 4WU7A 4HV8A 1T21B 1VACB 2BVUA 5I6XC 3WDJA 5B38A 1VGKA 2O26U 1BJ8A 2PW2A 1RURH 3JWOC 3NABL 4JZJC 1CG9B 3P4MA 4JHWL 4NQSA 4MQSB 3MLSL 4BQ6A 1A7RH 4M5ZH 1RUML 2LV4A 1D6EB 5EH1A 2G5RA 3WDHA 3H7BA 4TSCL 1F6AA 3KWWA 4P3WA 1PG7W 3QEHA 3IDGB 4LLQB 2AQ2A 4LNVA 1T1ZB 4JO1L 4WO4D 2XV6B 2Q8BH 3O6KL 5C86A 4M7LT 4FS0A 4OZFA 1BFSA 2BNQA 1DBJH 3AROA 4DFIA 5J11C 1PBYA 3MMEA 1YEHH 5GGTH 1CD9B 1OCWL 3PG2A 2HFEB 2BDNL 2DIJA 2Y7QB 3BPLB 1K85A 4UBDC 4KY1L 4GKSA 4QXTA 2PYFA 1KPUA 4GG8A 5EN2A 5HYSG 3CIQA 1B0RB 5KSAB 3FT4B 4WWKA 5HHME 2YD2A 3DO7B 1UYWH 1RIVH 4UOW1 2HVJB 5C2UB 4CVUA 3ZKQD 3VFPB 4CMMA 3ELAT 2DQDL 1F58L 3BH8B 3F7YB 1AKJA 1LO2H 1KLGA 1RAMA 2VLKB 3BXNB 4XNUL 1TJGH 3ARBC 3HG1E 3ULVL 1H15A 3KPSE 4LAQL 2BNUA 4UB0L 3MROA 3LMJL 4BYHA 1YEDB 4V1DB 4YBQD 1PY4A 5HJ3B 1FNEA 2JJSC 2JE8A 1YY8B 5BJTA 5DJAA 1QBBA 2Z92A 3DHJA 1B4JH 5HYJD 5EU4A 3MLUL 4PJDF 5DLMH 1CICB 4FQXD 3PQYD 1JHLH 1S78C 3B2VL 3ARVA 4P9MH 3K1DA 2YK1L 3MUJA 2X42A 1LHZA 3FONA 5F93C 3GIVB 1ACYH 3SQOH 4X7TB 1KCVL 5JDJA 2I5YL 2VDQL 4KKBD 3OGCB 5F9DC 3R0NA 2IG2H 4XNYL 3LKPA 3CUPA 3SBWA 3HZMB 4X6FB 1QSEA 3VFSA 2WNGA 3EGSB 4OJFL 4GW1B 1HHHA 4YLQT 2X1PA 5D7LB 1WBXB 4TTGA 4TNVK 5I1IH 3VXRE 1YPZA 4L1DA 5E08H 2DLFL 1RUAL 4PY8J 2B1AL 2C1PB 1I9IL 5DEFB 1QQDA 4XCFL 4GKZB 4HIJB 3MGTB 2BERA 3SDXE 2FR4B 2DWEB 3VXRD 5ICYA 4JFED 4I2XB 1MI5E 5CILH 4YHZL 4WW2C 3KYAA 4PJAA 3V0VA 3GJFK 4K9EC 4PJEB 2VUOA 1KCUL 2A6IA 3CUPB 1S9KC 5T5NF 2IPUK 3MRPA 2VB5A 5C09D 4XPHL 2FATH 3ZE2F 1IAKB 2BVPB 3O2WH 3DARA 3GMQA 4NQDA 2DAVA 1IQDA 3PL6D 4ZO6A 4BA8A 3N9GL 5TPWL 1T0NA 5HDQH 5B3JE 2Z0BA 3L3GA 1S3KH 5I0ZA 1LO0H 1YMMB 4OV6F 3IXAA 2JKXA 4YHPA 2BCKB 4W70A 4NUGH 5D2LB 5JW5A 5C9JB 5DZOA 4F7MB 4RGNC 3P0VH 5E2WH 4UQ3B 4Z7UA 3Q6GH 4FMKA 5C9JA 3C5JA 4OD1L 3PWPD 5C7XL 3LD8C 1G6RB 4NBYB 3SEPA 3QZWG 4NGHH 1CGSH 4TNWF 2P5EA 4UDTA 4OIBA 1A8JH 2HH0H 3VFPA 3MA7B 4CMMB 2Y72A 1NANH 3LHPL 5I8CA 1AO7A 4IDLA 4NZRH 1FBIL 1YNTB 3MREB 1FDLL 4NQXB 4D9QE 3WHE1 5MEQB 4D8PB 3QA3B 5I1GH 2DQCH 4S1SH 2X7LB 4HAGA 3PIQA 3S96A 1SJHB 4JG0L 3SKNB 4X7SH 4GKSB 5ICZB 3FQWA 4QHMA 4PJEA 3I75B 3EFDH 3TYFA 2ZPKH 3UX9B 4Z95H 3TVMD 4H26A 4PD4J 4LSRH 4KU1A 4KUCF 1A9EB 5E1AB 5FYJD 2WZPD 1EUTA 1ZXQA 5DEFA 3MJ9A 3GI8L 1FFNB 4RRPA 1LEGB 2MWCA 4FQLL 3D2UA 4RX4D 4M00A 3HMXH 4XBEH 1T4KB 5FM4A 4HPOL 1BVZA 3UBXG 2FLBT 4EOWL 4X6BB 2N1KA 5I73C 3LEVH 1WT5C 4YIQB 1RY7B 1QYGL 2BMKB 3H9HA 3C60A 3ULVE 4LARL 5TE7H 4AH2A 1URLA 4PREB 1OOAA 3QDGD 5I8OL 1SM3H 2IH3A 1JRHL 3SGKC 2XN9A 2QHLA 2JELL 2JCCF 3C5SA 1HEZA 3DRQB 5DEGA 3LV3A 3TPUB 3WL9B 1WZ1H 4PLJC 1AQKH 3BD3A 4Y5XC 4PLKD 2OK0H 1T21A 1QEWA 3QFJB 2RJMA 1IEBB 3BPNC 1UZ6E 5DEZA 3MLYL 3E2HC 3PGFL 4P5KB 2D7OA 3L3IB 2MOVA 4Y8DC 4LLYA 3ZDYF 2GQHA 3H3PL 2H2PC 3VD5A 1KEML 2P49B 4X0KA 3D25A 3GSWB 3VFUB 4P99A 3BE1H 1KCSL 2C7UB 5HHPA 4R8WH 4NP4H 3IJSB 2V2TA 1EBAA 4KMLB 4GW4B 1BWWA 4FXLA 4HCRA 5JXAH 1TETL 3RI5F 2F15A 2R8SH 3MCG1 1INDL 1IT9H 5HGGS 3CCHB 1U3ZA 2WWKO 4QOKA 4AEHL 2PO6A 2V5RA 3HUJB 5IWLC 1HQ4B 1FCCA 3G6DH 3I02A 3DWTA 5I2IA 1FRGL 4KHXH 4PRHD 4UQ2B 1IGCH 4KKNA 1KB9K 4DTGL 2X4NA 2AI0L 3GM0A 1WIOA 4U7SA 3HZYB 3ZKXB 1T3FB 4P23C 3T0XA 2VE6B 3CFDB 1HYSD 3ARGC 3IF1B 2FX9H 4K3DL 1J1OH 1UEYA 3VXUD 5FYKH 4OCSL 3QCVL 1RZ7L 2Y5TA 1KELH 5C0BE 4EUPG 1GAFL 1RULL 4JFEE 1S7WA 2CXKA 1QPXA 2BC4B 5I75C 3UO1H 3DRTA 3TYGL 3OR6A 5DDHB 1OP3K 1Z5LA 5EOTB 3RVUC 2YD5A 5E1HB 1WWAX 5F8RC 3ULSA 3S8WA 3L3DA 5ID0B 4L4TA 3OZ9L 5JW4Q 3BPOB 4PUBL 1T1YA 1B0WA 4WDIA 4MQXD 3S36X 3T1FB 4N8VG 4NYLA 5L2KD 5E7FA 1BREA 2HP4A 1U6AH 4ZXBB 4IOFD 3DIFA 4LSVL 3LOWA 1U8HB 4EQ3A 1N5AB 2DMKA 1AGBB 1NC4B 2FEDC 2FD6L 5DD0H 3V0WL 2AEIT 2FX7H 4UTAL 1V7ML 2B1HL 5MENE 4KTEL 3UJTL 4J6RH 1JZ7A 3GBLA 1FO0B 1BJ1J 4OKVA 4TRPL 4LCYA 4I3GA 5CJQH 5IF0A 1KTLB 3TP4A 2VLRE 4WTZG 2H26B 4RISL 1UEMA 1RUKL 2AK1H 3V8OA 2CLVA 4NO2B 4PS4L 3NGBC 2BHYA 1M1SA 5ACZB 3B6SA 4GRWE 4HX1A 4PJ8C 2A9NL 5FKAB 1XF1A 3D2UD 4RX4A 5C6TH 3DGGB 6CGTA 1QLRB 4TVPE 1WAAF 1T2XA 4IRJC 4MQTB 5E8PA 1NGXA 3TFKC 3FRPA 1AGCB 3LSOB 2B2XH 3UTPE 4NO5A 1U36A 2BVQA 1NFDF 32C2A 3ZYIA 3GMPB 4KHXL 3GGWB 4OZFG 3ES6A 3MRKA 5GRJL 4O4YH 5B39G 2BNRA 4U1IB 2WUCH 2VR4A 4HFUL 4LMQE 3QG6A 4GRLA 1FL6B 2FGWH 4UNTA 2C3XA 1CLZL 5DQDH 3FHQA 4JE4B 3UJIL 5D2LA 1ETZA 2DMCA 1FLRL 2QSCH 3NIDE 1A9EA 5E1AA 3NCYP 5D7JA 2OX5A 2Z8SA 1GGBH 1XGPA 3GMNA 3RWGA 1XF5B 2NY6B 3S34H 5F7WC 2PKDA 5E8NB 4WFGD 3NIFF 1MCIA 5ESVB 4DZBB 4KTDH 4OB5H 4DKEH 5KVEL 1I8LA 4MCYA 5C08A 4M8QB 5TQ0H 3UPAA 4C57C 1S7UB 5LQBL 1CVRA 2AJZB 5DWUL 5F7HA 3A0OA 4JKKA 4D8PA 3ARRA 1JGDA 1PKQB 4YPGA 1NC4D 1JPSH 1VEOA 1EH9A 1A6ZA 1KXVC 4N90D 4CBPA 1KULA 1HEZB 3TPUA 5DHXB 4HJ0C 4ODHH 5IVNA 4NFDA 4NQED 1U3YA 5EZLB 4XNMA 3SKMA 2YD1A 1RZGA 1D7FA 1AP2A 5IT2L 4PPTA 3TZVC 5CS7A 5IB3B 1RVFH 2EDLA 3KPRA 4PJXA 2C1PA 2M26A 3QUZC 3R8BB 2WQRA 2VLMD 