3G04B

Crystal structure of the tsh receptor in complex with a thyroid-stimulating autoantibody
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
215
Chain Sequence
QVQLVQSGAEVKKPGESLKISCRGSGYRFTSYWINWVRQLPGKGLEWMGRIDPTDSYTNYSPSFKGHVTVSADKSINTAYLQWSSLKASDTGMYYCARLEPGYSSTWSVNWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the TSH receptor in complex with a thyroid-stimulating autoantibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HUMAN THYROID STIMULATING AUTOANTIBODY M22 LIGHT CHAIN
total genus 40
structure length 215
sequence length 221
ec nomenclature
pdb deposition date 2009-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g04B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g04B01
2FEDC 4K71C 1DFBH 3QG6A 2DMBA 1FAIH 3RVTC 3CXDH 3PNWA 5JIHA 4UT9H 3STBA 2GTZB 1GYAA 1XIWC 2Q7NA 5I74B 4ODSH 5JQHC 4DN4H 1JRHI 2GIYA 5J11B 3MOBH 5IMMA 1CBVH 2RCSL 4MDIB 5HHXL 3IDIA 5C6WH 5KN5A 3BSZH 1D5BA 4I4WB 2MSPA 4MJIB 3EO0A 3WO4B 1U8QB 3TA3A 4Y19B 4E41E 5TQ0L 2F53A 4YGVA 1VERA 3QJHB 1FPTH 3UC0H 3HRZB 1KN2L 1TLKA 1RIHH 3VH8B 4LLWB 1ZS8B 1G7IB 3V0VA 4POUB 1OAUL 3C87A 4JFQA 5DZNA 1UGNA 1KB5B 2IFFH 4G6ML 2BVPB 4UT7H 2ADIB 4Y4KA 2R8SL 3VI3E 3GSRB 4LOUC 4WW2B 1VFBB 4JZNB 4NCC1 3GI9L 4NO0D 4D0DB 2VLKA 4NZTL 4UILH 3ZMRA 2CQVA 2ZCLL 3IDJB 2ZZUT 4O51A 1YNKL 4F9LC 1T0NA 3CUPB 3LKNB 3BPCA 1J0IA 4FXKA 5JHDB 1AP2B 4W6XB 3HRPA 5DHXB 2A6DB 5B3JE 1VDGA 1FNLA 5IW6A 1AC6A 4CGTA 3C5SB 5D7IA 3IDMB 2K3TA 1CT8A 4W68A 5DS8B 1GZPB 2CDGB 1IFHH 4HX1A 4P2QB 4RIRA 1OLLA 2A1WH 2NY4C 3BIKB 5MENA 1NGQL 4FHBD 32C2B 3EYSH 4LCWE 4HJJH 4D9LL 3L7FA 4X6CA 3L9RB 4TNWK 2C1PB 4GRLD 3T77B 3Q0HA 1FC1A 1ACYH 3AS2A 5GGSY 2FBJH 1NMBH 4IIQC 4ZUSA 2FR4A 3AC0A 3IRPX 5CMAB 5KSUA 4W6WB 5KSUB 2OR9H 1RJCA 3E2HC 1BWWA 1FGNH 5TQ2L 4FQQB 4H0IA 4EN3C 3LD8B 4K2UL 2H32A 2IH1B 1Y6NR 5DMIH 3TN0A 4YXLL 2OZ4H 1PX4A 4ZPTA 4L5FH 5IMKA 1H3XA 3PWNB 4P46A 1BOYA 1NGPL 3DURB 2RHEA 4G8GD 5HHOB 1LE9A 5EUOF 2NX5D 3M17A 2NY1C 5EO9B 5SWSB 3GHBH 3IT8D 5D7KE 4JVUA 5EIIA 3DYMA 2V17L 3QA3A 4RGNE 3MRFB 2VQ1B 4D9RD 3VXPB 1BVKB 3J7HA 4GJTB 5ERWB 3VXPA 5J06A 4NZRH 1CN4A 2WBKA 5DUPL 4P5TC 3WO4C 4PJXF 3S5LB 3FN3A 4YHPB 5A3ID 3EHBD 4LSVH 4LSPH 2B1AL 1FDLH 4MCZA 3WHXA 5D1XC 1BZ7A 3FONB 3FJTA 3MRQB 2X4PA 3CDFA 4I5BA 3MLXL 3HC3H 3O3EB 4XHQA 3FO9A 1P7HL 4LVEA 3JZ7A 5DD0L 3ARGA 3OXSA 1NJ9A 2EE3A 4M5YH 2HH0H 3QFJA 1IGIH 3R1GL 1ZEAH 2HT2D 4KHXL 4Z9KB 3MUJA 5KVDL 3EFFA 5BRZB 4E9LA 4Z7QE 5DMGD 3MYJB 5IG7A 1HEZA 1OSZB 2XG5A 5TF1H 5FF6A 1BF8A 1R0AL 2J3SA 1LK2B 1INEH 1GOHA 1ZT1B 3FT4B 3IXTA 3MXVH 4L4JA 1FNAA 1QACA 4PRPB 1MRFH 4PRPA 4XI5C 2PXYB 2Q8BH 3BN3B 5J13B 3Q3GB 3BRDA 1NBZB 1WLHA 2NR6C 1NBZA 4RMTA 3DUSA 3O9WA 1CYGA 3QHFH 4NHUB 2DIJA 4PJ7F 5C86A 3JXAA 3TO2A 3C2AH 3EHBC 3IFPB 1P7QB 5ESQA 2NY0B 5HD8C 1Q9WB 2GK2A 2NLJB 1IGYB 2DKMA 3CFCH 1NCDH 2VL5A 2ESVE 4JRXA 1A6TA 4DZ8A 4M7ZC 1ES0B 5T1LD 5DDHA 5FOJA 5E4EB 3OGCA 4AEEA 5JMRA 1NSNL 3FOLA 4EUPG 4NM8L 3S7GA 5SWSE 2X7LB 3NFSL 3CH8A 5MI0B 5DJAB 4O02L 5GGTA 1V7ML 3N9GH 2OI9B 1EAPA 1F6AA 3F12A 4NP4H 1GHFH 4YX2L 1I7TA 5SWQA 1GAFL 5DK0B 1KULA 3MLRH 3NCYS 3SE8L 4M1CD 5F3HA 2Z4QA 5FYKH 4F7CA 1QNZH 5DQDL 5H8DA 1U95B 4Y0GA 1SYSA 4U49A 3OKKA 4ENEC 4YO0B 4ZFOA 2X6MA 2B8OT 1W8OA 2C3GA 2VABA 2OP4L 3CLFH 1L9MA 1Z6JT 4PLKC 2MNUA 2EDYA 3CH1A 2A6KA 3LHPH 5HHPB 4JCMA 3S96A 1U8NA 4Q58C 4KRNA 4J3UA 1T66C 4XP4H 2VLMD 4ZUVA 4HQQL 1N3NB 1J1PH 5C3TA 4ZFGL 2GQHA 1U8JA 1XGRA 1A6VL 2ATPB 3D48R 2EDWA 3WMSA 4HHAA 1CDBA 4Z7UA 4Y4FB 4HHAB 4P2OB 3WEXB 3REVB 2F58H 3LQAL 4GKNB 3PWJB 2NY3D 3MOBL 1P84J 4UNVA 4R0LA 1MCEA 5I71B 3HZYA 3O3AA 1R3IH 1JZ6A 3U7WL 2VN7A 5E1HB 1AO7E 2CKNA 2HVKB 3AXLA 5KSBA 3R0NA 2E8ZA 1WCQA 3EOAB 3QPXL 2JCCB 4X6EA 2D2OA 1PJ9A 1NDMB 5HYFA 4G7YL 4HDIB 2XQYK 5E6YA 3HAEB 3NA9H 4X6CE 3L6FB 3RRQA 1Z9LA 5L8JB 3GSOA 1TCMA 4JG0L 1RAMA 2VRAA 3PWPD 3VCLA 3BOVA 4DK3A 2E7CA 5B39B 3WDIA 3RI5F 4ODUB 3TBYB 2FZ3A 4M1GL 5E7FA 3VG0L 4X5WB 4OTXH 4BH7A 4PV8A 2B7DT 4IHOB 3EFDH 1AXSB 2GK0A 2LE9A 4CW1B 1I8LC 4TSAH 1NEZG 4E41A 4NQDE 5I30L 4DTGH 1LGVA 3LKSA 1CDCA 3LKSB 2A1WL 4DOHE 2DQEH 3BFOA 2P49B 5JDJA 3EYSL 1P1ZB 2YSSB 4L9LA 1Q72L 1R24A 4HV8B 5ECJE 3D3VE 1A5FH 4ONHB 4QHUA 5AD0A 5IB2A 5HI4C 5ESVA 2UWEE 5JLZA 2R1XA 3QHZL 2YPLA 4LEXH 1MRDL 4JO4H 4E0RA 3MNVB 3ES6B 1NANH 4MHHG 4XMPH 3MJ8B 5I8CA 3STZA 1RQ5A 1BJ1H 1JYWA 4JO2H 4YHKL 2Y36H 2ZKHL 5DRWB 5FYLE 2Y6SC 1L7TH 2WQRA 3MROB 2AV1A 4NBYB 2VLRE 3GBNL 4PJAA 2XTJD 1X5LA 2RGSA 1VA9A 3SKMB 2CIIB 3SGKA 5I1JH 1NCTA 1YQVL 3UTTD 3BE1L 4EKXA 1S7UB 3QEQB 1KV3A 1T4KA 4LLYB 2V17H 3O4LB 3RWDA 1OAXL 3C5JB 1XZ0A 1X5FA 4HWEH 1MH5B 4KQ4H 4OGXH 2PTUA 5LBSH 1BJ1J 1MH5A 3PXHA 1ED3A 1HILB 3DI2B 2DS4A 4Z7OF 4MA7H 4XP5H 4EZMA 3QB7C 5ITBL 1OSPL 4OZIE 1MJUL 2NXYB 3VFVB 1ITCA 1PEWA 2AABL 4IIQA 4ZAKB 3PNWB 4TULL 4LSSL 2HLAB 1YEIH 2O5XH 3AY4C 2NPLX 1DBAH 3NOIA 2UYLB 3JWOL 1ADQL 3G9AB 4OM1H 3MLPA 4YHIA 5GS0H 4KZEL 4Q2ZB 3U2SA 1ERNA 3QHTC 4YPGB 4JFXA 4NPYA 3PJSA 3QDGE 5JIPA 4MJIA 4JPIA 4Q7DA 1PG7H 4KJQD 3NCBB 5EWIH 3VFTA 4FQJH 12E8L 1JZ4A 3S34L 3T4AA 4WU5B 1QHOA 2VITB 4K8RL 4NSKB 2VITA 1RMFL 3EAKA 4G6FD 