3G04B

Crystal structure of the tsh receptor in complex with a thyroid-stimulating autoantibody
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
215
Chain Sequence
QVQLVQSGAEVKKPGESLKISCRGSGYRFTSYWINWVRQLPGKGLEWMGRIDPTDSYTNYSPSFKGHVTVSADKSINTAYLQWSSLKASDTGMYYCARLEPGYSSTWSVNWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HUMAN THYROID STIMULATING AUTOANTIBODY M22 LIGHT CHAIN
publication title Crystal structure of the TSH receptor in complex with a thyroid-stimulating autoantibody
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 215
sequence length 221
ec nomenclature
pdb deposition date 2009-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g04B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g04B01
5L2JB 1KCSH 3V4UL 1YNTA 2Z4QA 5ITBL 4NN5C 4XHQA 3KPSE 4CJ1A 4FNLL 3HG1E 4XH2B 1YEHH 1T0NB 3TEUA 3MRMA 3WXVH 1YJDC 5FYKH 5AZ2L 5KW9H 3JSSA 4CAGA 1JWUA 2DBJA 2ADIA 5GS0D 1T66D 3STZA 4JFOB 3DWTA 1PQZA 3T0ED 4UI2A 3CK0H 2NY2C 4HGKC 1ZGLB 1FE8L 2R0ZL 2J6EL 3WNLA 3UYOD 1WFNA 3R1GH 2XN9E 5MERA 2OL3L 1QSFA 5INCA 4OM0L 1OTSD 2AV1A 3QG6A 3AB0C 5HVFB 3RWCB 1JGUH 5ISZD 1OVZA 1A1MB 5HHNA 3LQAC 2G2RB 3SDCC 4JQXA 4FFYL 3MV9D 4R0LC 1TVDA 2W1NA 2W91A 2ZCKL 4G42B 3EOAA 1ZHBA 1W0WB 4M6AA 1NUGA 1IKFH 3TNNA 2NY3C 4QLRA 3VGAC 1WT5A 4P5TC 1YPZA 4KUCF 4ODTL 3LRHA 4AQOA 3ZTJH 1AO7E 5DVLA 1BGXL 1ONQB 1EUUA 5DRWA 5E00A 1XIWC 4OGXL 4BSJA 1CBVH 4MD0A 2KL6A 1LVEA 3Q5OA 1D5ZA 1MCFA 4I2XA 3MJ9H 2VDKL 5GGSA 4FZ8H 4MHHG 2WIMA 3UBXA 3C6LA 3EO0A 1CFQB 4YGAB 3OXSA 4L8DB 5B3NA 2VLKB 3S8WA 3PWNB 3GHEH 1JGVH 4KMTL 5IM7B 3H9SD 1ZVSB 4JRXB 3O9WB 2FEEL 4ZPTA 1OAYL 5L2KE 5IROC 1BVLA 3C5ZB 3BZFA 4IJ3C 4XCNB 3ZE1F 1DBAH 4DGIL 4AM0B 4CKVX 4YXHH 1IC5H 3T77B 5JW4N 1SJXA 3P9MA 3UZVB 3T1WA 3OGCA 3V5DB 1U8KA 5IMOB 1P9MC 5I73B 4ODSH 1GZQB 5BXFA 5MENE 2A9NH 1MCBA 2MPAH 3DVFA 3ARDB 4F3FA 2BSED 4UUJA 4PJXA 3ARSA 3IJSA 4HSQA 5ACZA 2DB8A 1NGPL 3IDNB 1A6WL 2R69L 2C9AA 3EFDL 4NQDB 7FABH 1MJUL 4I0PA 4FFVC 4P2OB 1I8LA 1EVTC 5CP3H 1NH6A 4U6TA 4FHBD 2B0SH 2CKBL 2AXJA 2CRMA 3BP5A 1BFOB 4YNYB 1I3RA 4PS4L 3BGMA 3BDYH 3H2WA 4ODUA 2DMCA 4EDWL 5IF0B 4NN7B 2F54E 1F3RB 4MA7L 2R2EA 1A6PA 5EO9A 4K7PY 2NY0C 3MOAL 4ZTPL 5GGUB 4O58H 4LEOA 4GW1B 4S1DD 3W81A 5TH2B 1MFAH 3HC3H 1AHWA 5HYJA 1H8SA 5IFAH 2XRAL 1HCVA 2J8OA 1A7QH 3U48A 3MRHB 4MA3A 4ZG1A 2Z35B 4DKAA 2W65B 3MA9H 4LCYA 1YMME 4J4PC 1CLOH 3LEXB 5E9DB 1QBML 4NWTL 4D9RD 2YKLL 4JY4A 2GTZA 2GJZB 1I8IB 4G6ML 4Q58C 4PRHD 4MDJA 4GXUN 1OSZA 2B4CC 2NMSA 3T8XB 5D7JB 5AWNH 1OGAA 2GT9B 2L7JA 3KNBB 1X5LA 3MRNA 2AQ2A 4Y5XC 4ZD3L 3S3SA 4CNIB 4GG6A 2WWMC 4X7SL 2OXHA 1PYWA 5ICXB 3ARRA 5T1KB 4A6YH 5IJKC 2P5EB 4NRZB 3WIHA 4DFIA 5EO1B 3UJJH 4FQXA 5ENWB 3Q0HA 4FP8L 3FQTB 3HCVA 4IIQA 2XA3A 4K7PH 3KPRB 5GSVB 3TN0D 1AGFB 2X4NA 4HUXA 1LQSR 4GW4B 5F9JA 3ARED 4D9QD 1U8LA 1X5ZA 3O4LB 5TE7H 4J1UA 2I27N 1E4KA 4M7ZC 5DUMH 4MA1C 4QHKI 2GJ6A 2FO4B 3TH2T 3ZMRA 1OT2A 5F7FA 5F7DB 1AGCA 4J3UA 3P11L 3D69A 3GZKA 1Z9SA 4ZO9A 5D70H 1HINH 3KGRA 4ONGH 4WU5B 3UTSB 3KYKL 3OR7A 1E6JL 4G3YL 5FXCH 3QIBB 2FIKB 2BCKA 1PX3A 3UTQB 3DVNA 2XZAH 1PG7X 3QWRA 4ZO7A 3BMVA 3HA0A 2EEBA 4PLKD 4NSKA 1IM9D 5IW1A 2BY3A 4XWGH 3P4LA 2Z92A 3QIWC 1I1FA 4ODBD 3W0WB 4EI5A 3MLYL 1KULA 3H9HB 3I50L 3LPGA 4PG9A 1E6OH 1JNLL 2XKNB 4TOYL 1H8OA 3MMEB 2UVFA 5C0DB 3ZKXB 4L5FH 1HKFA 2MQ0A 1HNGA 4KRMB 3ZL4H 4JR9H 1T7ZA 4BKLB 4J3VA 5GISL 4JM4L 1ZT4B 1KBGL 3HMWL 3QXUA 5I9QC 4PJ8D 4ZXBD 1NCAL 2CRYA 3U4EA 2R29L 4WGVB 4AEHL 1TVBB 1YEDA 4BSVA 3MODH 3U0WH 1YN7A 2BRQA 2EC9T 3X3FL 4ZSOE 2GJ6E 1T0MB 1H5BB 3MRQA 5AYUH 2JE8A 3NTCH 4P46A 2IANE 1A1OB 4RGNE 5KBNC 1CTNA 3TNMA 1G6RB 1U2HA 3KXFD 5EU3A 4XNMA 4HKXA 5J1AA 5EOCJ 5DJ8B 3SY0A 5C0BA 3RNKA 1HHHA 1OP3K 4ZNCD 4LKXB 4NUGL 2E9JA 2GQHA 2HVJB 1K8IA 2J5LB 1CICD 2R1XB 3TZVD 3GJFA 2YZ1A 1Q94A 4WJ5B 5DURD 4HXAH 3RWJB 3L3OA 4ZFFA 3JV4A 3ARUA 4KDTA 1S7RB 4H1LA 3O45B 3IDIB 1MFDL 3L3GB 3V6OC 5JZ7C 1AP2A 1FNFA 5K9QI 1NC4A 4AIOA 3S5LB 3DECA 4D0BA 1YEEL 4R4FL 4Q6IC 3QAZB 1CT8A 3ESVF 3TBWA 1UQSB 3LY6A 4M1CD 4S1SH 3HUJE 4YHKL 1YNTB 1H3PH 1ZWIA 2VDRH 2Z4QB 1N4XL 4OLYH 4UTBL 1H15A 2RBLA 4HPOH 4KY1H 1KJVB 5E6YA 1HYSC 2YSSA 1MNUH 3LEYL 