5IK3B 3VGBA 2AW2A 1ZHKB 2DQGL 3IXAB 2DMBA 4YK4C 2CGRL 5H8DA 1T5XB 1U0QA 3EGSA 4CKVX 2VLLB 4H5SA 3MOBL 3L3HA 1OQXA 2YD4A 3TJHC 5C07A 4BH7B 3EYOA 2CMRL 3W39B 3I75A 1GZQA 2AAVA 2E7BA 4G6FD 4AM0A 2GFBB 4QY8A 2VDML 2D7NA 3VE0A 15C8H 3CK0H 1J8HA 5D7LE 3OXSB 5FDWB 5KSBA 1X5GA 2LU7A 3PWPE 2IGFL 4QHKJ 4P2OC 5T33H 3MV7B 2D31A 3QUMH 4NM4H 4WV1C 4ODWA 3S37L 3GSXB 1DN0B 5IIEA 2D9QB 3TCLB 3ZTJG 5FM5M 3SDXB 2VLRD 1WITA 1GIGL 1G9MH 5F1IB 4HF5H 4CJ1A 5TF0A 4MAYA 4Q6YA 5C7XH 3P30L 4AEHH 4PLKC 35C8L 2HN7B 2VLJD 4NWTH 3IDXL 1ZGLM 2VERN 3CZFB 3UDWC 5CEZL 2LTQC 2R0WH 1DBBH 3GSNH 5K9KA 5FKPA 3RVTD 2R1YA 3HTLX 5JOFA 2E9IA 1YECH 1JFQH 4FOMA 3EZJB 4HH8A 4PJBE 2H2PD 1INEH 1YEFL 2VQ1B 1GC1C 5MP6L 1AQDA 5FM8A 1H3VA 1T66D 3L3JA 1J9CT 2E9BA 4D94A 4N0FB 5TDOA 4FQ2L 1SQ2N 2AQ1A 3HS0A 4TUKH 3ESUF 3UBXB 2JB6A 4NQCB 4FXGA 4N1CA 3ARZA 3PF2A 4QT5A 3MOAH 3G04B 1FSKC 1W72B 3BD4A 2Z4QA 5DJYB 5L0QB 3TJEL 1KENL 5CKAA 2EKSB 2FD6H 2QQKL 4PJ8B 3B8YA 5LCVL 1U8PB 1EEZA 1EAJA 4PJ8A 1P2CA 3WO4C 1KLGB 2IFFL 1JI2A 1I1AB 3PDGA 5BCAA 4UAOB 2ADFL 1IEHA 3JWDH 4NM8L 4M6AA 2VWEC 4UZGA 3DX8A 3GFUA 2A6DB 3U0TA 3KR3L 4P9HH 4H0IA 4ZS6C 2Z35A 3D85B 3DHMA 3HZVA 3LS4L 2FZ3A 2GSGB 1MHCB 1AXSA 1YMHA 2P1YA 4J3VA 5AZ2L 3EKCA 1WFOA 3HLAB 1MJ7L 1J0ZA 1MRFH 5HVWA 5TFSH 1UWGH 3T4YA 3RWEA 3ZT6A 1GAFH 2XZAH 2ADJB 4G80A 1EO8H 1IKFL 5DVKA 4GLRH 4Y5YC 5HI4C 1H3GA 3NBNA 1K8IA 3SGDH 3SQBA 1OP3H 4JG0H 3UC0L 4FFWC 1PSKL 3GRWL 5D7JC 1RZGB 2XQYK 4DOHB 3EOYG 4KV5F 4MWFA 2B20A 1GGYA 4K94H 1FDLH 5CP3A 1RHHB 4F7CA 3QDHA 4PJ9C 2VDRL 5AUMA 3VWJA 2ZUUA 4JFDB 3VXMB 3RJDA 3D0VA 1I1AD 2P47B 1DANT 2HT3C 4PRIB 5JHDA 4Z7WE 3ARGB 3BW9A 1F4XL 3K4AA 4JFOB 4AY0A 3X12A 3QNZA 2DS4A 5DQ9B 5JHLL 2QJDA 4HZLB 4P4KA 1KJMB 5KSVB 1HI6A 3DYMA 3J7HA 4ZD3L 3Q48A 3V95A 5F89A 5JR1L 4IIQB 1B3JA 3ULUE 2W9EH 3EUUA 4X5LA 3QUZA 2X4PA 2V7HB 2F5BH 3CXDH 1YDPA 3VXNA 1WWCA 1X5LA 1PVHA 1SYVB 2ARJB 2NZ9C 2B8OT 2W0LA 4WI5A 2E7LA 1SJEA 2NPLX 5HHNB 3RVXC 1I7UB 5D2NB 1ADQA 4OZFH 4UUJA 4X8JB 1ITBB 4Q9QL 1BD2E 2GY7B 4U3XA 1MY7A 5JZ7D 1UQSA 1DLFH 2ENYA 3RDTC 3KWWB 1MCEA 2NTSP 3CCHA 4GQPH 3HN3A 2OP4H 1MCWM 3WLWD 1I9IH 4HLZH 4LBEA 2APFA 4GBXC 3CGTA 1EO7A 5E08L 4R9HA 4DVRH 1JPST 4ELMA 1J0HA 3MR9B 1P6AB 4PGZA 3QHTC 2X4RA 2NXYC 4PJFA 3ILQD 1OAXL 3K80A 5DVLA 3SJVD 1CD8A 3QG7L 1MHEB 3WXWL 1A21A 2DQFA 1BQLH 4JZOA 1FIGL 3FZUD 5F7FA 3L3DB 5ID0A 3UTTE 2DM3A 5C0CB 4M61B 1AGFA 2AXFB 4DW2L 5EOQL 4KMTH 1F3RB 3P0YH 2ADIA 1UACH 4YR6B 5C0BA 1ETZB 1JNLL 4WI8A 1LD9A 3H0TA 5KN5B 1V3KA 3CX5K 3AY4C 5CJQL 2KQNA 4WO4C 3WD5L 3HAEG 4AG4H 3QDGA 3RY5A 4UIMB 3DO3A 1TITA 4LCWB 4LIQE 3V5DA 3DIFB 5CJ5A 4IBLT 4IOSD 4MXQD 2O5YH 2ZCKL 4H8WC 1I1CA 5ID1B 1S9WA 5IB5B 4JR9H 2XXCB 3DBXB 3LH2H 3TNNA 4LSVH 4PJGA 2FSEB 1CQYA 3CFCL 1PQZB 3T0EB 3P9MB 1QRND 4JPWL 4JJ5B 5C0AE 4QNPF 5DRNA 2HRPL 2O93L 4FQXA 1W0WA 4KI5C 4GXVL 1AGFB 2AXFA 1WCQA 4JRXD 4OD1H 2WUBL 3FB6B 5I1JL 3N1PC 4GUPB 4RQQA 4YZFE 2D7TH 3MRMB 1RIHH 2AJYL 3RKDD 1MHEA 3V52H 1RIVL 4DEPC 3TESA 2VABA 1JE6A 1UKTA 1ZLWK 3NA9L 5DC9B 5D5ME 5A2FA 1L7IH 2AJSL 5CJOH 1NGQL 4V2BA 1Q1JH 4HULB 2J8UE 4OKVB 1S7VB 1T3FA 2IAMA 4H20H 3GHBH 2X4NB 3WNOA 2EECA 1ONQB 5ERWB 3QXUA 1T1XB 4S0SD 5IFJB 4BFIA 4X6CB 1CR9L 4FQQB 1PW3A 5GS0L 3BUYB 4HS6A 4DQOH 1P4IL 1EO5A 4ZUWB 1JHKL 2Y9RT 3PWJB 4O5LL 5ADPL 1KUMA 5F9WC 4Y7MA 1X7QB 3T8XB 3VI3E 1I1FA 4O5LH 3G6JB 2UYLB 5CD3B 1OAKH 5KVDH 2O5XH 3C5ZB 4TSAH 2ZUVA 4Z7VF 4XB8A 1INQA 5FHBL 4LKCB 4K07A 2G60H 4S2SA 4OZ4A 5EOTA 2EYSA 3UBXA 2ZZUT 5B39B 1WFTA 3QWRD 5D71L 1JP5A 3HKFA 4PBWD 4WI4A 2XKUA 4QRUA 4EUPA 4WFGE 5FK9B 1FJ1A 3RWCB 4G80B 1IGMH 4FQ1H 3D3VA 3HG1D 5DJXA 5CLWA 1FORH 1SYSA 1NPUA 2Y5TB 3QPXL 2ITCB 3BP5B 2NXZC 3QP3A 3QZWA 3CFBA 1MCNA 2VZSA 3O4LE 5DD3L 3CFDA 3IKCA 2EH8H 4YNYB 2VWEE 4XMKL 1T2JA 2DQTH 5D7IF 3B2VH 5J6GB 1OSZB 3LEYH 4LASL 1M7DB 4D0BA 1JYVA 1XCTB 1UXSA 5ESQA 3OKDB 5IMOB 3N85L 1XGTA 3HR5A 5B21A 3SDYL 3TZVA 1R3KA 3N85H 3ULUF 4NQVB 3WFBH 2P5EE 5CEZD 4N9GB 2MCG1 4UT9L 5DMYA 4Z7VB 5B4MC 2G5BA 3KYOB 1BZ9B 2R1WB 3H42L 4IDJH 1JNLH 3VFGL 2VIRB 1OP5K 4K3JH 3QISA 4FXGB 5EOQH 2ZCLH 4YDJB 1BLNB 4P46B 3RVVD 3WIIH 3M1BB 4XNXL 3T2PA 4U1JA 5IVZA 3RZCB 3TYFB 1J18A 4MLSA 4F33A 1KACB 3HZKA 2YUWA 3EOBA 3PQYA 1ZHNA 4ODSL 1EDQA 4B53A 1F45A 5D7KD 1JK8A 4R26L 5B3JF 3NFSL 5HVGB 4XWGH 4P5MB 4I2XA 3AS1A 4WEUD 3JSSA 1FNEB 5GGSB 4JDVA 5I9QB 1C12A 2ICEB 4Z0XB 1HH9B 3DX8B 3O6KH 1T1XA 4BZ2L 5JXEC 4N0UB 4QHKI 1FPTH 4OLXH 4AH2B 4PRNA 4XAKE 3NFPA 4PRPA 2X70A 3RI5K 3IDIA 3L6FA 1CR9H 4Y19D 2BY3A 3KPLB 4YPGB 4UIKL 1EEZB 1NUGA 5CGTA 4LIQH 1P1ZA 4H20L 5C8JA 5I1HL 5HHXH 4DZ8B 1KTDA 1S3KL 3FCTB 1JHTB 3OX8B 4F2MB 5E5MB 2QQLL 1KB9J 4MDJA 1A0QH 3DUSB 5D93B 4Y19B 2XT1B 5SX5K 1EFXD 3H42H 3PXJA 3TV3L 3ZTNH 3Q3GB 5FUOH 4HH9A 2R0ZL 4O9HL 1MFAH 1Y6KR 2V9QA 2GY5A 4N5ED 1A7PL 3SKOB 3QI9D 3IXTB 4N8PA 