4PFEA 3KGRA 5C07E 3LN9A 4W6YB 3E8UH 4RX4A 1QA9A 2EH7L 3MLUL 4XB8A 3EYVA 5CBEB 4PJDA 3QUMA 4XPHL 2WZPD 5LGJA 1N0XL 3UZVB 3ZDXF 3IDJA 1LDPL 4L8SB 3EO1A 5IWLA 3QO1A 4NN7B 3TH3T 4L8DB 3HPLB 5DD3H 2Y4SA 4N68A 3HPLA 4JY5L 3M45A 3MV9B 3QNXB 3JWDC 4XVJH 2G9HA 4G9DB 1NLDH 4N8CH 4WY7L 1F4AA 5EOQH 2E6PA 1CQKA 2A9MH 4DAGH 1IGJB 1CXKA 1KLUB 5IHZB 1NC2D 4NZRL 5DUPH 4R4ND 4LKCB 5H94A 4C83B 3MUY1 3NAAH 3WKNA 2GJZB 1MJ8H 3VD5A 4O02H 5IEKB 3T0XA 1SJEA 1JF6A 3T2NL 4PRHE 4YH6A 4Z7VE 1VFMA 3A0OA 5I9QC 4LPWA 3HR6A 4ZMAT 5LAXB 4NQEB 3TT1L 5ID0B 3L3KB 1JE6A 4PUBH 5EU6D 3VGEA 4KV5E 2EKSB 1GGYA 1W0VB 1BM3L 4GKZB 3PGCB 2J5LC 3I3EA 3QUXB 1TTGA 2QADC 3OJ2C 5JPMB 3AS1A 2KDGA 3NCFB 2H2SD 5F93C 1A14H 4BQBA 3N1PC 1YDPA 5F44A 4B0MM 1J12A 3GB7A 1QRNA 3OR7A 4J12A 2BXZA 1JUFA 1NAMH 3ZDYE 1LO3L 2UV3A 3LHPL 4M7ZB 4X7CC 4HUNB 1LE9B 1S8DA 2HN7B 2PF6A 1H3PH 3NZ8A 4FQCH 4PRHB 1QFUL 3C9NA 4N0CD 4MWFA 1NBQA 1WBZA 3MRFA 4L3ED 2W07A 2NYYD 3BKML 3ZL4H 3SDYL 2APTA 3CFCL 2F5BH 1NCDL 3DRQB 1BOGA 3LSOB 3TCLA 1CR9H 2V9QA 4FQLH 2DQTL 2YMXH 5A16A 2MCPH 1HI6B 4OZIF 4R90L 3FO1A 3UDWA 5C0BB 3I6LE 2FIKA 4YBHA 3DIFB 5CEXB 3GO1H 5DHVA 1IKFH 3QPXH 1GHFL 1G7LB 1M7IB 4FQXA 4LASL 3MYZA 1AGCA 4RGNC 1Z9MA 3FFCE 2JJWA 4ZPTB 2DICA 5HDOA 3MNWB 2DQJH 3VXSD 3I84A 1YMMD 4IDLA 4CUCA 1O7SA 4U6TA 1QKZH 1LEIA 4G5ZH 4CN6A 2IPUK 2VUYA 3S98A 4R4BB 3SDDB 3RZCC 1FH5L 4R2GB 2P5ED 5D6DC 5HI3D 3E2HB 4MZ3A 2K1MA 4OD3L 5B3JF 5IQ9A 1W72H 1U8LB 4NHUA 3JVGC 2AEIT 1CGTA 3NFPB 4RAHA 5D7JB 4Y5YC 4BKLA 3HKFA 4XP4L 1Q0YL 3QNYA 3S5LA 1A6VH 1A9BB 4X6FA 2DIBA 5KG9B 4PG2C 4S1SL 3HE7A 4O2CB 1P4IL 2DQEL 4KROB 5JOFB 1OW0A 4WI3A 2XKSA 1ZLWK 4KMLB 5IEHB 3RWGA 5HYEA 4X8JA 4DVBB 4UQ3A 1WBXA 5DMGC 4BQCA 2IPTH 3DLQR 2GJJA 2EC9U 4O9HL 4U4BA 2DRUA 4XZUB 1OVZA 4DKAA 1ZWIA 3VXNB 3BAEL 1BD2D 4KXZI 2L7JA 5HYJD 2EEBA 2BK8A 3DVGA 1C5BH 3LEXA 4OUUB 4XC1H 3QEUB 3GRWL 4DN3L 1DLHB 2W60A 3RWHA 1HEZB 1OSZA 3GBNH 1NMAL 3OG4B 2VLRA 4JJHA 3X3FH 2VLRB 2NY2B 4H8WC 4A6YA 1JHKL 1A6WH 3KYNA 4RNRA 4KTDH 1F13A 4HF5L 2FJFA 2Z8SA 3D85A 2FDBP 1JPTH 2XY1A 3O9WB 4JANB 2GFBB 1A7QH 5EOCH 2YEZB 2A6KB 5FKPB 2XXMB 4P2RE 5DYOB 3WV0A 2UZYB 4EI5B 1EIBA 5DJ8A 5H37H 1BQSA 2MQ0A 2BCKB 5K9QG 5T1KD 2G2RA 4M61A 4G42A 4XVSH 4U1HA 4BJLA 3KAAA 4Z78B 4G9FA 1EZVX 4JGUA 2JELH 1QSZA 4UMGA 2Y06L 3IXAB 2FJGB 5E6ZA 2DQDH 1ADQH 4OM1L 1E27B 5J8OA 1KIPA 2IGFL 2X40A 1B90A 4WNQA 1G7QA 3TZVB 3HZYB 4E5XB 1EAPB 1F6AB 1Q72H 4HK3J 2BVPA 4X7DC 5ESAB 3CVHA 5CIPH 5EC2B 5GZOD 2IANB 3KJ6L 2RAMA 3MV7E 3T0VA 3QDME 1BFSA 4R7NA 2AS5M 1IM9A 2F53E 2Y36L 1IT9L 4MJ5A 4GAFB 1BAFL 2Z93B 4PG9B 4Y5YB 1KPRB 3NPSB 2BC4B 4ZTOL 1UKQA 1TTUA 1U58B 1U58A 4KROD 4MNHB 5L2KD 2GTWB 4J23A 3MRIB 4JAMA 3V7AE 1EJOH 1TETL 1YQVH 5DS8A 4U7MA 1NH6A 3MRJA 4NQXB 3U30C 4P49A 3HE7C 4X0KB 4P57B 4EEEA 4WY7H 1TZIB 3T1FA 1LILA 4ELMF 5IR1B 2G75A 4KQ4L 4RZCA 4ZSOA 4C56D 2AJYH 2C1PA 2VZTA 4V1DE 4HCRA 3V5DA 4ZUSB 3NGBC 3VXOB 4K94C 2F15A 3FMGH 1MWAH 2ZG2A 3HI6L 5CHNA 2YPVH 5BVJB 4JFEB 3P30L 1MF2H 2FO4A 3IKKA 3MXWH 4X6BB 2VLME 3R8BB 2ZG1A 1PY9A 4XI5D 2DQIH 4JFFA 3O2DL 4JR9L 5J9PB 5KSBB 5IMKB 3GMLA 3DX6A 2CO6B 2VDMH 1Z2KA 5KN5B 3QQ3B 1UXWB 3U83A 5I8CB 3RAJH 1LP9F 12E8H 5I6XC 5CINL 4APQB 4I2XE 5I71C 3QRGL 5F96H 1B88A 4UNUA 1JHLH 4OF7A 1XF5B 5K9OA 3BGAA 1BGXH 1YN7B 5IHUH 5D72H 1MCDA 1N4XH 1I8LA 4OZ4B 1CDYA 4NWTH 3CFEA 4YHNA 4S2SA 4YDVB 4JZNA 4D0DA 2D03H 4NC0B 5BXFA 1SJVA 2A6IA 1QFUH 4QRQB 2VZOA 1YN6A 4MB5A 3BKYH 2AJSH 1T0NB 4Z7OE 1OGAE 2VH5H 4ODHH 3CC5A 1PQZA 4ZODA 5IJVA 5ACZA 5IVXA 1AGBA 4U1KB 3JSSA 2YA2A 4FQ1H 3BQUD 2ESVB 3VGGA 2UWEF 2HT4D 1A7RH 2CH8A 2E7BA 1JHTB 2XZQH 3PABA 2VLJE 3BH9A 3UBXG 4U1NA 3VMPA 1J1XL 4IOFC 3Q1SH 2EDEA 1D5XA 4X6CB 1FNGA 3HUJB 1AKJB 4L9LC 3VGAC 4P59L 3NIGE 3WFCH 1HINL 1UH2A 3IF1A 4UDTA 1ROWA 2WP3O 2VE6B 3QCVH 1EBPA 3AROA 2J12B 4PJ8A 4JFHE 1A14L 2FATH 2AERT 2OYPA 3RKDC 5FB8A 4P5KA 4NN7C 3OR6A 3C6SA 2PR4H 2YUVA 3HG1B 4KKNA 2VL5B 4XTRC 3HG1A 4C54A 3PWNA 3UJIL 2J4WL 2XYCA 1I9IH 4LLDA 4LSQH 1NBVL 1RZKH 2Q20A 2CLVA 2J7LA 4NFDA 1UEMA 2R1WA 3GBML 5I73C 4URTB 4UOJA 2FIRT 5E2UL 4FQPA 4ZUUB 4KKLD 3VI4E 3EOYG 5B22A 4Y1AD 6FABH 4LHUD 3AGVA 4HIIA 3SDYH 5FHAH 4YK4C 3HG1D 3LKRB 4HIIB 1C08B 4U33A 2F5BL 1L0YA 3HMXA 4PB9L 1U3ZA 4RGMB 4RAUA 4CRPA 4RGNB 3KLDA 4X99B 1SJHA 3RGVC 4XCFH 4HUXA 3WJLA 1ZK9A 3AAZB 1IGMH 2R23A 3MBEB 3VRIA 1MELA 2AK4D 1Q9KA 1G6RA 5HI5D 3BD4A 3IFNH 3SKJL 5F3BB 3CX5K 3UBXB 3T8XB 1NL0L 3FO0L 1LP9B 5GS3A 1E4KC 4TVPE 4ZNEA 3UTSE 1I1AB 1RIHL 5J6GA 4HK0B 1L9NA 1HSAA 1Z0NA 5HJ3A 2IFFL 4G6MH 4FFYH 3WJLC 3P3YA 5FM8A 1VFBA 3BQUB 1JPTL 3PL6D 1DN0B 3DO7B 2ZCLH 3Q5YA 4TTDD 5CCKH 4H1LH 3ZYIA 4PGDB 4G5ZL 1NFDF 3BI9X 4WFGD 4FXLA 1FVDA 1BFOB 1JNJA 2VDPH 3B83A 4R4FL 1P7QA 5ESQB 5C07D 1HHKA 1WBZB 2R0WH 1HHKB 2KQMA 3WIHA 5TH2A 1X6LA 2V5SA 4QHNA 1EERB 4HW6A 4UQ2B 3X14B 1ORQA 3X11A 4TTGA 5BJTB 1IAKA 3IS1X 4K3JH 2C4FT 3I9GL 2YD2A 3CXDL 5EBGA 1QSFE 5ITFA 3MSPA 5ITFB 5MHSD 3EDKA 4R3SB 1ZLUK 4LGSB 3QXUA 3KPSD 1YYLH 1MY5A 2YKLH 3HAEA 5AEAA 3MR9A 4JKPL 4OLUH 5C0ND 4PRPE 3ZE0F 2CGRL 4CVZB 4YHOL 5SWZE 1I3GH 1LO0L 4JRYE 4PLOB 5BRZE 3MRHA 2B0SL 1FGNL 2NY1D 4QWWD 2V7NA 4K2UH 