3G04B

Crystal structure of the tsh receptor in complex with a thyroid-stimulating autoantibody
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
215
Chain Sequence
b'QVQLVQSGAEVKKPGESLKISCRGSGYRFTSYWINWVRQLPGKGLEWMGRIDPTDSYTNYSPSFKGHVTVSADKSINTAYLQWSSLKASDTGMYYCARLEPGYSSTWSVNWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN THYROID STIMULATING AUTOANTIBODY M22 LIGHT CHAIN
publication title Crystal structure of the TSH receptor in complex with a thyroid-stimulating autoantibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 215
sequence length 221
ec nomenclature
pdb deposition date 2009-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g04B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g04B01
3WS6C 4XGZA 1E6OL 2BCKA 4R2GD 1P5UA 2Z93A 4PGCA 5CHNA 3HZVB 2QHRH 3GGWA 4X7SH 3O4OB 2VN4A 4FQ1L 4XI5D 1MWAH 1SM3H 5I75C 4ELMB 2Z91B 1D6VH 2BOCB 4NQVA 4H0GA 2J1KA 4J23A 5CMAB 2CK0L 2CUIA 4N9OB 3LSOB 3IETA 4HS3A 2EE3A 2NTFB 5AUMB 1KCUH 4Z76A 1R5IB 2BY3A 4JFXB 1AXSA 3V6FB 1EEZB 1NBYA 2APFA 1OY3B 4K2UL 3LMJL 3ILQD 1IILE 3BQUD 2RHEA 3VFGL 3MGOB 3VXUE 4F7CA 5DWUH 2DKUA 3ARBD 3KGRA 3WKML 3S35L 1UCTA 2AK4B 1NUDA 4DUWA 1SYVB 2ZOLA 3S36H 4OF6A 1CFVH 1M71A 1U3HD 1XGPB 3STZA 2E7BA 4KDVA 2R1WB 5EZOL 2R0ZH 1DBKH 3G5XB 1X5JA 2XG4A 1DSFH 3P9LA 1BJ1J 3QG6B 3V0VA 1YPZA 2JCCB 4NHCH 2W9EL 4N0CC 4ZODA 2CKBB 5ALCL 4OZ4A 3VGDA 1BVKA 1P4IH 1FAIL 1A7BA 3TT3H 5DK2A 2X41A 4NFCA 4K71B 2NY3B 3LEYL 4NUJA 5HYSG 1UEYA 5IM7B 3KR3H 2P8MA 4IRJD 1FAKT 4IOIB 3N1QC 4PG9B 5AZEH 3PE9A 3I6KA 5KVEH 3P4NA 4IM8A 1DL7H 2BSTA 1NDMB 3T0DA 3IDXL 4K94L 4ZO8A 4U1KB 4YPJA 1OAUH 1VSCA 2YA2A 1CDYA 1JI1A 1YC8A 2ICCA 1CXKA 4NP4H 3E2HB 2FSEB 1CI5A 3IAQA 5F71A 3NFPB 4GAGH 3TN0B 4L3EA 2IFFH 4ZO6A 1KACB 1MJ8H 1KELH 5DRZA 3QWOA 4K9EC 3G6AB 5CINH 1ES0A 4R96B 4U1SA 4XRCA 1U8QA 1ZLSL 3UTTB 2GT9A 4I9WE 1KIPA 5FM5M 5ACZB 5BO1H 1D5IL 4UUJA 2PKDA 3LQAH 4TSCL 5T1MB 3FRUA 4RBPH 3SKUD 1A3RL 1I7UA 3GMMB 5HD8C 5C07E 3EOAB 3U0TB 1Q38A 2YRPA 3UTSB 3H3BC 2NCMA 3KNBB 1FRGL 5BVPL 4R97B 1QFWI 2HVJB 3K1KC 4XPBL 3O3AB 4TUJA 1X4XA 3QCUL 4WEBL 2ZOKB 5SX5H 1QSFA 2NW2A 1I9JL 3BWUC 1XGYL 1B6UA 4MNGE 3WFCH 4DCQA 4YDIL 4F80A 3D18B 2EDBA 3BEWA 3TH2T 3EW3B 1IC7L 3QQ4A 1WSST 4GRMA 1VFAA 5A2JH 2KBGA 2YD7A 4RAUA 4MXWH 3P0YL 3CZFA 3JWOH 3SDXF 3TVMD 3MRIB 3WL9A 1IC5L 3CU7A 2EXWC 3L7EA 1XFPA 3MXVL 5GQBA 4KMTL 4Q0XH 1FVEB 4HX1A 5FA3A 4XNYL 4JFFA 4ZFGL 2F54E 3WJJA 4UI2A 5JIKA 1SMOA 4K3HA 1U8MB 4NO2B 4NWTL 4ACPA 5E8OB 4Z7QE 4P0DA 3TA3B 3ARSA 3H9ZA 3OKLA 3TIEB 1ONQB 5CBEA 2FJFA 1JGLH 3C60B 1RULL 1J5OH 1WLHA 1PVHA 1ND0A 5DMGC 4WTWA 1W0WB 2VE6B 2J12B 1L0XA 3STBA 4RGND 2CLRB 3B5GA 1WFNA 4K94C 1C5DA 2XN9A 5DC0A 1RUPH 2VLJB 1ZT1B 1TTGA 2EC8A 5B3JE 5D2NC 3NMEA 3N1MC 5LAXA 4UTBL 4K7PH 2NY7H 3IU4L 5L2JA 3BRDA 5T5NF 2VZ3A 4DWHA 2R1YB 2VO5A 4MNGA 5CP7A 3VXMB 3HRZA 5I17B 2HH0H 3VFVB 1XF4A 2CLVB 2DD8H 2DRUA 5DUPH 3D39B 3J7HA 1OB1B 5J1TC 1FNSH 4NRYB 2L4OA 5E6ID 5K9KA 2V17L 3P0VH 2X10A 5HYFA 5T1KD 4NYLA 4G9DB 2ZCKL 2VXQL 2D7MA 3QNXB 2HN7A 4IRZL 1IL1B 1F3JA 1XIWD 4TULL 1OP3K 5EBGA 5E08L 1D5BB 5BS0E 1HXYB 2F54A 2QQLL 2HKFH 1D9KC 3C6SB 5EZJB 5GRZA 1KFAL 1T80A 2NY2C 3QFDA 2GFBA 1NC2D 1GVIA 4Y5VC 1GIGL 1YEHH 4ZUSA 2BMKA 2EIZB 5CEZL 1WBZB 2FIRT 4PJ7B 3O4LB 3PGDB 5C3LD 1KCSH 2EIDA 4PJIE 4G3YL 4GW5B 4PTTA 4X8JB 4PG2C 4JFDD 2JCCF 1DBML 5DJAA 5JW4R 4YDLC 1U95B 2PXYA 4TVPE 5FFLA 4EZMA 4NC1E 4XNUH 3KWWA 1AI1L 5FYKH 1P84J 1AD0A 3BKCL 4ZUUB 1KJ3H 3WEXB 1I8IB 1WAAE 4NQCE 1YZZA 3FMGL 1DVFA 3A67L 4IHOB 3MUGB 43C9B 1GZQB 3ILPB 4PYHA 3HZKB 1HHIA 3I9GL 1KCVH 1G0YR 5DHYA 3BOVA 3MRNB 3SJVE 3PJSA 5B39B 5DQDL 4KVCL 2VDPH 3FOLB 2Z35B 4U2ZA 2YN5A 1NLBH 4H20L 1NMBL 2JTDA 3HI5H 1T1WB 2MWCA 1S8DB 2GAZA 1C12B 4KJWC 2EEAA 3W0WA 3F8UB 1OSZA 4EI5D 4N5UA 2ZUSA 2G5RA 4E41A 3KYOB 2FL5B 5I6XB 5K59E 2LU3A 4CBPA 1GAFH 3QUXB 2Y1VA 5I1JH 3IDNB 3FO2A 4QRTA 2BFVH 4TUOB 4QOKD 2YBRB 3V95A 5BMFH 4M3KB 3QI9D 4UT7H 4PD4K 2R2HB 3AFLA 3QIUB 4KTEH 1K3ZA 1EVTC 4PJIA 3L95B 1GPOH 3IGAA 2AQ2A 1P7QA 5ESQA 3C6LB 2D0GA 4I3SH 3V5DA 5F6IB 1KPVB 2P46B 3MRPA 4ZUVB 3LQZB 1HQRA 4WTZA 1AHWB 1FO0A 3NIGF 4GKNB 3UAJC 4XNMA 4CNIB 1AJ7H 5J8OA 3CDGA 1TZIB 2PYEB 4JQIL 3O6FA 3MJ8B 4NRZA 4HEME 4U1IB 4B7IA 3VWKD 4XNZB 5KVMC 3CXHK 3GSXB 2NY0C 3TNNA 3MRHA 1YYML 2JJUA 2C4FT 4TVPH 3DO7B 5J3HD 3SJVA 1KTLB 1U2CA 4MB3A 4MZ3A 1FO0H 3C5JA 4NRXA 2W9DL 4LSPL 4N5ED 1VENA 4O4YH 1HDMB 4DGVH 1TENA 5LWYH 1G6RL 4C55A 5GGUB 3BW9B 4XX1E 2R8SH 3D85A 3O41B 4LKXA 1S7QA 2I9LA 2X4TA 1WT5A 1WFUA 5E0QA 2EECA 3E8UL 4XPFH 1JYXA 1OF2A 2HLFD 1SY6L 5TJWK 5IHZA 3BT2L 3OB0H 2ZUTA 1AY1H 1FBIL 4Y2DC 4JFOB 5MP6H 5D71L 4OGZA 2J8UF 1T4KB 1DUZA 5K33A 4WUKH 3VXRD 1GCFA 1XR8B 3DHJA 1TCRB 3VU2A 5H2BA 4FQ1H 1IQDB 3ZDZF 3PDDA 1PG7W 1CU4L 3MLRL 5ID1B 3BH9B 4I5BA 1GL4B 1MCHA 1KCRL 1U6AL 4HXAH 4YK4B 5TE7H 4NQTA 2E7LA 4LVEA 3BD4A 3BDXA 1KTKE 2Y6SC 1F11B 3CD4A 4DKEH 3K8MA 4Y19B 5ESAA 3I2CL 5A2LH 4HUXB 2E6QA 3LMJH 3T4YA 3SDAB 4XHJC 2J5LB 3RIFF 1B4RA 2IAND 3DYMA 2VXUL 1NGQL 1EXUA 2J88L 1ITCA 4Y1AD 3LKPB 3NABH 3C5ZB 4PJ7F 1RJLA 5D7JD 1NCNA 3LKOA 3R0NA 1OAKL 1LE9B 3ZL4H 