3A6OA 3U4BL 4HG4J 3RBSA 1ZLUH 5DMIH 2NY6C 3KLDA 3QFJD 3IKKA 3QRGL 3I2CH 1KIQA 2C4XA 4TOYL 2ZP0T 3IS1X 2HJLB 2WW8A 1MJ8L 4M93C 5ENWB 3RU8L 2HMID 3SKJH 5DJ0B 2PNDA 1QFWI 1RMFL 2VXTL 3G5XB 4G5ZL 2D0FA 1S5HA 2ZSVB 5C07B 3IAQA 3WKMH 3B3IA 4NJAH 4ZYKA 2PXYD 4GBXD 5FYJU 1SY6A 5KSBB 4HIHA 4BZYA 3BGMA 3UAJD 3QPXH 1JK8B 3ZKMD 2P45B 4KZDL 3EYFB 4MDIA 4P2RA 2VTFA 3SDAD 4X9FA 3NCJH 4FRWA 5C0DB 4LCCA 1TLKA 5IFJA 4XP1H 3PV7A 1S7SB 3BQUC 2FECI 1IJ9A 1VFAA 1C1EH 1IRAY 1L7TH 1CFVH 4HUMB 5FA4B 4XC1L 1OGAE 4LLDA 1GC1H 4X4ME 4YH6A 1FZMA 2NYYC 4WFED 3MLTB 1H15B 2IANB 4I9WE 2V5SA 3MLUH 5IHLB 1HYSC 1MQKL 2CLZA 1DLFL 1ULVA 4MQ7A 1LP9A 3STZA 3ZDXE 3NH7L 4X7DC 2YSSA 3A6BH 3LMJH 2HJKB 3QH3A 1NDMB 3O6FD 3LN9A 2HFGL 4EDWH 4IMKA 2ESVD 4EN3B 4I5BA 4JDZB 1ZA6A 1B0RA 5KSAA 2L4OA 3VXSA 4IEFB 2BJML 2AXGA 5DSCA 5D1QC 5HHOD 2E3VA 1CFQA 1OW0C 3F7QA 3CLFL 3BO8A 2LU4A 2P8PB 2W9EL 2QQLH 2HAZA 3G5VA 4ZUUB 4M6OL 4MD5A 5A43C 4PRIA 5JHDB 2N7AA 4WHYG 2VITA 5FCUH 5C0RL 1FL6A 1GGCL 3TEUA 2O61B 4RAVB 3WIIL 4PJIB 3DUUB 4KY1H 3G5ZB 4FG6D 3IDXH 1N64L 3ROLA 3VFGH 4LHJB 2OTWB 3HUJF 1LDSA 3GSNB 3U30B 4LPYA 2EH7L 3RPKA 1AJ7H 1U93B 4MNQA 4ZTOL 1W0WB 4RAHA 2D0GA 1G9ML 2G75A 3TBSA 1KBGH 3VMOA 1JZ3A 1A7OH 4OFKA 1PX4A 5I1LA 1UB5B 4LMQI 1QTYT 4LLUB 5EIIB 2HG5B 4OI8A 3SDYH 4ZTPH 1H3PH 1X4ZA 4GKOA 2X4RB 1RIUH 4QHUB 3HI6L 1PEWA 3O4OB 4MVBC 4POUB 3RUGE 1D6VH 4KVCL 4JFFA 4KKAC 4Q2ZB 4UIMA 1PZUB 1QRNE 5I6XB 3HPJB 3HR6A 1N6QL 2XWTB 4Z7OE 1IEAB 3X13A 1OAYL 3P0YL 4JFQB 2QSVA 3ULSB 4AIZB 1T80A 1FORL 5DYOA 3STBA 5GGRY 3VXQB 2ORBL 1A3QA 1O0VA 3KXFB 4HIIA 2R1XA 3S4SG 2XWBB 2YD7A 3MV9B 3FB7B 3BN9C 5E00B 3WXWH 3GSVA 4KJYA 2W92A 4TYUA 5ACZA 4YHLH 1P2CB 1WV7T 4GRWF 1JGEA 4ZPTA 4KK6D 2XACC 2X5PA 5K93A 1E28B 2YA2A 3IFLL 4XPTH 4KDTA 5DUBA 3WS6C 5EU3A 3X14A 4MA7H 4Q74A 5EBWA 5ESAA 4XP9H 1S9VB 1DBKL 4HZLA 5DA0B 1QFWL 3SE8H 2MJWA 3PGDB 1FLTX 2P4AB 5C09A 3DVGB 2NXYB 2ZOLB 2IQAA 5HHQB 3ZSSA 4JY6B 1I8LC 1XR9B 2N7BA 1PYWA 4YHYB 5DJCB 1NGPH 4K71C 1WBZA 1XCQB 2ITDB 4WUKL 3RVWC 4MJIA 4OQTL 4JO4H 3DVNB 1G6RL 1WGOA 4PJ7F 5C0ND 5BOPA 4LGRB 4MB4A 1WIUA 4LLVB 4MNQB 5HHPB 3V6ZA 4IRSC 1F3DJ 4N68A 2CRYA 3TZVD 4UQ2A 25C8H 5IQ9A 1S7WB 5E24E 3LB6D 5T5NG 3VG0L 3P3YA 4NO0D 2OXGA 4ELMB 3PV6A 1DR9A 2X7LA 1HQ4A 4TSAL 5EDXA 4A2LA 3T2NH 2E27L 5IKCB 3TF7C 4XVSH 1QA9B 3TO2A 3FCTA 3QEQA 3C60C 5K9QG 2N4IA 4OSUL 2FNBA 1ORQA 1PJ9A 1F3DH 3ARDA 3KYNB 1F2QA 5MEOA 1F97A 3PGCA 5CJXC 2VN4A 5BS0A 4P5KA 1Q94A 4MA3A 5J12C 2YZ8A 4MA8L 2ZOKB 5D5MA 5TFSL 5DUML 1RUPL 3QI9B 4RNRA 4ELKB 3F12B 1FP5A 3OKNB 4RZCB 5HGAA 3ZT5A 2H9GA 1NSNH 1MCWW 5TGBB 5LGJA 3LD8B 1KC5H 4NUJB 5FYKU 4ONGH 1QVOB 3O3EA 1MWAL 1EJOH 4WFHD 3KNBA 1V7MH 2B1HH 3C5SB 3WLBA 5I1KL 2W9DL 3TBTA 1MFEH 3O8XD 4N0FA 2QQQA 2MCPL 3QWRA 4GXVH 3D9AL 3T1WA 4M6NH 2MQ3A 4U6XA 1MLBA 4IOIB 1ES0B 3OXRB 5IT2H 5LBSH 4X6BA 4H1LH 4HEPG 3QEUB 4XHQA 5INCB 3MRJA 2RBLA 3C6LD 3QXWA 5F97E 3QXVA 3D9AH 1FYTA 1R3IL 2Z93A 4I4WB 3QUKA 3LQAL 1AO7D 4DGVL 5A1AA 4RWYH 5JW4M 1T66C 4HFWB 1KLFA 2BSTA 3O3AA 3MUY1 4PYHA 5K9JH 5F88A 4KVNL 2VL5A 3EHBD 4ODTH 2ATPB 2PXYC 3D1MC 4HBCH 3VD9A 1BQHA 3P9LA 5FO8A 4S1DC 4OBSA 4M9PA 3U7YL 3RKPA 5F72S 1YEFH 4GKNB 3SKOA 3KLHD 4U1HA 4GSDL 1XIWD 4FTVE 1A6WL 4A6YA 1FLRH 3OMZA 4JDTH 4LDOB 1FSKB 1A6UH 4HK0B 3X3FH 1MJJB 4UMGA 3O6FB 1OF2B 1HIMH 5J1AA 3DVIA 4LF3B 2AXHA 3PDOA 3FTGA 5IMLB 3BQUD 3DPBA 2JJUA 1DE4A 4P3DA 2AV1B 5K33A 3ROOB 3QIUC 2BHUA 3MBXL 4RFOL 1HHIA 5FUZL 5DJ2B 2F58H 3UJJH 4YXKL 4ZS6D 5JW4R 1ORSB 4LPCA 5DFTA 3CDFA 4L8SB 2NMSA 1P1ZB 3HNSH 5CMAB 2BHZA 3C09C 3L3KB 4JG1L 3ME0A 1FV1A 1RJYB 2XTLA 1F90L 1UC6A 3BIAX 2HKFH 4L3AA 4LQFH 4OGZA 3SO5A 5FFLA 1KTLA 2M1KA 3IYLW 2DN7A 3CDGA 5C6TL 4Z7VA 4X98B 2Y23A 2I9LA 4WV1B 3MBEA 2UWEB 4WWKC 1KEMH 3Q3GA 2YPLE 7CGTA 4ORGA 4FQIL 5E2VL 3OKDA 5IMOA 3BIKB 2P5WE 4L4JA 2VLLA 3RQ3A 5CZXC 4I18C 4ZXBA 3I6LD 5TDNA 1WZLA 4M3KB 2J3SA 1OB1B 4LHUA 3ESVF 2K7PA 4DZ8A 2OK0L 1FYTB 3FONB 4ZSOA 3V4VH 2H32H 2DWDA 3F5WB 2J8UF 4URTB 2R0KH 4PJAE 2DKMA 4YDJA 1SYSB 4ZOAA 3VXSD 1KBGL 4YUEH 4QWWC 4CN1A 5FGCE 3RWDA 1ZVHA 4ODHL 2NY3C 3UTZB 4GW1A 5T3ZH 2I27N 2BOBA 4XBGA 2MMXA 5I18H 4PRNB 2AK4E 2CKBL 3HZMA 5DD6B 2XXMB 3VRJB 3DJ9A 3GKWH 4NQVA 5D7IA 3KDMB 1NFDE 1GGCH 4HC1A 5FV2A 4CVXB 4ETYA 5B8CA 3MYJA 3FO9B 3HR5B 3TZVB 1MUJB 3TA3D 5IESH 4MA1B 1YPZB 5ALCL 3GI9L 3N1FC 2YD3A 3KLAA 1OSZA 4LCCC 1CICA 5F3BA 4K23L 5I1DB 4Q97A 3U2SB 1VADA 3MQIA 4DAGL 4OCSH 4F7EA 5HI4D 1TJHL 3IAGC 1HHGA 1MFDH 3V6FA 1A22B 3U46A 5TF1H 3TVMC 1LMKA 2Y7QA 4LPVA 4QO1A 4JZJB 4HKJB 4O2EB 2WM0A 4WW2B 3WO4B 1B4RA 1RJZB 1JTTA 1BM3H 5FGSA 4HJGB 3WIFA 2ZUWA 3BH8A 5ECJE 4QRRE 2NXYD 1E4XL 4X7CC 2DI8A 1JF1B 3VFRA 3IT8D 1RJYA 5DD1L 5DUBB 4HHAA 1C5BH 3OQ3B 1MI5B 4Q6IA 3EOTH 2DIBA 5F7KC 2J2ZA 4LLQA 4I48A 3IU4L 4K71B 4KI5E 3TJEH 1BVLA 2XWBA 1IAMA 4RGNE 5JUEL 4F80A 