4N8CH 3TFKD 1MRCH 3MRMB 3IS0X 1U58A 3VFUA 1JWUB 2CR6A 2DQHL 2ADIB 4TSCH 5MEOA 3STZB 3MYZA 1PQZB 1VFOA 1IGTB 1WK0A 5F71A 5GS1C 3U30B 5MP6H 5J12B 4UAOC 3TM6A 1M6OA 5MERB 1KCSL 2MHAA 4PGZA 1QSFB 3OZ9L 4UB0H 5INCB 5DVOA 2OYPA 1JHTA 5SWSA 1ETZA 2AV1B 3QG6B 1YEHL 2BNQD 5L2KB 1IZKA 1IGCH 3WXVL 4TNVF 1FGNL 1JTOA 2IBBA 5FYKL 5KW9L 1FVEA 5HHNB 1W8NA 5A2KH 1WZ1H 2AV7A 3GMPA 3GM8A 4LVHB 3EOAB 5TE6H 2VE6A 2HJKA 5D9SA 4PJFE 3QUYA 5HHXH 5KVMC 3CK0L 3TNNB 3T08A 5MENB 3C6SA 3RL2A 1UKSA 1YPZB 1JUFA 1G6VK 4RNRA 3MCLH 4W70A 1H3UA 4NQCE 2F5AH 1D9KA 3BMWA 1CGYA 2A74A 2KZWA 4PPTA 5E00B 3WFHA 1Y18A 5GXBB 1JGUL 4YE4H 4MD0B 5DWUL 3NCJH 3B3IB 1R3KB 4CU8A 5GGSB 4XAKE 3LN5A 1OAZH 4AQ1B 4WWKA 1PGRB 5ANMA 3UBXB 3C6LB 3EO0B 5HGDB 3C8HA 2FEDC 5EC2A 3OXSB 1OL0A 3LIZH 1ZXQA 3EJYD 4CDHA 3QBTB 1I7ZA 4ZPTB 2EDHA 2MKLC 3WYRA 3BRFA 4WW2F 3BZFB 2V5SA 2XA8H 4OLUL 4WI9A 3SJVD 3NZHL 2R39A 4GRWH 5EBWA 3P9MB 3TF7C 4QRQB 5HVWA 4U1HB 3IDUA 3ZSTA 4ONFH 1U8KB 4R8WH 4FZ8L 4FQJH 3EO1B 3VXUE 5FHBL 5E2WL 5BXFB 1YMMB 2DYPA 3S4SB 1X5HA 4JFDD 5F9WB 4GG8A 5IT2H 4D0DA 1PY4A 1B0WA 2IPUG 4UUJB 3MOBH 1SQ2N 3FT2A 4PJXB 3B5HA 3B9DA 1JGVL 3IJSB 1A4KA 5FDWA 4EKXA 5ACZB 4XPGL 3MRRB 3ZT7A 5DT1L 1XT5A 1DBAL 4XP9H 1JPTH 4YXHL 1IC5L 2ERJC 2AJVH 1ZSDA 1N64H 2P47B 2QTEA 4W81A 5JR1L 3BP5B 5ETUB 4ODSL 2QQNH 1I3RB 5F7HA 2F8XC 3BGMB 3EIFA 4ODUB 3WIHH 4Z18A 5ESAA 5IV2B 3SBWC 3T0WA 2R2EB 3U7WH 5INDB 4M8QA 5EO9B 1WAAE 2DM7A 2NY1D 5ITFA 1NAMH 3RL1A 4LEOB 1SY6H 3IFOA 2LE9A 3QQ4A 5D7KD 4Q9RH 7FABL 1AHWB 5HYJB 4LPYA 2PXYD 4RFEB 5EU5A 2QHRH 3U7YH 4ZAKC 4DK3A 2B0SL 4D3CH 1E4XL 4LCYB 5DTFB 4UOW0 1F3DJ 4K8RD 4PGDA 3S97C 1MY7A 3BDYL 4L3EE 1IGIH 4DK6A 5A2FA 1MCSA 2DDQH 3DOSA 4JY4B 2ZP0T 4MDJB 1IAII 1X5JA 1OSZB 5HHQA 2E3VA 1UCBH 3C08H 4N0YL 2KUTA 1OGAB 1R5WA 3MOQA 4R90L 3ULVD 1T83C 5HI5D 3MRNB 1MFAL 4GG6B 3HC3L 2VB5A 5JW5B 2GY5A 1EGJA 2GIYA 5IFAL 3CMOH 5F3HA 3WIIL 3O41A 1OM3H 1Q9KA 5I15L 3HFMH 4KJQD 4D8PA 1CLOL 2BRRH 4NZUH 3HCVB 4MJ2A 5FYJL 3NVQA 3KAAA 4DZ8A 2DJSA 2X4NB 4HUXB 5C0CE 5F9JB 3HI1A 3RIAF 1NCWH 3DGGA 3BJLA 5AWNL 4J1UB 3ZE1E 4HAFA 3ILQD 2GJ6B 4URTB 4KJWD 3P4MA 2N7BA 1GAFL 4LSRH 5DXWA 5F6IC 1AGCB 1MFBH 3QO0A 2EC8A 3WFBH 3TWCH 3D69B 1V7MH 4A6YL 1GCFA 4KV5F 4HGWA 5JPNA 3OR7B 4U1MA 2BCKB 3QDJE 2YEZB 2HLFD 5FV2A 1KLFA 1L6XA 3DVNB 4K7PL 4AK1A 3MLZH 4NQEA 3BE1L 4NSKB 2EDFA 1DQQA 4UIKH 5IW1B 5GZND 3C60D 2N4IA 2Z92B 5TE7L 4EI5B 4LCWA 2YUVA 5EOQH 2WNGA 5ABDE 3GJFH 2BJML 1RI8A 3MNWA 4PG9B 3ULUH 4RAUA 5D70L 3WS3A 1HINL 4H1LH 4MSWA 4YHYC 3UP1A 1IRAY 1XR9A 3OJ2C 4OLVH 4LAQH 1J0ZA 2JF1A 3T2QA 2RHEA 4U4BA 1RMFH 3P30H 3L5HA 4MB4A 3U4EB 4XZUA 1RAMA 1YN7B 4KZDH 4DQOH 5KVEH 4W6WB 3QUKA 3EDEA 3MRQB 3TC9A 3FQWA 5MHSE 4U1SB 5F1SA 2OLDA 1RJZA 5JXED 3D9AH 3HAEB 4PJAF 3TNMB 4L5FL 5EU3B 4XNMB 3MFFA 5J1AB 3MLRH 3SY0B 4JR9L 5C0BB 2JJTA 3RNKB 3NFNA 4X6DE 1HHHB 4GSDH 3QEQD 1A7OL 2Z8SA 2R0WH 3NAAH 4K2UH 1P7HL 1K8IB 1U0QA 1C7TA 5J3HC 3U0WL 2N56A 4V1DD 5I1CH 3GJFB 5SWZD 1NMBH 1Q94B 4PY7A 4OD3H 3L3OB 1DUZA 1KTRL 4ZFFB 3JV4B 4PJ9B 5AYUL 4CVWA 4NQSA 1NFIA 1UG9A 2GFBA 1LMKA 4I0CC 1AP2B 4I3SH 1NC4B 1V3LA 2VXSH 4D0BB 2VZTA 5IFJA 1LWRA 1RUAH 1LDSA 2UZIH 1F13A 5GHWH 1CT8B 2OXGA 3VFTA 5KAQG 3TBWB 3WNKA 3HI6H 2Y1VA 5D4QA 5I71C 4Z76A 1IM3B 3QUXC 4F9PC 3HZVA 1ZWIB 2VYRE 4LP4A 2LU4A 3UO1H 4NQCB 1H15B 4N9OB 3STBA 2FJGA 2VAAB 1K6QL 2YSSB 5IFHH 4GJTB 4IRZL 3BUYA 4N0FA 1CGSH 1U58B 5IQ9A 5CFHA 5DEZA 3P9LB 3WNNA 4FQLH 2ICEB 2AEQL 5MEOB 4LLWB 2EYRA 1QSEE 2NR6C 3QPXL 1LD9A 1FLRH 4AG4H 3SKMA 1MCDA 2QBWA 3G6DH 4OFYD 2XACC 1M6OB 2PR4L 4OKVA 3BISA 3VD3A 2VDRL 1H3PL 1I9IH 4OLYL 1WVZA 1QQDB 4Z7UF 5D2NE 1JHTB 3KYAA 3ARFC 5SWSB 1ETZB 2DLFL 4KY1L 1TZHA 2OL3B 4G6KL 4HS8L 1EFXD 1FVEB 3QNXA 3UTTD 2AV7B 3T0EA 3GMPB 4YBHA 1JN6A 4TSCL 3ZE0E 3WLWD 2X1XR 3HPLB 2VE6B 2HJKB 5D9SB 3NCMA 3QUYB 4XNQA 4PYHA 1WCQA 5GZOD 5MP6L 3C6SB 2DQDL 5DJXA 4PJGF 3VWKD 1Q72L 2X4PA 1JUFB 3JZ7A 3O3DB 4RNRB 3T09A 4ZDHA 4DN4H 3SGJA 2YPVH 1D9KB 4UB0L 3NBNA 1KUMA 5F7YC 4OZGA 1AD0A 5ISZA 2A74B 4WI2A 4R2GD 3WFHB 4JQIH 1Y18B 4M00A 3MV9A 3BKCH 4G8IA 4M1DH 4JANA 1NDMA 1WZ1L 2Y36H 2H1PH 3DVGB 4QRPD 1IL1B 5C07D 5D72H 5TE6L 5HHXL 4WWKB 5ANMB 4YFEA 2OM5A 