3U0PB 1RIVL 4J4PA 4HS8H 3S96A 1Z0MA 4CADB 5DJ2A 4PJDA 3WFDH 4OGXL 4NN7B 3VJ6B 5IB5B 5DMKB 2VAAA 3U6RB 5JHDE 5ACMA 2HTKC 1I1RA 2W9EH 5D1ZB 1ZAGA 5ALCH 3RVWD 2RQ8A 4JLRA 4QXUL 2DTMH 1MVUB 1K5NA 1UKQA 3V6OA 2HYMA 3CU1A 5HHOD 5T3XL 4P23D 4E0RB 3VFWA 3AAZB 3I75B 2OR9H 5GGRB 2WWKT 4G43B 1F4YL 3L3JB 4M6OL 3S97C 3DRQA 4C57C 3QQ9C 3IDXH 1KEMH 5DJYA 1W72L 4P99A 3FTGB 1YN7B 5I15L 3HMXL 5LVEA 5D7KE 4LDOB 3WDHA 5BRZD 4YBLC 3BAEL 2CDGA 2YSSB 5KAQG 5L88L 1WIPA 4M5YL 5J56B 3BSZL 4G7VH 5INCA 1I75A 2C4FU 3DX7A 2P5EB 3INUH 3DV4A 1DN0A 4FQHA 5ERWB 5D96B 3MJ7B 3NCBB 4TSCH 1MCOH 2A38A 3NIDF 2HJKB 4IDJH 1A3RH 4HT1L 1A1MA 5I1LB 4QXTA 5J12C 1IGTB 3CUPA 2P44B 1AR2A 1F4HA 1VGKB 4LCWE 2A74A 1JN6B 3QCUH 3X13A 1EFXA 4MNHA 3GHEH 4LQFL 3D69B 4V1DD 5SWSB 1HIML 5JUEL 5JHDA 1IGCH 1WGOA 4XPGL 4UBDD 2GJ6E 3MZGB 4Z7OF 4GRLA 3HC0B 1EZVX 4PY7B 2HMIC 1ZOXA 4LIQL 4WUUD 5D1XD 2KZ1B 1IC5H 2OTWA 3KPOB 5C0BD 1EBAA 2QEJA 5CEZE 2R56H 4L4VE 5DJ6A 3MXVH 3O3EB 5CJXC 3GMNB 4X5XB 1FG2A 5BW7C 1LQSR 3TPUA 1BBDL 5LGJB 2A6IA 4L9LA 4NZRH 4GW1B 1VFMA 3SDXE 4ONHB 5F9WB 3EKCA 1R3IL 1BZ7B 4LPWA 2YUXA 3ARGC 1EHNA 1XF2B 5I76A 4ZYKB 1DQLH 3DYOA 5TDOB 3U4BL 4XBPA 1S3KH 4PB0H 4K3DL 1V7ML 4ORGB 1R3LA 3PIQA 4GQ9H 4QRRB 1DQML 1OW0C 1VEPA 1JGEA 1I3RA 2AW2A 3L5XL 4JY4B 1BFOB 5D2LB 2ESVD 3DXAE 3CFBB 2EYSB 4I48B 2OS7A 2AEQH 2M26A 4DZBA 3RGVA 3HAEG 5IJVA 5D7IB 1REIA 4UTBH 2GK2A 4Q58C 4LLVA 4K23L 4K7FB 4N90D 1SJHA 4XNXL 2ICEB 3C5SB 5CZVL 4GW4B 4GXUN 5DJCB 3LB6D 3QHZH 1FIGL 2ZG3A 3SDCB 4DEPC 4JDZB 3MR9B 5LCVH 3QEGH 4X9FA 4B7LA 4FQJL 2EEBA 4XWGL 3EFFA 4JDTL 1NUGA 2VDRL 2KDGA 5B3NA 5EO9A 4OZFG 2YD9A 3WFEH 1OGAB 1KBGL 4R7NB 5HGBB 1MAJA 3VI4F 3U9UA 4URTB 2R1XB 4QRPE 2EE6A 2ZCKH 1Y0LB 2VXQH 3EYSL 4BSWA 4F2MB 4Q2ZB 4TULH 3D87B 1EJOH 2VQTA 5KS9A 1JVKA 4PP1C 2GSIB 1A7NL 3F5WA 1AXTH 3H0TA 1H8OA 3U7AA 1E4WL 3SDXA 4CVXA 1MCBA 5DD3H 2ILLA 4NGHH 1INEL 3SQBA 5C09A 4PJ9D 3NCYP 2R2EA 4UDTB 4NJAL 3VW3L 4YHNB 4Q9RH 4JY6B 1QFWH 5HHMB 1MQKL 4MDIA 4OF0A 1DBMH 4JAMB 3TZVB 1JYNA 2W59A 2GTWA 2FGWL 3BIAX 1CGUA 3ARFB 4I18C 1NCUA 2EDHA 2JB6A 3O9WB 3TBSA 3SY0A 2EDYA 3A67H 2XTJC 1MCPH 2VR4A 5F7UA 5SWZB 4FFZL 2WLZA 4P2RD 1H8SA 4ZDHB 1U42A 2YPKA 5HY9A 5B4MD 4MD5B 5E2UL 4WY7H 5DQDH 2YHGA 5C08D 5ILTH 4OT1L 5EC1B 3ARVA 4H20H 4UIKH 3HZVA 2O5XH 4Z7UE 2DLHA 3VD4A 3T0AA 3PGFL 5JW3H 1HYRC 4G6AC 4ELMA 5DD0L 2Z91A 2DQFB 3RHWK 2BOCA 1J0HA 3IAPA 5KANI 1LO4H 5CMAA 5ICXA 4JRXB 2ADIB 1A8JH 3LSOA 4KKLD 2NTFA 3OAUL 1PY4A 1S9KC 1S7WA 1IC4H 2FH8A 1EUUA 1R5IA 4JFXA 4HAGA 2FWOB 3ZT7A 1MI5D 1EEZA 3V6FA 4OQ1A 5D1QC 4HFWB 3ZYOA 4P5TC 4LARH 3CDCA 3TM6A 2P5WB 4CKVX 4OCXL 4XP6L 3HE7C 4Z0BH 3MGOA 3WO4C 3RAJH 1NFDF 5GRJL 2XACC 3B5HA 2FO1A 2R0WL 3LKRA 4U0RC 5E56A 2H26B 5HHVH 4N0YH 2H8PB 4XP5H 2AK4A 2VL4A 2VB5A 1SYVA 3VDAA 2VKWA 4YGAB 5I8OH 2NXYB 4JQIH 1XGPA 4UU9B 3P4MB 4EXPX 1FJ1B 2R1WA 4U3XA 1J1OH 3IJSB 4PJHB 4Y4HC 3G5XA 3LV3B 1G7PB 4X6EB 3UZQA 4POUB 3EBAA 2XG5A 2PO6D 2JCCA 3E1F1 2BHYA 4LFHD 2CKBA 1H3VA 2EE9A 2FJHA 4L8SA 2FX8L 3QEQD 4LEXL 5E03A 2R0LL 4F57H 1E27B 1T2JA 3U79A 3QUYC 4JPVL 2LU7A 3RRQA 5GSRA 5IM7A 2EXYC 4IOIA 1G7IB 4PG9A 3SBWA 2ADGB 3QDJD 2NY4C 4L8DB 2MKWA 1YMMD 4WW2F 3DX8B 1RZGB 2BRRL 4MAYB 3S9DB 1F2QA 4U1KA 5TF1H 2IBZY 3F7YB 1F97A 3WN5C 2IBZX 4NKMA 1SY6H 2FSEA 1JGDB 3NFPA 1KCKA 5DVLA 3TN0A 1RZKL 1NEZG 4ONOA 1R6VA 3OWEA 1FBIH 4GS7C 2DJSA 1LGVA 3G6AA 4JPKH 4R96A 3H42L 3UTTA 5I1EL 3O6MH 4M03A 5ACZA 3BFOA 3CJJA 2LTQB 2DKSA 2Q3ZA 3DECA 5T1MA 3LEVL 2VLJE 4ZSOE 3GMMA 4W4OC 5GGRY 4OBSA 2VDOL 3EOAA 3U0TA 5C0CD 5K9JH 3UTSA 3MRFA 5JORB 3GKWL 3KNBA 5CFHA 2HVJA 3U46B 3O3AA 1LHZA 4JO1L 3M1BA 1G7MB 2ZOKA 5EUKB 3VXME 1KCRH 2J8UE 1U6AH 4NO0B 3D18A 1JHLL 4Z7WB 2DIAA 5JW4N 3D39E 3LY6A 5JIPA 4LU5L 4U7KA 4ODWB 1BD2B 3ZDZE 3GMLA 3IYLW 1ZWIB 1XF3B 1BPVA 1ZEAL 3EYUL 4R2GB 1FVEA 1N5AB 5D7SL 3TNMB 4XTRC 4OV6F 1RIUL 15C8L 2XICA 1PJ9A 4XCYB 4OJFH 1EAPB 4NO2A 4OCLC 2EICA 5F3HB 4OGXH 3DRTB 2NXZD 5E8OA 5LGHL 3LKSB 4NQED 3V7AE 1T6VN 3TA3A 4HSQA 3TIEA 1ONQA 3F6IA 3WSQH 3O4LE 3C60A 4G9FE 1CXEA 1KLUB 3QO1B 1CDGA 5F89B 5GRYA 1CLCA 3CVHB 1BQSA 3WE6B 1W0WA 3EDKA 2VE6A 2OMBA 1AD9B 1OT2A 2NY2B 2CLRA 1WZKA 3BQUB 1SEQL 4WNQB 4PJBF 2VLJA 4NBZB 1CYGA 1T7XA 4X4XB 4WV1A 3UCRA 3QPQD 2R1YA 2QQNH 1DTUA 1QR4A 3ULUL 2FD6L 1L0YA 3VRJB 2QV2A 3VXMA 4Z5RB 5CILH 1U3HB 3PL6C 5I17A 12E8L 4FP8L 3VFVA 1PKOA 2RGSA 2CLVA 3U1SL 3BPNB 3D39A 4G7YL 3S88L 5KTEH 4NRYA 2DQTL 2F53D 4YXLH 3VFMA 4GBXC 4C83A 3WNKA 5I1DB 3L3HA 4OCSH 3FAWA 4G9DA 1FV1B 3QNXA 1NSNL 5FYJU 2AXFB 4HT1H 4IRJB 3FB7A 3ULVD 2R2BB 1D5BA 4P9ML 1HXYA 2J4WL 4JJ5B 3MOBH 5EZJA 2QJDA 1EEQA 1Q1JL 3PWPE 4UAOC 3LKNB 2BY2A 2IGFL 2EDJA 4JGMA 1AGFB 1WBZA 5JUEH 4JG0H 4GXVL 2XZZA 1IARB 3NIDE 3O4LA 4PJ7A 2V7HB 1IFHH 4GW5A 4X8JA 4X7EC 1DDHB 4OCNC 5LBSL 3AREC 1U95A 4FQCH 4QT5B 2ED9A 1RZFH 2NX5E 5EBLB 4ZUUA 2CO6B 4F33B 4AYFA 4LSVL 2PYEE 5DLML 4KZDH 1QO3B 1C16B 3EJJX 43C9A 1GZQA 3ILPA 4LLDB 3HZKA 2OZ4L 1R3IH 2I5YH 2FB4H 2OI9B 3MRNA 5CJOL 2FO4B 4P9HL 3HNVL 2AJ3B 2HFTA 4TSAL 4MQXC 5B39A 3U4BH 4UILH 3FOLA 5B8CA 1P7HL 1V7MH 2Z35A 4HKJB 5DK0B 1OQXA 4G8GE 5DF0A 4AM0B 1T1WA 1DQMH 1HCFX 1S8DA 3TVMB 