4XNQB 4JDTL 5I1CL 3T0ED 3QPQC 3SY0A 3MRFA 4GSDH 1M71A 3L3OA 1I85C 4M8QA 5HD8C 3RVWD 1T22A 5CBEA 2HT2D 3RTQA 3ALXA 4I13B 4G3YL 2V5TA 1U8MB 4P5TC 2NZ9D 1G9NH 5J3HD 2XN9B 1W72H 2BSED 3DSNA 5BZWA 2IAMB 4E5XB 1JPTL 2HG5A 1FJ1B 1BVKA 3TPKA 1J1XL 3EYUH 1JF5A 4HGWB 5CHNA 3TN0A 2IBZY 5L8KB 3GHEH 3KAAA 3RZWA 5CEXA 3U0WH 5T1DL 2OXHA 2BVYA 1SVCP 4M1DL 1UWXK 1EEYA 1CDUA 4S1QL 4S1RL 1YC8A 4LARH 4XP4L 5IBTH 5GGSY 3H2WA 2CXGA 3IGAB 4XVUC 5J4MA 3C5ZA 1T04B 2Y07H 4X83A 1K4CB 4XBEL 3MJ7B 2RCSH 1NBYA 2VITB 3NCJL 1TCMA 3MRFB 1LO4L 2EXYC 4KHTH 4NZTL 1QRNB 4FA8A 1N7ML 3RUGA 4OV5A 4W4OA 3CVHH 1G7PA 3NFNB 1ZV5A 4JM2A 3KJ6H 1UA6H 4YBLB 2I5YH 5BVJB 2NY5C 3KXFE 5CD5C 3G6JF 1FNAA 3QHFH 4ODVL 5GGRA 5H2BA 3L7FA 1QFUH 4Y1AD 3C6LA 4WI6A 1J0IA 1D6VL 2GIYA 1IVLA 2GAZB 4MCZB 4HS3A 5CSGA 4S1SL 2ADIB 4MXQC 2V2TB 3OF6A 1MJ8H 2AI0H 4UNVA 2VAAA 4OT1L 1OT2A 2FWOA 3GSVB 2BRQA 1IGCL 4YBLC 7FABH 4X0KB 4KPHL 4NZRL 1BVKB 4L3CA 2HWZL 3VFNA 1MCQA 1F4YH 4RFOH 3RTQD 5EFIB 2OTWA 5EC1A 3S88H 1LDPL 4JN1L 2ZKHH 3K81A 5HGDB 2RGSA 4KJQC 1IT9L 1BGXH 1MH5A 5GZOD 2YS4A 4Y16C 3JTTA 5FV1L 1IFHL 4NC0B 4OV5B 2KPNA 1X6LA 4HWUA 2NW3A 3BKCH 3RA7H 4XNQA 4EQ2A 2IMNA 2QADD 3DECA 5L8JB 2JJWA 3B3IB 3T2OA 2FX8H 4JO4L 1QFWM 2M2DA 1CCZA 4HBCL 3WFEL 3WNKA 5DGRA 5F7DA 1SEBA 5EWIH 2NTFB 3EFFA 2ARJA 1U8PA 4PG9A 3KJ4B 4BKLB 4O02H 3CX5J 5C0CA 1NDMA 2DLHA 3FT3A 4F57L 2A73A 2V5YA 2OSLA 4KI5F 5CILL 2APBA 3MO1A 3R1GL 1G7JB 3MNWB 2JJTA 3X12B 4XRCA 4NPYA 3UYRH 5HHOB 1NCUA 4V1DD 1AXSB 1YMHB 3CSGA 4M5ZL 2FH6A 5A2IH 4ORGB 2FBJL 4G42B 4BELD 5M7QA 4X6DA 1A7QH 1KLUB 4P4RA 1II4E 1YYLH 3RY6C 3RTQB 3E6HA 2FHCA 4ZFFB 5I1AA 3MRBB 4C56A 4L4VA 1IGML 4FQ1L 3TO4B 2VISB 2JCCA 2A9NH 3FQNA 4XNXH 3PHQA 3QXAB 1D5BA 1PGRB 3K8MA 3B5TA 4LSUL 4DCQA 1BFVL 2ID5A 5F9JA 5BMFH 4G43B 4D0DB 5SX4I 1C7SA 3MV11 4XVTH 5JO5A 3IAPA 1TNMA 2WSKA 3FFDA 5DZNA 4UT9H 5LG1A 5CZXD 2JJSA 2EE2A 2F54B 1P7KA 1FFQA 3CD4A 4YO0B 5AWNL 3X13B 2DQCL 3HE6B 2Z91A 5FGBC 4BZ1H 2YC1A 4OM1L 1SVZA 1DJSA 4JY5H 1CGSL 1FO0H 3PJSB 4H8WL 1XGYH 3MRHB 8FABA 4XMKH 1JPFA 1JYWA 1NBVL 3P4OB 3F58L 4RIRA 3FB8A 5DK0B 5GJSH 1VADB 2H3NB 1QSFA 3WSQH 3HZKB 5D7IE 2OQJB 5I75B 1NGQH 2AKRA 1FZKB 1Q9WB 3W9EB 3GM8A 1ZHKA 3UP1A 4P23A 4DEPB 1OF2A 3BISA 4XXDB 1MLCB 4F7PA 2ZSWA 2AEQL 1KIPA 3QR2A 4RGMC 1YN6A 5DHYB 3THML 3GSXA 4PRPE 2ZSWB 2XWJB 4HCRH 3VXRB 4F8TA 5I1HH 1OAZH 1QSFE 4OCRL 2IAND 2WUBH 5I1JH 4NQDB 2E7MA 3E6FA 4XNMB 3SKMB 5BVPL 5F6IB 3H9SE 1KJ2B 1DBJL 4YBHA 4X8XA 3A6CL 3D6GA 3P9LB 5FO8B 4HLZG 1OWWA 5A16B 1ORSA 1FNLA 4JPWH 1R3KB 4PJ5B 1P6FA 1HHJB 1NGWB 4ALAL 1Y6NR 3PWLB 4I2XE 2W91A 1X5HA 1HHJA 5JXED 1YEJL 3A6BL 3JVGC 4MD4A 2PCPB 1M7DA 4D0BB 2AJVL 4CNIA 3HC3H 2J6EA 1BD2A 3QIWD 5JOFB 5TH2A 1KB5L 4IRZL 4CW1A 4LF3A 5IMLA 4KAQL 1U95A 3O6FA 4ZO7A 4J3OC 2AJUH 1IC4L 2PTVA 4CW1B 1QBMH 2H8PB 3ZKMC 1BPVA 1GC1L 3L5IA 4YE4H 4BJLA 4JM2F 2HJKA 4P2OD 1YY9D 2YUZA 3QI9A 1GCFA 4XPTL 3TBWA 1YMMD 5JNYA 2P8MB 4ZAKB 5D8JH 1MLBB 1NMAL 3IFNL 4WFFD 3U9UA 3MV8E 4P4KD 5E4EC 4S10A 1OTUC 2R8SL 2JIXA 4WO4B 3L6FB 3DUHA 4HDIA 1CI5A 2ESVA 1KJ2A 5FO9A 4IHOB 3QEGL 3NA9H 5DGQA 2EYRB 4I0KA 1AP2B 2W65A 1TVBB 5DJZB 2VIRA 4K8RC 3QEQB 4AK1A 2A9ML 4XCCH 4XXDA 5IMMA 4QGYA 4Y4KC 3TBYA 2BVQB 4OZHF 2EDNA 2YK1H 4E0RA 5EO0A 3KLSA 1SBBA 3RDTB 4BH7A 3BAEH 2KQMA 4HIEB 1F4WL 3O4LD 5E8DL 2CD0A 4TUJB 5AAMA 2CH8A 2NY6D 5HTSA 1WZ1L 1UXSB 4FQQA 1FBIH 4Q9QH 2W9LA 4F57H 3U4BH 1RK0B 2BFVH 1A7OL 3M1BA 4WVRA 5E2TH 1TJGL 2XTJC 5HHVH 1DDHA 4ZXBD 5J1AB 1LO2L 5FUOL 2BY2A 1EFQA 3OKNA 4R4NC 4A6YB 1MHPL 1MY5A 2VISA 2ITCA 2FX8L 2ZUQB 3HMXL 1A7NH 4L29A 2OM5A 1CTNA 4DKFH 4ZUSA 1CBVL 4ZFOL 4PYGA 4XCYB 4QHNA 4PJCE 3W0WE 1NC2B 1UWEL 3QG7H 4L4VE 3ARDD 3KS0J 4WGVB 4K2UH 2YKLL 3DYPA 1MIMH 5INDB 1CFNA 1XCTA 4NC1E 3IDMB 4OD2B 5ESQB 2AKRB 1X5ZA 3O3AB 4YHMH 4G6AC 4ZDHB 4NWUH 4DN4L 3CFIC 1JF6A 2VL4A 4QCIB 3TNNB 2YMXL 5HYQA 4QRPE 4JY4A 2VDRH 1J0JA 2EDDA 2GCYB 5HGDA 1XF5A 1FL5B 1QUNA 4PJHB 5GSVA 3VXTB 3ZKSD 5LWYH 1H9VA 4P57A 43C9A 4PR5B 3RHWF 1I1YA 3KHOA 1T1ZA 5T1LA 4QRPD 3IDGA 2UZIL 4HUWB 4PRHB 3ZDZF 3WN5C 1XEDA 1J86A 3AVEA 5AYUH 3VFMB 5BVPH 3ULVF 4OIIL 4YHML 2BNRB 4ETQB 4JQXA 4FQHB 4PJ9D 4NQSB 1R24B 2NLJB 4L4VD 4M43H 4GH7B 2QL1A 4RGNB 1UWEH 1MWAB 2HT3D 2HFFB 1NC2D 1EMTH 2EC9U 3RL2B 4WU7B 1TZGH 4K3JL 4N8CH 2QADC 4HUNB 4MJ6A 3FQXA 1HCFX 4HIIB 3BUYA 4NM8H 2GEEA 3QCUL 3HNTL 4BH8A 4E41E 2DKUA 3TH4T 4S1RH 1BF8A 4MXVF 1R3JA 4U6HB 4G5ZH 4G42A 1LVEA 1DLHB 5KTEH 4KI1A 2IADB 4NHUB 5FYLH 3RWJA 3HMWH 4FFVC 5FA3A 5DC4B 3PP3K 4QXGL 4M7ZC 3NZ8B 1Z9SA 2GITB 3CLEL 5F44A 5HHNA 1QLFB 2ZCKH 1AD9B 2P7TA 5FB8B 1G1YA 2ARWA 3SOBH 3VDBA 1D9KC 5K9OB 5TE6L 3TV3H 5GISH 3ZTNL 2C1OB 2IJ0C 1TPXB 1QR4A 2FGZA 3KXFA 3FAWA 3OGOE 1JPGB 3D69A 3OPZL 4P46D 5KS9F 1UM4H 1QO3A 1ZGLA 1A47A 2XFXA 1T04A 4R0LC 4Q2ZA 4PTUA 1FFPB 3ARSA 3BN9D 4GG6B 3FAXA 