5FCUL 4C56E 2O93L 3BGAA 3N50A 2BX5A 3MCLL 4Y19E 4HAGA 5DLMH 3DURA 2XY1A 5DJ6A 3GIVA 1G7HA 1G9MC 1DFBH 4ZYKA 3QI9D 3NN8A 4LVNC 3O9WC 3QG7H 1PKOA 5DD6A 2QV2A 3CSGA 5KTEH 4F58H 4L4TD 1UH2A 4UILL 4YE4L 2Q8BH 4XX1G 4JPWH 4HUUA 5EBWB 2DLHA 3DO3A 1NSNH 3B9KD 3HLAB 3HS0A 5FYKE 1OWWA 4FQCL 4F80A 1OAZL 1FC2D 2HLAA 3SDAD 2DYPB 1B4JL 2A77H 4GG8B 4D0DB 1KIQA 3H9SA 3ARDC 1BAFL 1Y6NR 3FT2B 3LIZL 1A4KB 3MGTB 5FDWB 5EB9A 4KVNH 5HHMD 4DVBA 1N26A 3AM8A 2XA8L 2J8HA 3O0RL 1MHEA 2R0KH 2ATKA 3EHBD 3OXRA 1ZSDB 5DUBA 1VACA 4LPCA 3ARYA 4NC2B 1EGJH 4FQJL 4H8WC 2CKBB 3LSOA 4HG4K 1F97A 5ESAB 3CX5K 2A6KA 5IT2L 2FGZA 4NN7C 1IT9H 3E3QC 5C08E 3NIFF 4P4KD 1U3YA 4M8QB 5FV1L 4KRPB 5ITFB 3RL1B 1MWAA 3IFOB 5B3JF 4XP9L 1C8PA 3WE6A 4C57C 5EU5B 1X7QA 1UXSB 3QHTC 1DN2A 2AJVL 1QBLH 1N64L 4OTXL 3QDGD 1EAJA 1B0RA 2QQNL 1PEZA 4PP2A 5I1GH 4PGDB 4GLRH 3V7AE 4YXKL 1RURH 4M6ML 3QDJB 5IHZA 4P2QD 2VOTA 4TNWK 4G9FE 2WK2A 5HHQB 1XGRA 3WD5H 1CD9B 4J3XA 1NAML 2OTPA 2ZJSL 1R5WB 5D7JC 5FYLD 4KHTL 2VDMH 1SY6L 2VRAA 5HHVH 4BFIA 3EYUH 5LG1A 3NGBB 5CGYC 4DFHA 2Q8AL 5TDNA 1Q9KB 4D3CL 1F2XK 4D8PB 4R96A 5CD3A 1HK6A 3VFVA 1CYGA 3AMKA 4QNPF 1DLFL 2HH0H 3QJFA 3F5WA 4X8JA 3U46A 4PRHA 1OB1A 2CDEA 4LGSB 2DDQL 4N5EC 5K9OA 1EH9A 3HI1B 5I1IH 3DGGB 5DC4B 3N85H 1UCBL 3K4ZA 4UTAH 2A1WH 3GJFK 3EYFA 2GK2A 5SX4H 3UYPA 4JG0H 4KXZH 2EKJA 3P4MB 3OJVC 3CSPA 3Q48A 3QO0B 3CMOL 3L3IA 5KVFH 1OM3L 1ACZA 4HGWB 3MLVL 3WBDA 1K4CA 4M7JH 3HFML 5JPNB 4U33A 1G7QA 4ETQB 3DX8A 4ZUVA 1YYLL 3THMH 5H2BB 5TF1L 2BRRL 3GGWA 3QIBC 3TN0A 1L7IH 3DIFA 4F2MA 4OCWL 3NFSH 3AREA 4NQEB 3REWA 2NTFA 4EJ1C 2EYTA 1KCUH 1OW0A 5JW4M 1DQQB 5LQBH 1NCWL 5CUSH 4M1GH 2F5BH 3KPQA 3MUZ1 2UUDH 4GW5A 4XBPA 1MFBL 4PJIA 3MNWB 5GGTL 3WFBL 3TWCL 3WNOA 1V7ML 2OMBA 4RAUB 3WS3B 3TPKA 3DHJA 4MSWB 4EI6A 1VEOA 3ZKXC 5CZXC 2DJ4A 5D7IF 1XR9B 5DQJA 4AZ8A 1JZ8A 1VGKA 1IM9A 4N68A 3MLZL 3WJLA 3H42H 1A4JA 4N1HB 3P40A 5FYJE 3LD8B 4N8VA 1ZVYA 4UIKL 5CAYB 4JQVC 4ZUWA 5J6GA 3QUKB 1H5BC 3IS1X 5EOQL 1U92A 3FQWB 1KIPA 4LPWA 1RJZB 5I16A 4QRRE 3RWHA 2ZUXA 3DYMA 4S2SB 2C1OA 5FKAA 4PJDF 3MFFB 2AAVA 3KLHC 2Q20A 3CLEH 2Y5TA 4OLVL 2FHCA 1N59A 4LAQL 1N3NA 1HXMB 4PJ8A 4ZXBA 3OV6A 4PRPE 1NPUA 3MUY1 1QSEB 1J0HA 4XBEL 3LDBB 1RMFL 3P30L 4HJJH 2J5LC 4KZDL 4DQOL 1C08B 4ZODA 5KVEL 1RZ8A 1KJ2A 2DOCA 1MCLA 1DUZB 5HDOA 3CNKA 1MUJA 4NQSB 2GFBB 5D1QC 1A21A 3KXFA 4FQPA 4ENEC 2HYMA 3KPOA 3LS4L 4M7LT 4OCRH 4CW1A 1NGWB 3T1FA 3S9DB 4N0UE 5D71H 3JWDH 4XPFL 5IFJB 4ISVB 2ENYA 4DN3H 1MCOH 4X9HA 3VFPA 1F11A 3TZVA 1CICA 1KN2H 3VFTB 2R0WL 3NAAL 4K2UL 3GBMH 3F7RA 5I1CL 1AE6H 1NMBL 3HZVB 2Z93A 4HT1H 4OD3L 3GJEA 2BVOA 5E08H 2FJGB 4AY0A 2J12B 2P24B 2J8UE 2Y23A 4FTVD 1TZGH 2PCPB 4KV5E 5T1MB 2WWKT 3CDGA 4N0FB 4I3SL 1EK3A 1NUFA 5IQ9B 2VXSL 3GKZA 1WIPA 3VH8G 4JFYA 5DZOA 3QUZD 3EYVA 2PTVA 1JPGA 1RUAL 1JPST 5CIPA 2UZIL 3E8UH 1LD9B 3SKMB 3U30C 1OHQA 2PN5A 2XICA 3A67H 3MV8D 3HI6L 5H37G 1F00I 4OKVB 5EUKB 3RVUD 4MXWH 3RAJH 5BRZD 4Y5YA 5T3ZH 1L4IA 1DBBH 4BA8A 4P3CH 1HHIA 1EO8H 1TZHB 5IFHL 5FOJA 4HEME 2HT3D 4JQXC 5I1JH 4FQLL 1JN6B 2YMXH 1WV7T 4LVHC 4OIBA 4PD4K 4XNQB 2NTSP 4ZS7H 1FLRL 4AG4L 2VMFA 3G6DL 4FZEL 4F57H 5DJXB 2X4PB 3ET9F 1K8DA 1WT5C 1CK0H 4ZDHB 2PYEE 3P0YL 2KKQA 2BNQA 4OZGB 1NCCL 3HNTH 3LQMA 1AD0B 4XTRD 1QD0A 5ISZB 1S7UA 3ULSA 3ZHLA 3BJ91 3MCG1 2DLTA 3RY6A 4PJAE 3MV9B 4G8IB 1INDL 4JANB 4EUPH 2V7HA 1NDMB 5JOEA 4E5XA 5KANG 3KPMA 2EDLA 5F96H 3VD4A 1FFRA 3IDYB 5LXGH 5HVGB 3C6LC 1YN6B 5FUCE 4PJCF 4J23A 1EO7A 1YEGH 1ZVHA 2H3NB 1U3JA 4FFWC 1QACA 3DURB 1NANH 4DN4L 1EFQA 2YPVL 4QYOA 5DJ6B 1G7HB 3GIVB 4ZYKB 3RFZC 3NN8B 1ED3B 4C4KO 5DD6B 4LARL 4JQIL 1X4YA 1MWAH 4M1DL 3REVA 1OTUD 4HUUB 2OP4H 2Y36L 3VXMD 3HS0B 4WFGE 3DETC 1H0DA 2CR3A 4LGRB 1T1WA 2NNAA 5FGCE 5L8KB 2HLAB 1JHLL 4YC2C 2XYCA 5DS8A 5MEQA 3OB0H 1HH6A 4CVZB 1WC7A 5F9WC 1LO2H 1KIQB 3H9SB 3TA3D 3Q1SH 1AR1C 4YH6A 3O3UN 1X6LA 2NY4D 1Z0NA 4HULB 1DFBL 3SJVA 1QPPA 3BIKA 5CEXA 4DVBB 1W72H 1UADC 5KTEL 4CN6A 4PGEA 4KZEH 2Q8BL 4I0PC 1RJLA 1I8LC 1MHEB 2ATKB 5SWQA 3OXRB 1NSNL 3UZQA 1DANT 4JFDA 4ONOA 3EFFB 4N1EA 3SDXF 3H9ZA 3Q6GH 3LSOB 1MJ8L 3QA3A 3UAJD 4IM8A 4L8BB 2A6KB 4YHLH 3ZKNC 4Z7UE 2NW2A 4G6FD 5EBMA 2VZOA 2NXZD 4HG4J 