4F9PC 4WDIB 4OF5A 4XZUB 2L0DA 5I18H 5T3ZH 3ULUC 4DKFH 1VFOA 3IFNL 5EOQL 3KYOA 1GGBL 2CSPA 4KI5D 2FL5A 4UTAH 1UADC 3RDTC 2OM5A 3QUXA 3L3KA 3IDNA 4XNXH 4TUOA 3T09A 4KHTH 4FXKB 2DQEL 2JJSC 3EYQC 3GZKA 1H5BC 1PEZA 3T0XA 4JM2D 4NZTL 2L7JA 2R2HA 3QIUA 1II4E 3G08B 4XWGH 4JANB 3EO9L 3L95A 4Z7WF 5E5UB 2FHCA 5E6ZA 2D03L 4X7FC 3FQXB 2DQUL 1T89C 1KBGH 1KPVA 5GGSB 4GT7A 5I1KL 1AHWA 4LVHC 4RGNB 2X4UB 4GAYB 3UYRH 1Q8MA 4GKNA 4CNIA 3UBXG 1TZIA 1A6ZB 2PYEA 1MCRA 4RMTA 3MJ8A 2DIBA 4MSWA 3PV7A 5DVKA 3C8KB 4N8PA 4U1IA 2ATPB 5DO2C 3TH4T 5IHUH 1E4WH 4LNRB 3C87A 1J1PH 4TQEL 4KKAD 1MRCH 5EN2B 4X7DC 3VI4E 1R0AL 1CTOA 3QNZB 3S4SG 2OL3B 4PBXA 4RGMC 1F90H 4NDMB 2YD6A 5D5MF 5CEXB 3B9EA 3O2VL 4MJID 1MQKH 4O5LL 1EHXA 4LOUC 3G5YA 4YXKH 5D7LE 3X17A 5FM5O 3MYJB 1M05B 5GGUA 3BW9A 5IT2H 1ZVYA 1D6EB 2MPAH 3O41A 5E6IB 5CCKL 1DUYB 1UA6L 4PRHD 1AC0A 2BXZA 6CGTA 2GK0B 1Q9KB 4JQXC 4P9HC 2EDWA 4NNYB 4NKIH 5EFIB 1CGWA 4POZC 4CJ1A 25C8L 2X40A 4XMKL 5F7KC 4AY0A 5CLWA 4NM4L 1NJ9B 1YNTB 4JFOA 4S0TD 1EIBA 4Q6IC 2MNUA 1J87A 2JIXD 3KPNA 4LCUB 4TTDD 3HZMB 4OT1H 5HHPB 4F37K 1XR8A 2CIIB 1S7RB 1BECA 1TCRA 2MTPA 2QSQA 3PGFH 1SVZA 1ZSDB 3WFBL 1DP0A 1IQDA 4PR5B 1C08B 4ERSL 3OJVC 2D0HA 3K8LA 5F3BB 1KIUA 4KAQH 5ID1A 4ZAKD 1P4BL 3BH9A 5F1IB 3OAUH 3PHOB 1CLZH 4RDQF 2F8XC 2G5BB 3S35X 1MPAL 1A6AB 3LRSB 1I1CA 4Y19A 2WZPD 3N50A 3OR7B 1I9EA 3SDAA 3T8XB 4F3FB 5DJDA 5GIRB 3BDYL 1T7WA 2A83B 2P5EE 4XP6H 3WUWG 1U0QA 3LKPA 5E8DH 3C5ZA 2E9IA 1F8TH 4X7TB 2R0WH 5DMIL 1DJSA 4S0SD 4HJ0C 1JZ8A 4KK8C 1LE9A 3U0PA 3ROOB 4O2CA 1DLHB 4CADA 3RU8L 1CK0H 5F7NC 4EI5B 1PYWB 1TJHH 5GZND 4ZOEA 3VJ6A 5IB5A 1IAMA 5DMKA 3JWNC 1NFDE 3KXFE 4D94A 4TNWF 4ZXBD 3NPZB 1QTYT 1L6XA 2Q8BL 4J3UA 4QOKB 2FX8H 1J10A 2DLFH 3S37H 1MVUA 3TYFB 3HB3C 5HVWA 3MLUL 4JPVH 1WZMA 5FIEA 4D3CH 4E0RA 2V2XB 3AAZA 3I75A 4HJGB 5GGRA 4G43A 3L3JA 2BRRH 4KROD 1RZJH 3WS3B 3S3PA 4PRID 3FCTB 2FIKB 1DANT 3ZKMD 2Q76A 4JO4H 1YN7A 2GW5A 1UYWH 2W38A 4M48L 4H88L 3CDFA 1NL0H 3VWKB 5I0DA 1RZKH 1HH9A 4PJAB 2BNQD 2YSSA 2VERN 1S7XB 3L1OH 2X4NB 1OM3L 1CFTB 4UINL 1PW3A 1AGBB 2YD3A 1W0VB 2APXA 1I8LC 4QRRE 2UZXB 5DFVD 2P5EA 3TT1L 5ERWA 2FATH 3MJ7A 4U1NB 1N26A 2HJKA 3ARGB 3P30L 4NN5B 3F7PC 3IT8D 1X4YA 2VAJA 2X5PA 4KK9D 1RZIA 5I1LA 3VG0L 3SGJA 1A22B 2D7QA 3GKWH 3QUZC 2ZUQB 1VGKA 1JN6A 1EA9C 4JO1H 5ICZB 4HUVB 2H2SC 3D69A 1S5IL 3L3IB 5SWSA 5I19L 4L3ED 4ZS7L 2XTLA 4BZ1L 1EVUA 4IMKC 2Y06H 2HFEB 3HC0A 5JXEC 3UC0H 3Q6FB 4PY7A 4H0IA 4FHBD 4Y0GA 3OKEB 1OGAE 3QIWC 1I9RL 3U0WL 1Q94B 4BJLA 4MA8H 4R8WL 3O3EA 3GMNA 1U8IB 4X5XA 4YFDB 1EHLL 3VXRB 1X5XA 1MUJB 1M1SA 3FT4A 4LCIL 1QSVA 1FFOA 5LGJA 1HKFA 4GW1A 5IF0B 2PW2B 1QSFD 4KXZI 4A6YB 3HCVB 5I73C 2DQHL 5E8PB 5FYLD 1CXLA 1BZ7A 5EIVA 4PLKC 1XF2A 4ZYKA 1LE5A 4OF8A 5TDOA 4Y4KC 3VFOB 4DQOL 3MV7E 2E9BA 5BV7B 4JKLA 3BPLB 2NZ9C 2Y7QB 5EU6E 4ORGA 3OGCA 4N0UB 5FCUL 5DEFB 4QRRA 4O02H 5D2LA 4JY4A 1BFOA 3LDBC 4MQ7B 3CFBA 1AFVL 2GUOB 2EYSA 2IANB 4X80H 4OFYD 1JZ6A 5L0QC 3VRIB 5E99L 3EAKA 2GITB 5D7IA 3DMMC 5D7JB 1YEDB 5FHAL 2KPNA 1ZHNB 4PV9B 3VGFA 3CFEA 4UDUB 3PWLB 2FD6H 3LZFH 4APQC 3JUYA 3L3DA 4GW4A 4JFEE 1WISA 3SKOB 1WZLA 5DJCA 1N6VA 3SDCA 4JDZA 12E8H 4J3TA 4FTVE 1A4KB 3GSQB 4PJBE 1BVZA 4PGEB 2OK0L 2F19L 5GHWL 5HYIA 3S88H 3PUCA 4WWKA 2BVUA 4TOYL 4U1JB 3LH2L 1BZ9B 2ED8A 2DQTH 1CDCA 2VLRD 3G9VA 4R7NA 4J12A 5HGBA 1R5WB 2CR6A 2IFGA 3MNWB 5CZXC 4OZHB 2R1XA 1Y0LA 1Z9SA 4F2MA 4Q2ZA 4QHUB 3SDDD 5HHOB 4P23B 2VXSL 3F58L 3JV6B 4TSBH 2GSIA 3CSBA 2J4WH 4R26L 4U1LB 1G9ML 3IVKB 4M61B 1T22B 2FBJH 2HFGL 1KLGA 2WAHA 4HG4K 2P5WE 1DANU 1VADB 2P24A 4PP2B 3RVUD 4GXVH 3MLYL 4UDTA 2OJZL 1U8PA 1OCWL 5GJTH 5BRZB 4YHNA 1FVCB 5DURD 4JAMA 3TZVA 5KW9H 5GGSY 1DBAL 4XX1G 2A6KB 1K4DB 3ARFA 3BI9X 1EHAA 3OJDB 3O9WA 4P5TB 4QRQB 2OL3L 4K3EH 5I8EB 1AE6H 3BIKA 1GHFL 4UNTA 1DQDL 5C86A 4HHAB 3HE7B 3ES6B 1NFIB 1IM3B 3IDGB 5SWZA 3H9HB 5MEPB 3HI6L 5JOPE 4ZOCA 1UGNA 1KV3A 4ZDHA 4MS8C 5CJOH 1QRND 3MLXL 1H3PH 4V1DB 5DZLA 3X3GH 3DUSB 2FZ3A 1FL3B 2Z8RA 2PXYD 3HNSL 2NW3B 1KJMB 5CWSA 3SDYL 4WUUB 4I3RL 1F4WL 5D1XB 4JKPL 2AJXL 5EO0A 5EIQA 4P5KB 5C0BB 5HGDB 2VDQL 3FONA 3K2UH 4OCRL 1KJVB 3QAZB 1VA9A 3VFSB 4JRXA 2ADIA 5EOQH 2E5EA 3MV8E 2ZKHL 3QUYB 5KZCD 3G5VB 1JRHI 2FWOA 4D2NA 2NY4B 3RZCC 1J12A 1NUNB 1YQVH 4GQPH 4HFWA 1RK1B 4K07A 2F5BL 4R4NC 3MNZB 3DX9B 1NCCL 2P5WA 4NZTH 1WBXB 3QCTL 3QWQB 3QSKB 2DI7A 3H7BB 4BQ8A 4KJPD 4LLYB 4XAWH 1OAZL 3W0WD 5GZOD 2D03H 3S7GA 2H26A 4E41D 3I6LD 2H8PA 5I1KH 5F8QC 1LDPL 5IFAH 1WIUA 3DV6B 5JNYB 1KN2H 1A6UL 1N64H 4UU9A 1HZHL 3IJSA 4PJHA 1ZVSB 5I1IL 1FL5B 3LV3A 1BQHB 1G7PA 2WV3A 4X6EA 1AQDB 1U91B 4YH6A 4WFHE 3OKMB 1UB6B 4CW1B 1MCFA 5I9QC 5FYJD 3BP6B 1BD2E 4I2XE 2PYFA 4M93C 1E27A 5C7XL 2F5AL 3OAZH 1P7QD 1RUAH 3PP4H 1SQ2N 3O2VH 1JIBA 4KU1A 4O5LH 1G7IA 2A73B 2ADGA 3PABA 1FH5H 2BOBB 2CJUL 3NPSC 4TPRL 5GGQL 3MPCA 3DX8A 5CCKH 4MAYA 1A1NB 43CAB 1CDBA 1BX2B 3V79C 4HULB 1A7PL 3F7YA 4XCCH 5JQ6L 1P9MC 3TWCL 3PG2A 4HK0A 4RMVA 5IMKB 1ZKAA 3O8XC 5D5ME 2Y25A 3RI5F 4NM4H 3GSRB 3H2WA 3DWTA 1Q9LA 1N4XL 4WEUD 1FGNL 5ADOL 5DR5L 4KKNA 4ONGL 4PJ9B 1H3TA 3IJHB 3RTQC 1MIEL 5E8EB 2VLKB 4YHKL 2AK1L 4L5FH 3TYGL 2DBJA 5JORA 