4K7PX 3LEXB 3FO9A 4OD3L 1EEYB 4OQTA 4ZUVB 3MUGB 1TJIH 1MFCH 5GRUH 1C5BL 4NQCE 1SEQH 3UYRL 4L5FH 5FYJL 4GS7C 2VRAA 1FZMB 2OLDA 4HUWA 1FAIH 1I3VA 5CJ8A 4J7RA 4YZFF 1ZLSH 3RX5A 4LVHB 3CFKB 3S7GA 5KVFL 3WIFB 1ZGLP 4U1NB 3BOVA 1LEIA 3O6LH 4H26B 1U3HB 4TVPL 3MLVL 3F62A 2W0FA 5CHNB 3QUXA 2X4PB 1E4KC 3BGMB 4Y8AA 3V6FB 1JZ4A 5BZWB 1HZHL 5INDA 3SGDI 3FQXB 5HI3D 5IHUL 3D85A 4G7VH 1L7IL 5E6ID 2R2HA 2F74A 2DYPB 3BIBX 3HUJA 3MNZA 3U7WH 5EBMA 3B9KD 1A7BA 4XC3L 3MNVA 3EYFA 2D7TL 2AV7B 3PL6B 5TE4L 1Z0MA 4LOUD 4K7FA 2W60A 4QHUA 1LO3L 1F4YL 2HRPH 5IB1B 3C5JB 4R2GC 4PB9H 2DM7A 4C59B 3MRGB 3QUZB 2Q8BL 5A2LH 5KJRL 3VXOB 4QRRA 5JPNA 2GJZA 3Q2CA 3L3IA 5J7CC 4YQXH 2V2XB 5HHOE 1KIQB 1RZKH 1U9KA 3F8UB 4E42B 5C6WH 2DQTL 4AG4L 4PJ9A 3MLSH 4F15C 2ZJSL 4GT7A 3QIUA 5FO7B 3BT2L 4KUCD 5DMGD 1I7ZB 1A6PA 4U0QB 3MOBH 4XBGB 3BKYL 4L3EA 1BJ1H 2OL3B 3GJEA 2EO9A 4HQQH 3MA7A 5BW7C 2QTEA 4WFEE 1N0LA 4K8RD 5D1ZB 3TFKD 1ZS8A 3O6MH 2C7UA 3D0LB 3NACH 1C16A 3MZTA 3QXDB 2B5IC 3K7UA 4P49A 3V5KA 2OZ4L 3GMMA 4PRBA 2Z93B 3NA4A 5HI5D 3VXPB 2L0DA 1CIUA 4XXCA 4WFFE 3U4EB 3V6OC 2Q8AH 4WEBH 5JLZB 1J8HB 3BP7A 3I9GL 4IOIA 1DQDH 5GZND 1IQDB 4JHAH 2ERJC 3OKEB 4C4KT 1KEGL 1EAPA 2XTJD 1S7RA 5TQ2L 2Y6SD 4TUOB 2DQEL 3EHBC 2IPTH 4OLZH 4W6XB 5T1KA 1UADC 3D18B 5C0CD 2NY1B 2RFXA 4PRID 4APQA 2OMNA 4OAWB 4R3SA 4FQJH 4OLVH 2QADB 1T5XA 5ALBH 1Z6JT 2COQA 1HSBB 1QBAA 2CIKB 5ILTL 1JFQL 4M7LH 2ZOKA 5D5MB 1VERA 2GYSA 1YQVL 2YBRB 5HJ3A 3LCYA 4CU6A 1IQWH 2UWEA 4P48A 2E6JA 3QJHA 1BQHB 1EHXA 5DJDB 2F8VA 4IIQA 4PRPD 4U1JB 5IEHA 1RZIB 3S88L 4U1SB 1AH1A 1FNSL 2OS7A 1MNUL 3MV7E 3H9SB 4J8RA 1KT2B 1CFBA 3ULUC 3VMNA 4JFOA 3NOIA 4GAGH 2UVFA 2MFNA 3QUZD 4XH2A 1P7HL 1NCDL 3LKPB 1LNUB 4UINH 5D96B 1GHFL 3GO1H 4JFHE 4TQEL 3WS6A 2GCYA 1LNUA 5T3ZD 2BXZA 3QDJA 4O2FB 3MREA 3AB0C 3D3VB 2HLFD 3O4LA 3EOBB 4POZC 4F7CB 3EDJA 3NVQA 2X41A 1T03H 3WN5B 1KCRH 4JKLA 3GI9H 2YRPA 2XPGA 2VXSL 2B4CC 4UDUA 3BZDA 5K59F 3QSKB 2J12B 3K46A 4K9EL 5J12B 3VFTA 3ZYJA 3W9EA 2WP3O 4UTBL 2NY7H 4EUPB 5T1LD 1IC7H 3UROR 3QUXC 5KANG 5D6CA 3SDDA 3T77B 2X70B 5JIKA 5A2JH 3GSRB 3O8XA 3P4OA 1BWMA 3DVGA 2EDWA 3L3KA 5IHZB 1U6AL 5EC2A 4KTYA 5CGMA 1B6DA 4OFIA 3GHEL 2P5WA 2D0HA 3QUKB 4ZFGL 4MX7A 1B2WL 5EBWB 3SGEH 1JGVL 4PV9B 2YA0A 4UOW0 5GJTH 4POYA 1X5FA 5FECB 4XX1E 5MERA 2EXWD 5GGQL 5E99L 4Z7VE 4YO0A 2E8ZA 5BV7B 4JRYE 3S36H 1J8HD 3PGCB 4M7LL 4JEGB 1Z0NA 3VW3L 3WCYA 1B0GB 2VXQH 4UDUB 1CK0L 3BP6B 3EO9H 3LN5A 4Y4FA 1F8TL 1T6WA 4DUXA 5CBAA 2IPTL 4PJCB 2ESVB 4EN3D 4EI6B 2R1WA 4PB0H 1BGXL 5J6HB 3ZT7A 1XIWA 1PQZA 3MRBA 2H3NA 2PUQT 2CJUH 4LCIH 3T0EA 1N0XL 4XMLL 3U9UB 1G0YR 1CL7H 1IBGH 2GSIB 4KK9D 2ZNXA 4ZFGH 3LQZB 3OKKA 4QF1B 2VDOL 4G6FB 5C08B 1JRHH 5C0AA 4X9HA 2PYFB 2IQAB 4LPTA 3LSOA 1ZWIA 1I7TB 2UZYB 3MBXH 5GS1A 4JM2C 1XGPB 1DN2A 4Z7WB 3VFVA 5FXCH 2GK0B 4MD4B 2GJ6D 2NYYD 3LRSA 2OSLB 2D03H 4PB0L 1YEDA 3QZWB 3LY6A 3I6KB 1A6WH 3QG6B 5CWSA 5EO9B 1F6FB 1KCSH 3UTSA 2CDEB 1VCAA 4ZPVA 1AKJD 5HD8D 3QEHB 5AZEH 4ISVB 2R4RL 2R4SH 3DMMD 3ZHDA 3FB6A 1AD0B 1G1CA 4XZUB 5ACMA 3W11D 5HI3C 1QRNA 2IH1A 4HEME 4MJIE 4NIKB 1SY6L 4JVPA 2G9HA 2IPKB 1UCTA 1ZLWH 3UXFA 3QFDB 3BPOC 5EZJB 3GSQB 4Z9KB 5F6IC 3LDBB 5IJKA 4UINL 1S9VA 4E9LA 3M17A 3N1QC 3VXUB 4AQOA 3P77A 4JDZA 3BYYA 2WIIB 3KYMA 1A3LL 2XZQL 3IFOA 1DEEA 2RHEA 3SHSA 3TO2B 5H35B 3QCTH 5T1DH 2RB8A 4JY6A 2A6KB 3MMEB 1CGYA 3CPLA 2HFFA 3L95A 3AU1B 1IC5L 1DQQB 4PJXB 2IANA 3SO3B 1JWUA 4RFEB 3U6RB 4HJJL 5IB3A 3HE6C 4GW4A 4Z7OF 4JB9H 1BOGA 5FOBA 2YRZA 5DXWA 1IGJB 1T5WB 3UPRA 1IGYA 3EOAB 4N0YL 2EXYD 2YPLD 2EDFA 4J3UA 3TYGH 2NY4C 2R4RH 4LSRL 1X3DA 1XGUB 2X6MA 3N9GH 3LKSA 1HILA 5KOMC 3SPVB 2XTJE 3INUH 1V7NH 1BZ7B 4CU8A 5JW4N 3SDCB 3V79C 2FJFB 2FYYB 4KKAD 2F19L 3MRMA 3IFOB 5EUOB 3WS3B 3AXLA 3ARYA 3BKMH 3RPIA 2D03L 4MZ3A 1WUNT 1DQDL 3S9DB 3D87B 3OR7A 3JUYA 4HWZA 2H1PH 4XPAL 4LSPH 2B4CH 5F1KC 5JA8B 3D69B 1P7QD 3IGAA 3T2NL 3HG1B 5HI5C 3PDDA 5K9OA 5BRZE 1L0XA 1OPGH 5HYJA 4HXAH 2VAAB 3T4AB 3SJVE 3WIHA 3DMMA 4U1KB 1RJLB 2GITA 1IQWL 3VMPA 3BKML 3JWNC 5GZOC 2VDMH 4LLDB 4G8FB 4DAGH 4R97C 4YAQA 4M1CD 2CMRH 1KIRA 3R8QA 3ROLB 3VCLB 5IESL 1JNNH 2Y4SA 4NN7C 4EN3A 2SEBB 1M6OB 4C4KO 5D2NC 2GHWB 4Y16B 5IG7B 1DL7L 3V7AG 2GJ6E 2LTQB 4XCNB 1RZJL 1FE8L 1IKNC 1J0YA 4MJ5B 4YFLF 5HVFB 2CSPA 3QNXB 4TOYH 3UTZA 1FG2A 1LP9E 4MWFB 4IRSD 4G6KH 3TH3T 2YWYA 4YUEL 4ETQA 5I8OH 5DUPL 1MI5A 2ZUXA 3KPSA 3EBAA 3GRWA 1I1AA 3MGAA 4OCLC 5CEYB 5JW5B 2YXFA 4P2RB 1CLCA 1KJ3H 1WEJH 4YHLL 1NGYA 1LEKA 5DWUH 1CFTA 3PWUB 2CUMA 1FFNA 3ZYOA 1GZPB 3Q6FA 4JFFE 1UJTA 3VI3F 2A83A 3ARUA 4QT5B 5E8OB 4NYLB 5JA9A 3GDBA 5BOZG 4WCYH 3HZVB 3UO1L 4JCLA 3N0PB 2OJZL 2ZCHL 1WSST 2WBKA 5IHZA 4XPFL 3FQWB 1H5BC 3ZLQC 3HA0A 2P5WD 2DRUA 1I9RL 4NT6A 2C1OA 5MI0B 1RZKL 4KGLA 2R2CA 4NDMA 3D3VD 1MFNA 1Z9OA 2NY0B 2X9XA 1ZLSL 1AFVH 3OG6B 1NH6A 3E6FB 1H3XA 1QZ1A 