1M71A 3CX5J 4WW2B 4QOKE 3EDKA 1YZZA 4L29A 3BKYH 3WE6B 1AHWC 1GXEA 2W92A 4HBCH 3R8BB 2P8PA 2NY5C 3EAKA 2QADC 7CGTA 5FHAH 4P23D 4PP2B 4NUJA 4I3RH 1YEIL 2NX5D 4PJGE 2B1AH 1VADA 3WFCH 2EDXA 3RY4A 3S88H 4JO2H 1IT9L 1GGBH 2A83A 3EO9H 1XGRB 3VRJA 2DAVA 2ICES 5EU7E 4MJID 2PXYA 3MLSH 5DVKA 3B5TA 5EH1A 1RHHA 1V3KA 4Y4FD 3TBTA 1J05A 1QBLL 4JFDE 3G5XA 2UY7A 4GRWE 4R96B 3MRDA 5CD3B 3VFVB 4FQXC 1J9CT 1HWHB 3F5WB 1RURL 4X8JB 4PRHB 4WEBH 2CDEB 3U46B 4IIQC 1Z9LA 2JJWA 4PV9A 2YA0A 4NRXA 3CVHA 1MFEL 4NCDA 3CD4A 1OD7A 2PO6D 2ESVE 3ETBF 4OF0A 3WD5L 2UUDK 1JWSA 1JTPA 3EYFB 1E4KC 2VDML 3TV3H 5HHVL 4GAYA 5F7WC 1L0YA 3MV7D 4X4XA 1N0XH 3MBXH 3VCLA 3L3IB 2ZOKA 3IRZA 4LP5A 2H9GA 2Z8WC 3DX8B 4ZUVB 5F6HJ 1Z0MA 4LU5H 3GGWB 2YD6A 4LLUA 1UT9A 4NO5A 4P9HH 2HH0L 1WTLA 2D31A 3IXAA 3DIFB 1EHAA 4P48A 3TN0B 4F2MB 5BZWB 2G75A 3AREB 5FUOH 2DQUH 5C0IA 2NTFB 4Q9QH 2EYTB 3CU7A 5B21A 2V9QA 5JOFA 5CILH 4UTAL 3AS1A 1X4ZA 2Z91A 4EI5C 5DD0H 1P53A 5DSCA 2XTJC 3OPZH 5I30H 4GW5B 4XBPB 2ENSA 4MXQD 1KJ2H 2V17H 5KVFL 3CC5A 5IB5A 3AS0A 4M7JL 4EI6B 2Z31D 4NNXA 1HQRA 1XGQA 5DQJB 5J57B 5JXAH 3NFSL 4X7EC 1IM9B 3C87A 1XF5A 3NIFE 3C60A 3W5MA 3BD3A 1A4JB 1KCUL 4K3JH 2C4XA 2F8OA 5F21B 5LQBL 3SE3A 5J6GB 5CUSL 4ZUWB 4M1GL 4F7EA 4PLJC 5IBTH 5B3JE 2VN7A 4ZOEA 2Y6SC 2F5BL 1BLNB 3H8NA 4F7TA 1N6UA 1U92B 1KIPB 4W6YB 1KCLA 2VABB 3BX7C 5E99H 5I16B 1PVHA 4P46C 3M17A 3RWHB 4TTGA 5HD8C 2C1OB 3MJGX 1J8KA 5FKAB 5EWIH 3D25A 2IPKA 4U1KA 1MLCA 1N59B 1N3NB 4PJ8B 4ZXBB 4NQVB 1TQBB 1JYVA 1JZ7A 2EE6A 2F19L 1QRNE 4KROD 1H3TA 4WUKH 3I6GA 4JJ5A 1NL0L 2AABH 5JXEA 4XNZB 5GGQH 3S37H 2HT2C 3ULUC 3B6SA 1MUJB 5T3XL 4KDTC 3MNZA 1CXKA 4GRMA 4L8CA 3WLBA 3KXFB 4U3CA 4WTZA 3TJEL 2IG2H 3KPOB 4CW1B 3T1FB 3DYOA 4UT6H 4QNPE 3X13A 1XGUA 3QEQA 2VZUA 4HWEH 1FNGA 3VFPB 1PJ9A 1YC8A 5T5NG 1F11B 3WHE0 3TZVB 1CICB 4V1DA 2OJEA 1UM5H 4NKQB 4KQ4H 5SWZA 3FO2A 4HJJL 3SKNA 1YY9D 3TT1H 4TSAH 4G80A 1GGUA 1WWBX 2Z93B 2FX7H 1IAIM 4QGYA 4LSUL 2YD4A 3CDGB 1INQA 4OCRL 4PJDA 4JFYB 4OJFL 5KVGH 1CLYL 3JWDL 4U6VL 3K4DA 1JPGB 4ZS6C 1MCOL 4DN3L 2EO9A 5CIPB 3KLAA 4NKOA 1KN2L 3BVNA 1NGZA 4QXGH 5KAQF 2PYFA 4HF5H 1QLEH 4UMGA 4JFFE 5A2LH 1CIDA 4Y5YB 1I3UA 1Z6JT 1HHIB 5GRUH 3R06A 4KK5C 5E08L 4LIQH 3QFJE 3TP4A 1AC6A 1TZGL 4LPXA 4U6YA 4PBWD 4A2LA 4MNGE 5F72S 1L9NA 4OLXH 5D7IE 2NZIA 1U8JA 3MLUH 5ADPH 1F3JA 2NXYB 4OFYA 3E8UL 3QUYC 5CP7A 1BQHA 4Y1AE 2XG5A 4YEFA 4MNQD 3A67L 1K8DB 5C0GA 5TFSH 5IB1A 5GJSH 3MLWL 3RAJL 4HJ0C 5T3ZL 4PD4J 2XWBA 1DBBL 2BNQB 1D9KC 3TJHD 4G7YH 1S7UB 1EFXA 3ULSB 2VZSA 4B5EA 2FEEI 3UTTA 4XXCA 4JPVH 2FGWH 1UKQA 2V7HB 2H41A 5I1JL 5JNYA 1CF8H 4Q74A 5FCSH 3OB0K 4HKZA 4E5XB 4XC3H 4OZFA 1XCQA 3KPMB 3VWKA 2HJFA 4ZS7L 4WWKC 1GRWA 2ICWI 3GMQA 4F57L 5KZCB 4UT9L 3WO3B 4QYOB 5KG9B 4E41D 1WZKA 5KSAD 1D5BA 3SN6N 3IU4L 1BBDH 4QRPA 3REVB 1JMXA 5C07A 3O8XD 1X4XA 4JFHD 1S3KH 4GUPA 1T1WB 2NNAB 5TF0A 5F96L 1EAPB 4P9MH 4LSPL 2VISA 3GUTA 3O6MH 1XF2B 5DS8B 2ARWA 2X41A 5EZIH 3D2UD 5MEQB 1HH6B 2DM2A 2E5EA 5A2IH 4Y8DC 5GPRA 1NCDH 3ARVA 1CD0A 1YEGL 2XWTA 3QI9A 3C2AL 3IXTB 3SJVB 2WP3O 3BIKB 4JPIA 4KKLD 4L4TA 5DMKA 3T3MF 5CEXB 2HAZA 4O00A 3QQ9D 1Q0XH 3DRQA 3BYYA 2R4RL 3B9KA 4PGEB 1DBJH 4GRLB 1RJLB 2OP4L 5SWQB 3L5XL 4UQ3A 1VKXA 2VL4A 3SDAA 1KEGH 3Q2CA 5IB4B 4JFDB 2EDDA 5HI3D 2EIEA 3PP3K 3MNVA 3QA3B 1NLBH 1KCKA 4K8RH 1A3RL 4NN6B 4LOUD 1JF5A 1LO2L 3V2AR 3Q1SL 5HXMA 1FIGH 2NW2B 1NLDH 4V2CB 1MI5E 1FZJB 3DTXB 3MJ7A 1J8HE 3KVQA 3OG6B 3H7BA 4KRPC 1M71B 1U42A 4ZUTA 5E6ZA 2K7PA 1W72L 3ULVH 3SOBH 5JHDE 3UPCA 4L29B 1MIEH 1T6WA 2Z9TA 4KZEL 5DVMA 5JA9A 4KKCD 4P49A 4F8QA 2P8PB 5IG7A 2VLMD 5I66A 3TBYA 4U31A 4PUBH 4H0GA 4F37K 5FYJU 4OV6F 3TO2B 3Q6GL 2AJYH 3WMSA 4POZC 1VADB 4P4KA 1QFWH 2NY1B 5F44A 3BZEA 2A83B 3EGSA 3VRJB 4GMTH 2PXYB 5BV7B 2E8ZA 1KTDA 1GC1H 4EQ2A 3V5HA 3BKYL 1RHHB 5DA4A 3NGBC 4X98A 1J05B 3QDGA 4HBCL 3I75A 3V0VA 3G5XB 4M7LH 3MRDB 2EKSA 1N6VA 4I3RL 2YPKA 4X6CF 3DNKA 4P2QA 5EZOL 3VE0A 2B1AL 4HIHA 4P99A 4PJCE 1CDIA 2Y7QA 1FGVH 4PV9B 4M8VA 4NRXB 3WFCL 3CVHB 3S88L 2I07A 2HKHH 3DYPA 4JO2L 1MH5A 1GGBL 3H6JA 2O5YH 3EO9L 4X9FA 4YHMH 4NQXA 1JWSB 1LE9B 2BVTA 4JO3H 3MLSL 1CFSA 1OAUH 4X4XB 1C12B 3VCLB 4R4NC 1DBMH 4NRYA 3JTSA 4D2NA 