4G5ZL 3U46A 3UTZB 3WHXB 1G7MA 3L5HA 5DYOB 5MHSD 3IXAB 3KYNB 4WFGD 4OZHF 5EUKA 4NO0A 1A5FH 1KJ2B 3ZE0E 3TV3L 4ZO9A 2E27L 1A4JB 4XVSL 4Z7WA 4AEIL 1JV5B 1Y6NR 1CWVA 3G6DL 1TLKA 1LO5A 4ODWA 2FX9H 4P2RB 1BD2A 1U3JA 5ENWB 3O2DL 3O6LH 1ZWIA 4MWFB 5GS0D 3RIAK 2A0LC 4KZEL 1UWGH 4K8RH 2XA8L 5C08B 1JRHL 1N5AA 3KDMB 4OIIL 2V5RA 4PS4L 4ZFOB 3HG1D 1HYSC 5FV1L 2Z92B 5D72L 3IDJB 2MCPL 2IH3B 4PJ5B 4F9LA 1H9VA 4XCYA 3RU8H 1EAPA 4JDVA 4LRNL 3DRTA 4ISVA 4XAKD 3LKSA 2DJ4A 5E4EB 1S78C 3DIFB 3DVNB 2LAAA 3P0GB 5KN5B 4F8TA 3QA3B 1EGJA 1RURH 4W6YB 4Y5XC 2Q8BH 1KLUA 3EJZD 3QO1A 4PUBL 1MI5B 5F89A 3CVHA 3WE6A 5DTFB 1HXMB 3U7WH 3FOMB 5F70A 4Y5VA 3BQUA 8CGTA 3VGGA 3HNTH 1CD9B 4ZTPH 4OTXL 3D5OF 4WNQA 4X6CF 3VXNB 4J4PD 1KTDA 4EDXB 4LASL 4UZGA 1EGJH 1QZ1A 1MJUL 4Z5RA 3PV6B 2HWZL 1U3HA 3EGSA 4H88H 4HK3N 4QWWD 4CGTA 4UINH 3HMWH 5FUZL 1K8DB 1QQDB 3ISWA 3KYKL 2PCPB 4X0KB 1VPOH 5DDHB 1FNGB 5T5NG 3TT1H 5I1DA 4QGYA 4FN0A 5EWIL 5JOFB 1FV1A 4D0BB 1JPST 3P30H 1CDHA 2AXFA 4IRJA 3AVEA 5SX4I 4LAQL 2VMFA 3OZ9H 2R2BA 3FRPG 4JEGB 5GISH 4KDTC 4JJ5A 4BSJA 1YMMB 4DK6A 5IGXL 3K46A 2WUCH 1AGFA 3MBED 4ZS7H 4BZ1H 3U9PH 3KPSE 5IVXB 2V7HA 4I0PC 2MJWA 2IADA 4LPVA 3CFKB 5B38G 5CD5D 4OUOA 1QKZH 3RDTB 1DDHA 1XEDA 1ODAA 3A6CH 4QT5A 3MGAA 3Q3GB 3NACL 2B7DT 2APTA 4P2OD 4R8WH 1XGTB 5EBLA 4J1UB 5MEQB 3DSNA 1K6QL 4IRSC 5E1AB 4JVWA 1NUFA 1QO3A 1C16A 2EH7L 1KB5B 5C0CB 2W65B 4JPIB 3TO2A 1HWHB 4LLDA 1IM9A 4M43H 3UROR 5ITFB 4XVUD 2DQHH 3T0ED 3NN8B 4XMPH 1NCBL 3OF6A 1YNKL 2UZIL 1HSBA 3TBTB 2FO4A 3VH8G 5EB9A 4HIXH 3LN5B 4ODVH 4GRLD 4XVJL 3B9AA 2OP4L 4LVNC 4YFLI 4HKJA 5DK0A 2F8VA 3BMWA 4UV4L 2BJML 4AM0A 3FFDB 5FGCB 5AEAA 3B5TA 4JFZL 3TVMA 2CDFA 5FB8A 2NQCA 4WDIA 4XZUA 4YFLF 3D0VB 5CKGA 4IS6B 2CRYA 1AIFB 4EOWH 5E99H 1AC6A 3ULSB 1Q72L 4M62H 4XP9H 4RGMB 5FHAH 1C7SA 3OTTA 3IRPX 1WEJH 2YXFA 4MYWB 4FXKA 1QSEE 4UOW1 2NXZB 3OQ3B 3T2QA 1CS6A 1F13A 4NQEB 3GSNB 5CBAB 3HC4H 1CDUA 3G08A 2F19H 4JANA 5GHWH 5IEHB 3FHQA 4M7ZC 4LHUG 4W6WB 3OPZH 4N8VB 1CZ8L 4JFDE 4YEFA 5EG6C 3TP4A 5GGSA 1DEDA 3OBAA 4FNLH 3NGBC 3EO0A 3RGVD 2X4UA 4GAYA 4JCLA 4P46C 2J6EL 2WMPA 1A6ZA 1UG9A 3RVXC 2MQ0A 1FN4B 4JZNB 3C8KA 4JPWH 2ATPA 5DJXB 3EOTL 4AQ1B 3BP4B 4NFBA 1J05B 2CGRH 3ZE1E 1C1EL 1JNNH 5EN2A 2Z31C 5EH1A 2DIJA 5MEND 1JFQH 3QNZA 3DETD 2OJZH 2YC1B 4JQVC 4NDMA 5CEXA 4OCWH 4ZTOH 1YECL 5DGRA 3MROA 4MNQA 1QBML 3MYJA 5GRXG 1D6EA 1DBAH 1ULVA 2F53B 1KC5L 5E6IA 3IXTA 1DUYA 5DD1H 1BM3L 1D5XA 3B9KC 5KSAC 3JWDL 1IBGL 2GK0A 2NY6C 5IBTL 1Q9KA 2P8LB 4HC1A 2OL3H 5DMJB 3KPLB 5GRVL 2H1PL 2Q8AH 4NNYA 4LSQH 5EFIA 4MHHI 1OVZA 3IJYB 2VITB 2UYLB 2VDML 4HD9A 5C2UB 1KOAA 1QFOA 5C09D 2YD8A 1MQ8A 1NJ9A 1YNTA 4QOKE 2DQJL 5E2TH 1YEKL 4WW1B 2MSPA 4G42B 3QH3B 4HK3J 4HC1H 1WQVT 2YKLL 3HZMA 5HHPA 3RZWA 4KXZH 1R5VB 4DAGH 2N7BA 4AG4H 2CIIA 1S7RA 4GSDL 2EEDA 2C1OB 4ZQKB 1VACB 1ZSDA 4BFEA 4DZ8A 3E0GA 1TFHA 1C08A 2XY1A 4E9LA 1LVEA 5F3BA 4O2EB 1OT1A 4YJZL 5F1IA 1UWXH 2AAVA 3FL7A 3PHOA 1I8MA 2KH2B 2G5BA 4OLUL 3C09B 3ZDXF 3VH8A 3W39B 3IDYB 4FQ2H 4HQQL 4OFIA 4QTIL 3LRSA 1FNAA 1PAMA 4LPCA 1HHJB 3WNLA 1RPQA 3OR7A 3T8XA 1T20B 4KQ4H 5GIRA 2A83A 1CICC 2VSCA 4IBLT 1MCQA 1FE8H 1O7VA 1KJ2L 4X7TA 4FMKA 5DGQA 3N9GH 4LL9A 1AO7B 4WI6A 2N7AA 3LAFA 1CGVA 1WTGT 3ROOA 4AL8L 3C9NB 1DLHA 1LDPH 1BFVL 4RRPG 5JLZB 1TMCB 4EI5A 1A6UH 1PYWA 1MHCB 4HKXB 5CKAA 5I1IH 2WUBL 1TQBC 5IW6B 1QA9B 2EDDA 1PKQB 4GOSA 5HDLA 4QOKA 3VFNB 1U2HA 3TYFA 2PUQT 4HBCL 4JM2B 4QKXB 4MJ4A 2V2XA 3ETBF 2R15A 4TNVK 2YK1L 2XOTA 1JK8B 4HJGA 4TPRH 5GGQH 4EDWL 1GGIL 1TPXB 4UIMB 3FCTA 3GBML 3LEXB 1CD1A 4L4TE 1A7PH 3BJLA 3TWCH 1BFTA 5C70A 4X4YB 4P5MB 2IAMC 4Y16C 3BJ91 3HE6C 4FG6D 3LKQB 3VWKA 4FFWD 4M1CD 4PJAA 5C9JB 5F1SA 4F7TB 2X4NA 1GRWA 5BW7A 1K9TA 1AGBA 4XMLL 2NY3D 1W0VA 2ICWJ 1ZLWH 3ZTJH 5JZ7C 3QG7H 1K8IB 2IANE 3MRJB 3HN3A 1YN6A 4U1NA 4YHYB 3KLHC 1VFBA 1YMHB 3ARGA 4Y1AE 2YPLD 4MJIB 5IMMB 2B20A 4Y4KB 2AK1H 1MEXH 3TYGH 1BQLL 1MHPH 3KHQA 3M8OL 4H25A 3IKCB 5L9DH 1CL7L 4G5ZH 5ICZA 2Z8VC 3RY5A 4HUVA 1OW0A 4LPTA 4PJ8C 3L3IA 5F7DB 4QGTA 3FHAA 4DGYL 4PLNC 4RIRB 3UJJL 1FNLA 5L0QB 5EU7E 2HFEA 3QXAB 5TPWL 3UTTD 2HRPH 3JTTB 3Q6FA 5EUOB 3TGXA 3DMMB 4OI8A 4DUVA 2ENYA 3CMOL 3BKJL 4K55A 3OKEA 1Q94A 4P49A 2B8OT 3BP7B 3QFJB 4APQB 4OZHE 1T1YB 1JRHH 1U8IA 5HHOE 3UTSD 1A3QA 3VXRA 1BOGB 1MUJA 5FAAA 4XCNA 3CX5J 4PS4H 4Z7VB 3PGCA 1MFBL 5IF0A 1G7JB 5D72H 2MCPH 2PW2A 5C6PB 1ZHKB 4A6YA 3HCVA 4LRNH 1FLTX 1OSPL 5E8PA 1KENL 4FQIH 3ARXA 5A1AA 4ZAKB 5IROC 4M7LT 4H26B 4PJXB 4E5XB 2EDQA 4PGBB 1NAMB 2O61B 1T04B 5IFHH 3MXWL 4PIRF 3VFOA 2P47B 3ZKXB 3ULVF 2WWMD 4ZNCD 5BRZE 5I1CL 5ALBH 3RUGF 4N0UA 4OAWB 1KB5L 3BGFC 5DEFA 5TQ0L 2F9BT 4A6YH 1JWUB 3HUJB 4MQ7A 2GUOA 5LQBH 2IANA 2J8HA 4PGCB 3EHBD 4OTXH 3GGWB 3NCFB 3VRIA 3BN9C 4WO4C 5GSVA 2GITA 1L9MA 5BV7H 5D7JA 5HYJB 1JUFA 2DYPB 1YEDA 4KH2A 5KVDH 1ZHNA 4PV9A 3PWLA 1LNUB 3TA3D 5F96L 3BKML 1MJUH 3SKOA 2E7HA 2VWEC 3C60D 3RJDA 4O58L 4I18A 4N1EA 1A4KA 3GSQA 4DKAA 4PGEA 2QADD 4YBQC 1NBYB 2IF7A 4HUKB 4X6CE 4M7JH 5CLTA 4ZXBB 3OL2A 1ZHBA 4U1JA 5FUZH 3AXLB 1BZ9A 5CGMA 2X4SB 4G6JL 1Z6JT 2R0KL 3VWJD 3HC3H 4R4FL 5HI3C 1SYSB 1R5WA 1YJDC 5DK3A 3MNWA 5C0BE 3CSGA 