4YXLH 2E27H 3ARYA 4ZTOH 1ZSDA 4L3CA 1E4XH 3KPOB 1CLZH 1BLNB 4RQQA 4GW5A 3OKOA 4YHZL 3SKNA 2AEWA 1QFWM 4E41B 2AK4A 43C9B 1S8DB 2HN7A 4UU9A 4KUZL 2X9YA 5D1QD 3GHBL 4Y89A 2CLZB 2A74A 4Z6AT 1Q9OB 5ILTL 1A7QL 4TTDC 1YECL 3SDAC 1YNLL 1ORSB 4WUUB 2BVEA 5E7BA 1QHPA 3BRFA 1KEGL 4HKJA 1CICC 3MV8D 2J6EL 1S7QB 1DVFB 1A9BA 2BRRL 3NH7L 4X6FB 3MNVA 4Y1AA 1VB9A 2R2BA 3MRNA 4AIXA 3FQXB 2HG5B 1EO7A 3AVEA 3BUYB 4ZOEA 5FEBA 3F5WA 1J0ZA 1S78D 3CDGB 5A2FA 4QYOA 2ARJA 2OTPA 2ARJB 2IQAB 4QWWC 3LZFH 4NN6B 2VDML 4H0GA 5EG6C 5DK2B 4XPBL 2NY3C 1M7IA 1IGIL 3R1GH 4KUCD 1J11A 3DYOA 4Y5XC 3QEUA 4NZDA 2YUXA 4MHHI 3ZHDA 4BFEA 1MFEH 5FGCB 2AJXL 3REWA 3X3GL 1U8OB 3WFEL 4UINH 1SBBA 1MRFL 1F02I 2EYTA 4TQEL 5A3IC 2ATKB 2EYTB 4BSWB 4LCWB 1KG0A 1TCRA 1JNNL 1A3LH 4MGXA 3DECA 5KSBE 5T1DL 2HFEB 5BQ7B 3GMNA 3L3GB 3DX9B 5D7JA 1EJOL 3ZT7A 1YEHL 3TESA 3TBYA 4U7SA 3MRKA 5FDWB 4JKMA 5EZLB 1MNUL 4FQ1L 2F74A 1N7ML 1D9KC 2AJYL 2FJHA 4V1DB 4RISL 4OB5L 1JFQH 3C5ZB 3VFTB 1G0YR 1I9RH 2MPAL 4DGIH 3CFDB 3QPQD 3KNBA 4HPYH 2VAJA 3GFUA 4KHTH 5GZND 5EU3A 3NABL 3QZWA 2OL3B 2Y7QB 3L5XL 3NIDE 4NP4L 2X1PA 1S7SB 1XGTB 4HFUL 3W11C 1T89A 4JFDD 4NC1C 1T1XA 1Q0XL 1U8MA 4RGOL 2PXYC 1NCCL 4MXVE 4AY0A 1KCLA 4DFHA 5BV7L 4XBEH 2QEJA 2XKNA 2JKXA 3I6KB 1NEUA 2XKNB 3RA7H 4ELMB 1CIUA 4CADB 4MA8L 3ZSTA 2AK1L 1DBJH 3RU8H 3DUUB 3HUJE 1ZAGA 3QJFA 4PTTA 2EDBA 3EYQD 1JBJA 3RWJA 3D85B 1E0OB 3UJIH 2VDLH 1MI5D 1U0QA 3SKOB 4GUPA 3PF2A 1T83C 3UPRB 1CG9B 3H9SB 2IPUG 2X9WA 3RBSA 5D7JD 3G5ZB 3ZLQC 5E8PA 5SV3A 4EBQL 5F6IB 4PRIE 1QBLL 4IOIA 4S1DC 3QIUC 4U1HB 4GRLA 3DBXA 1ED3B 1S9YA 1S9YB 1BQHB 4TRPL 1W72A 1E4XI 1JRHH 5CGMA 1AGDB 5BV7C 1J88A 3TBWA 1AGDA 1CZ8L 4XCFL 3VI3F 1YEGL 7FABH 2FO4B 2NY7L 4DUVA 3CMOL 1RZ8A 5LCVL 1FIEA 2HT3C 4WO4A 5CSZA 5K9JH 4P0DA 2B5IB 2D31B 5DEFA 2LTQB 1FZOB 3EZJB 4PJCF 3AREB 4MSWB 3HZMB 3ZKMC 4F80A 5HVHC 1MUJB 4ORGA 3TEUA 3BWAA 5JHDA 3OF6A 4MNQE 1OAQH 2KZWA 2CK2A 1EBAA 2AKRA 3IJYA 3WD5H 3JWDH 2GTWA 5DO2C 4MLSA 3IDMA 4PV9A 4UIMA 2BSSB 1X6NA 1KJMB 4JPKL 1FYTE 1D9KB 4JVPA 4DKEL 3MRJB 4MQ7A 1Q1JH 1KC5H 4S2SB 3DMMA 3VFOB 4PV8B 1X5XA 2NXZD 1NGXA 4BZ1L 2AGJH 4Z76B 2IADA 2P47B 3I50L 4HUUA 3QO1B 1CTNA 3RGVB 1KJVB 1JCKA 4IRJB 2I07B 3MMEA 5GRJL 1RZFL 3U36A 1G7PA 4ETYA 2PTVA 4XAWL 5HHMB 1GOFA 1ZHLA 3PGDA 1RURL 4JRXD 1I3UA 5T3ZH 1T7YA 1JV5A 4TNVF 1G7LA 4FQXB 1HIML 2PW1A 4AEHH 5C3LD 2H32B 1WUNT 4X6DF 2HJLA 4KK5D 3PE9A 4BM7A 2NXYD 3CVIH 3SEPA 3E3QC 3ARGD 7CGTA 1A6UL 4OKVB 1AD0A 1XGPA 5D1QA 2CJUH 5CS7A 1BZ9B 2VQUA 3NTCL 1BZ9A 1HH6B 5FGRA 2X09A 4JPWH 1UKSA 5C09D 5HHVL 3BT2H 3QUKB 4QKXB 5GS0D 2ZUXA 3DJ9A 2XNAB 1TZHB 2FX8L 3QEQD 2VE6A 4RBPH 2X9XA 1KJ2B 1OGTA 1K6QH 1ZV5A 1OAZH 4PY7A 2BMKB 4XH2A 4OZ4A 4PJ9D 5F7DB 3STLB 5D2LE 1QRNB 2XTJB 1UWXH 4KKBC 3C6LB 4AT6B 1A7PL 4C59B 1FYHB 3NCJH 5K33A 1L7IL 3KYKL 3UTQB 2X4PB 2W9DH 1JGLH 3BXNA 4GAJH 3FT3A 2ITCB 4PRHA 4LRIA 1DQJA 1WZLA 5DRXB 1OSPH 2J6EH 3MLWL 3NH7H 3C5SA 4ERSL 4JEGB 2Z31C 2V9RA 4Z95L 4PJDE 4PJCB 4AG4H 4Z7QF 5I18H 1FSKC 1FV1A 1CE1L 1N0LA 2Z0BA 1BHGA 4F3FA 5I30H 3ARTA 2COQA 2ITDB 3VXRE 2XQBH 1QFWH 1WWWX 2ITDA 3NCEB 5MENB 3QIUA 3UROR 3RQ3A 5I66A 4KDVA 3MGAA 1LK2A 1FL5A 4KZDH 2YKLL 4XNMB 2VXVH 4J3VA 1HHHB 1C16A 3K2MC 2X2YA 5E2WL 3W0WB 4NSKA 2VLKE 1MFEL 1FZMB 2Y72A 3MRBA 5CZVH 4EIZC 1JF1A 5CJBA 5IGXL 1C7SA 3CSGA 3LQMA 1ZA3A 1I7RB 2ID5A 3T09A 1GGBH 3P4MB 4JB9L 3MNZB 5J56B 2VLJD 1TJIL 2IEPA 1ONQB 2UZIH 3RVVD 4JRXB 4DZ8B 3WE6A 5HHOA 3W0WE 3V0AC 1J8KA 1CLZL 4XP9L 1DN0A 3DO7A 1ZTXL 4G80A 2X89A 2OMBA 4KY1L 1FGVL 3PL6C 3GSNB 3AY4A 2FJGA 4I3GA 4HPOL 1WBYB 5MENE 1YECH 4LF3B 1OAXH 3KPQA 4R7DA 2ERJC 5ADPH 1MLCA 3HC0B 4ZO6A 1MLCB 3HC0A 3L95A 4C83A 1KT2B 4LKXA 3DX7B 2GJZA 1W8NA 4IOSD 3SDCC 4XWGH 4MCZB 3HZKB 4P5TD 2A73A 3BKCH 2F54E 3NABH 4FQ2H 1XF4B 4APQD 5SX4I 3ZKSD 1Q9KB 1IGCL 2FHCA 1OPGL 4Y2DD 3MLSH 1OP9A 4Y1AE 3T2PA 4CVZA 3ZKNC 5BV7H 5EC1A 2OS7A 3ZTNL 4NO0A 1LWRA 5I1IH 1F58L 4HLZG 5E70A 5HHPA 4XPBH 1OF2B 3MRHB 2DWEB 4L8SC 4JG1L 4LPXA 5AUMA 5DHYB 1WQVT 5I1CL 2P46B 1RK0B 5I15L 1S5IL 3QIBC 3WFEH 3SQOH 3I02A 3I02B 3SDAB 2AK4E 2Z31B 3Q3GA 1OAKL 2R4SL 3GIZL 1XF2B 5HYSB 1VKXB 5GJSL 3H0TA 3H42L 4JZOA 5FO9A 5FO9B 4GKNA 5HDQL 4J6RH 3VXRA 2WK2A 3FN0H 3EYUL 5F7HA 1BFVH 1QOKA 1BD2B 2DQUH 2PYFA 4IBLT 3BZ4A 2PYFB 2Y5TA 4WI5A 5I9QB 3AXLB 3TCLB 2ICES 3DX6B 1MHPL 4PLKD 2X05A 5B21A 1B4JH 4P23C 3MTRA 2XN9E 1N7MH 2A0LD 1CD1B 1CICD 3BUYA 4OV6F 4R90H 2XZZA 1BBDH 2VC2H 2ZJSL 5IROC 3LKPA 2MPAH 2VIRA 3OAUH 4NUGL 4Z5RB 1MJ8L 3ARWA 4Z7WF 3CZFB 5JA8B 1G7QB 4QEGA 3TZVA 1A3QA 2R69H 5DI8A 1X44A 3BRGC 2CRZA 3G08B 4Z77A 3S88L 1N26A 1Q0XH 2ZWLT 3QIBD 5FO7A 1HH9A 3GIVB 2YD8A 3C8KB 3RA7L 1E6OH 4J2XA 2BSRB 4DGVL 2BSRA 2IWGA 5F6IC 1QKZL 1TVHB 4Y19D 2Z31D 1BECA 1PQZB 5IJVB 4U3HA 1FNFA 4U3CA 3SDDA 4PJFB 3FFDB 1ZLUH 4NCC2 5K59E 3HC4L 3OSKA 2YOCA 3PHSA 5TPWH 2DYPD 2IF7A 2FLBT 2PNDA 2UWEB 3L3GA 5FCUL 4KI5C 1CWVA 3GNMH 5CIPA 3CVHH 1JN6A 1UJ3C 4FQCL 2Z8RA 2YPLB 4H8WH 2VXTL 4NKQB 4U1NB 3U0TB 3UJJH 1RHHA 2BVOA 3GJFH 4UV4L 4AIZB 3O0RH 1LQSR 5E56A 1I8IA 2KPNA 2FJHB 4V1DA 5MP6L 1I1FB 5M94B 1EZVY 4ODTL 3MROA 1FFRA 4L8BA 4R0LB 4O9HH 5FDYA 4YBLB 4XNYL 