1NCDH 2CDGB 5CZVL 1KN4H 4JPIB 4PP2A 2GJJA 5SX5H 4NFBA 5L9DL 1FRGH 2XZZA 1UZ6F 1HWGB 1ZS8B 1CE1L 1FNSH 2DQDH 3OKMA 4OFDA 1MFCL 1I8IB 2NW2B 5C0GA 1RK0A 3QJHB 4JHWH 1VENA 4G6JL 4UV7L 4XC3H 4RFNB 4ZFOA 1MJJA 3DXAB 3KPOB 4YHKH 5J0BA 1E6JL 2NX5E 4JPVL 5IHUH 2PO6D 2WMPA 3BWUC 4WY7H 4DKFL 3FHAA 5AD0B 3B2UC 2Y25A 2FZ3B 2AGJL 5EUOF 4P2QB 2CQVA 1NFDA 5EU7C 1TFHA 3H3PH 3D18A 3RZCC 4E42A 3O2WL 1Q8MA 1YEHL 3BJ91 4TUOA 4ODTL 2V2XA 1Q9KB 2X44D 2ZWLT 3UJTH 5LGHH 1S7TA 3FFDB 4S1DD 5F1OB 5DRZB 4N0UE 5SWZB 4F7MA 1OGAA 2Q8AL 3RWDB 2VMFA 5JOEA 1LK2A 1I8MA 4OCWH 4TSBL 4WI7A 3B5HA 5FYJH 5KW9L 3TBWB 2EKSA 4OCNC 3LZFL 5F3HA 4PJHA 2DLGA 4QRPA 2YUVA 4MA7L 4TSCH 3TO4A 3IETB 4LLMA 4LU5L 4U0RB 4YXLH 2W1NA 3QCUH 5DO2C 1MFEL 2A9MH 3DX9B 3V5HA 1HOCA 1FL3A 1GH7A 1MWAH 4NZUH 5IBUB 3VWKB 4HQQL 3GSRA 1CDBA 2QQNH 4YIQA 5E95B 5FCSH 2VXSH 5C3LD 5JLZA 3D48R 3RX8A 3EO0A 1J7VR 3UBXI 2ZJSH 1IGTA 2OL3L 2VABB 4GAFB 4M48L 4NSKB 5DT1H 3MRKB 5D7LD 1MLCA 4YFDB 4X5XA 2XPGB 4JCMA 1DVFA 1UM6H 2VL5B 4IRZH 3HI6H 4JQXC 5F7DB 3FB5A 2ICES 2YUXA 2AJVH 1NCCL 1D5IL 4I0CC 4OGXL 3C9NA 3KGRA 2YPKB 4IMLA 4U1LA 1BEYL 3ARED 4TNVF 3HB3D 1XR8B 3U9PH 1I3GL 2O5ZH 1ES0A 3SE3A 4X4XA 5H37G 2J8OA 4OKDA 1A0QL 4WUUE 4Y1AB 4RAUA 5AD0A 4U05A 2EKJA 1Y6MR 1G7QA 5B39A 3R4DA 5FCUL 1QVOA 4OZHB 4BSVB 4A6YH 5C0BB 3IKCB 5GQBA 1S7VA 1K8DA 5I76A 4GBXA 4PBXA 3WO3B 4QRRD 1IMHC 3DV6A 4Y2OA 4KK8C 4NQEE 1OCWH 3V4PH 1BLNA 4P46A 1CZ8H 1IARB 1XGYL 2UYLA 5CD3A 5CJXA 5CGYC 4EVNA 1D9KA 5SWSE 5MEOB 2BSTB 5E2TL 3QT2A 1W2KT 4BFGA 3CDYA 4LBEB 1D9KD 3KPSB 1NCCH 3ZKXC 1RFDH 4BFIB 2HMIC 1KLUA 4NJ9H 5C08E 4HAFA 4HW6A 4L8SC 3CXHK 3MA9L 4L5FL 3VRLF 3AGVA 3L7EA 1QLRA 3QIWA 4HC1L 3BKJL 1HHIB 1S7UA 2Y06H 1C1EL 1L7TL 4ERSL 2K9UA 4FABH 4YDLC 3PDOB 2ARJQ 1KN2H 4ONOA 3O3EB 1U42A 3O0RL 2YKLH 5D1XC 4OJFH 4XBPB 2J8UA 1T1YB 4RCAA 4WDIB 1RV6X 2Q7YB 5KN5A 1KIPB 1YMME 1BQLL 4HWBA 1ZT1B 4P59H 3C6SB 2ZCLL 3CSBA 3F7RA 3P0GB 4PJEF 4F9LA 1MHPH 5TDPA 2FBJH 1WIPA 3H7BB 4YE4L 2ZUTA 1T83C 3K8KA 3JV4B 1NCNA 4HC1H 5C0JB 4XPGH 5HHVL 4ZNEE 4W4NA 3E2HB 2LABA 3I6LE 4P2QD 4H25A 1QLFA 3FO0H 4HFWA 4GXUN 4K8RL 3UTSD 5IROA 4D0CB 4R4BB 3MRRB 3W2DH 1MVUB 3U36A 3O11B 1HDMA 2HRLA 3ARXA 1S8DB 1YEJH 1I9JH 1CDCA 5EU6A 3DXAD 3ULVH 5J6HA 4O02L 4WTWA 4K3EL 3SY0B 5LXGL 4ZTOH 1CXKA 1ZT4B 1IL1A 3EYVB 3QDAA 4JLRB 4NCC1 3SCMB 4U6VH 3RGVA 4NRXA 1F4AA 1DUYB 3HC0B 4PJXF 1DUZB 1SJEB 3RA7L 4NC1C 1Q0YL 3OTTA 3STLB 3B4NA 4GW5A 5GS0D 1ED3A 3O2VH 5HDQL 3I6KA 5ETUA 1JF1A 3VFRB 4NCC2 1WFUA 4FQHA 2YD9A 3LRSB 3FT2A 2HLAB 5HYJB 2OTUB 3MLZH 3VFVB 2DYPA 3JUZA 2QLVB 3U9PL 1HH6A 5AYUL 3F7VA 3OAZH 4PRHA 1JN6A 1I7RB 4QRTA 4MAUL 2DYPD 2QKIB 2NCMA 2R9HC 1F42A 5F3BB 1FL5A 1UVQB 4ZQKA 4NKDB 1FAIL 2DQJH 3R0MA 5I71C 1HDMB 1RSFA 5F96L 1I9RH 2J8HA 1U41A 1MIEH 1TVBA 4NZJA 3G04A 2IH1B 1CFNB 4R26H 4UBDD 3BMWA 3G6AA 1K8IB 1IM9A 4P2YA 5CJOL 3AM8C 1EEQA 4KQ3L 4HUVA 3VA2C 2PO6C 4HT1H 2UUDH 4AZ8A 4JFQA 1BQUA 4NZUL 5GIRA 3B2UD 5EA0H 4DWHA 5EZOL 3QQ4B 5DJ8B 3LEXA 4JPKL 3D0VB 1E4XI 5KSVA 1R0AH 3VGAB 4WHCA 4Z7WA 3RHWK 5EC1B 5GRYA 3IJHA 5C9KA 1I8IA 4ZDHA 3SGJA 2V17L 4FXKA 3REVB 4HIXH 1MRDH 5ENWA 1JN6B 4LSSH 4ZO8A 4ZG1A 3MPCA 4BSJA 3MRCB 2A6JA 5CCKL 3QDMD 3MRIB 5C08D 3JWOL 3QA3A 2D31B 5IIEB 3TBSB 5JIPA 2ADJA 2VDLH 4LEOA 3OJ2C 4L29B 3AAZA 2X1XR 3GMRB 3MRNA 5IFAL 4RMUA 4XVTL 4ZMAT 5L0QC 2VZOA 5ETUB 4PY8I 4JREB 3KVQA 4PJFE 2Z4QB 3I3DA 3VE0B 4N8CL 5KANI 1FC1A 3QIBC 5BVJA 1UYWL 4JKWA 3QEQD 3ALPA 3QDJE 4K3GA 1FIGH 3FFCD 3WN5A 5C0EA 5GRVL 3ILPA 3DROA 5HYSA 3AMKA 3VFWA 1NMAH 3IFNH 1IEAA 4JN2B 2BDNH 3UTQA 3T0DA 4M5YL 1FGNH 2AEPL 1JZ5A 3PWUA 5GGTL 3I84A 4FFZH 4RWHA 3OJDA 2G60L 2ATKA 4F15B 4AT6A 3BHBB 5F96H 1AO7B 5JW3H 2PETA 5L9DH 4Z0BH 1OGTA 1IAIM 3T65A 1A2YB 2HYMA 3F6LA 3JWDC 1LGVA 3IDYB 2CLZB 5D7SL 2BMKA 5ISZD 1ZANH 5GSRA 1FG2B 3EO1B 3U82B 2XNAA 2J5LB 2DIAA 3R06B 1WK0A 3VFSB 1Z2KA 5AYQA 4O58H 3AB0B 4FZEL 1CLYH 1MHHB 4I0PD 3NFSH 4Y16A 5IG7A 3ARFC 1V7NL 1MREL 5C0FB 3A67H 4NSKA 3PL6C 1R5WA 2OJZH 2XKSA 5D96C 5JR1H 1RURL 3QUXD 3GIVA 4HUKB 3GMQB 3DV4B 1DQLL 5CIPA 4PJBA 2H41A 3UMTA 3X17A 1CBVH 2J88H 3FQUB 2VQTA 3OKMB 4CNIB 4WUUA 4HMDA 1UCBL 5MI0C 4J3XA 5E6IA 4HUUA 4HJJH 5D7JB 2FIKA 1AQDB 5D7KE 4R96B 5KG9A 5ITFA 5JPNB 3KPPB 1AIFA 1VFUA 4PLJD 3MROB 1MCDA 1FL3B 1QP1A 2IBZX 3KYOA 5J11B 4K3EH 2Q1EA 3U0WL 5IGXH 1G6VK 1U8QB 1S9XA 1AKJB 4DOHE 1D5IH 1QQDB 2H45A 1X9QA 1N3NB 1L4IA 4K94L 3GBNH 1J1XH 5HYEA 5LKNA 1FE8H 1Q9WA 3IU3B 2D9CA 1RZ8A 1UJ3A 4XPGL 1QFUL 3CX2A 3DV6B 2F74B 3DI2B 3NCBB 1MCKA 3U83A 5F70A 1EO8L 1QSFD 3SBWC 4DUVA 4F58H 2DB8A 4LVEA 5DRXA 4HUUB 1BFVH 5HYSB 1F6LL 3CVHL 1IZJA 5L88L 1R6VA 5IW3A 3AMLA 3GUTB 1MJ7H 1T0PB 3RDTA 2W0FB 1GGBL 4AYFA 1QLEL 3ULVC 5GGUB 3TO4D 3EYSH 3EDKA 2HKFL 3O0RH 5EPMB 1WICA 5FYKE 1BBDH 4P4KC 4MJID 3SDAA 4ERSH 1T20A 1DVFC 1OPGL 1T7YA 1T7WA 4WEMB 