5T5FL 1IGMH 4X4ME 4F7CB 4JHBA 4F7MB 4QHUA 5HHOA 2XNAA 3JV6A 2LVCA 4DOHE 5C0JA 5F9OL 1M7XA 4KROB 1WWAX 4U1LA 3GIZH 1M71B 3STZB 3IVKA 4M61A 3I84A 4PRIB 3F62A 2JLLA 1ED3B 4P4KC 3RFZC 1VADA 5J13B 4PP2A 2V5SA 2BZDA 4X6DB 2HKHH 1YPZB 4QYOA 4KI5F 4NM8L 5BRZA 1FVCA 4GKZB 3BZ4B 3ZKNC 2BNQB 4IEFB 3CVIL 4GMSL 4L8BB 4OFKA 3NACH 4LSRL 2ESVE 2A6KA 4FQLL 3RZCB 1K4DA 2D7TH 3NCMA 3OJDA 4JM2F 4P5TA 3P4NB 4QRQA 1KXQE 4Z77B 5D6CB 4WI4A 5HI5D 3MLZL 5C6WH 1WJ3A 5I2IB 3HE7A 5TDNB 1X5AA 3ES6A 2BERA 2BRQA 1NFIA 3LRGA 1IM3A 3IDGA 5J11C 5E00A 3AMLA 3H9HA 5MEPA 1CGSH 3UJTL 2VRAA 3QDGD 1YNKH 3QJHA 2UZIH 4U4BA 1UT9A 1DBBH 1U9KA 4V1DA 3ZTNH 4L3EB 5DC4B 1FDLL 4R90H 5HI4C 1TZGL 1UACH 3QXWA 1FL3A 5DRZB 3ULVL 4LLAA 3L3GB 3DARA 4HCRL 2VIRB 1KJMA 2NW3A 4WUUA 5CSZA 1MRFH 2YUVA 3MLWH 4P5KA 1UJ3C 5C0BA 5HGDA 3GMPA 2D7NA 5IWLC 1WICA 4OCYH 5FOBB 2FECI 1KJVA 3ARDC 5CUSL 4AEEA 1OAYL 4LCCB 1ITBB 4PPTA 4NCC2 5C0IB 3VFTB 3QUYA 2VDNH 5FUCE 3G5VA 5I71C 5T3ZD 2C4XA 1UH3A 1QSFB 3GMOB 4W4NA 2Y72A 3RX7A 3MV01 4PJGB 3B2VH 1U93B 3O2WH 1RK1A 1U36A 3WIFB 3IAGC 1QLEL 2I24N 3MNZA 3DX9A 3ESVF 4YQXL 1WBXA 1CF8L 4RAUB 3FB8B 3S6CA 3H7BA 3SE4A 4HJJH 2OTUB 4M5ZH 2LQRA 1IGFL 5AZ2L 1CZ8H 5EUOF 1LO3H 4DTGL 4EIGB 4G6ML 4AIXA 3DV6A 5JNYA 2J6EH 3R06B 4PJFB 2YUWA 5DT1L 5EPMB 1QLFB 2HJFA 5I74B 1MJ7L 2XY2A 1RHFA 4QLRA 5HHXH 5JIHA 1BQHA 3EOTH 2AJSL 1U91A 4Y4FC 3EFDL 3OKMA 2F8OA 3Q6GL 1UB6A 1O7SA 3B6SB 4CW1A 5TF0A 2FLRT 3BP6A 2GSGB 4P2RE 2VJXA 1K85A 3ALWA 4PJXF 1I8KB 5K93A 3MRDA 1YQ2A 1ND0B 1YECH 2A73A 2DKMA 5ANMB 2BOBA 4X99B 4MGXA 3W5NA 1YYLL 2FX7L 2G2RB 1KC5H 2VLRB 2WQ8A 4OQTA 3GNMH 1X5HA 1A1NA 3JWDH 1IBGH 1PG7L 2D9CA 43CAA 1BX2A 2YMXL 5IBTH 3D3VB 3SDDB 4S1QL 4JGJA 5LAXB 1F42A 2HG5A 2VDMH 2Z9TA 2A77L 1UM4H 3K81A 1MI5E 1TITA 2FRGP 1YEKH 4FQXC 2VZVA 4LPXA 4PJ9A 5H8DA 3OAYK 1Z3GL 3IJHA 1G9NL 5E8EA 5HYSB 3ESUF 5M94B 2J3SA 1RK0B 3WD5H 1IGJB 1JGUL 1JWMB 2VLKA 2QHLA 3BZEB 5DURB 1GH7A 5HGGS 3FN3A 4RFOL 1OAQL 4HKBA 3QQ3A 4XP1L 5TE6L 1Y6MR 3UTZA 4JY5L 2Q87A 5DYOA 3IXAA 2BNRA 1N6QH 4OD2A 1OTUC 5TQ2L 1A4JA 2FJGB 4BZ2L 3FT3B 4ENED 2GFBB 5DUMH 1JP5A 1JV5A 4RGOL 3AY4C 4NQDD 2RCSH 4Q74A 2FECL 4RMUA 5A2FA 2EYRB 1QRNB 1N5YL 3TO4D 4MWFA 3QEQE 2X1PA 1HILA 1QBLL 4QHKI 5IMOB 5C08A 1KJ2H 1YPZF 3F6LA 3KDMA 2WBWB 2W1NA 3ZDXE 3QDJE 2BVEA 1LP9E 4ZFOA 3Q5TA 4P57A 3RA7H 4DVBA 4ZPVB 1HH6B 2NY1D 1YMME 3IDJA 1BFVH 4PJ5A 4MJ5B 1CFQA 4BZYA 1JNLL 2QSCH 2V9TA 1X5IA 4GBXA 2HA1A 4MVBC 1G7LB 5GRWA 4U7SA 3DIFA 2AJVL 3P9WB 5IK3B 4OB5H 3DVNA 2WUBH 4Y19D 5KN5A 1HHIB 2UY7A 3TCLB 5KZCB 1VGEL 4EN3D 1OLZA 1E4JA 5HHNB 2E9JA 4MCYB 1KSRA 4CU8A 5DTFA 1HXMA 3FOMA 2GCYA 4X7SL 1UC6A 4EDWH 3FB6B 1MWAL 1SM3L 3W0WB 1NLDH 3SO5A 5CJBA 3WYRA 4EDXA 2ZCHH 4GUPB 1N0LA 5C0CE 4JZJC 3T08A 1FC2D 4DFHA 1FYTE 3RHWF 5KVGH 3PV6A 2BSSB 1KCUL 2AJUL 2YN3A 1CQKA 1J0JA 2ARJQ 2YEZA 3LIZH 1ZGLB 5LGKA 5J1SC 2AJZB 3VXUD 1A1OB 5I66B 2DAVA 2HJLB 4PJGF 1QQDA 2PCPA 2W0LA 4X0KA 5DDHA 1RMFH 4LPUA 2MOVA 4WJ5A 1FNGA 5JOFA 5C2BH 4D0BA 5DWUL 1EMTH 1FZKB 2H9GA 1BQLH 3MA9H 4KK5C 4Z6AT 5DD5H 4LVNB 3S36L 1FYHB 3HTLX 1HNFA 4Z0XB 1T7VA 4YIQB 3SKJH 4QXGH 4FRWA 5IW1B 4IOSD 5HVFB 3I02B 4LP5A 4OM1H 2R0ZL 2R9HD 1W0YT 4WENB 4F9PA 1DBKL 2OR7A 4HIJB 4NQEE 4DGYH 1DSFL 2V6HA 3RWJA 1OP3H 2ITDB 5TPWH 5IVXA 4JB9H 5E9DD 1PD6A 1TZHB 1R3JB 1S7UB 2UUDK 3TT3L 3RDTA 2HTLD 4FFVC 1MH5B 4LMQE 1LEGA 3THMH 3Q3GA 1S9YB 3KR3L 4J1UA 2JJSA 1EO7A 5MEQA 5AZEL 4Z18A 5E1AA 5KVEL 1BOYA 4OLEA 4R7DB 4ODSL 1YA5A 4P59H 5C0CA 2W65A 4JPIA 5F9DC 4RAVB 2JJTC 5ITFA 3QWRD 3NN8A 4UNUA 3JUZA 5SWSD 1A2YB 1MFNA 1OF2B 3TBTA 2GKIA 4J3XA 3LN5A 3MXWH 4GAGL 3NGBB 1AGCB 4PRDB 4KUZL 2NR6C 4Z78A 3P73B 3QBTB 4XXCC 4BKLB 2IFFL 5FDWA 4H8WL 1MJ8L 1KELL 2I9TB 3SCMD 1KB5H 3FFDA 5C07D 2VZ1A 3TJHD 2XRAL 3U7YH 5F7EL 1KXVC 1P6FA 3D0VA 3L6FB 3MACH 4IS6A 5HTSA 1AIFA 4KRPC 2WBJD 3ULSA 5E4IA 3ULVE 3HG1B 4HPYL 3RUGE 4L3AA 3WFCL 2DLEA 1XF1A 5HGHB 5JMOC 4Z9KB 4XPTL 4NQEA 3GSNA 5CBAA 4O58H 5GJSH 1J1XH 4UT9H 4WFFD 2NY6B 4MXWL 5IEHA 4FABL 4JQXA 2KUTA 1AQKL 3JWOL 3VA2C 5AWNH 3WXVH 5DMYA 3FFCA 4N8VA 4O9HH 3QB7C 5T5FH 1ZV5A 4Q0XL 4QCIB 3V8CA 4TRPH 3GSNH 3OKNB 1FN4A 1IAII 4JZNA 2X05A 3V0AC 5DJXA 1BEYL 1KIQB 3BP4A 4MXQD 1CVRA 3TCXA 1BGXH 3LD8C 2VR5A 1HHHB 2ARWA 5C0AA 5H35B 1X6LA 4HZLA 5I1AB 2HT3C 1UH4A 4EBQH 3I6GB 4JFQA 3AB0B 2YC1A 4WWKD 3BX7C 1J5OL 5J6HB 1RY7B 3V4VL 1IKFL 1T66C 1MY7A 1DFBH 3CVIH 5C0NC 3JZ7A 4J6RH 4XWOC 3VMOA 4ALAH 2F53A 3WMSA 4H1LG 3MBXH 1RUPL 2P8LA 3X14B 5FKPB 4K7PL 4KI5E 3MLZH 5EOTB 3IJYA 2VITA 4EQ2A 2UYLA 1PKQE 2Q86B 1A0QH 2OX5A 4XH2B 1IRAY 3GO1H 1QG3A 3VGAB 4WW1A 3MBEB 4G42A 2DD8L 5AAMA 5HHMD 1FDLH 2J8OA 5FO9B 3LQAC 3ZYZA 5JHLH 4ZNEE 1FNSL 3ULVH 1J0ZA 1R5VA 4BH7B 2B4CH 3P0VL 2ENSA 2C1OA 4ZQKA 3BZFB 3RL1B 4P2OB 4J8RB 4O2EA 5CUSH 1LO2H 3QXUA 2HKFL 1GGTA 5SWZD 3W39A 1Y18B 4NNXB 1MVFA 3OXRB 1YEHL 3JWOC 3T0EB 1HHJA 2L7UA 1QLEH 1QUNA 2BVPB 2WP3T 3SKMB 1T20A 1JJUA 1KCSL 2CRZA 1GC1H 1RJZB 1YDPA 4G8EB 5AZ2H 4LCYA 1ZHLB 1BAFL 4MJIE 1AO7A 3HE6B 1I7ZA 4N0CD 5DJ6B 3KYMB 4XNUL 4JM4H 4XP4H 3OJMB 5FYKL 1Z9MA 3C9NA 4CVZB 1KJ3L 4KPHL 1JF1A 5JLZA 2IALB 4PRHE 1JZ2A 4NIKB 3TPUB 4Y7MA 4HKXA 1MJ7H 