2CR3A 3MCG1 5DGRA 4JFEA 3VXMD 2KKQA 3MCLL 4JDZB 3MRGB 1UB6A 1YEGH 7FABL 4PJ8B 4HS6A 4OGAD 3UYRH 3UBXI 1EEUA 5DQJA 1CQYA 1GC1L 5FM5M 5ICXB 3RWHB 2HRPL 5IESL 4N1EA 3LKOA 1NDMA 2PN5A 2HKHL 2FX9H 5GRYA 1OAQL 1OHQA 4QOKD 1ZHNA 3B9KC 3HA0A 1QVOA 2DQJL 5IB5B 3O6KL 3ALXA 4NKIH 1SVCP 3RDTC 5GQBA 5TE6H 3GMNB 5F70A 4NIKB 4FQIH 1FH5H 4P2RA 2W1NA 1ZLVH 5A2LH 3ARFA 1Z9OA 3RVXD 1EV2E 1YN6B 4KRPD 5EFIB 2V7HA 3T0EE 2V7HB 3D6GA 4TPRL 4QRTA 3RIFK 1YY9D 2CR6A 2CSPA 3O45B 4NQED 4GG6F 4MMZC 2Y06H 1WFUA 3Q5TA 4M1DH 2MOVA 5TJWK 5GZOC 3MRRA 4RGND 1LP9A 5D2NE 2NNAB 3QQNA 3QZWB 4HV8A 2P48B 4OV5B 1HSAB 3VGFA 5FYKD 3TBTA 5DC0A 5ICYB 5ESVB 4WFHD 1T1XB 1H0DB 1U8MB 1AC0A 4K23L 3EUUA 4V2BA 4U1GB 3WUWB 4PJAF 4L3AA 5D1XB 1MI5A 4TN9A 2XFXA 2Z91B 5DRNB 3D85D 1ZVSB 5CZVL 5I17A 3VH8G 3ISWA 3FQWB 1AFVL 1VCAA 4CADA 2YK1H 1IT9H 4OGAC 2CMRL 3QP3A 3OZ9L 3DRTA 3MQIA 5IK3B 4X4XA 5EBLB 1MCRA 1GGCL 1KF9B 3MRLA 1RIVH 4NDMA 1CGUA 3MBXH 5TH2B 4HC1L 3WN5B 4LSUL 1YC8A 2R8SH 2W65B 1S7VA 3O6ML 3UX9B 5F7UA 4LPTA 2VZUA 4LQ1A 2R0KL 4LEOB 3QXTA 2WUBL 3QUYB 1IAKB 5J6HB 4F9LA 3BJ91 1SJEB 3EDFA 4G6JL 3V52L 4NQDB 4ETQB 4NQEA 4CJ0A 2EH8H 4IMLB 3MRCA 4PB0L 1WV7T 1QSED 3HE7D 3CCHB 4JCLA 5FM4A 3QDJD 1ZOXA 4X6BA 2O5ZH 3M1BA 3VWKC 1RD6A 2UYLA 3VDAA 1WT5A 4WO4B 3ZE1F 3V6FA 3O2DH 1DQML 2VSDA 1SYVB 1N6QH 4YPGA 3IDIB 1BWMA 4R26L 4HEME 4N0UE 2N4IA 5DEFB 2DBJA 2DI9A 1WAAE 2DKSA 2YBRA 4KMTL 3RUGE 4B5EA 4JG1H 1MIMH 1RULH 1OM3L 4NQCD 4QF1B 5I1CH 4NBXB 1EHXA 3G9VA 3QULB 2XQYG 4JQXA 3THMH 1N4XL 2AXHA 2I24N 3OB8A 5GJSH 1D9KA 3TNMA 2X44D 3LS5H 2HJKB 4LLQA 4PRBA 1DQLH 1ZTXH 1WITA 1FRGL 3CDGA 1AD9B 2X4SB 3RL1B 1EDQA 1K8IA 1EGJA 1FGVH 1FHGA 1OAYH 1LD9A 2R1YB 1WIOA 3JV4B 4H20L 5EN2B 3P73B 3GKWH 1FG2B 2GSGB 4N0YH 2X70B 2ZSWB 2APFA 3MV8A 3MZGB 4RFOH 5J13C 4M8QB 2LV4A 5EUOA 4HZAA 1A7RL 5ADPL 1ZGLA 5JNYA 5D7IE 5JNYB 4LLVA 2AXGA 3V95A 3VXUD 5IB3A 5HHNB 4PJIB 1QRKA 3SDDD 5K9KA 1R3KB 1FAKT 3VWJA 4BK4A 2ARWA 1HINH 3DGGB 1B3JA 3MLSL 2NZ9D 4LCWA 3L3HB 4WTXA 1U8HA 4HKZB 3QUXA 1EFXB 1TZHA 2CUHA 3OTTA 5MI0C 2BNRB 3S9DB 2EIEA 3QRGH 4PJHF 1JHLL 1M6OA 3HE7B 3MV01 3GI8H 5TPWL 2L0DA 2A83B 4FZ8L 4FN0A 4H25B 5HGBB 3GIZH 3ARFC 3E0GA 3BXNB 4NWTL 4HUWA 1R3LA 1DBML 3VFSB 1FL6B 4UV4H 2FX7L 4OQTH 5BZWA 5I8EA 2DQUL 1O0VA 4ZD3H 4WUUE 4LRNL 4F3FB 2GUOB 1S7QA 3PWLA 4JRYA 5HY9A 2W60B 3ULVH 5I0DA 5C92A 1D5MB 5F9WB 3FB6A 3I6KA 2HVJA 4LMQI 4LSTL 5ID1B 1BBDL 2VC2L 3VA2C 1JWSA 4M7JL 1G9MH 1PBYA 2IQAA 1G6RB 3WS6C 4HFWB 2DQHL 3PL6A 1X5IA 4JANA 4XNUH 5C0CB 5CJOL 2X1WL 5F9DC 3S88H 1I7RA 3K46A 4RBPK 5F7FA 1KIRB 3SE8H 1FG9C 3MUGB 3WHE0 3NZHH 2J8OA 4K7PH 4DWHA 4XX1E 3CLEH 1U8OA 3PDGA 2NY6B 1E6OL 4ONFL 5B4MD 5E0QA 2NTFA 1TENA 1T5XA 4TOYL 5IV2A 1D3CA 1IGFH 1NKRA 2BVYA 4YK4B 3NCYP 1WAAA 1YEFH 2MCG1 1KIPB 3BVNB 3EJZD 3JTTB 4L4TD 3BVNA 4FFZH 4PRDA 1MY7A 3HLAA 4PS4L 4WFEE 5E8NA 4TUKL 1AXTH 1J1PL 3CVHL 5DA0B 5SX5H 3U4BL 1NGZB 3OKDA 2VLLB 3ZTJG 4KJYA 2BNQA 1LO5B 5KJRL 5EORH 5MP6H 4Z0XA 1YYLL 1INQB 2F58L 2IBZX 3LQAH 4RMVA 4A2LA 3T1WA 4HMDA 1Q94B 3K4AA 5FO8B 3RDTA 5EU4B 1KLFA 1JI2A 3VRLF 4JJ5A 1TFHA 3WS3A 3G08A 5T3ZE 1KJMA 2YR3A 2V7NB 5F3HB 2YUZA 3FAXA 1DQDH 1FL3A 1KLGB 2NTSP 3SJVA 1HH9B 2YPKB 5D1ZB 1QP1A 4NQCB 4UTBL 4WW1B 1JF5A 1U95A 2N1KA 1G9EA 3ROOA 3IVKA 2HKHH 4JQIL 4LARH 2BVQB 2WSKA 4YEEA 4FFYL 5D7SH 43C9A 3V5DB 1UZ6F 3W9DA 4KK8D 1UWEH 4WFFE 1PG7W 4F58H 5B3NA 3JTSA 4YZFF 5FHBL 1JPFB 3ZDZE 4P2QE 2YPLD 2OJZL 4QY8B 1OOAA 3HUJF 5GGUA 5DFVC 4M1GH 4MMXC 5DT1L 4ZFFA 3QI9B 3QUMH 1QSEA 4JM2C 1NGYB 4PB0H 5HHMD 2VDPL 4RDQG 1KENH 1NAMB 4IOIB 2AJUL 4R4FH 1F6FB 3SO3B 4I4WA 4XBGA 1VFUA 3G5XA 2HG5A 4BUHA 5LWYH 4NRXA 3KLAA 2UVFA 2HYMA 5JORB 5GISH 1RUAL 3I9GH 1QFWI 1F4WH 4PBWD 4PJ9A 1S7TB 2P8MB 3CPLB 2CIKB 3MFFA 4MQXC 4AZ8A 4U6XB 5KAQG 2J6EA 5C0AE 4B50A 5C9JA 5BCAA 3B5GA 3QHZH 4LEXL 2ICEA 4P23B 3K80A 1OM3H 1IQWH 4CDHA 4PRHD 3EOAA 4O51B 4NFCA 4JO2L 5DA4A 2M1KA 5DLML 1SJXA 2ZKHH 5A2KH 1T3FA 2CMRH 3O11A 2BC4A 3FFDA 3T2OA 1EAJA 2A6JB 5I1HL 4AYFA 3OKEB 4K71B 1UCBH 4MAYC 5T1DH 1SHMA 1Z5LA 3MJ9L 3T3PE 5I1JL 4XWOC 4I3RH 1YEHH 3RWCB 4FFWD 2R29H 1MHCB 3DMMB 2YN5A 5DVOA 1NKOA 3GKWL 5IP4A 4MA3A 3DXAB 1D6EA 4KI1A 4OF5A 4JQVC 4OGXL 4D0BA 1CGYA 4RISH 3S37H 1W0WA 3IFOB 2H6PA 4C56A 2B2XH 4MD0A 3D25B 5FGSA 1F3RB 5GSVB 1CLOL 3W0WA 1U8KA 2HWZL 1A4KA 3SE3C 4P4RB 1CVRA 5GS1B 4Z7NF 3TO4A 2O26U 3WNOA 4XNZC 1F3DH 4FQHA 4FA8A 1PG7L 5DXWA 2OQJA 4HIHA 1DBJL 2EICA 1T7VA 4HIHB 3WN5C 4QTHB 1CGSH 3FQTA 1WWAX 2AJXH 3QA3B 4FZ8H 2YS4A 2DQGL 3KPQB 4P23D 4WHDA 5DUBB 3OGOE 5DUBA 4M6OH 2FD6H 1B6DA 3F7YA 2DDQH 3L95B 1AGFA 3C6LA 3G5ZA 5D2NB 1KIQA 3IAPA 4CNIA 1SJHB 1DBMH 1C5CH 3UTPE 3DSNA 2FX7H 5DRZA 3E1F1 3ESUF 1OAYL 3EKCA 1H5BB 4N8CL 5C71A 3IRZA 4PJ5D 1MNUH 3AM8C 5HVWA 4GG6A 2ESVA 4IIQB 5B8CC 3GMOB 5BS0E 1YZZA 4WO4D 5KVGL 4NJAL 3MREA 4UBDD 3PABB 2QSVA 4CJ1A 4GQ9L 5DHYA 4Y5XB 2ENSA 4WI2A 3B9KD 4XNUL 3L5XH 2FSEA 3O9WD 4N90E 3T0WA 3KS0J 5CJOH 3H6JA 3TT1H 2GT9A 2JB6B 1TZGH 3UJTL 1TNMA 1A4JA 4K07A 4AQ1B 2X4UB 3CLEL 3GZKA 5LKNA 3C8HA 4UNTA 2I5YH 4JY6A 2VZSA 4F33B 1IMHC 3D3VD 2YZ1A 2BSSA 3HB3D 5IFHH 5FXCH 4ZNCD 1DE4B 4JN1H 3N50A 2D7MA 5FUOH 