2ZOKB 4ZUSB 4TTDC 1CZ8H 4WFHE 3LPWA 2E9WA 3HE6B 4LLUB 5DJZA 3LB6C 2D31B 4F7CA 1HSAA 4WEBL 4BZ2H 5JW3H 2G75B 1JPSH 1FNAA 1ZS8A 4XP1H 5F7NC 5JOFB 3QCVH 3I2CH 5LAXA 1CGUA 3QT2A 3C5ZD 2E7CA 4FQIH 3RKPA 2Z91B 3TV3L 1TETH 1OGTA 4PY8J 4YUEL 5DSCB 3NOIA 1YQVL 3CAFA 3L5IA 5E4EB 2EXYC 4OCXH 3MBXL 5FFLA 5C0JA 3CC5B 5IB5B 3RY5A 3LPFA 3SDXE 2RCSH 4NNXB 1HQRB 4N0CD 4LU5L 1XGQB 3O3BA 4FXLA 3C9NA 3OJMB 5BJTB 2BVPA 5CWSA 2DQUL 5FUOL 1VSCA 1XF5B 3C60B 4TVPD 5CILL 3LD8C 4F7EB 4P2OD 3NA9H 3BH8A 5DD0L 3MA7A 4F7TB 3DXAD 4P0DA 3OPZL 5I30L 3P73A 1PSKL 3RWIA 3M17B 1FAKT 4WVRA 1XCTA 1HHGA 3D25B 4HK0A 2IPKB 2NW3A 2GSIA 4Z7WA 4U1KB 1MLCB 2JJTC 2XPGA 4Y4KB 1KCVH 3PWPD 1D3CA 1MHPH 1X5XA 2X4QA 4K3JL 3LDBC 4JO1L 4JVWA 3A6BH 3F7VA 3B43A 3ARBD 5CSBA 4JJ5B 4S1RH 5B4MD 2AXGA 4JFFB 1NFDE 4L9LA 5HGGS 3MNZB 3QNYB 3FFCD 2FNBA 4R26H 4L8CB 3WLBB 2OR7A 5EOTA 1QFUL 3FB5A 4XNUH 4JZJA 4TUOA 1FL6A 2J7LA 1XGUB 4N9GA 5D7IB 2DBLH 1I9RH 4P5KA 1FNGB 1NJ9A 1MJ7H 2D7PA 4KTEH 3S3JA 4JRYE 3QUMA 2V7NB 2BY2A 2VQUA 2OJEB 4U1GB 4V1DB 5SWZB 3T0VA 3FO2B 3SKNB 1U36A 4WUKL 4HW6A 1ZHLA 4G80B 2PKDA 5HPMA 5GGQL 3WKNA 1H9VA 5T1KD 3GI9L 4IOFD 2P5ED 4HS6A 4GKNB 1SEQH 1INQB 5AD0A 2EDJA 5EDXA 2GITA 4PJDB 1A8JH 4JPKH 1DQTA 5KOVC 3KPRD 4OQTH 5E03A 2BSTA 3IDJB 4Z77A 3KLAB 4NKOB 3GSRA 1NGZB 1UM5L 3O4LD 2JJUA 2PYFB 4KQ4L 4OZFH 5EUOF 3GSNA 4KI5D 5J1SC 4M43L 3CMGA 3TT1L 4TSAL 1MCPH 2FX7L 4FTVA 1NCUA 2H26A 1KV3A 4R3SA 1R3JB 1GHFH 4Y16D 2FATH 3QUZA 5T3XE 5BO1L 2DMBA 2CIKA 5GS0C 1T66C 4JFQA 4NNPL 4XVJH 1MFCH 3A6CL 2YN5A 5KVGL 1U8JB 3T0EC 1MEXL 3E2HB 2YA2A 3GHBH 3HZKA 1F3JB 1CFTB 3B5GA 3MV8A 5D6DA 3WFDL 5ILTH 1EX0A 3WHXB 5BRZA 2XZZA 4HF5L 3PWUA 4KWUA 5IB1B 1M7DA 1EEYA 4OLEA 1QLEL 3SPVA 5IMMA 1OTSC 2XWBB 3SGJC 1P4IH 2IALA 3PHOB 5GRUL 5H35A 3WDIA 4LIQL 1EFXB 2P45B 4D0CA 4X83A 3UTTB 2IGFH 1SYVA 1J5OH 1EHXA 3RU8H 4OLXL 5JIIA 5JNYB 2OTWA 3MLUL 4HKZB 1DR9A 2X40A 5ADPL 1XCQB 3ALPA 5I8CA 3E6HA 1WTGT 3VWKB 1UB5A 4EXPX 2HJFB 2VR9A 2CD0A 5GJTH 3CVIH 3GMQB 3IDYC 3O6FD 1QG3A 2X10A 5CCKH 3HB3D 5GJSL 3KPSD 5I0ZA 3VGDA 4K3HA 2H32A 3VFGH 3GMMA 4R2GB 3HG1D 2KQMA 2CGRH 5DFVD 4G7YL 1D5BB 1J8HB 3KYOB 1Z9OA 3HC4L 5IHBA 4QRPB 2FGWL 4LDOB 4RGOH 3WXWH 4PTUA 3E6FA 5C07B 3GBLA 3BQUD 3OQ3B 3OAYH 4YPGA 4XC3L 1M05A 2VISB 1RZ7L 3LKQA 3TCLA 4LEXH 2ZZUT 3N9GL 2XN9D 3S36H 3OKOA 3BP7B 2XWTB 3QI9B 4NGHH 3RI5K 4GBXD 1FC1A 1YJDH 5T3ZE 1NKRA 3ZLQC 1UKTA 4M5YH 3DRQB 4NBXB 4P3DA 3AM8C 3VXMA 3B9KB 1BBDL 3C09B 4M9PA 4UQ3B 1VKXB 3SDAB 3MROA 1S3KL 4MLSA 1MVFA 3BD4A 1E4XI 4P9ML 3VJ6A 5EZIL 3TA3A 3MNVB 2VQ1B 2ZOLA 1GGIH 3L7EA 1AO7D 2KDGA 5F1KC 3MJ7B 1TNNA 3H7BB 4X6EA 1DN0A 2ITCA 3JV5A 5FYLH 3LQAH 1Q0XL 4WCYH 4JB9H 1YYMH 1DBJL 3RIFF 2KH2B 2XKSA 3WEXA 5IG7B 1U8QB 3BN9D 5I66B 3TBYB 3BP4A 2R2CA 2VXVH 1BVKA 1FPTH 1BJ1H 2FWOA 3TYFA 1RK0B 4FXGA 1NLBL 3ARXA 4P4KB 5T33H 2WZPD 5FK9B 2Q7NA 3R8QA 3GNML 3VXPA 5C92A 3EGSB 1NLDL 4S1DC 5L2KD 1CDBA 4HUWA 1UA6H 3T4YA 2IBZX 1Q8MA 2NYYD 1KTDB 4UNUA 3V5HB 3SOBL 2AGJH 2MQ3A 1MIEL 1IAKA 1OY3B 4X98B 5GGRY 3QDGB 2HP4A 4MJ6A 3I75B 4P23A 4FRWA 3V0VB 1VB9A 2NX5A 1UJ3A 4PUBL 4Q0XH 1LP9E 5MEND 2EKSB 3WN5A 2L7UA 1X5YA 3TCXA 1OARH 2RFXA 3I3BA 2HVKA 3BN3B 1MJJA 4P2QB 3VE0B 2DF3A 5A1AA 4HIHB 5L8LB 1RUQH 2Y7QB 5DHVA 1QFWL 2I07B 3ZDXF 1MH5B 4U1NA 2FH8A 5IVXF 4MJIA 3NPSB 4PG2A 2XNAA 2AK4E 2ITDA 2WSKA 4EIZC 4NQXB 2I26N 4GMTL 4IRSD 1A9EA 4JG1L 5L9DH 4Y4FA 4NPYA 1GC1L 1CFSB 2HTKD 5I17A 4NRYB 3JTSB 3CXDL 3ARTA 3EYSH 2BHUA 3WUZA 4LHUG 5IHLB 1F6LL 1GGCL 4H0IA 5JIHA 4X7DC 5DJZB 5K59F 3L1OH 4F7CB 2F54D 1HSAB 3TN0C 2PO6A 1GOFA 1WWCA 1FGVL 3AREC 4CU7A 3BT2H 2O5YL 1OW0C 2AJXH 5LAXB 4YHML 3CFIC 2FLRT 1HQ4A 5I8KH 1T3FA 3MV7A 3HI5H 4B53A 1OGTB 4NZRL 4JO3L 4PJ5E 4F9LA 5CJXA 4HWUA 1OAUL 4WO4D 4XX1E 4Y0GA 3LVEA 3G5ZA 3X12A 3N1FC 1CZ8L 1YMMD 4POYA 4XCCL 1Z5LA 3O6KH 3BD5A 5HBBA 3SKOA 4XMPL 3C9NB 4PLKC 4BZ2L 5JW3L 2BVPB 5CWSB 4OF7A 4LQ1A 5ACLA 3WJLC 1A7RH 3QCVL 3I2CL 1M7XA 3QUMH 4JAMA 3U9PH 4LRNH 4FQIL 1ZK9A 3D0LB 3BH8B 5BS0E 1TETL 4FQ2L 1FN4A 3MA7B 3P4OA 5IVZA 4NO3A 1RULH 2Z31A 3RWIB 1WCBA 3T0XA 1KJMA 1TFHA 2X5PA 3QPQD 4P9HC 1XCTB 3B2UD 1HHGB 1PD6A 4CJ0A 4BUGA 4HK0B 3EDJA 1HCFX 3TYGL 2GSIB 3KR3H 3IETA 