1R3HB 1UB5B 3VG9B 1A9BA 1ZLVK 5IW6A 1QA9A 1KCVL 1V3MA 3WJJC 5EUOE 4HH9B 5I76B 3GK8L 1DLFH 3VFNA 5E94A 5DXWA 3ZYIA 2VDPL 4JM2A 1NLBL 4YHIB 5JPNB 4KJQC 1BFSA 5K9OB 2H41A 1JGEB 1JK8A 1YYLH 2FX7H 4RMWA 5ISZA 2CMRH 1PG7H 1MFDH 4UIMA 3LEXA 4GAJL 2X89A 1WV7T 4LLVB 4P5MA 4X4YA 2HP4A 3VRLF 5HD8D 5I1JL 2Y36L 5GGVY 5L6YL 4J3WA 5F6HJ 3LKQA 3V2AR 5KSVA 4S1RL 4U1HB 4F7TA 5C9JA 5TGBA 1KG0B 1CGXA 3EYVB 4UT7L 3SE3C 3AS3A 1P84K 4KTEL 5MENB 5LXGH 1K8IA 3LPWA 1Z3GH 1GPOL 1YMHA 3PDOB 1JGUH 5EO9B 4LHJB 4MJIA 4P48A 4I3SL 4Y4KA 3DX6B 4U6TA 3NZ8A 1NC4D 5C8JA 3IKCA 2IBBA 4JN1L 1AJ7L 4JY5H 2EXWD 3MSPA 2D4FA 5F9AC 5FYJL 3P11L 1QBBA 1A6VH 4NJ9H 1F2XK 5F7DA 2ZZUT 4RIRA 4Y8AA 1NCAH 3X12A 3QXAA 1FGVL 1QFUH 3JTTA 4PJDF 5EUOA 5FXCH 2Q3AA 3DMMA 3TBVB 3ZHLA 3O0RL 2XA3A 3D0LB 3BXNB 1IEBB 3N0PB 1QBLH 3BP7A 2Y23A 4XCEB 1LEIA 3QFJA 4APQA 2VXVH 4Q9CA 1T1YA 1JHTB 2YWYA 1BOGA 2JK5B 2GTWB 2IPKB 1YEJH 4Z7VA 3P40A 4S1DC 4UB0H 1G7JA 1U8LB 4M1DL 5DMGD 1ZHKA 4JN2B 1MRDH 2DLGA 4XPFL 4ZAKA 1HKLL 4E5XA 4PJXA 4GG6B 4JG1H 4PGBA 4KMLB 1NAMA 1XCQB 2O61A 4U1MB 1NGYB 4JO3H 1W8OA 1YPZE 3VDCA 1AY1L 1DVFC 2FEEL 3P9MB 1CDIA 2BNQE 1G0DA 4OAWA 5HY9B 5MP6L 1EPFA 1NFKA 1P4LB 1JWUA 3HUJA 2BY0A 4KDWA 4WUKL 5T1DH 5EA0L 3SGDI 1NAMH 4P4KB 2ATKB 3CIQA 4F37F 5HYJA 2DYPA 4DW2H 3QISA 3MV9B 5ICXB 4NUGH 1LNUA 1YNLH 4KKCC 4J3SA 4HXAL 1S7WB 2AJUH 5TE7L 3U30C 2IMNA 1QLRB 2J2ZA 3G04B 4MXVF 4L3EE 4DKEL 1PZ5A 3MRRB 3V5KB 1D9KD 4ZXBA 1ZANH 4EIZC 2NMSA 3AXLA 4LVOB 2NY2D 2X4SA 1MNUH 1O0VA 1U92B 1SYSA 3NABL 4MCZB 3EJYC 1NPUA 3T0VA 4F7MA 2FHBA 5IOPB 3LKRB 1D7FA 5FUOL 3HAEB 4LSTH 3S3SA 3ZL4L 4DVRH 5J0BA 1JPTL 4HS8L 1ADQA 4JFHD 5F1OB 3CFIC 3OX8B 3WFDL 5CD3B 1Q9WB 1QSFE 4PJGE 4NC1C 4PRIA 1X9QA 4YDVB 3H9YA 1ED3A 5GS2D 1BQUA 3O6FC 4X6DA 2YD2A 2V2WB 4M8QB 1V7NH 1I9IH 2DDQL 4P3DB 4GKZA 2FJHB 4L8SB 2DQCH 3BZ4A 2BNQA 1ADQH 3NH7L 2DTML 3DPBA 4OZFB 3QQNA 4L8BA 1NMCC 4FQPA 5GSRB 3RZCA 3K4ZA 3I3BA 2OR9L 4UT6H 3BD3A 4W70A 5TE4L 1UZ8B 2IPUG 4JFFE 3QHTC 4ODSH 2YPLB 4Z77A 4OLWH 2EZ0C 5D6CA 5D7KD 1A7RL 1FIEA 1CDJA 5I2IA 2BSED 5TDNA 1KEML 3DROB 1JNHA 4KJWD 4YHOH 4LGPB 4Y88A 2EDKA 4NKMB 1WT5C 4YHMH 3D9AL 3PHQB 4KUZH 4U6YB 4Y5YC 4U1GB 4H8WH 3MOAH 3L3GA 4G7VL 2VIRA 1XH3B 3INUL 2XRAH 2VLRE 2XN9E 4LCWD 5F7EH 3OHXB 4XXDB 1MCOL 4XPHH 5FOBA 2XKUA 4IDJL 1N8ZB 3MRFB 1IM9D 4LCCA 3IS0X 4DFIA 5C0IA 3VFTA 5ETUB 2XWJB 3M1BB 4HPYH 3OF6D 3GMOA 4PJGA 1XZ0B 3GHEL 4AJ0A 1U93A 5DRXB 5BZDB 3WIFA 4XPTH 3UAJD 4HF5H 1IGCL 5KS9F 2DM7A 5CEZD 5KSBB 4L4VD 3NVQA 3FB8A 1AKJD 4WEMB 1F3DJ 4FABH 2OTUA 1AQKH 1P9MA 2NY0D 4JREC 2CIKB 1WFOA 5DFTA 5DVNA 3GMLB 2R56L 4EUPG 3VFRB 3MRLA 5MI0C 3RPKA 4OZGB 4OFYA 5FYLH 3R06A 4PJFA 5EPMA 1VKXB 4FQXB 1QLFA 5TFSH 1CQYA 1Q0YL 4NZRL 2W0KA 1SBSH 1BEYH 3RTQA 4QNPF 2B39A 5FYKE 1OP5K 3B6SA 1CCZA 2G9HB 2GSGA 1DQLL 3DXAD 1S3KL 4OD3L 4PB0L 4JGUA 4GG6F 1I8KA 3JXAA 3V4VH 1IKFH 3MO1B 4GQ9L 1NGPH 4D0DA 2QADB 3NFSH 3OG4B 5ANMA 4X99A 1QYGH 2G2RA 4Y2DD 4YPGB 2VLRA 1MREH 3VWJB 2AEQL 1ZTXH 3D3VA 3SDDA 5IBUG 4WV1B 5IG7A 3GMRA 5IFJB 4ELMF 4OFPA 4EKXA 3QHZL 4PLOB 4LLQB 4WHCA 5LCVL 5IEKB 3QEGL 2NPLX 4FS0A 4P2QD 2O5ZH 1CLYL 4MNQD 5HYSA 3RVVC 1RK0A 4X7CC 1IGJA 1JWMA 2Y6SD 3VFMB 3WFEL 4C83B 3BZEA 3W0WE 1P6AB 3L3HB 2RFXA 2ZG1A 3OGOE 4XHJD 1V8HA 1XR9B 1CXHA 4E41E 4F58L 3FB7B 1EJOL 2H2PC 3BN3B 1N59B 2YRLA 5D6DC 1AXTL 3QUMB 3WO3B 2FJGA 3FT3A 5D70H 2M2DA 2DWEA 1TQCC 4ETQB 5DD3L 4PTUB 2B1AL 4NGHL 4AIZB 4MA1C 3D48R 3QDGB 5FYJE 1IT9H 2EYRA 4JZJB 1QRNA 2CUMA 4RA0C 3FO9B 4YHZH 4CUCA 4L8CB 4Q9RL 1QFWL 2XT1B 3FT2B 5IMOA 2EDOA 1BAFH 1QPXA 1WIOA 2HTKD 4U7MA 2ZCLH 1SJEB 4ZPVA 5C0DB 1HH6A 2WANA 2VXTL 4KPHH 5C6TH 4MJ5A 5HYQA 1ZA6B 3ORJA 4NN6C 1DN2A 3QXDB 1MCPL 1G7LA 3VD3A 4MD4B 5D93B 1NCDL 5IK3A 4W81A 2APVA 2HVKB 3TCLA 4YO0B 1C5CH 3BPCB 4MLIA 5CGTA 4MQSB 3WDJA 3QQ9D 5HHNA 3GK8H 4KDTA 4YHLL 4RFEB 4WY7L 4MCYA 1FC1A 3AU1B 1HNGA 1IAIH 5B8CB 2ORBH 5ILTL 4UIKL 5FHBH 2O5XL 3FB6A 1QBAA 5JW3L 5GGVH 3DI3B 2IJ0C 4GUPA 2M1KA 1LO4L 1JWSB 4RCAA 3CPLB 5F97E 1RFDH 2OR8A 1U8JA 1A47A 4GAJH 1S5HB 1TXKA 4X6FA 4ZUTB 5MHSE 4D8PA 2BSSA 1IC4L 2RR3A 3D1MC 3L3KB 2Y36H 5L6YH 1ZGLA 4S1RH 2AJZA 3MRCB 1A1OA 4LARL 5I66A 5DJ8A 1NQBA 2HJLA 4JKWA 2EIEA 5IKCB 4Z0BL 2GJJA 2HAZA 3RAJL 3F12A 1CFBA 3MUJA 2ERJC 2RJMA 1FZKA 3VRLE 4LSUL 3RWIA 1YEIH 4N0YL 5HHVL 4XP5L 2HMID 3R8BB 3H9SD 4JRYB 3HG1E 4Z0XA 4JN1H 1Z9OA 4YIQA 2QQKL 5I8OL 1JYWA 5FYJH 5IW1A 3P11H 32C2A 4MSWB 2UV3A 3I02A 4OZGF 1YEGH 2OTPA 1J1OL 4PLJC 4XAKE 4HIJA 4B53A 3I50H 1JPGB 2CPCA 2ITDA 1FGVH 3JTSB 1TZHA 1R3JA 4CAGA 5A2KH 1S7UA 5C0GB 4F57L 1MH5A 3O0RH 5IVOA 3ARGD 1S9YA 4Y89A 3IFOB 1OTSC 3G5YB 4XHQA 5T3XD 4R7DA 4DK3A 3P3YA 3CNKA 1T3FB 2D4DA 2CKBL 1A7QL 4M1DH 4PJDE 4RAVA 3R8QA 4RX4D 5TF1L 1NGXB 4WGVB 2XWTB 1JMZA 4R4BB 1XMWA 1A2YA 1BLNB 1HKLH 1Z9LA 4PJCB 5JW5B 3P4OA 2ZNXA 4HS6A 5GGTA 1AGCA 4PRDA 3IFPB 3P73A 2ADJB 5FO7B 4BKLA 3BUTA 1FP5A 5T33H 2I9TA 3F7QA 3WLWC 1W8NA 4JPKL 3NCJH 4NQDB 4JO2H 3O6ML 1X4ZA 2VZUA 4PRAB 3V6OE 3QEHB 1MHEB 3QHFL 3KPNB 3TO4B 1M7DA 5EA0H 2AKRB 5J7CC 3L6FA 1CT8B 5GGTH 5K9JL 2AEPL 1AR1C 1NBVL 4HIEB 1J88A 5CJQL 2XZQH 3MRGB 3HG1A 4M1GH 2NY1B 3DVGB 3REWA 