5E2JA 4Q9RL 3FRUA 4S2SB 5DD1H 1IC4H 4LLWA 4IRJA 4RMTA 2C3VA 2HJFB 1E4XH 5GSRB 5KVDL 4R97B 3KYKL 4P3CH 3HE7C 2P8MA 2P24B 3MGTA 3QXAA 4ESKA 3ARPA 4LVNC 1HCVA 3BDBA 3ES6B 4ZAKD 5A3IC 2R23A 2PW2B 1GSMA 3CFEB 1WBZB 2X4OA 4MJ2A 4I1NB 3MRJB 2RQ8A 3WIHH 4Y2DD 2L7UA 2EIZA 4ZSOE 3L5WB 2OTUA 4R3SB 2QBWA 3OKLB 3INUL 2YPLA 4HCRL 4YPJA 3CNKA 3TH2T 2AK1L 4HK3J 4ZD3H 4NPYB 1OP5H 5JIIA 3WFDL 3CVIL 5IB4A 1CTOA 2WQ8A 3DRTB 3N06B 4WHDA 3W81A 1K4CA 3MLPA 1EFXA 4R4ND 5ESAB 1UZ8A 2C4FU 5CSBA 4PGBB 2FX7L 4UTAH 2D7QA 1C5DB 4NQDD 5F3HB 3P30H 1U91A 1OAUL 4H8WH 2PYED 3VG9B 2GJZB 4N9GA 3K2UL 1AGCA 2H32B 1DFBL 1KCLA 2D2OA 4HLJA 3KYNA 1C16B 4K55A 5J9PA 5I2IB 1IC7L 2XRAH 4J4PA 4O2CA 1EJOL 1QA9A 1KOAA 2IMMA 5L6YH 2KL6A 5IV2B 5J89A 4BM7A 1J1PL 1RUPH 4KRPC 2RR3A 3OF6D 4PTTA 3TA3C 5IF0B 3FL7A 3OAUL 5IFHH 4CDGC 3ARFB 4PJCA 2A0LC 4HWEH 4ZOCA 3RX7A 2YD8A 2HTKC 4DN3L 4KHTL 3D39E 4CU7A 5FYKL 3MACL 2DI7A 1WLHA 5FKAA 3RGVB 3MCKB 2A1WH 3CJJA 5T3XD 1A6TA 2MNUA 1TMCB 3HFMH 2ZNWA 5F9OL 3VJ6B 5GXBB 2VKWA 1I1YB 4XVSL 2VQUA 1R5IA 4RRPG 2EDHA 2D3VA 3G5YA 4C58B 5L7XH 4UT7L 4E41A 2VE6A 4LKXA 5HXMA 4PJ5E 4U1IA 1N2RA 5F7LB 5BRZD 4KMQA 5LCVH 4G8IA 4MD5B 1D6EA 2OMBA 5KS9B 1KENH 1N5AA 1IBGL 4OUOA 3VH8B 4XGZB 4BUHA 3CMOH 4MYWB 5JDSB 3MOAL 1HXMA 4JREC 1XGQA 2YA1A 3H9ZA 3P4NA 4HXBL 3OJVC 3MO1B 5EWIL 5F6HJ 3KLAB 5IP4A 1EHNA 3LKNB 4FFVD 4Z77A 1MPAH 4Z7QE 2AK4A 2NY4D 12E8L 1YEIH 5JMOC 2GT9B 3HI1A 3UZQA 4RNRB 3S37X 12E8H 4KK5C 2EDXA 5MP6H 1WBYB 5SWZD 1E28A 3WEXB 1KGCD 5FOJA 5A40E 5GGVY 5FK9A 1DBBL 3GSNL 5DS8A 2VLKD 3QNZB 4JGMA 4MHHI 4K7PY 4IRJB 1JZ6A 4JQVA 1ZWIB 3VGAC 1VPOH 5FYLE 5EB9A 5IQ7H 3EYVA 5ELIA 3SE8L 2NW3B 3MV9D 1H3TA 1EEUA 3EOTL 4W6YB 2JELH 2WBWB 4G7YH 1JIBA 1A1MB 3F5WA 2PO6B 1QEWB 4MB3A 1H0DA 3REWB 5IVXB 3T3PF 2A6KA 5IBUG 5CZVH 3V7MA 1TQBC 4R4BA 4WHTA 4HIHB 4KQ4H 4EVNB 3IRZA 5DRXB 1PSKH 1PX3A 1TJHH 2XFXB 2XOTA 1ZHLA 1NSNL 3F7VB 4ODVH 4XPFH 5DUMH 2VDNL 2NY3B 3ARFD 2OR8A 3C08H 2P43B 1WBYA 3B5GA 1UWGL 3LS5H 3WFHB 4RISH 4MSWA 4PTTB 1C5DA 3ZSTA 4ISVA 1VFBA 3KDMA 4EI5C 1CICD 4PRAB 5FB8A 1RJZA 4KTEH 3JV6A 2CKBH 4K7PL 4AEFA 3HI5H 5C92A 2AERT 2JJTC 4N0RA 3LKOB 2AP2A 4I18B 4LRNH 1R3IH 1CQKA 5F7MC 4Q58C 3OG4B 3VGDA 5ICZA 4F7EB 3EDFA 5KS9A 1NKRA 5E6IB 5DSCB 4GAJH 3P11L 3PHSA 3VXSB 2NY5H 2DWDB 3MJ9L 1JHTA 4F2MA 1UM5H 4KJPD 2EH7H 2VOTA 4LKXB 4YDIL 3EYUL 4X5XB 5TE4H 1UXWB 3O11A 4I0PB 1ROWA 1J0KA 1JPTH 4P2RD 5HYIA 3BWAB 4CVWA 1BZ7A 1JTPA 5FYKD 5LQBH 3IDMA 5E4IA 3BIKA 3C8DA 1JGEB 3F6IA 1K2DA 3EW3B 1FVEA 3VRLE 1S9YA 3MBEB 3QDME 3I6GA 1FVEB 1NMCB 3NAAH 3VG9C 2ATPA 4OQTH 5FA4A 2VLJA 4GRWB 4X98A 1KJMA 5JNYB 1C5CH 2JB5L 2QSCL 3TO4C 2BVTA 5CEZH 1UFUA 1CXEA 2JCCE 4O51A 3CPLB 2NZIA 4Y19E 4HFUH 2BVPA 4EKXA 3HNSL 1DEEB 4QHMB 1J12A 2WBJB 1QFPA 4R90L 3ZE2E 3TCLA 1NLDH 1I3UA 2B4CL 2YWZA 3LIZH 2CK0H 4XMLH 5I1IL 3VD4A 4OGYL 3HFML 1FN4A 1IAOA 4OGAC 4XAWH 2C26A 4JJHA 1A6UL 2MQ0A 3X3FL 4MSWB 4CDHA 5EPMA 1NGZB 3QRFM 1A1NB 4P2QA 4U1HB 5FYLD 3D2UB 1CT8B 5EBMB 1K4DA 1LO5A 5C0CE 1AE6H 4KROD 4M4RA 4J1UA 1IAIL 1IGFH 4Z7UB 1FYHB 2GTZA 1N6QH 3ET9F 4I77L 1ACYL 5GISL 4BSVA 2GSGA 2MQCA 5IW1A 3DYOA 1U8JA 4P4KB 4KC3B 2AXGB 3MLYH 3HHRB 4ZFZB 3IJYB 3AY4A 4RWYL 4H88H 2R23B 1XFPA 4OZFB 3HMWL 1MRDL 3W5NA 4UB0H 2X4TA 1QSVA 3G6JE 5DMIL 5E9DD 5BV7L 1KXTB 5C0FA 3MJ6A 3T0EE 4RGMB 4JFYB 2K1MA 3VA6A 3NPSC 5AUMB 5E56A 3VWJB 3TGXA 5L2KE 3HNTH 3LEVL 5FM5O 1S9YB 5JQ6H 3IFLH 1EK3A 1T1WA 4GAYB 1ZA3B 2NY2C 2FIKB 1RZKC 1FZJA 1XF4A 2A1WL 3ORJA 4NUJA 3U7WL 4ONGL 4HT1L 3QO1A 3GZKA 1XF2A 5SWSD 1W8OA 5DJDA 4AEEA 1A6VH 5A2KH 5KZCB 4AT6B 2A83B 3QEQE 1ODAA 4J3TA 3OAUH 5IFHL 4P4RB 5KSAC 5TDNB 3DETD 1JGLL 4JKMA 3VGFA 4KJWD 1U58B 5D1QA 1P69B 1TQCC 1WAAE 1ADQL 5T3XH 2PF6A 1F90H 4Y2DA 4FFWD 4YEFA 3E3QC 4Y5YB 4LVOB 1RZFH 4F33B 4GRMA 3MRPB 1U3HC 4IRSB 1A5FL 4XXCC 2IFGA 1AR1C 2W60B 4PJ5A 3LHPH 2L7JA 3QNXA 1FN4B 1IAOB 1MCHA 2F58L 2UV3A 3AREC 5BS0B 1MNUH 4H1LB 1OAUH 2R69H 2MTPA 5GRUL 3VG0H 2FR4A 1J8HE 4TTDD 5I74C 3O3DA 2Y5EA 4NRYA 3MGOB 2HVKA 3ECBB 4L8BA 4RQQB 5KG9B 3VFWB 2FECL 4MLIA 4DCQB 2P46B 4L8CA 3BVNB 1Z9MA 1F8TH 3JTTB 2AV1A 3ROOA 2PW1B 1PLGH 3SGKA 1MH5B 5L88H 3OJMB 4PGCB 3ARQA 1YEIL 3UCRA 1VACA 2BJMH 4JGJA 1BBJB 2E6QA 1R24A 5CGYD 4ONHB 3WNNA 5IVOA 5K9JL 3P73A 3RVXD 4NN5B 3S97C 5CEXB 2HFGH 3P2TA 1WCBB 3KPRE 3VDCA 4PJHE 4G6MH 4WW1A 5C0GB 1LD9B 1G7JA 3H0TB 2YD6A 1U8NB 1N4XH 5KTEL 2WIMA 2A73B 3BP4A 3X14B 5E2UL 4N0UA 2EZ0C 4M7ZB 3RUGF 1QSEE 5IMKB 4PP2B 5HVHB 4JHZA 5TJWK 2MCPH 4NO5B 1EIBA 3BZ4A 4Y4HC 2O61A 3G6JA 1BBDL 5IWLA 1HSBA 3B83A 4OUUB 3TA3A 3UYOD 3MTRA 2J1KA 3TIDB 1HKLL 2AV7A 1FCGA 2DTMH 4KDWA 4X99A 3VH8A 5D93C 3QNYB 1QD0A 1IZKA 4OZIA 2V9TA 1X5JA 4RSVA 1BIHA 1X4XA 1NL0L 2XWTA 2VDQH 3B9VA 4NN6B 4PJ5D 4F58L 4PRDA 3PABA 3X3GH 4X4YA 2CRMA 4ACPA 5B38B 5EO9A 4E41B 3D39B 1QBML 1W0VA 5L6YL 2VXTH 