2H32H 2VJXA 2HJFB 3VMNA 5BZDB 1Q1JL 5DQ9A 3R0MA 2HJKA 4YNYA 5CD5D 2DI8A 2AI0L 2HLFD 3QPQC 4LAQL 4ODXB 5F8RC 1XGUA 2HTLC 4GG8A 1KJVA 1H3PL 2BSED 3ARED 2NX5E 4MNGE 1KJ3H 4NYLB 1UXSB 1N5AB 5GS1C 4GOSA 4JZJA 1N5AA 1EXUB 2EXYC 4TVPL 2OJEB 3U4BH 1N59A 5D7KD 1SEBB 4DGYH 4H1LG 2FEEI 5T3ZL 2P8LB 4ZD3L 4AEHL 2QTEA 3ULSB 4QTIL 5FA3A 3BGFB 5H35A 2D0FA 1S3KH 4G6FB 4MAUL 5EZJA 5CD3A 4BZYA 5FYJL 2NY7H 5D1QB 2NY6C 4G43A 3NTCH 4JPVL 3IDNB 3ALPA 4HXBL 4MD5B 4JPWL 2EKJA 3DUHA 3O6FD 4H88H 3WIHH 5K9JL 1OWWA 3C09C 2A74B 4HS8H 5KW9L 1I1AA 4ZPVB 4P46D 1MJ7L 1OF2A 1KJ2A 1CF8H 4U6HB 4CMMA 5C1MB 2VZ1A 4L4VA 5CZXD 4FQXD 4Y4KB 3D0LA 3L3OB 1YDPB 2BOCA 3L3OA 1DVFA 1G6VK 1EHLL 4X7FC 3H7BB 2VLKB 4CAGA 4XPTH 1CFVL 3FHQA 4TOYH 5CEZD 4JKKA 1UA6H 2KQNA 3C60D 1J0KA 1KGCE 1TQCB 4LU5L 3ARBB 4FFZL 4BZ1H 2AJUH 3VXRB 2DLTA 2GW5A 3RZCA 4TUKH 1AXTL 1CE1H 5C0AA 3SCMA 1OCWL 4WDIA 1GZPA 2CDGA 3WXWH 1ZMYA 4UI2A 4MJ2A 2FCBA 1WT5C 4NO2B 1DFBL 2AXGB 2YRPA 2JIXA 3LKOB 3RTQD 5CFHA 2E7LA 4YBQC 1T80A 2BNQD 2XZCL 3O2VL 3SPVB 2VXQL 2Q6WA 1AQDB 4HKZA 1A6UH 5D2LB 3ZYOA 4ZFZA 2NXZC 1C5BL 5GJTH 3IDGB 1GGBL 4X98A 4M7LH 1UC6A 1YEJH 1TTFA 4X5WA 4HIXL 4NQUA 4ZS7H 4QRTB 4UUJB 1OTUC 1UCBL 1JHKH 4PBVC 3WFZA 1JTPA 3MBED 1T5XB 1I9EA 3V7AG 3BYYA 2F54B 4F7EA 4HPOH 1U9KA 2CKBH 4PLNC 3SDCD 3V5KA 5C70A 5EIQA 2P42B 1MLBA 2OJZH 1P1ZA 2YSSA 2ZSVA 3FO2A 3RHWK 1N5YH 3DARA 4U1MB 1RVFL 3RJQB 4GAJL 4I0PB 3QNYB 1OP3H 5CJ5A 1KB5L 1FFPB 2R1XB 1N2RB 3U4EB 1CLOH 5MERA 1JGUL 1IZJA 4LHUB 2HWZH 2APBA 3HR5A 3UZEA 1YMHA 4PJHE 3BKCL 1YMHB 1PD6A 1DANT 5DJDA 1OARL 2DM2A 4D0CA 4DVBA 1KXVC 2AV1B 4DEPB 1Q94A 3PWVB 4HWBH 1FZKB 2G60H 4L3EE 1JGEA 2IAND 3WJJA 5I1IL 4JJ5B 1FYTB 2Z92A 5TF0A 4KJWC 1EEYB 1NMCB 4WWKA 5F9WC 4AL8H 5T3XD 4S10A 3U0PA 1CGSL 4OFYA 3S35L 1Y0LB 1RK0A 5C09A 2H41A 1CU4L 3QAZC 4HG4K 3QUZB 3SQOL 1U42A 4X9FA 1KTDA 3S5LG 2EC8A 4MJID 3H42H 1TJIH 3OBAA 1W72B 2LVCA 2W0PA 4Z7WB 3T08A 2NY4D 3MA9L 1B0RB 2YWYA 3DX9A 3QI9D 3MJ9H 3HLAB 1TETH 1KXTB 1T04A 2NLJA 5E9DD 5C0IA 4NHCL 3FQUA 4GXUM 2JLLA 4PJCE 4PGCB 4KU1A 4ZFFB 3V6FB 2BHYA 3VXSE 4CMHC 2BNUA 1GIGL 1B4JL 4WU7A 3HZMA 4O58H 5H37G 3S37L 1U6AH 2ZJSH 3RL2B 2YBRB 4U6YA 4P5TA 5EU5B 3IXAA 1F42A 2NXZB 5MEOB 4NQDD 1P69B 2JJUA 1OTSD 3DXAE 5TE7L 3L5IA 3CZFA 4NZUH 1YJDL 4RAVB 4OBSA 3L7EA 5D1ZD 1D9KD 5FKAA 4UIMB 4OV5A 3QIBB 4JKWA 1X5GA 4LDLB 4QXTB 5IMLB 5GGVH 5DMKB 2CDFA 3I2CL 4OLVL 5CBEA 4FG6C 1QBAA 2PYEA 4LLQB 4FP8L 5DD0H 4K8RC 4ELMA 4R7NB 3LRHA 3G6JB 4ZFOB 3LKNA 1U92A 4MJ5B 2WQ8A 2Z93A 3P4OB 3U36B 4OIIL 3FB8B 5TF1L 4KQ3H 1IAIL 1R0AH 4IRSC 4OJFL 5EPMB 5JOPE 1INEL 3MXVL 4PY8J 4OF6A 1MCHA 1KLUA 2DQGH 1FC2D 2CO7B 2C9AA 2E5EA 4D9QE 4JFFE 3INUH 4QY8A 4I0PD 2FD6L 3IDUA 2AQ3A 3QUYA 1U8JB 5I8OH 3QHFL 3AS3A 4J1UA 4Z7UB 3DBXB 3L7FB 4FTVA 2EXWD 4YPJA 5E2VH 1L4IA 1K8DA 2H6PB 4C56B 2VWEE 3L3HA 3O4LE 4DQOH 5DWUH 1XF3A 1OP3K 3O3AB 1WWCA 3SOBH 1V3LA 4NM8H 4XXDB 4FQQA 1CXEA 3QAZB 3H9SD 2BMKA 4AEIL 3VXTA 4FRWA 1J9CT 2ICEB 1QSFD 1V7MH 3N9GL 4JM4L 3SE9L 1CGWA 4HS8L 3DWTA 1FZOA 3AREA 4MSWA 3ECBB 4XMKH 1T2XA 3QDGD 5KANG 3M17B 2ORBH 3WFCL 3KPSB 2CK0L 3TIDA 2EE6A 1S78C 2VZVA 3LCYA 4DGVH 3HPJB 3O6KH 4DFIA 4P5MB 3LN4B 4PJCA 4XPTL 4Z0BL 4WUKL 1INDH 4HXAL 4ZYKB 5ERWA 4YFEA 4ZYKA 5I8EB 3D3VB 3EOBB 1KACB 4LCIL 3HC4H 4ALAH 1UFUA 3FOMA 4OCXL 1LDSA 3ARBD 1MOEA 4QRQA 3WNMA 1NBVH 4CNIB 4LAQH 4YDJA 2R39A 3MRQA 4M02A 5HPOA 5IUSA 4C4KO 43CAB 4ONGL 4GBXA 3GBMH 5DJYA 4GW1B 1W0WB 3AS0A 3ORJA 4P2OD 1RU9L 5TDNB 3AMKA 4M1CC 3KPLA 1A4KB 5DHVB 2ZOLB 4PJEB 3ZZ1A 3LIZL 2OK0L 3C08H 1AGCB 2IAMC 3TO4B 4QTIH 2XZCH 5AD0B 4ZUTA 4KGJA 4S1RL 3ME0A 5I1KL 3BH9B 2W38A 1EFXD 5D1XA 3FT4A 3IXTB 1OT2A 2FSEB 4LIQL 3VWJB 2YK1L 1OLZA 1QPXA 2D7PA 2WAHA 4H0HB 4R4BA 3V4VL 1MVFA 2JB6A 2ZUQC 2HFFB 4AIOA 3VXQB 2JIXD 3MRMA 2HRPH 2ZPKL 3VFPB 1U8LA 4HIXH 3VGHA 3CFBB 1G6RH 3P11L 2FB4L 2X4UA 3TNNA 3IFPA 3JWNC 2IJ0C 1AHWC 2VXUL 5HPMB 3LS4L 4MXQC 2A77L 1QLEH 4YQXH 3E6FA 4POYA 3F7VB 4Z8FH 1CD9B 2Y9RT 1MFCL 5EBWA 3K2UL 3QWOA 3BPLC 3RWDB 1G1YA 1UT9A 4S0TD 5FYLL 1S9VB 4FFWC 3TT3L 1F8TL 2X1XR 5E99L 2D7TL 3S3PA 4FFVC 3WFDH 2NMSA 4OFKA 5DFWH 3OPZL 1JGUH 4M5ZL 1JMZA 1DVFD 5GSRA 3DVGB 1GXEA 4XNXL 2JK5B 3WXWL 2R15A 1RUKH 5F7NC 4JFPB 3U2SB 4LPVA 2XTLA 5FAAA 3WDHA 4HD9A 4R26H 3C60A 2QQKL 4OCYH 2Z31A 2VZ3A 4QHKJ 4I9WD 5EULV 4YIQB 1FZMA 5FGCE 2NY6D 3IFLH 2BSTA 1OWRM 2W0KA 5D7IF 1P9MC 1EFQA 1Q9WA 4CU6A 1K4DB 3ARSA 1FVEB 1BD2A 3T0DA 3QDJB 2CUMA 1YEJL 3QDJA 4LDOB 3WE6B 1CL7L 3P0VH 5DQ9B 1S7RB 1NAMA 4OI8A 1HHIA 4JY4B 1HHIB 4JY4A 3GHEL 4HEPG 4Y19A 3VWKD 5GGRY 2P4AB 4G9FB 4GG8B 2WUCH 3IDYB 1TIUA 4PJIE 4U6VL 1JPGA 3CDCA 1FVDB 4WTZG 2HTKC 1P7KA 2NCMA 3P73A 2C3VA 4FS0A 3G5VA 2ED7A 4KDTA 4PGBB 3G5VB 3F12B 3KPNA 4JKLA 5FECB 4Z77B 1RVFH 1I85C 5FK9A 4CBPA 2DLFH 1CTOA 5HXMA 2FECL 3GSRA 4GRWB 3TZVD 3UPAA 1MJUH 5EA0H 3LAFA 4S0SD 5K93A 3F7QA 4HDIA 1QLRB 4MX7B 1AHWB 3JWOH 3VWKA 1AHWA 2VABB 2GY5A 4W81A 3DROB 3DGGA 4KKCC 4QT5A 2CPCA 4YBQD 2HRLA 3OKEA 3C5ZC 3HG1E 2Y6SD 2OBGA 3W2DH 5KSAD 4ZFZB 1JPST 1MPAH 4Q97A 4BH7B 3GB7B 3H7BA 4QRPE 1QQDB 1QYGL 3KPOA 1YYML 2A9NL 3MGTA 3F58H 4K9EC 3K7UA 4XPFL 1JWMA 2UVEA 4N0UB 