4Z7WB 5JUEH 2Y9RT 1OD9A 5E8DH 4PJ8C 4ZXBC 1IQDA 1KB5H 1TQBC 4WTWA 3LKOA 2X4QB 2APXA 3CFBA 3F7VB 4GXVH 5HYSG 4HCRH 4OZIE 3VW3H 3MO1A 2FX9H 5E1HB 1JWMA 2AXGB 3NA9L 2DM4A 4L9LB 3GSNH 4WI3A 4XNZC 1LE5A 1J0YA 5L6YH 5F1IA 3FB8A 1S78D 4X9IA 5EOTB 1FYTE 1S7SA 3G6JA 2JKXA 4L9DA 4JZJB 4TUOB 1FL6B 2W9DH 2V5MA 4X6CE 2UWEF 4N9GB 5D7SH 4P5KB 5ALBH 2N7AA 1MHCB 1NJ9B 1KCVL 1PG7H 3TZVC 1CICC 1MHPL 3A6BL 2NY6D 4X0KA 1ZHLB 4UZGA 5HPMB 1J1OH 4Y89A 4JREB 3P4NA 2R1YA 3HKFA 1E4JA 3T04D 3PWJA 1EPFA 3NCBB 3H3PH 5AD0B 4POUB 2AVGA 4XNUL 1V5JA 2GITB 1LO0H 2F58H 1MIML 4YIQB 3UXFA 4OCNC 5IBLD 2MWCA 2CXKA 2DBLL 1I9RL 2E7BA 2B20A 4Z77B 1MJ7L 3LCYA 1NMAH 5T5NF 3WJJA 4M1CC 3OHXA 2XZQL 4TULH 2O5XL 3GSNB 3B8SA 3OGOE 1EDQA 2EIDA 1JGDA 4XBGA 1NGYA 3VFOA 1DANU 1CQKA 4Y5YC 4FTVB 5IB2A 2H26B 5B38G 3LV3A 4R3SB 3TFKC 2IAND 4GMSL 2GI7A 1FO0A 4ONHB 4RGND 4OF8A 1SEQL 2DWDA 3QUZB 2CIKB 2FR4A 4JFQB 1S9XB 2H2SD 5C6TH 3U1SH 1LO3L 1D5MA 4X4ME 3HZKB 4OQTL 1MF2H 1ZLWH 4OUOA 4O2FA 3BW9A 3QRFM 3MV8B 3S37X 5IEKA 4LF3A 3P77A 3PV6A 5BRZB 2OR9H 5BVPH 3PWUB 3ARWA 1M7DB 1EEYB 4F33A 1CS6A 3SPVB 1UXWA 2VDNL 3PXHA 5IMMB 3BRDA 4KFZC 1BQSA 5DFWH 5H35B 4M62H 5JQ6L 1GHFL 2JCCA 4LSTH 4M6OH 2VSDA 3UZEA 3CH1A 3MGAA 5MI0B 4JKPH 3RY6C 4XC1H 2R23A 2RGSA 4YR6A 2OTWB 2BXZA 4BQ9A 2WV3A 5I8CB 3E6HB 4MNQA 3HHRB 5HI4D 1UB5B 3GRWH 3ZKSD 3QSKB 5ILTL 2A38A 2VWEE 3BP6A 1OLLA 5EUOA 3LEVH 2CRZA 4F8TA 2GTWA 4OKDA 5L0QB 4JN1L 2H32B 3GMMB 1N5YH 1P4IL 4QT5B 5DK2A 5DD5H 4XCFH 4J12A 2X4RA 4W68A 5D7LE 4YQXH 3UEZA 2IGFL 1J5OL 4KUZH 3RU8L 3E6FB 4MD5A 5C9KA 4YPGB 2W0LA 1M05B 1JZ5A 2DKUA 5GJTL 4QO1A 3TCLB 3M45A 3CVIL 3RVVD 3NH7H 5D1XD 3BEWB 3OKOB 5CCKL 1JK8A 4E41A 3EJYC 4PJ9D 5KSAA 4RCAA 2YUZA 3VFGL 5IVNA 2CGRL 4GQPH 3EKCA 1C5CL 2XQBH 3OKDA 4PJHF 4P3DB 3O8XA 3VXMB 4LIQE 3GSXA 1P1ZB 4RGOL 1T03H 1MCCA 3MROB 2UZXB 4MHHI 3D2UA 3JBG7 3S35X 2WINA 1FDLH 2IFGA 4R7DA 3PQYE 3VJ6B 3TA3B 4LEXL 4YEEA 2NY4B 2FJFA 2ZCLL 1YMHA 4NN6C 4NQCD 3L7EB 4HX1A 4NGHL 2V2WA 3HMXH 4X6EB 1DN0B 1MVUA 2QKIA 2ITCB 1YJDL 2YRZA 4ZS6D 3QIUD 2BVUA 4HC1L 3KLDA 4XAKD 4F7MA 2VLRE 3BP4B 4JY5H 1ADQA 4PJEF 4WIQA 1BVKB 2FWOB 1CFVH 3CDYA 4O4YH 3TYFB 1T5XA 4FXGB 1K85A 1SYSB 5LBSH 2B2XH 2BNRE 3VXNA 3ZTJG 2NY1C 4G6FB 4J2XA 2BC4A 2NXZB 2F74A 3VXPB 1NBVH 2A9MH 2SEBA 4HUWB 2P4AB 1G7MA 2XI9A 3SKUD 4B7IA 3K8KA 3LQAL 1P7KA 2PXYC 3RHWF 5BV7C 5JMRA 4DOHB 4WCYL 4JB9L 4N5UA 1IAKB 4UINH 4XPBH 4H26A 1BZ7A 4MJ6B 4P23B 5DRNA 3VXUD 2NX5B 1UJ3B 1SJVA 4K8RC 2W59A 3WN5B 2VXVL 5GGVY 3DX9A 2RFXB 2HVKB 1MJJB 5DHVB 5T33L 1A6UL 5LJYH 2DQTH 4U1NB 1Q1JL 4MJIB 1REIA 4LHQB 2XNAB 2ITDB 3ULVC 3SE9L 4YPJA 1UA6L 5HI5C 1A9EB 4Y4FB 4NPYB 4YBQD 5I17B 2AGJL 1DTUA 1GIGH 4KJQC 1RUKH 2AEPL 4G6AD 4MZ3A 1VFUA 4CADB 4Q6YA 4HLZH 4CN4A 3LQZA 1K5NA 1OARL 2F53E 5E8EA 2PO6B 1RUQL 1QVOA 4ZPVA 1ZHNB 4NQUA 2MMXA 4XNXH 1WIUA 4JVUA 3ILQC 1HQ4B 4Z7VA 1T3FB 1JNJA 3O2DL 3MV7B 4KJWC 1RZFL 1VFMA 5L9DL 1T2JA 2R9HD 1I3GH 2VLME 1IGFH 3GO1L 3QWQB 2CK0H 2FRGP 3G5ZB 3GSQA 5E4EC 3WS6A 1OCWH 3X12B 4QTIH 5GGVH 3EYSL 1FYTB 4S1QH 4LMQE 4RISL 1SM3H 2HLFC 1Z5LB 1QEWA 2QSCH 1J0JA 1D6EA 2Q6WA 4L3ED 3UJIL 3SKOB 4KUCD 5L8JB 3L1OL 3HR6A 3WFEH 3RZCD 4K94C 3C5ZA 5C09D 4AENA 5IVXA 4AM0A 5GZNC 3C60C 4ZFOA 4LCUA 1NBZA 1IFHH 2AJXL 3V79C 3SE3C 4JAMB 3T77A 5I8KL 3SE8H 2FYYA 1G1CA 5GS3A 1FN4B 5EU6E 1UVQB 5IVZB 4NO3B 4DTGH 1MRDH 2Z31B 3CFCL 1JYXA 1WCBB 1KJMB 3K3QA 4LL9A 4EEEA 3IETB 2AJZA 4XT1C 1ZGLP 3VMNA 4EZMA 3TIEA 5C0CD 1IQDB 4MQTB 3VFRA 5JDSA 3CFBB 3GFUA 3ZTNH 1A7RL 4P2OA 5AYQA 5T1LB 3U9PL 3G6AB 4LRNL 3DXAA 3IAQA 3MO1B 1JWMB 3VI4E 1QRKA 2P46B 3D5OF 5JXEC 5F1IB 1NEZA 3FB8B 1RULL 2DIAA 5A3ID 3G6JB 1PX4A 1S7VA 1N6QH 1G0YR 4HMDA 4RMWA 4P5MA 2EEDA 3SEPA 3GB7A 3QDJD 1RZKC 4PJ7E 3RDTB 3PWPA 1JGLH 1BHGA 4OIAA 3KR3L 4EOWH 1WBXB 5E8DL 3U79A 3ZDXE 2OTUB 4GW1A 1F4WH 1CDJA 2BOCB 2HKFL 3ARBA 1KB5L 2B4CL 2G9HB 2ZUWA 2FSEA 4U1GC 3L6FA 4XWOD 2AXHA 4ELMA 4HCRL 4X0KB 3VW3L 3D85D 5TQ0H 5B39A 3FFCA 1JZ6A 1NAKH 2Z35A 5D5MA 5EZJA 3P4NB 1T7XA 2R1YB 4ORGA 4P2RD 4LFHG 5L6YL 3PWJB 1ZLWK 4O51A 4B41A 4KVCH 1VFBA 2W9DL 2MCPH 5K59E 3I6LE 4WFFE 3DSNA 1PG7L 1WSST 2OZ4L 3OHXB 4OQ1A 5BVJA 3ALWA 5GRVK 2E6JA 4Z76B 2P49B 4HZLA 4O2CA 