2QV2A 5LGKA 1L9MA 3ARGD 4TQEH 4RGOH 1YJDH 4A2MA 2XQYG 1F2XK 1OM3L 4ZPTB 5DFWH 3MLXL 4ZTPL 1KF9B 5E94A 3I2CL 2W0KA 2Q86A 5DRWA 2BP3A 2EEDA 1WCBA 4XI5D 3NTCL 3E8UH 5IGXL 2F53E 3S3SA 2OZ4A 5JW3L 4GMTH 5DMKA 5KSUA 2I07B 4JFPA 3FQRB 4IM8A 1F58H 4QF1A 5DQ9A 5DRNB 4JRXB 3RVUD 3V0AC 1GJIA 3NCMA 1MFBH 4YK4B 4HPYL 1MCFA 3MCLH 1M05B 2NX5A 4QTHB 1YEGH 4ENEC 2IBGA 2DLEA 4IOFC 4N9OB 4GRWH 3BP5A 4EI6A 3O2VL 4CGTA 2R15A 4G7VL 2E6PA 4M02A 4GG6E 5J9PB 5EO1A 4WNQB 5DD6A 1PFCA 4FQJL 4OLVL 1VGKB 5BO1L 3JV4A 1YEGL 3KPNB 2AJYH 1IM9B 1PG7X 5GJSL 3S35L 4CL7A 3X11A 4PV8B 1HNGA 2JIXB 4WUKH 3ULUL 3VWJC 3FKUS 4YR6A 3PGFH 4Q6IB 3SE9H 3EJYC 2IQ9L 2PXYA 5L2KA 4JFYA 3NTCH 5GS1B 1KSRA 5DZLA 4ZUTB 5F7EL 4Q9CA 4R0LB 2XYCA 1NCAL 5DJCA 1F4HA 4HIXL 2O5YL 5DVNA 1X7QA 5AWNH 2UY6A 3IVKB 4M9OA 3PWJA 3LQAC 4HK3N 1OW0A 3RVVC 4PJ8D 1RUMH 1EVUA 4B50A 3FN3A 4PG2A 4Q9RH 3CVHB 3LKRA 3T1FA 1N6UA 2OL3H 5T3XE 1V05A 5EZJA 4XCYA 1EHAA 4NO0A 2PTUA 4OZIB 4OGAD 4OFYD 5B3NA 3QIBB 3RPIB 1U8OB 4L9LC 4X6CF 4KQ3H 3GBMH 5ITBH 1S7QA 4G8GB 3RWIB 1KG0B 1ED3B 2X9WA 3BT2H 1QNZH 3BRDA 1FZKA 2Y06L 3FFCE 5CMAA 5CWSB 4WW2F 1OGAB 4O00A 2C5DC 2P8LB 5E4EB 2ESVE 2EE6A 4X7SL 5LVEA 1GOHA 1JHLL 2YPVL 5FOBB 3WFBL 5KW9H 2CLRB 3ARFA 4MZ2A 2DOCA 1QPPA 1DQQA 4LSSL 9CGTA 2VC2L 1XZ0A 1KJ2H 2V17H 4LSDA 1YPZF 4ALAH 1TVDA 4HK0A 2VQ1A 4WW2A 5C0AB 5IJVA 5DF0A 2A74B 4LCUA 4RMSA 5B4MD 3SDCC 3UEZA 4J8RB 4M03A 1HE7A 1NAMB 3ALWA 3P77B 4XCEA 3BEVB 1QBLH 5EZOH 4KKCC 4XTRD 4LSTH 4WI3A 4HDIB 1KTKE 4NUGL 2EE9A 3KPTA 1YUHA 4FMFA 3HC4L 4G43A 3LPGA 4D0DA 1CFSA 2AQ3A 3MV9E 4GAYA 1JCKA 3HCVA 3QI9C 1NC2A 4XP6H 4CMHC 4H1LG 2J8UB 3MRQB 3OWEA 2CDFB 3BZFA 1EZVY 1F11A 3DTXB 1NMBH 3M8OH 43CAA 1UWXH 2EYTB 4G9FB 1T89C 4HH9B 5FHBH 3H6JA 4CAGA 2HTLC 4PV9A 5HGBB 3DX6B 3TJHD 2F53D 3BZEB 1DLHA 1FGVH 5HGBA 2EO1A 1GGIH 1KN4L 5A16A 3GIZL 1OAQL 1ZA6B 3WLBB 1MELA 2V7NA 1T83A 3UAJC 2X1WL 3IDJA 1OB1A 4XCFH 1O7VA 1DTUA 2AJXL 3TT3L 3VFOA 1CFVL 3C2SA 4P23B 4LSUH 3Q5OA 4XP1L 2BRRL 1OSPL 5IMMB 1X6NA 4NBZB 1A6VL 3SCMC 3ZKND 1NFIA 3BPCB 5GHWL 3RAJH 2DTML 3BEVA 3WJLA 1W72A 4X6FA 4APQB 1MAML 4P2CG 5I30L 5DJ6B 3GSWA 3VFUA 4P9HL 5DURD 3KHQA 2XKNA 5FO9B 1T0NB 1JI1A 2WBJA 4AQ1B 4MDIB 4QTIL 4BUGA 1MOEA 3O6FC 3DX6A 2B0SH 4PJAF 5GSVB 3TBVB 4XAKD 5EU6E 1BIIB 4MCYB 4U1LB 1FZOB 4X80L 1YY8A 2ZUYA 5C3TA 2SEBA 5M95B 5D1QD 1Z3GL 4V1DA 1P9MC 1R3HA 1S5HB 2IEPA 2IH3B 3ARBD 2XA8L 5GZNC 2P5EB 2FWOB 4JVUA 2VLJB 5C07D 4AIXA 1JNHB 3UPCA 1L6XA 3UTSE 4MNGE 2EC8A 4QHNB 1MEXL 4ODWB 2R2BB 1UACL 5D1XB 3S6CA 1CXLA 1YMMA 2CDFA 3BZFB 1YECL 1P7QB 1IFHH 4QHLB 5F6HI 4JFFD 5I8KH 2ENSA 3C8KB 1AIFB 2V2WA 4PJIF 5IW6B 1WWWX 4OAWA 1UXWA 4ZFOB 2LE9A 4MS8C 4OGYH 5L2JA 3KG5A 5CUSH 3VH8G 1R3LB 3WYRA 3GMOB 2Z35B 4NKQB 4DVRL 5I73B 4XRCB 2H2SC 1I3GH 1DVFD 2NW2A 3EYOB 5JXEA 3U79A 1T7VA 1XH3B 2Q76A 2XA3A 2A6IB 2D7PA 2D4DA 5ISZE 4HS8L 5E8OA 4CRPA 1VKXA 3IETA 4LLMB 1CDYA 2ED7A 3GIZH 3PV6B 1A1OB 1DQJB 1OVZA 4PG9B 2H1PL 3JV6B 5GS2D 1YNTA 3V5DB 3MUHL 5ICYB 3RWCA 3EJJX 1YJDL 3R06A 1LP9F 4WTXA 3V5KB 5SWZA 5EBLB 3UC0H 3WUZA 5DJZA 2V9RA 1H8NA 5KAQF 3VXQA 1CFSB 1JGLH 2XZAL 1FVDB 1MCPH 1UA6L 2YHGA 1NL0H 1AR2A 3MXWH 3ZZ1A 4PLNC 2DL9A 2DI9A 4Y5VC 2HVJA 5I0DA 1FFPA 1NBQA 3LPWA 1IAII 4AENA 3U0PA 4JFFB 1I7ZA 1GOFA 1IM3A 4WU5B 2K7QA 5J1TC 3C87A 1F02I 2R1YB 4PJGE 1F4XH 4ELMF 3QUYB 2Y07L 4C56B 2QKIA 5GS2H 1U95B 1Q0XH 1HXYA 1CF8H 1X5IA 4PJFF 4YXLL 2W07A 4W4OC 4DVBA 5I1LB 5FAAA 4UOJA 5HDOA 1BVLB 2LAAA 3WUWA 2Z92B 1EHLH 5SWSA 3PNWB 1U93A 2GAZA 3LH2L 4MCZA 4C83B 1TNNA 4OM1H 4AMKH 3T3MF 4LRNL 1W0VB 5EUKA 4OLUL 1P4LB 4NHUA 3RWJB 3I50H 4PRDB 1AHWA 2YPVH 3LN4B 3MV8D 4Y4HA 1DUZA 1A9BA 5DK2A 3QJFB 4U31A 3MRCA 2YN5A 2VXUL 4CN6A 3H9YA 4BKLA 1F5WA 1FH5L 4MGXA 4AIZA 4GG6A 5KSBE 3DO7A 3OKLA 4YC2C 5D7LA 4Z78A 1INEL 3DXAE 3WLWC 4JRXA 3HPJA 3QEGH 4RDQF 1PG7H 3NIGE 4FTVB 4MXVE 4RIRB 2B7DT 5I1CH 3RDTD 1XCQA 4NN5C 4YGAB 2VZTA 2H6PB 1RK1B 3MR9A 2VZUA 1EGJL 3QO0B 4FABL 2R39A 4YHIA 4P5TB 3QQNA 2OR9L 4MQ7B 4LU5H 3S3JA 3H7LA 2OP4L 2VLKE 5CEYA 1XIWB 2AJ3B 3WJLC 5TDPB 4LLWB 4M62L 2Q6WA 4YFEA 3BDYL 4OTXH 5T1MB 1BOYA 4FQPA 2QQKH 4M61A 3JV0A 5F7EH 5T33L 1B6UA 3MRDA 4PJXE 4QKXB 5JO5B 3MRGA 2CJUL 4EDXB 4XBPA 2F53B 5JOPD 3V4UH 4JANB 2IPUG 4LQ1A 2W59A 4KZEL 1CDGA 1Q72H 4NOFA 3SDCD 3U4AA 1CICC 3EO0B 4LPXA 3BQUA 3C6LB 3LRGA 5BO1H 4Y1AE 3QIWB 3NZHL 3PHOB 2YPLB 5C0NC 3BKCL 2ITDA 4RFNC 2E9JA 3RL1A 4L8BB 4M4PA 5IV2A 2F9BT 5EUOE 4KI5D 5ACLA 4YHKL 2ZUSA 3BP4B 5D2LE 1KXQE 3O8XB 5T1MA 5DJ0A 4DGVH 1NAML 4XZUA 2KH2B 5HHOA 4HPYH 3CZJA 1ZVYA 3OR6B 4PJDA 4OZGE 1N2RB 4GFTB 1DSFL 1QKZL 3BZ4B 4I8DA 2APTA 4JANA 5BXFA 3P11H 2GK2A 1P4LA 3HPLB 4HKJA 3MRDB 3ZL4L 1CIDA 3MLWH 2G75B 3TWCL 3BH9A 2VXVL 4PJ7E 5BRZA 4OZGA 1P53A 1WF5A 4UTBH 1K9TA 1G7QB 4Z76B 3JXAA 3X11B 2XQBH 3O9WB 5IB4B 3P9MA 4LSQH 1KC5L 5TQ0L 2BSRB 1NFDB