1T6WA 3UTSD 1N0XH 2H2PC 1FRGH 2UUDK 1UB6B 4C4KT 4P2RD 4NHCH 4EQ2A 2J88L 1DJSA 2FGWH 1NLDL 5C2BH 4H20H 4ORZC 1FFPA 2A9ML 3U4EA 3QEHA 5DD5L 2R2BB 3MRNB 4RFOL 2ZP0T 3LVEA 1K5NB 1MFBL 1JFQL 5D96C 2DL9A 4M7JH 1OGAB 1XIWA 2GITA 1ZHNB 3LD8C 3QR2A 5T1LB 4ZQKB 2DLHA 3GSOB 2F5AH 1UACL 2WP3T 4PJ9B 3KPRA 1KCRL 4GRLC 3C6LD 5CILL 5K9OB 5DK2A 1F90H 3RIAF 3GMRA 4FMKA 5GGVL 5C8JA 2R0ZL 5JW4R 2M2DA 5HGDA 1HCVA 2WV3A 2GJ6E 4MA8H 5LGHL 2F53D 3MRPA 1J8HD 4B53A 1X5KA 3MRPB 2Z35A 1NUDA 3BP5B 3I3BA 1I4FA 1UCTA 4LVHC 2XWJA 3M8OL 3BH8B 5E6IA 3QIUD 4ZFOL 4OCXH 3GUTB 4PREA 3ARGB 3OXSB 4PREB 4JHWH 3NGBB 4HKBB 1LO3H 3P40A 1LE5B 5I1AB 1FNSH 4AQOA 3INUL 4H5SA 2RQ8A 4NKMB 3ZE0E 3ROLB 2FEDD 4ONHA 5BRZA 2IFGA 3CMGA 2OR7A 2VLLA 3WL9A 1D5XB 1JMXA 5EOTA 3RVWC 2GYSA 3LIZH 5D5MB 4RA0C 2GT9B 1G7JB 2DJ4A 3PV7A 5LXGH 4MB4A 2W9EH 2ADFL 3UYPA 2V2XA 1M7DA 5I19L 3CXHK 1A4JB 1M7DB 1MQ8A 3WUWG 2CRYA 5B4MC 3L3DB 3E6HA 4OAWB 4HS6B 1NC2A 5LCVH 5C07A 3C6SB 4DVRL 2D4DA 3KLSA 1RZKC 5CP3A 4LSDA 3GO1L 3U7AA 5AYUL 1IKFL 3U7YL 4XXCA 2IQ9L 3SGEH 1G6RL 5F9OH 3IDXL 1KCVH 3ARQA 4RA3A 2YD6A 3V4PH 3L5WB 5F9JB 4HIJB 1D6VL 2ORBL 4LARL 3WKML 2BVQA 4OZFH 4YAQA 4X5XA 1NAKH 1RJZB 3ULVD 3NZHL 3FRPA 2OJEA 1MFAL 3RWJB 4NN5B 3QO0B 3HS0B 4ONFH 3R4DA 2GTZA 4MCYA 5E4EC 2HA1A 3WFBL 1PW3A 1KPVA 1R3JA 1UH3A 2VAAA 5T3XE 4YDIH 4XVUC 5D7LE 5IKCA 2C1OA 4R8WH 2NY2C 5C0GB 4LSRL 1N64H 1TJGH 3IJHB 1SYSB 2AGJL 1D5ZA 5IVZB 1FE8H 4GRLB 4KVCH 2AV7A 4KK9D 1XCQB 1J8HA 4X9HA 4HT1L 4O2EB 2MKWA 3BX7C 3VXUA 1RUAH 4GG6B 5EZOH 2NNAA 1VFAB 1UENA 5KJRH 3HMWH 4XCCL 3JV0A 1VADA 1VADB 4X4ME 5HVFB 4KRLB 2PTTA 1X5YA 1MCLA 2VR5A 1LO4L 1PY4A 4CN1A 5L2KA 2RCSH 1P84K 5EBMB 4LBEB 5ANMA 3IU3B 3IFLL 1ZVSA 4G7VL 3BAEH 4Z7WE 4LIQH 4BSJA 1K8IB 1T3FB 2R0LH 3R06A 3TIDB 3R06B 1NMAH 4UTBH 1CL7H 4OLZH 3WIIL 3SJVD 4XBPA 5L7XL 4F33A 3FT2B 4P5MA 4M48L 4PJ8D 2OZ4A 1HYSD 1QFPA 2W65A 4YQXL 4OT1L 4WGVB 5CJ8A 4P2OC 1UWEL 2IPKB 4PGJA 1KCSL 4NO2A 4F58L 4XRCB 5K9QI 2AXFB 2V9TA 1TJHH 5FGBA 5EOCL 1F2XK 2ZUYA 5C08D 3LDBB 5IB3B 5JHLL 3B4NA 1HI6A 3S4SG 3HNTL 1JGLL 5F72S 1XIWD 4EDXA 1F8TH 3T4YB 4NQVA 2VKWA 3DIFA 5JXED 1K8DB 3L6FA 4NQVB 1K2DB 2BFVL 3T0EB 5ISZA 4B7IA 5I18L 4OF8A 2ZOLA 4PJEA 1ZLSL 3S3SA 5IROA 3WUZA 2DMKA 4ACPA 3QISA 3RNQA 1GH7A 4JDTL 3K1KC 4F9PA 2JJTA 3ARDB 2EIZB 1RUKL 2BY2A 4OCMC 4ELKB 1F4WL 4P46B 5D1ZC 4KZDL 1HDMA 1P53A 5FUZH 2AQ2A 4U05A 3GM0A 4LVNC 4MAYB 5HYQB 1KFAL 5AZ2H 4J7RA 3BESR 2LQRA 4I77H 1PAMA 2CLZA 2EEDA 4RMRA 1Q9OA 4LLUA 5L9DL 3CFBA 1VSCA 3B9DA 3TBSB 3HPJA 4L9LB 1VHPA 1KEML 5HYJB 3QFJE 5HYJA 3QWRD 5JPNA 5F7LB 2EDJA 4LGPB 5BW7A 1D5MA 3QI9C 2QQNH 2BERA 3LPWA 5A16B 3GHEH 3QIWB 2BDNL 4QYOB 2D0GA 3SBWA 1S9VA 4X4ZA 1HNGA 4J3WA 4P48A 4U6VH 3LEYH 3FT3B 4KI5E 2X70A 5B38A 1ZWIB 2DLFL 5GGSB 2P8PA 4BSVB 1DLHA 5DVKA 2B1AH 4LLYA 1AJ7L 4KPHH 4JFPA 3SDCA 2JIXB 3L3IB 4PJFE 2X42A 5C7XH 2D3VA 4ZUWA 1LEIB 1A7OL 2R2CA 1IGCH 4MAYD 1NFIB 4LP4A 4CN4A 3VFRB 1TZGL 3WSQL 1YMMB 3SE3A 1IM3B 2Y23A 3O4OC 5I1LB 4P3CL 4GKOA 5D9SB 1JF1B 1FO0H 1NCNA 3VD3A 2LAGB 3FTGA 1KTRL 1A64A 4KVNL 5T33L 5FB8B 1T0MA 1KCUL 3BMVA 4PGCA 1BVZA 1M6OB 4HCRL 1YMME 1RSFA 4PJ5B 3PUCA 4PJ5A 4JPIB 2AI0H 1BGXL 4OZGE 4X83A 3KYMA 3V6OC 4OZFB 2R1WB 3V4UH 3T04D 1MCSA 1WBXB 4PJHA 4P5TB 4WU5A 3EYFB 4Y4HC 5KS9B 5D70L 3RDTB 1C5CL 2YRZA 4WNQB 2YD4A 4LF3A 2GAZB 2VH5L 1U93B 35C8H 3WS3B 1BFVL 5GSRB 3NA4A 4Q74A 4F7PA 2JK5A 5IMLA 5DMKA 4FZEH 3QXVA 4LVNB 4CVXB 2ADFH 1JZ8A 3SJVB 4RAUB 3FB6B 1A1OB 1HHJB 1PX3A 4YO0A 1DUZB 1RUPL 2R56L 2XWTB 1F11B 2NX5B 4MNGB 3PG2A 2C4XA 4OLWH 2EO1A 4X7SH 2F8XC 2GFBA 1F90L 3QEGH 2CD0A 3MRIA 3IDXH 4JAMB 3WCYA 1CF8L 4YXKL 1T20B 3OKMA 2OXGA 2ATPA 3DX8B 1F3DJ 4WCYH 1MFAH 5D2NC 3QUZA 1NUNB 1J10A 1CFVH 4P2OA 2PCPB 5FUOL 4Z7WA 4XP1H 4GXVL 3I6GA 1BPVA 5CLTA 1P7KB 1N64L 1RZKL 1TJGL 3W81A 1FNSL 5CJQH 4D9RE 4M43L 1ZANH 4RFEA 1OCWH 5D1QC 3VXTB 1URLA 1NGZA 5KVEH 1GGIL 4YHLL 1HXYB 4RSVA 2H1PH 4PLJC 1UXWA 5IJKC 1HXYA 5EZOL 3OX8A 3MGOA 1TPXB 3JV6A 5KANI 2K7PA 1CICA 2QADB 3EOTL 3NZ8B 4L29A 1KPRA 3LKPB 3SPVA 4PJXE 1TNNA 3QIWD 4GMTL 3TYFB 4JM2D 3LKQA 2VTFA 4F15B 4NN5C 4RX4D 1LNUA 3DRQA 1NEZB 3EOBA 4K55A 3SKJH 1BOGB 1P7QD 5F6HJ 2R0LL 3VD7A 5DZOA 3WFHB 4S11A 4LPCA 2PYEB 2A6IB 1PKOA 1UZ8B 1D7FA 4HS3A 5KW9H 4RFNC 5IBLC 3C8KA 4KK8C 1DZBA 5FA4B 5L7XH 5DD6A 1AKJD 3RKPA 2K7QA 2I60L 1RFDL 5T5NG 3BZFB 5GSVA 1I4FB 5EPMA 1RZGA 2KH2B 1HHGB 1ZA6A 2QHRL 2YC1B 4J3XA 1AH1A 1RJLA 3HAEG 4X4MA 5HHQB 4I0PA 5ISZD 1OQOA 2ESVD 3DURA 3QQ9C 1FAIL 3BWUC 4J1UB 5JXEA 3KLAB 3F5WB 1X5AA 4K3HA 5EOTB 4IS6A 2LABA 5GRUH 4OZGA 3KR3H 4DN4L 4K3JL 1HNFA 4UDTB 4P2YA 3A6CH 1ZGLM 2AJVH 4U6XA 4JFYB 3ARFD 4GXUN 3QUXC 2CDEB 1YN7A 3F6IA 1G0DA 2Q3ZA 2ZUUA 3O2VH 3ABZA 4XH2B 5J12C 5C07B 1IKNC 4OCLC 2CGRH 5IB1B 2FGZA 2XN9D 5L9DH 4KJPC 1T0PB 4YHKH 2HMID 1UM5L 4JO1H 5HGHB 2ADJA 3V79C 3D0VA 2ADJB 1L7TL 4M7LL 2E27L 2X4NA 5HTSA 1DQJB 2Q3AA 3ESVF 4ZS7L 2APWA 5C0RH 1QSVA 3MLYH 1T7WA 2CLRB 3T0EC 5I1AA 3N1GC 3LKRA 3ULUH 3MLTA 4U0QB 1G7MA 1KPVB 1GJIA 1MHCA 3CXHJ 5FGBC 4WWKC 4MD4A 4L4TB 4MD4B 4L4TA 1IL1A 1YNLH 2DLEA 5DEZA 4OZIB 1QUNA 2YN3A 4P46C 3HNTH 2PXYA 4YLQT 4GBXB 1J8HE 5DK3A 