5FM8A 4NC2B 3K1DA 4LLMB 2LVEA 5HGHA 5TDPB 1CXFA 1X3DA 5GS0H 3B9KA 4R9HA 5IB4B 2X4QA 4PP1D 3SOBH 4AQOA 1P5VA 4EN3B 5DJDB 1ZT7B 4F15B 5BVJB 4KUCD 1MAKA 4O51B 2CO7B 4QY8B 1LWRA 4HUMB 4QCIA 3RIAF 4XBGB 5FGSA 2C3WA 3U36B 3OKNA 5FUOH 4ODHL 1N7ML 4MXVE 1ZGLM 1JPTH 4O2CB 4RFNB 1EO8H 1I1AC 1KIQA 4OJFL 2PF6A 1YY8B 4U3HA 2Y07H 1EV2E 4G9FD 2B5IB 1HHHA 3T0EE 5H35A 5DA4A 4GAFB 2UVEA 8FABB 1E0OB 1NCWL 5F7FA 5I1AA 3I6GA 3WSQL 3WJLC 1RUMH 3MLSH 4OFVA 5J6HA 2DDQH 2XTJD 5DEGB 4P3CL 3U2SB 3TBWA 5INDB 3NH7H 3OSKA 3VXUB 3QR2A 3REVB 3T04D 3RKDC 1FHGA 4YR6B 1UCBH 1CR9L 3F65A 3UBXB 5TE4H 3X14A 1T1XA 4AEFA 5FKPA 2BP3A 1A7RH 3SBWC 2ZP0T 1E28B 5EOTA 4LKCB 2V2TB 2QQNL 2Q86A 4G6AD 2Q76B 5CILL 2F58L 4XH2A 4QHMB 2AP2A 4X8XA 1E4KA 3D9AH 4KTYA 3MBEA 3S4SB 1HH9B 2P7TB 5FO9A 4K3JL 4I3GA 4R0LB 4HV8A 4AT6B 5KTEL 5E9DB 4BH7A 1VEOA 3EO1B 4YXLL 3TN0C 3T3PF 2VDLH 3PNWB 5D1QD 3BZFA 3RL1A 1B4JH 1JL8A 4OCSL 4P5TD 4TTGA 4WI8A 4P2OA 5IHLB 2A2QT 4J8RA 3MODH 1RZIB 2LV4A 3FZUC 3HE7D 3MOBL 3CLEH 2FGZA 1KGCD 1Y18A 2EDXA 4NNXA 3OXRA 3T0EA 3SPVB 3EDDA 2D9QB 2DQGH 4R97C 3SGDH 1L0QA 5BOPA 4JG0L 1KNOB 2BVPA 3SKMA 1DQJB 1EZVY 4D0CB 2AGJH 1IFHL 4BFGA 1RJZA 4B41A 3BESR 4Y4HD 4G8EA 4NZJA 1ZHLA 2DM3A 2IAMA 3QDAA 3DSFH 3SCMB 3HE6A 5C07B 4FQCL 5DSCB 3KYMA 2X9XA 1RZFL 4CVZA 3B9DA 2IALA 3FT4B 4KZDL 1FFOB 3QUYD 1MFEH 5KS9E 1JMXA 1Q0YH 1X5YA 1F6AB 2WBJB 1C8PA 2EXYD 1R3HA 1UB5A 2APWA 2NY4D 1GZPA 1Q9OB 1SJXA 1F02I 1K2DB 2I5YL 2J7LA 2FB4L 4HH9A 5KVFL 1TJGL 5C09E 1LE5B 4QEGA 1N0XL 4OD3H 3SKNA 4UILL 2A6JB 2VABB 4YHIA 3WUWB 1B6DA 5JPNA 3OGCB 5K9OA 4M6AA 3ZT6A 5JW4Q 4QNPE 5J89A 5I18L 5T3ZL 4RSVA 4DKFL 4OV5A 1SMAA 1JF5A 2ID5A 4PGDB 2BC4A 4UTAL 2X1QA 4GG6E 4WCYH 2GTZB 5DQ9B 3CFEB 1OD9A 5DFWH 4BQCA 3L3DB 4KHTL 4RMSA 1PQZB 4U1HA 2XI9A 3CDYA 1KG0A 3EYVA 1J8HA 3HI1B 3GRWA 5MENA 4JRWA 1CLYH 4WWKB 7FABL 3PDOA 2YZ8A 3ZHDA 3DX6A 3NFNB 2FCBA 4ELME 1Y6KR 4M7KH 1MLCB 2RBLA 3UYRL 2DQDL 3VCLB 4L4JA 4F58H 5C0EB 3GRWH 35C8L 1OPGL 3ME0A 5IHUL 1J86A 3GJFK 4YDJB 4XTRD 4N1CA 1J1PL 2B1AH 1MRCL 5EZLB 5I75B 3HZYB 1KLGB 3O6KH 5D7LD 3TBVA 1KCLA 2P24B 5F8RC 2X4PB 1U8PB 1F90L 3BXNA 1KYOJ 1IEBA 3D0LA 3C2SA 4XCEA 4WHYH 2VLKD 3DJ9A 4N1HB 4YXKL 3U30B 1JHTA 1ACYL 2JK5A 5IT2L 2IPKA 2MPAL 5CZKA 3W11C 2AK4E 2I25N 3UBXI 5BS0B 1U8LA 2VXTH 1QHPA 2GQHA 2BNRD 5FKAB 4JN2A 1CE6A 3BIKB 2A6DB 2JELH 2YD4A 1FNHA 4NKIL 4GG6A 1GXEA 1BJMA 4CN4A 1NCDH 1XCQA 1AP2B 1NGYA 4U1MA 2JCCE 2PTTB 4HWNA 3P9MA 5HSFA 3QZWG 1OQOA 5HHQB 4YHLH 3C08H 4V2BA 5LJYH 1P4LA 3OXSB 5L2KD 2WSKA 1RIHH 1RU9H 2FZ3B 3PL6D 3MREB 2AS5M 5FECB 5JMRA 1YJDH 5CWSB 3AUVA 1M7IB 4P4KA 2ATKA 1G6VK 4PJ5D 4NQCB 5EO0B 5ICYB 3FONB 4Z95L 1NMAH 5ID0A 3MV9A 1U8KB 4C4KO 4GBXD 2XWBB 2VC2L 4KAQL 4DUXA 1CLZL 1XGRB 2AXGA 3RVTC 2V9QA 1QLRA 5E6YA 2K7PA 3G04A 3S36X 5I6XC 5FF6A 3MRRA 3V5KA 1IGIL 3QUXC 1IZJA 3OG6B 4S1SL 1UM6H 4YC2C 3UTTE 1U92A 4MDJB 4C56D 3VXQB 5E8DL 1GGCH 4MCZA 1F8TL 4Y2OA 3BIBX 5JA9A 5IOPA 2NTSP 2EYTB 3QIUC 4UV7L 1OAXL 1T1ZA 4LSUH 3HAEA 3UTSE 1RUKL 1MY5A 3PP3K 4HIIB 1YEFL 1ERNA 1CK0L 3C6LC 3KXFD 3OX8A 2QQKH 3ARED 1CD8A 1Q9WA 5CD3A 1TJHL 3BE1L 3QDHA 4YDVA 2DQIH 5ITBH 1UKTA 1GOHA 2KKQA 2ADFH 5C1MB 1V3LA 3S5LG 2V2WA 4M8QA 4LSSL 3HAEH 4P3DA 4XNZC 5IESH 3AC0A 5D8JH 3MX0A 2DLFL 2PYFB 5FGRA 3S37L 4OZFA 3NIGE 2K3TA 3ARYA 1QFWM 4D3CL 4OZGE 4MQXD 3PABB 1UZ8A 4OSUH 2YPLA 4TNVF 4W68A 3T2OA 5D2LF 1RZJL 3L5JA 1NC4B 2CKBH 1A7QH 5EIIB 2JB5L 3DROA 4NNPH 4JREB 4OZFH 4JO4L 4HWEL 1UYWL 4A2LA 4HK0B 3AMKA 4P4RB 2QKIB 5BOZG 3ULUD 1JPFB 1P7KB 4U6VH 5E2WL 5AG8A 4U6HB 1Z2KA 5D7IF 1NL0L 2KQNA 3PHQA 2ZSVB 5MI0B 3HR5B 1NCTA 1KT2B 4U6YA 1Q9LB 2W60B 4Z7QF 3L1OL 4OI9A 3RDTD 3WUZA 2JJVA 4PV8A 2P8PA 1T0NA 1XH3A 3QHFH 3EYQD 3BGMB 1MAML 2FATL 4FXGB 4A2MA 1LK3H 3OHXA 4XXDA 3NIFF 1N8ZA 3D2UD 4GG8B 5ACLA 2AEPH 2DBLH 3QEUB 1NBVH 2WQRA 4KRLB 2X70B 5ETUA 1ORQA 5CJQH 2XWJA 3PQYD 2XFXB 4ZG1A 1XZ0A 5DRXA 5BZDA 3MCLL 1FORH 3QZWA 3PDGA 3F7RA 2CR3A 4BA8A 2Y06L 5KSBA 4YNYB 4YK4C 3O81A 1LO5B 3UC0L 5D2NB 4QF1B 2A1WH 1QP1A 3MRQB 5DRNB 5DO2D 4OD1L 1F6LL 2CIKA 1WCBB 1MCEA 4MA8L 3VFRA 4NOBA 1U3YA 5AD0B 3SDAC 2J5LC 2ZUXA 4OLVH 4OZGA 4ODHH 1VKXA 1N7MH 4FQXA 3ARRA 4ODUB 3C5ZC 3P77A 4OIAA 4LOUD 5DD6B 4JDVB 3FO1B 4ISVB 5EU6D 2G9HA 4OUUB 3AM8C 4K7PX 1NCWH 3KPQA 4IOFC 4PJ7E 3PHSA 5JXAH 5T1LD 4PRPA 1QNZH 3MYZA 3FFCD 4POZD 3MO1A 4P3CH 1CGYA 1MFAH 2VZSA 4O02L 5H37G 1D9KB 3LRHA 1AGDA 5D1ZC 1RZJC 2X44D 4X80L 4YPGA 4Y5VB 4NKDB 3VWJA 3AY4A 3H3KA 3MQIA 1CR9H 2FEDC 3QO0B 3BYTA 2XZAL 1KTDB 4JFED 3BKYL 1HHGB 2B2XH 2AV7B 1RZKC 2QL1A 4FTVD 5IFJA 3FQRB 3HLAB 3E6HB 3LZFL 5C0AD 4LPYA 3QULB 4YDLB 5T3ZE 2F58H 5EU4A 3EGSB 4LLQA 1OWWA 5IEKA 3Q1SH 4ODTL 3NA9H 4K3JH 5DJZB 3S3JA 5CP3A 2GY7B 4NT6B 2V7NB 2W9LA 3SQOH 1MF2H 1PBYA 3DGCR 5HPOA 4L1DA 4DKDC 4G80B 2JE8A 1LMKA 1YY9C 4M8VA 2FDBP 1XR9A 3MV11 5I8CB 3MUHL 3L9RA 4TSBL 5D96C 5DUBB 1N59A 5J4MA 3QUMA 5CP3H 1IAOB 1SEBA 4HJ0D 1CG9B 3L5WB 2EDRA 5E1HB 4ETQA 1Z0NA 4KK8D 4PTUA 1NEZA 3EYFB 2FBJL 3T3PE 4AIZA 1BBJB 3CCHB 3QDGA 3ALXA 2QBWA 4JZJA 1M4KA 4XB8A 1NEUA 4PJHF 1S9WB 3MUZ1 3DVIA 3FO9A 5GJTL 2IADB 4L8CA 2PTUA 3FT2A 4WHTB 3QUMH 3ZE2F 4H0HB 1TVDA 