3QEGH 1JGDB 5T1KA 1NGYB 3VFOB 2P5EA 1J1OL 3AAZA 5MHSD 2ZUYA 5IB2B 1HXYB 2YPLE 3LV3B 4U7MA 5GQBA 3DV4A 1FO0B 4X9BA 5C6PB 4WHDA 2DWDB 4RDQG 1SMOA 5HHOE 4X99A 5D7LB 3VGHA 3KPRA 5GSVA 2FR4B 1LO0L 3CZFA 3PWPE 2X4OA 3CIQA 1CDYA 1G0DA 3AROA 4M5ZH 3E2HC 3O4LA 5JDJA 4O2FB 1NMAL 3BW9B 3HUJF 5TE4H 5IEKB 5DJDB 5CGTA 4LF3B 5JW4R 3TVMD 4R9HA 4F33B 1UXWB 4Y16A 4U6XA 2APBA 1MELA 4NKDA 2BNUA 1YUHA 1ZLSH 3VDAA 1EV2E 5HPOA 4M3JA 2JCCB 3UTQA 4I5BA 2X1OA 4JHAL 3CH1B 1KXQE 5IW6A 3PP4H 1B3JA 4XXCC 1F4YH 5JOPD 2R23B 4YR6B 5C6TL 4RGMB 3U1SL 3WLWC 2EEAA 4PRIE 1FV1A 4PBVC 4MNQB 5GZOC 1T89A 3VWKC 2WBWB 5JMOC 3PQYB 1DSFL 3HRZA 3BP6B 5BVPL 2YD5A 3ISWA 5EUOB 3OAUH 2GUOA 4Q7DA 3MMEA 1OOAA 2DLEA 5CD5D 4R2GC 3PF2A 4M62L 1H3GA 1ZANH 1BWMA 2X4RB 4LSTL 4M6OL 1V7NH 1YC7A 1ERNA 4JKPL 5A40E 4XC1L 2UWEE 4S0SD 2C5DC 1QSED 4MD5B 1A64A 4PP1D 3KJ6H 3MXVH 2VLRB 3O6FA 2VDPH 2FL5A 3GRWL 4JFEE 5TQ2H 4KJPD 1B0GA 5C8JB 3KPSA 1BECA 4WHYH 4PRBA 1QBAA 3HG1A 3DROA 3LEVL 2PETA 3QDME 2YXFA 4E41B 1FQ9C 3WDJA 5KSAB 1UM6H 5IQ7H 5HGAA 3QI9C 5E70A 1N5YL 1H3VA 4GS7B 1TJIL 4NC1C 5DD5L 1WGOA 3OKDB 3AMLA 4XCFL 3T2OA 1VGEL 1JZ3A 1CDUA 3O8XB 4YQXL 3BQUA 3QO1A 5IIEA 3B9KC 3L5WA 3C09C 4KUZL 1EXUA 1IGMH 2R1XA 2QEJA 5DUPH 3D2UB 3SDAC 2WINB 3S96A 3W11D 1T4KA 5DJ2B 2XN9A 2LAAA 3N0PB 3K81A 3ZZ1A 1BJ1J 2FJFB 3NH7L 2IQ9L 1YMHB 1BF8A 4GBXA 4HX1B 4PTTA 2V2WB 3PG2A 3S5LA 1ZEAH 1MVUB 2QKIB 3GK8H 5DC9B 2XQBL 2EDNA 4EVNA 2BDNL 1C7SA 3EHBC 4OI8A 5TPWH 4IOIA 2YC1B 2QQKH 4F7MB 4HWNA 1FDLL 1T5XB 3RTQB 2CPCA 4C56D 1AO7A 1FAIL 2F53B 1KJVA 1G9EA 4Y19D 4P4KC 3VXNB 2BC4B 4U2ZA 2F74B 1HNFA 2VKWA 3ZT6A 2SEBB 3HMXL 1JV5A 5EOCL 2FD6L 1G7MB 1KEMH 4LCIH 2M2DA 5JW4Q 1P7KB 1O5DT 1R0AH 1LO4H 1S9KC 1HSBA 2IEPA 4YHZL 4YK4B 4KK6D 1IGTA 1T1ZA 1ZA3A 4H26B 1BZ7B 4LLMA 5FYKD 3S36X 3C5JA 4X5XA 5DRNB 3QCUH 3ZYIA 3DO7A 3CSBA 3ZDZF 3BRGC 3MRGA 4PB9H 4K07A 1CFVL 4O4YL 4QHNA 3DX9B 1IARB 1WAAF 5LBSL 4BJLA 5CEZL 5L2KA 3KPLA 1G9MH 2YS4A 3BIBX 1EHLH 4CRPA 3CXHK 3NPSC 2A9ML 4FMKA 3T0AA 5C0AE 4JZNA 4KAQH 3O2WH 4G6JH 5SX4I 4UINL 5MENA 3LAFA 3BAEH 3CPLA 3LQZB 1K5NB 3S98A 5E8EB 1C5DA 4WTXA 5E95B 5CJQH 1UENA 1F8TH 1QVOB 2CO7B 2PUQT 4WI5A 5C08D 2DQTL 4ZPVB 4HH8A 5EULV 4IRSA 1I3VA 4Z7VB 4PJHE 3B3IA 4B50A 1R3KA 4GO6B 1QLFA 1ZT7A 2I5YL 1JF6A 4UBDD 1IC4H 2MSPA 3GSQB 1J11A 2RJMA 4CVXA 4H8WH 5HGDA 1RUKL 1KENH 1JNNH 5A43C 6FABL 4YDKH 1EMTH 2F54A 2LFGA 1QEWB 1D6EB 1HZHH 2Q6WB 3PXJA 2A2QT 4G8GE 4M61A 5F7UA 3STLA 4DGYH 4DAGH 2QSTA 4G9FD 4AENB 5IVXB 4ZFOB 4NZTH 4LCUB 2VJXA 1NBZB 4XNXL 5I0DA 1O7VA 2ED9A 3D3VA 4QRQA 3FJTA 2FYYB 3OKYA 4U1HA 4WO4A 4QKXB 3SCMD 1F42A 4RMTA 3EO1A 1IGFL 5HY9A 3FONA 1YMMA 3S4SA 2CK0L 1OCWL 1JJUA 5GGVL 2EZ0D 3E0GA 4S1QL 4JFPA 3U4AA 4PJEE 5I18H 2AJZB 2W0KA 4WUUE 3WFEL 4ZNEE 4AIZA 5I1EH 3IT8D 5EORH 3MRRA 1ZLVH 3TIEB 3VFRB 5JDSB 1IFHL 1EVUA 1BZQK 2BMKA 3F6LA 4RMVA 5FM5M 3DXAB 4OLZH 3SE8L 4NZJA 1HHKA 1TJHH 2VLJE 5ETUA 4L9LC 1TVHB 1S5IH 5DMIH 2YPLB 1NEZB 2LV4A 1MRDL 4DTGL 4Z7NF 3X3GH 1KB9K 4NOBA 5B8CA 2VKXA 1S7VB 3FOLA 5IV2A 3HPJB 4P5MB 4MAYD 5D2LF 4JZJC 3GB7B 4NO2A 5INDA 3PWPB 1AI1H 4LASL 4U0RB 4UU9A 5DJYB 1RIVH 3PL6D 4QEGA 3S6CA 3ARBB 2ZPKL 2FSEB 3VXSE 4NP4H 5J7CC 3L6FB 3ZTNL 4APQD 4KKBD 4RFEA 4ELMB 3D3VE 4JGJA 1X5FA 4JVPA 4M4RA 3BWAA 3GKWH 2HJLB 5B39B 3FFCB 1TNMA 1QFOA 5D5MB 5EZJB 4JREC 4ORGB 1I7RB 2W9EL 3S34H 5DTFA 5HYQA 3BO8A 4QHKJ 3CLFH 4X6DF 4O51B 1N6QL 4M3KB 1VFBB 4TSBH 4PJBF 3SDYH 1EJOH 4EOWL 2CXGA 4NZDA 3K0WA 4PRIB 3U4BH 5JPMA 3V52H 1F4WL 3MRCA 5FYJD 4JCMA 3WUWA 5BVJB 25C8L 1IEBA 5JW5A 1RZJC 4MVBD 4HZLB 3T65A 3V6BR 2FHFA 4O2CB 2IH3A 5TQ0L 3AAZB 1NAKL 3DV4B 1QP1A 4QRRD 4HWBL 4OAWA 4H1LG 4Q97A 4X99B 3QUZC 3U36A 4KVCL 3CZFB 5KSBF 1A2YB 2C26A 2X4OB 4EN3D 4PREA 2VN4A 2UWEB 4UT7H 4PRPD 4C59B 4IS6A 2VXUH 4I8DA 4ZSOA 5D6DC 3ARZA 4XPAL 3RVUC 1BBJA 2HTLD 3QEGL 2DKSA 4C58B 2IANA 4Y16B 4U6XB 3S7GA 1AD9A 2KZ1B 4NKDB 2BNUB 1IC1A 1YUHB 4U1LA 1G9NC 1I1CA 2YEZA 4I5BB 4RA0C 1AGDA 2HT3C 4QGTA 5IW6B 1G6RH 2VDLH 3DHMA 1I9EA 5MI0C 4K23H 5DO2D 1EO5A 3NA4A 1WWWX 1FV1B 1TIUA 3LN9A 4M5ZL 1Q0YH 3EUUA 3FQUA 2Q1EA 3HRZB 2BHYA 2VO5A 1A22B 2GUOB 2DICA 4HFWB 5F9AC 4XTRC 5L0QC 1IJ9A 3GIZH 2FJHA 1NANI 2J88H 