3VRIB 4XNMA 3PHQA 3IFOA 5A1AA 3GSNH 1XCQA 5ITBH 4I18B 1A0QH 5E1AB 2QSTA 5IOPB 1EPFA 1NGQH 1V3JA 1YEIL 1RPQA 1WFNA 3PP3H 3D39A 2O5XL 1KJ2L 4N9GB 4EVNB 5DJ8B 3QIBA 5HVHB 1ACYL 3GMQA 4KJPD 2HMIC 2H8PB 3T65B 1RK1A 5CJXA 2VQTA 2BCKA 4EJ1C 1YJDC 5F1IA 1MI5B 4M7KL 1CFQA 2XWBA 3IGAA 4M6NH 5DJZA 1DUYA 3HNSH 3L5WA 4N5UA 5L2JB 4M9PA 3GMPA 15C8L 5F1OB 3T0BA 2QLVB 3L5HA 4QTHA 4EI5C 5CLWA 3QJFB 4PTTB 1X9QA 1KCUH 2OCFD 4AJ0A 5IBLD 1EUTA 2PW2B 1AY1H 4HCRH 1CU4H 5IW1B 3ULUD 4GUPB 3KPNB 4N5EC 5CBAB 1FCCA 3THML 4C57C 1JYNA 1C12B 1O7VA 2EECA 4LEOA 1A3LL 5TGBA 1CLYH 5D70H 5EZJB 5TGBB 4LCYB 1LDPH 2OR8A 4XVTL 1EMTL 4WI9A 4BELD 2BDNH 1A1NB 2R23B 2YD9A 3L1OH 4J3TA 4ZXBA 2E7MA 1H5BA 3L3KA 1BQHA 1JNLH 4LSVL 1OP5H 4PP2A 1C8PA 5TDPA 2E9BA 3UCRA 4XPGH 5HJ3B 2DWEA 4NQXA 5E9DB 4PJGA 1JVKA 1J5OH 5TE7H 3FQNA 5F7EL 4HPYL 2BOBA 4LNVA 3T2NH 1JUFB 1IBGL 1JP5A 3QFDB 4YXHH 1QQDA 4V2CB 5C7XL 1XEDA 5C2UB 1HYSC 2EDLA 4LCWD 3BIAX 5JO5A 5JO5B 4JM2F 5CJXC 3BDXA 2JCCE 3VE0A 4OZHA 1HE7A 4FP8H 4OZHB 2BZDA 3TBSA 1FO0L 1INDL 4HXAH 5T3ZD 4WFHE 4TSBL 5AWNL 1ACZA 2HVKA 5F7MC 4HKJB 5TE4H 3ZHKA 3TPUA 4OJFH 1BF2A 3AREC 5FYJE 3TYGL 4NQSA 3FQXA 4Z76A 4R3SA 5CJQL 4OD2B 4XGZA 3RVUD 4PJBB 1FSKB 4WFGE 1KIUA 1A02N 4LPUA 4GW1A 1WTGT 1R6VA 2C5DC 1PG7X 1N59B 3JV4A 5CEXA 3GKZA 3T0EA 5CWSB 1UZ6E 3D18A 1S5HA 4BA8A 1NSNH 1DBBH 1ND0B 4LRNH 3RNQB 1FBIL 3JBG7 4LAJH 3MACH 5BXFB 3LV3A 3EBAA 3ARPA 4N1CA 5I6XB 3C60C 1CZ8H 5C08E 4DQOL 2H9GB 4PJXA 1BLNA 4RQQB 1NDGA 3MV11 5L6YL 5JZ7C 2F54D 1UWGH 1H15A 1FCGA 1EH9A 4M62H 5I8KL 3V4VH 1IJ9A 3VRJA 4ODVH 4JM4H 3V9FA 4LFHD 2Y07H 2JJSC 3TJHC 4XCYB 1QNZL 4GW4A 4FQXC 1ZHKB 5I1LA 2PUQT 3CZJA 1ZHKA 3P0GB 4LASH 3EYOB 4RWYH 1ZGLP 4RRPG 1JHTA 4KKCD 2BNRE 1CIDA 2VXUH 4PY7B 3KG5A 3A67L 1QLEL 2OSLB 1RUQH 4NKDB 3F7VA 3MV7D 4Z8FL 4K3EL 4HGMA 4AH2B 4YHMH 5T5FL 5JUEL 2AEPL 4YFLI 3HZVB 1MFNA 3HE6A 3O8XA 4RDQF 5E94A 3KYMB 4X8JB 3LQZB 3RPIA 4L8BB 3RPIB 3BZEA 5DGQA 1BZQK 2G5RA 2BP3A 4LCUB 4JDZA 4JFDA 4L4VE 3FN9A 5D93B 4WDIB 4YFDB 4Q9RL 4XNXH 4X6DA 5EU7C 5GGSA 3RTQC 5GRUL 1RZFH 1G0XA 1J1OL 2LFGA 3GBLA 4HUVB 4XAWH 2VDNL 1AI1H 5J57B 3REWB 1CFSB 1DEEB 4UT9L 1R5VA 5ID1A 5DTFB 1SBSH 1F11A 1MIEL 2NX5A 4MNGA 4RNRB 5JHDE 4Q6IB 2GJ6A 2VDQH 1NANI 4PRIA 5HVGB 1MCNA 5I2IA 1LMKA 2FL5B 3GDBA 4NNXA 5AG8A 1Y18A 4NNXB 1EEQA 1P5UA 5IW3A 2NQCA 4EI5A 3BPLB 5C8JB 4FFVD 3BT2L 4J4PA 3DO3A 3O6FB 3QUXD 3D2UB 4JG0H 2AXJA 2FX8H 5HBBA 4G6KH 1ZT4B 3MO1B 4IJ3C 1PSKL 1A6WL 4OZHF 3TWCH 1XFPA 2Z35B 4Y19E 2WUCL 4OKDA 5EU5A 3UBXA 3MLVL 4KAQH 3EYFA 4PD4J 1A7PH 2VXSH 4XAKD 2D9CA 2LVEA 1HCFX 4NFBA 5J6GB 1VFAA 1R5WB 3Q5OA 2ZSVB 3DMMD 2IH3B 4YBLC 5E00B 1I9JH 1TPXC 3P2TA 4OF0A 1XGYH 5E08H 5EC2A 3DTXB 2IMMA 5C0DA 4CVXA 3G04A 4ERSH 4QO1A 3UTPD 3IU3A 5ELIA 4XVSL 1LO5A 3H8NA 3MRDB 1AR1D 2MWCA 3GEWB 2VISB 4ORGB 2E6JA 5GISL 3F7PC 1INQA 1OY3B 2X4OA 2EDRA 4ZAKC 5DJ0B 3W39A 5B8CB 3U6RB 1MRDH 5GPRA 5HDLA 1IM9D 3RX5A 4M7KH 4L1DA 4YE4L 4M6NL 1YEDA 3VXME 1V05A 2Z92B 2WBWB 2QSCL 15C8H 3X11B 5AUMB 1LP9E 3F7RA 4OCWL 2IBZY 1NGXB 2VR4A 4HH8A 2CKBA 1BAFH 3OF6D 2Q8AL 3C5ZD 1PLGL 1Q9LB 1A9EA 4XCEB 25C8H 5MEPA 1GCFA 3RVVC 1MI5E 3VXOA 3PQYE 4GLRI 1VPOH 1A7BA 1BBJA 3HS0A 4OQ1A 1MHHA 4XP9H 3OL2A 1XF3B 4MQTB 4ZO7A 4S1DD 1T03L 5CSBA 1AO7A 3ULUL 2P1YA 1ZA6B 4Q9QH 1KB9K 2R29L 2QJDA 5I75C 2Y5TB 5DZLA 1RZJC 2O5YH 1NGYA 2N7AA 3QEHB 4ZAKD 2DN7A 1KCKA 3EO0B 4TULH 5LQBH 1JZ7A 3JV6B 2RIKA 3SDXF 4F8TA 1MFBH 1J8HB 4PJ8C 1DP0A 1P6AB 3B2VH 2VIRB 4Z7UE 5C0JA 4KZEH 4ZQKA 4L4TE 3TBVA 2OMNA 1X5HA 4LLWA 2ZCKH 1DSFL 2PTTB 4IJ3B 3PWUA 2QQLH 2ADIA 1X4XA 2O61B 1CXLA 4K8RH 3ZKND 3B9AA 4PRBB 3G6JA 3QUYC 5FA4A 4N8VG 4QRUA 4QRUB 2DMCA 5HI4D 1MPAL 5L88L 4G8GB 3D69A 2J5LB 1ZHLB 3QDMB 5I15H 2P43B 3EJJX 4FNLH 2C3XA 5JW5B 4M6OL 1WCBA 3RWCA 2B20A 3EW3B 4PJEE 4ZUTB 2EXWC 4DAGL 5C0FA 4J6RL 3TIEA 2IBGA 2ICWA 3ELAT 5CGYC 3QSKB 3L1OL 4LLAA 1QBML 2X10A 3GK8H 4ODHL 1VEMA 4MJ6B 5C6PB 3DSFH 4K3DH 5C2BL 4FTVD 3OKLA 5FOBA 3IF1B 1YMMA 2XV6B 1VESA 2ILLA 3VXSB 2E9WA 1V3MA 2YPLE 4N9OB 3MJGX 2WIIA 5IFJB 3PP3K 3TM6A 3H2WA 2D7OA 2XZQL 5GS1A 4HZLB 3ARVA 4HZLA 3E6FB 4M62L 3MNZA 1JNHB 3AU1B 3TFKD 2H8PA 3T65A 5C0CD 4MXWH 1H3WM 5I1GH 2R69L 5CILH 2A83A 3ECBA 2C3HA 4HUKB 5DJZB 1KCVL 3V4PL 5IEHA 3KPSE 4HG4J 4P59H 4RCAA 2AJZA 5TDOA 2FEEL 1MQKH 2HT2C 4GRWF 2X4NB 1C7TA 4L8CB 3QXDB 3QXDA 3ILQC 1NAML 3LN4A 5EU3B 5IW1A 5L2KE 1OB1B 4EUPB 5IFHL 4EUPA 3KWWA 5J0BA 5TE4L 1N8ZB 3CLFL 5IKCB 2WWMC 1AGFB 5IFAH 4K94L 3TH4T 3WHXB 2GEEA 4OZIA 1MHEA 3C60B 1VACA 5IVZA 2Q76A 3DV6B 3KVQA 3V7MA 3WLBA 3OWEA 2Q76B 3DV6A 3DUUA 2AV7B 5TDNA 5IBUG 2FJFB 4OCNC 2JJSA 5ACLA 2FYYA 1MAJA 2VDNH 2DQTH 5EIVA 4NN6C 5DJXA 5DJCA 5FHAL 1MREH 3NACL 3LPFA 1J18A 2J8UE 1E4JA 1HWHB 1NPUA 1PDKA 4PB9H 3VGAB 4GKSB 3GMQB 1LO4H 1PZ5A 1JWUB 1JWUA 1CLCA 4WWID 4YUEL 1R3IL 3P0YH 4G42B 5DRNA 4TUOA 4YC2B 1CE6A 5J11C 3P9MB 4DEPC 2HAZA 4TNVK 1SEQH 3U7YH 1I8KB 2IANE 4UOW0 4G6KL 3S37X 4X80L 2PETA 4GS7C 3RWEA 2ZNWA 3UTTE 5I1DA 5CBAA 3CVHB 5EB9A 1Z9SA 1KT2A 5CSZB 4X8XA 1EHLH 1X7QB 3QG7H 3RI5K 4CKVX 2VXSL 3OKDB 2NY5H 1HOCA 1UEYA 4JQXC 3KYAA 4CU8A 3BKJL 3X13A 3DVFA 1OGAD 2J2ZA 3X13B 4MX7A 2H3NA 