3I85A 3BO8B 1QHOA 5KW9L 4X9IA 1SJEA 1F4XH 5C0DA 4LCWB 4E42A 5JOPD 1ZA6A 3HB3D 4K3EL 2EKSA 1AE6L 5F7WC 2AERT 1W2KT 4M00A 3QXDA 4Z7OE 4MD4A 3TO2B 2G60H 1IM9B 2X1OA 4C59B 2HVKA 3NTCH 4YO0A 4YZFF 3BPCA 1QD0A 1OTTC 1HSBB 4ZS6C 5KVFH 1ZMYA 1TJGH 4ZOBA 4RFEA 1H3PL 1N0XH 3AU1A 3X3GL 1MFCH 4XVTH 4L4VB 4RMRA 1AO7D 1AKJB 1WBYB 4I1NB 2SEBB 2CDFB 2NY0B 5FB8B 3FAXA 3MV8D 2ZJSH 5I8KH 4WW2C 3K2UL 1R3KB 2XV6B 1JWSA 2N1KA 3CPLA 3ARUA 5F44A 1E4XI 1S5HA 1UQSB 4ZUTA 4MB5A 1KUMA 4U0QB 2H6PA 5HDOA 4MA3B 4OLYH 2Y4SA 1YQVL 3S34H 3QUZD 4NC0B 3MRCA 4NQDE 3K7UA 1UJTA 4HPOL 5CGYC 4ZD3L 4JJHA 5IKCA 2H2SD 3LS4H 5JTWA 3DXAB 2AI0L 3SDCC 1X5FA 4JVUA 3T1FB 2IWGA 4XAWL 4G6KH 7FABH 5ISZD 5E2VL 5JXED 4Q9QH 3EO0B 2DQDH 5IFAL 4Y2DB 4JRYA 1KIRA 2X89D 3QIWD 1KN2L 1N64L 35C8H 2R29L 1OPGH 4D9LH 1FLRL 2VN7A 4PY8I 2C3HA 1JPGA 2YD5A 1U41A 2YZ1A 4KK6C 3JTSA 3N1FC 4Y19E 3PWJB 3GSOB 2BHZA 2NNAB 5C0GA 4Q97A 3RWEB 4K9EL 3KLDA 1RUAL 3G6JB 3PP4L 3BRFA 2BY1A 4PLKD 4KKBC 5IJKA 4P2QB 3IFOA 4NO5B 2I60H 4Y4KD 3MROB 4MNQB 1OLLA 4QRPB 1CGTA 3V7MA 1ACYH 1VHPA 1FH5L 3PXJA 1JBJA 2NZ9D 3MNVB 5I1GL 1V3JA 3IXTB 2EDLA 1T3FA 1D5XB 2VQ1B 1MCDA 3C8DA 4OLXH 1IEAB 1F45A 3HS0A 3TZVC 1NGXA 2WIMA 2XWTA 4R4BA 1ZXQA 5K9QG 4XCCL 4AEHL 5JDSB 3ARFC 1BLNA 4PJCA 5JW5A 4OLZL 3B2UC 3O9WC 5B22A 3MRBB 2R69H 5HGAB 3IB4A 3IFPA 2ADJA 5FO7A 3DMMD 3FQTA 4KJYB 4B50A 1FFQA 4WI5A 5D9SB 3HFMH 4KTDL 4NQDA 5B38B 1TIUA 3QFJD 4APQD 1I1AB 4PRAA 1MCWM 3Q2CA 1MHEA 3QEHA 3B4NA 3RNQB 2ARJB 3QRFM 3TO4A 1A7OH 2AKRA 3GSUB 1CT8A 2XXCB 4L5FL 5I16A 1ZA3B 4X9HA 1SVCP 2R4SH 4DZ8B 5EOCL 4HIEA 4Z95H 3UO1L 1G6RB 1H3GA 3MLPA 3MRGA 2VC2H 3DVGA 1NDGB 3KS0H 3LQMA 4LLMA 1A5FL 4QRSB 5CZXD 4C4KT 1I8MB 2IQ9H 3QIBC 1F58L 5TDPA 3N85H 3VH8B 3BMVA 4OGAC 6FABL 4BQ6A 5IB4A 4N8CL 1K4CA 4WU7A 3U48A 1EEYB 5GRVK 2FYYB 1IGIH 4HUUB 2FX9L 2WWKO 5E9DE 4EN3A 1GYAA 1YEEH 4S1SH 1VDGA 2CRMA 3BD5A 3O6LL 1ZT7A 1E4XL 4R3SB 2DF3A 4Z7UB 2Y5TB 5BVJA 4O51A 4M7LL 1UWGL 5F6HI 4K8RL 5JPMB 4QY8A 4CVUA 4EJ1C 4XBGA 3U36A 2H3NB 4UV7H 5HYJD 1OAXH 2DYPD 3MTRA 3LS5L 4GH7B 1RUKH 4YBLB 5ABDE 2VL5B 1TJIH 1TDQA 1YEFH 3B9VA 1YY8A 2YOCA 5MEOA 3BE1H 3GBNL 2NYYC 3UDWC 3U4EA 3TJEL 3V8OA 5SWSE 2CRIA 2YPVH 8FABA 2NXYC 4X6BB 1CE1L 3ZZ1A 1RURL 4G6FD 4LSSH 4YDKH 3H8NA 5DEGA 2D0FA 1B9ZA 5J12B 3K4AA 3U2SA 5INDA 1FCCA 3VXUA 1FNEB 3KG5A 4LHUB 4PRBB 3REVA 4HUWB 3U7WL 4MS8D 4YR6A 5CJ8A 4CVWA 3HNTL 4ZTPL 3UBXA 2EDNA 4GMTL 2W07A 1EGJL 4M4PA 1E28A 1UWEH 2JB5H 4LKCA 2V2TA 5A3IC 3HPJB 3CVHL 1CD1B 4CDGC 2GJZB 3H6JA 3H9SB 3KPTA 1DBJH 2BK8A 4MAYC 4HWEH 3WIHA 4DGIL 3TH3T 4QHMA 1JPSH 5E2WH 2IEPA 3S4SA 2P7TA 4CN6A 1U58B 4R0LA 1T0PB 4AT6A 4WFFE 3HMWL 4OF3A 5E9DA 5FCSH 5D2LE 3EO1A 1VPOL 3RZCD 3PNWA 1UENA 3HA0A 1CLOH 1MAMH 1YN6B 4MA7L 1TCMA 1FNFA 4R4ND 1VFBB 3WIHH 5I1HH 2KQMA 1CD0A 2OXHA 5A43C 3LN4B 3U82B 3OZ9L 2EDTA 5D7IE 3SGKC 2LTQC 5GISL 4H25B 5KOMC 5LKNA 2A9NH 3JV5A 3KPSD 3NZHH 1SBBA 2HT2C 2WUCL 1WITA 1CIUA 1KB9K 3MCLH 3QWRA 3SPVA 5SV3A 4P2YA 1KNOA 3FN0L 1DQJA 3U9PL 4D0CA 1W72B 4K8RC 3NIFE 4OD1H 1QKZL 3H3PH 3SCMA 4ZSOB 2W91A 2HT4C 3A6CL 5C07A 5DSCA 3M17B 4WTZG 3IU3B 5BZWB 4DN4H 3G6JF 3SE3A 4DEPB 4XCNB 1FPTH 1K3IA 1MLBB 3PGCB 4R2GC 1F6AA 1GOGA 2WBJA 2J8UB 4GKOA 4M43L 1Q9OA 3M45A 4XMPL 1CFSA 1K2DA 4XI5C 1RHHB 3QUKB 4F9LC 5FA4B 4YAQA 3RKPA 4HIXL 4ODVL 3BH8B 1KEGH 2DWDB 4Q9BA 2A6JA 2VABA 3WUWA 5HHME 3O8XD 4X9GA 3WFHA 2NY5H 2G75B 3ZKSD 2Z8WC 1UM5H 4EOWL 1I1YB 3ILQC 1QSED 2XZAH 4MQTB 5GSVB 4PGDA 4M62L 1JUFB 3BQUC 4XP9L 3BKYH 3RTQD 3JSSA 3SO3C 2GTZA 5DQ9A 3AS2A 3SE8H 1WEJL 5FO8B 4HWUA 5SWZE 4FA8A 3ARBC 1PQZA 3UTQB 3RWGB 4G9FB 3HI1A 3HC4L 3QNYB 1T7ZA 4ODTH 4I18B 5FV2A 3WNNA 1U3HC 2VLLA 1PSKH 1ZHBB 4RZCA 2XTJB 3OPZL 3WHE0 3RY4A 1A3LH 3BPNC 3NFNA 4QRUB 2WLYA 2WW8A 4FNLL 4NBYB 1MLCA 1S7SB 4Z7UF 3VCLA 1IKNA 1T83A 3D3VD 4JRXE 5C0EA 2XNAB 4FXLA 1IZKA 2A0LD 3WS6A 5C0JB 4JPWL 1WZ1H 2VR9A 4YBHA 2M8XA 2MHAB 4IRJC 4YDJA 2CGRL 4BQ9A 5IB2B 2RAMA 1HYSD 5EZLA 1JNNL 3HZYA 1JZ4A 1JFQL 4LLUB 3UMTA 2X4PA 4QYOB 2A9MH 5IQ9B 4FZEH 2KZWA 4OCWL 3SE9L 4YXHH 1IQWL 3IFLL 1S78D 4ZTOL 3OMZA 5EU3B 3RY6C 3FO0H 5A40E 3CSYB 2C3VB 4X98B 5DD1L 5BS0A 5AYUH 5D1QB 3D6GA 3KLAB 5FKAA 4YC2B 3PWPB 2A6DA 2ITCB 3GM0A 2Q8AL 1QOKA 4KGLA 5BJTB 4PJHE 5HPMB 4LSQL 4NWUH 3QRGL 3WO4B 1AP2A 2AABH 4Z7NF 4HWBA 5E00B 3KLSA 4L29B 2PTTA 3ZE2E 4U0RB 3QJHB 5HHQA 5E2TL 1J0KA 3AROA 3QYCA 3OXSA 4KMQA 1MELA 4HC1L 2OI9C 2R4RH 3MREA 2NX5B 4DAGL 3RPIB 4PJAF 4AG4L 4Y4HB 5FECA 1M7IA 1HE7A 4HWBH 5CSZB 1WAAA 4NQCA 4OBRA 5ICYA 4XPAH 1EO5A 3GMPB 4YZFE 4ONFL 3MCG1 2LE9A 4TYUA 2YA1A 1U8KA 3TVMC 4BSVB 2XWBA 4JR9H 1JHKL 3V5HB 2VZOA 1XGRA 1RUQH 4FQ2L 1JGVL 4G8GB 3K80A 3DYPA 4KQ4L 2VOTA 4HPOH 4ZD3H 4EVNB 4MDJA 1FE8L 2AI0H 3BWAB 3VXQA 3OKDB 1QVOA 3WN5B 1GOFA 2EYTA 3N9GL 4I0PD 4X5LA 5E2VH 4RWYH 2XZCH 2CD0A 4WU5B 4Y5YA 1G9MC 4HIIA 4GS7B 5I30L 3NAAL 2R29H 2HJFB 2MMXA 5ESVB 4RGNC 1FLRH 4KV5F 4XC3H 4IRSD 2QTEA 4Z7WE 4KQ3L 3GSVA 5BCAA 1E6OH 1A64A 5D2NE 3N1GC 5BXFB 1B0GB 5EU5B 3KJ4C 5MERB 1ZT4B 2UY6A 4K9EH 4RNRB 1JYVA 4ZPTB 3MRDB 5KG9B 1C7TA 4L4TD 2CK0H 3GSWB 5I1GH 3E6FB 4FMFA 1NC4A 4HKZB 5EIIA 3O3DB 3ARTA 5E6IC 4KUCF 4AEHH 1QRKA