4JREC 4YDIL 4Z7VF 4OTXL 1P2CA 3DHJA 5DJAA 3ZDYF 5KS9A 2P45B 5EU4A 4NO0B 1ZLSH 4F37F 1DDHB 1K9TA 1H8OA 1ND0A 4HT1H 3MJ7A 5SX4H 3ARUA 3MX0A 2D0HA 2IPTL 4WUUD 5FA3B 2ZUTA 3VFNB 3VFNA 1EJ6A 1MCOH 3BSZL 2L4OA 4XX1G 4PY8I 3QFDA 4I0PC 1LO2L 1WFTA 2OLDA 4WI8A 4PJ7E 3RWIA 4N0RA 4JZOB 2X1QA 5ADOL 5AZ2L 1WICA 4ZDHB 4PJ5E 3BDYH 2XPGB 3QG6B 4OCWH 4LFHG 2HKFH 3TVMB 5DEGB 3VDBA 2I9TA 3KXFB 5GXBB 4P2CG 4HUMB 5GJTL 1CGVA 3OZ9H 1U2CA 3BZ4B 5HHQA 25C8L 4Q9BA 2PO6A 1FORL 5I16A 1YPZB 2WW8A 4QXWA 4HC1H 3RGHA 3GSUB 3HE6B 3QDHA 4QRRE 3W11D 2WLZA 4DK6A 1CGXA 3BO8B 2XN9A 4HJ0C 1A7NH 3RTQA 2XN9B 3LEYL 2WUBH 4Z5RA 4YZFE 3RTQB 5T1LA 4AM0A 3B2UD 5JOPD 5FCSH 1FFOA 2O5YL 5JHLH 4OI7A 1XF5A 3CSBA 2CIKA 1MCPL 5KVFH 5FUCC 3O2DA 4JFDB 5E6IC 1KB5H 4PGZA 4YC2C 3RP1A 5F7DA 3BGMA 3WYRA 4OCRL 5DD1L 4I8DA 4X4YA 4K7FA 3RIAK 3GJFA 3MGOB 2V5MA 2Z8VC 5GS2H 4HK3N 2OX5A 3CC5B 4XHJD 1OARH 5ACZB 4GS7B 2ITCA 4PLJD 2FBJL 4QT5B 5GS0L 1DQMH 1TCRB 3AB0B 3LKQB 3O6LL 4QNPE 2CLRA 1T7XA 2MMXA 4OFVA 2DLIA 4XC3H 5D9SA 4EI5D 2V2TA 1OW0C 4KVNH 4JVWA 5T33H 1G7MB 1MCIA 4I77L 1JN6B 3RWFB 3GSQB 3UTSA 5L88H 3KXFD 3MRKB 5DURB 1I1AD 3O6FA 3PP4H 1RHHB 3HI5H 1AXSA 4WI7A 1AKJA 4MA1B 3CNKA 3S36X 3V4UL 1C16B 3VG9B 2NY2D 4WTWA 3LS5L 3Q48A 5CMAA 2Z8WC 1R5IB 1RJYB 2V2XB 2W0FA 1G9NL 1HHGA 1ZA3B 35C8L 3IJSB 5E00A 5BZWB 2IH1A 5F88B 5I1EL 3DSFL 2MHAA 4M93B 1DR9A 2VDRH 3KPPB 2OTWA 5HHME 2YPVL 1FZJA 5LQBL 4NBZB 4FQHB 1UQSA 1RUPH 2UZXB 2ADGB 3QCTH 4OZGB 1LK3H 2WBJA 4D0CB 4DGIL 1RJZA 4ZUUA 4KPHL 3T2QA 3U6RA 5B8CA 4JRXE 1U3HB 5I1GL 4TSCL 3K8MA 1FZKA 2KUTA 3MJ6A 5F71A 4M6ML 4KHXH 4YXKH 1OTUD 1T20A 5CINH 5HYSG 4HKXA 2EDXA 3DX7A 5HGDB 5E8PB 5FV1L 3IS0X 1SM3H 4TNWF 5EFIA 3W82A 3TA3C 4P3CH 3C6LC 4HJGA 2NW2A 1H3UA 1S9XA 3RUGA 2NTFB 3C5JA 2BXYA 1NUFA 2I9LA 1VGKB 5DSCB 3ZO0A 2ERJB 4XP1L 5E6IB 4NNPH 4K94H 2B39A 4QRSA 4BZ2L 2XACC 4H5SB 2IH3A 4OLXH 1CD0A 5ICYA 4OF3A 5FF6B 4I0KA 3TV3H 1G9NC 1X5JA 4MYWB 4ZG1A 2MQ3A 4NPYB 4P4KB 1H8SA 1JYVA 1QEWA 3PHQB 4YEFA 3K81A 3G6AB 4TRPH 5EH1A 3H3PL 4K3DL 4WEBH 4F7MA 3RGVD 1BFOA 2BY0A 4FQLL 5C0JB 3W5NA 5DWUL 5AG9A 3L3DA 3L3JB 1MWAA 4D94A 4LP5A 4PJGE 4N9GA 2FHBA 1A8JH 4JQVA 3WBDA 3O8XC 5BJTA 2AP2A 3IB4A 1CFQB 3IGAB 5I0ZA 3QCVL 4G8GE 4Z7UF 3RGVA 1AD9A 2X4SA 3WJJC 4PJBA 3K74B 3PHOA 3MV9A 1MQKL 3MMEB 3QNXA 4ELME 5IHBA 3W9DB 4G9DA 2G9HB 4QRPA 2VLKD 3BIBX 5EN2A 2PO6D 2SEBA 4Y4HB 3F8UB 3QG7L 4WHYG 1I9IL 4Z0BH 1AO7B 2ZNXA 4DKEH 1DCLA 4ALAL 1HZHL 1I7UA 2HJLB 3U1SL 4F7CB 1F4XL 5GZNC 3SDXE 3NN8A 5EO0B 1F45A 3GMMB 2ICWB 5GGTL 2RJMA 4ONGH 4ZXBD 3WDJA 2ICWJ 2X4RB 3FRUA 1P4IH 1MVUB 5T1KA 1PYWA 1EVTC 4ZPVA 4UV7L 3WO3B 5JPMA 3S96B 3BN9C 3C08L 4JFQB 2CDEA 3SE4C 1KB5A 2EEAA 5L2KB 4HH9A 5ADOH 3BDYL 3ARXA 3PQYB 4R97B 1QR1A 3RBGA 5KTEL 4QOKB 2N7BA 4KRMB 4G7YH 4JO1L 4G8EA 4F2MA 2W0LA 4OD1L 2EYSA 4WENB 4XC1L 3NA9L 5JOEA 3AM8A 5DFVD 1A3RL 3ZKMD 3RFZC 3X3FL 3PXJA 3LOWA 4XBPB 2DQCL 3MLYL 1K6QL 2X4TB 4K7PX 1Z5LB 3J8F7 2RB8A 3LS4H 4KTDL 4JFHD 3MLTB 4KJQC 4NOBA 1A7NL 3KPTA 3EIFA 5HY9B 4U1SA 3BGFC 2DTML 3RIFF 2JCCA 3OJDB 5AAWA 2OM5A 5ENWB 1D6EB 1JTTA 3BKJH 3L9RA 4PBXA 2WBJD 3X12A 5C0BA 2FIKB 2R9HD 5IT2L 5F97E 1GOGA 4BFIA 3QUML 4HFWA 2PKDA 1QSFA 5KSVA 4PRIB 4P3DA 1IQDB 4PJGF 5IOPA 4KGLA 3VXSA 5ETUA 3TPKA 5BQ7A 5DJXB 1P6FA 2V5RA 4XP6H 1FJ1B 1KJ2H 1DL7L 1A5FL 3P4MA 1G7HB 3MUGA 2XRAL 4OLUL 3AU1A 4NKOB 2AJVL 4F8QA 4NRZA 1BMGA 1GL4B 4XMPL 1I3GL 1LO0H 2EZ0D 4ZO9A 1LO2H 4MXVF 1U91B 3RHWF 1U91A 4H25A 4IRJD 1H15B 3HTLX 1HKFA 4FTVE 4RWHA 4WHCA 3D1MC 5E2WH 4PJ9C 2VMFA 5C0EB 2HFFA 4DKFL 1EO5A 1JK8B 1OD9A 4HGWB 3PP4L 1I1YB 4PRDB 1UM5H 3ARBC 2NZ9C 4CU7A 5D4QA 4F7PB 4GBXC 3PWLB 1TQBC 1FO0B 4JRYB 2Q7YB 5C0CE 1UJ3B 4FOMA 2NY5C 5I1HH 4LHUA 1F4YL 3ULVC 3OG6B 3HZKA 2XZAH 3ZSSA 5JOFA 3IAQA 3OV6A 4X6CF 1EMTH 2QADD 5FV2A 5IJKA 4HWEL 4EOWL 5DRWA 3DI3B 5D5ME 2MJWA 4MA7L 2XXCB 3BD3A 4WV1C 2AEQH 3QQ4B 3DETC 1BFTA 4GO6B 4JZJC 1RZIB 4IDJH 3GSXB 4LSSH 3BW9B 4EXKA 4DUXA 5KVMC 3B9EA 3LPGA 1DDHA 4AMKH 3MREB 3C2SA 1FL3B 3MYJA 5IG7B 5J6HA 3DX8A 4ZO8A 3HI6H 3ZYJA 1XH3B 3H9HA 2B4CC 3H9HB 1VKXA 1WIUA 3S8WA 1I1RA 3K0WA 4XCEA 2GJ6B 4JRWA 3S34H 3D2UD 1JYXA 2NW3B 1I8KA 3X3GH 1Y18B 1JPFA 3O41A 2BSTB 3PWPE 1ZT7A 1NUGA 5DYOA 4NM4L 1JGDB 4L1HA 1IGTA 4RFEB 5A2IH 5I1DB 3HE6C 4LHQB 2AJ3B 3TPUB 2PO6B 1JNNH 4NNPL 1MJJA 1BJMA 4XBGB 4BZ2H 2AW2A 1QFHA 1M05B 2ARJQ 3F58L 4JO3H 4XPFH 4Y4KC 1WZKA 4IEFB 4JY5H 1T66D 5GRVL 2BVUA 1MRCH 4J8RA 1CDHA 1TITA 4MB3A 3HRZA 1E27A 2R4RL 4RMSA 5C08B 3TYFA 5GGQH 5CGYD 1F4HA 4XVTH 2AJSL 3EYUH 1S5HB 2WWKT 3V6ZA 2FRGP 1FBIH 2QHLA 1XF1A 3BGMB 2E3VA 5LGJB 1UZ8A 3EJYC 5KVGH 5JDSB 1P4LA 2ZUSA 4F37K 4XPGL 1NDGB 4L8DA 5C6TH 4A6YH 5DD6B 5L6YH 3CFKB 1LK3L 1WJ3A 1EGJH 4UOW1 5BV7B 3VRJB 3FB8A 1MCQA 2EZ0C 5JXAL 1IBGH 4XHJC 3Q1SL 1I8MB 2UWEA 4U6HA 4RWYL 4ZUVB 5J3HD 4MA1C 5JZ7D 3A67H 4P2QA 3MLZH 5BVPL 1IEAA 2OSLA 3ZKQD 4H1LA 2D7QA 2LTQC 5I16B 5C0FB 4FTVB 1T1WB 4IMKA 2PCPA 4EN3D 4I9WE 3C09B 1J0JA 1NLBH 1UM4H 1HZHH 4KKBD 3Q6FA 5E03A 3B5HA 3U1SH 5J1AA 1U8KB 4EBQH 3K8KA 1F4XH 1W0VA 4GKZA 2V2WA 1FFOB 3T3MF 4HAFA 1T1ZA 4DKDC 1ZLVK 3RZCB 4OLXL 3ZL4L 1ZE3C 5F89A 1CXIA 1V5JA 3SCMB 2DI7A