2ZCHL 2COQA 5IVOA 1LK2A 1U3HD 3ZE0F 4NFCA 5E5UB 3PP4L 1BEYH 2XIDA 3VGGA 2V5YA 1NGQH 2JIXD 4PBXA 1A14H 3VRLF 1D6VH 4HJGA 3P0VH 4KH2A 3GSVA 3O6FB 2FL5B 4MDIA 4AL8H 3P2TA 3HUJA 5DJ0A 1B0GB 3KPSB 4U1SA 4PRBB 1UWEH 3HG1B 4HMEA 3OAUL 3DROB 5J6HA 3BXNA 1YDPA 4L3AA 3HAEA 3MUHL 3SGEH 5HGAB 4EBQH 5J0BA 1OT1A 3MUJA 1D5IH 1AXTH 4OGAD 4FG6C 4P3WA 1ZANL 2W0FA 2YWZA 2DQCH 3FZUD 1OTUC 1V7NL 3BKJL 3BQUB 3QO1B 5IIEB 3L5WB 3O3AA 5C3TA 5DD3H 2CKNA 1EXUB 4OCYH 4NQTA 35C8H 3HNVH 3KJ6L 3S96B 1T4KB 3MXVL 1IEAA 5GGSY 2VDPL 2XN9B 5D1XA 5TQ2L 1OP5H 3TA3C 4PJ9A 3RUGF 4GBXB 2NY4C 2PYED 1TJGL 4PTTB 5ALCL 3RKDD 4HGMA 4Q2ZA 1GYAA 2P43B 4EVNB 1AY1H 3FRPA 2VDOH 5I19H 5C0AB 4IOIB 4PJFA 1CXIA 1IGML 4MA8H 5DUPL 2C3WA 1IM3A 4FS0A 1MCEA 4G5ZH 1ODAA 3UAJC 4LAJH 4NQCA 1AO7B 2VAAA 1BPVA 1HDMA 3KHOA 4LDLB 1RUML 1HWGB 2NXZC 5E4IA 1JV5B 3P9LA 1ZEAL 1BQLH 5CSZB 1DQMH 2ICEA 4GAJL 3GK8L 3QIUA 4LLWA 2R4SL 1HSBB 3V6OE 3MACH 4G9DA 3AB0B 5TPWL 1T1ZB 5EA0H 1ZA3B 4LLMB 2NXYD 1CGTA 4K71B 4WFGD 2QQKL 3C5JB 1J86A 2ICCA 1BFTA 4P23C 4X5XB 1UJTA 1YEJH 2IJ0C 3DO7B 3MRGB 1UJ3C 3WN5C 4QHNB 1QQDA 3F62A 1CL7H 4MZ2A 2J6EA 3NCYP 4BZYA 5GRWA 2OL3A 2Q3AA 3KPLB 4PG2C 3F7YA 5HTSA 4XCYA 4X5LA 1CU4H 1KEML 4LCIL 1ZLUH 1R0AL 1LO4L 3L3HA 4JZNB 3HPLA 4Y4FC 2AJ3A 4ODHH 3VXUA 1MCQA 3CXHJ 2Z8VC 3SO3B 5CKAA 3O3DA 5DK0A 5EG6C 3R1GL 3R0NA 4BFGA 2D9QB 2X44D 4GOSA 4OD2A 4PJEB 4PB9L 5KZCD 3CPLB 3VI3F 1C5DB 5CJBA 1UYWH 1QSZA 2PO6C 3DSFH 4JFZH 1G9ML 4IRSB 4XMKH 1EHLL 1LDPH 2M1KA 1NQBA 4QOKD 3DVGA 4DKEH 1IZJA 1QLFB 1IL1A 1ZT7B 2R56H 4HUKB 3HZYA 3O2WL 4G6JL 4F9LC 5CJXC 2DTMH 3TGXA 4CVXB 1IKFL 2VITA 1MCHA 1QNZH 3D0VA 2F54B 1IAOA 5IWLA 3BAEL 1ZLVK 1UEMA 2HN7A 2P5WE 1U3ZA 4M61B 1FNSH 3FN0H 1WAAA 3STLB 4GKOA 5T5FH 5CJQL 3C8KA 1F8TL 3O4OB 4H25B 1CBVL 3LKPA 4JDVA 4QTHA 4CMHB 5C0EB 5CEZE 1JCKA 4HH9A 1UH3A 3D3VB 3HLAA 3I6KB 4GRLD 4WO4B 3MJ9L 2A6DA 1T1YB 3UTOA 4MXQC 1FVCA 2H2PD 1KACB 5HY9B 3FONB 4OD1H 1IC4L 2NY5H 4FQQB 4NHCH 3HRPA 2Z31C 4PFEA 1QYGH 4H8WL 2N1KA 1KENL 4L3EA 1DVFD 4JFPB 3PIQA 2ICWA 1V05A 3RZCA 3M07A 1T2XA 3GHEL 5C09A 3MGTA 4AIZB 2C1PA 4DGYL 4N90E 2ESVD 4OFIA 2X6MA 3PHQA 4NZTL 2GHWB 2BMKB 2P48B 1HHKB 3F8UB 2HFGH 4YWGH 4X8XA 2Q3ZA 1QTYT 2A9NL 2CKBA 1A6TA 2MPAL 5B8CB 1B6DA 4O9HH 1C16A 3FOLB 3ZDZE 3VWJD 3PABA 1R5VB 4Z95H 4NO2B 2BSRA 5C0CA 4Q9BA 1JNHA 4UU9B 3UC0H 1UACH 1KB9J 1P84K 5I1EL 4HXBH 4KROC 1Q9LB 3BKMH 4TPRH 1JGEA 1WISA 4FOMA 1FL3A 1UXSA 2WQ8A 3BWAB 4AMKH 4GKZA 1RUPH 1J87A 3TO4D 3IDGA 3IFLH 1TJHL 1RU9H 1K9TA 5DMIL 5HYQB 3BO8B 3QDJA 1X9QA 3F7PC 2MCG1 5C09E 5JLZA 1AI1L 3PGCA 5KS9E 3DPBA 5I75B 4O58L 5JPMB 1RIVL 3CFJA 2NY6B 3MRCB 1YY9C 1HOCA 3WJJC 3WUWB 4Z78A 3D85A 5E24E 1DBKH 4NP4L 1IEBB 1SJEA 3T65B 2HA1A 2VWEC 1A7BA 1WITA 4P2RA 3GKWL 1A7QL 2IH3B 1HEZA 1F6AB 2JELH 3MA9L 4U6HA 1ZMYA 2DD8H 1CD1A 2BOBB 4OAWB 3CLFL 3HE6D 5L88H 3U36B 3RA7H 1L6ZA 4TSBL 4PREB 1EJOL 1Q38A 4RMRA 5C0ND 4IS6B 4JHWH 2WANA 4QRSA 4ZSOB 1QRND 5CJOH 3ZO0A 1BBJB 4PLOB 4YDVA 2J8UF 2IANB 3VXOA 4E42A 1BD2E 4RGNB 1AD9B 3CSYA 3GSUA 4ETQA 3UJJL 1K3IA 3VFSA 1L0QA 4U1LB 4OUUA 5H2BA 2AI0H 3HAEH 1IQWH 1AGDB 1CVSC 1HKLH 4X6DA 4RDQF 1KXVC 4P2YA 4DUXA 4MS8D 3LKRA 1KOAA 3FQXA 5DUML 3TVMA 3FQUB 3HNSH 2VXUL 4XRCA 3SGDH 3JVGA 5ESQB 3EOTH 4P2RE 3A0OA 1NDGA 4PB0H 3TJHC 4ONGL 2A73A 3FHAA 3V6FA 1M1SA 2FJHB 4Z7NE 1BF2A 2OSLA 1LK2B 1OTTD 1H3XA 3ZYOA 1G6RL 2VDLL 2XZAL 1DL7H 5D2LE 1BREA 1NCNA 4NBYB 3WDHA 4Y4KD 3T0BA 4C4KT 3QH3A 4HJGB 4YJZL 1OP5K 4XWGL 1OWRM 3GSVB 4MDIB 2V2XA 3HUJB 1J1XH 5DJ0B 4X7CC 5C0RH 2WUCH 1KGCE 3ARQA 4JFFD 5I1DB 5J6HB 3BXNB 1E6OL 1YDPB 2PTUA 4S2SA 5KSAC 3FRUA 5ICYB 5DZLA 1NCBH 3GIZL 3QFJD 3EYQD 5IMLA 3ZL4L 3K74B 2W0FB 4M7KH 2YXMA 1XF3A 4PLNC 1HXMA 3O8XC 1QSEA 3O3AB 4PJBE 1NGQL 4I9WE 4AYFA 5KANI 5AZ2H 1D6VL 3MODL 1SEBA 2LABA 2GY7B 3P0VL 5EC1A 5CBAA 4YHNA 4AIXA 1C08A 1IEAB 4Y1AD 5D1XB 2FLBT 5D2NA 1UWEL 3NTCL 1MAKA 2OCFD 3MPCA 2J6EH 4KKLC 4EBQL 1NGWA 1D5IL 3QQ9C 4Q2ZB 1AXTL 5JOPE 2OL3H 5HVHB 4ISVA 4DJMA 5GIRA 1N7MH 5KSBE 1UC6A 1AKJD 2BY1A 4PJFB 4OCYL 4LMQI 5HI3C 35C8L 3HNVL 4FFYH 3Q5YA 2X1QA 3QZWA 4HXAL 4LLYA 4LOUC 4KPHH 1HDMB 2P24A 1A9BA 2D7MA 2PW2A 2X9YA 5EFIA 2PCPA 5T1MA 4HIJA 5DHXB 3ZYJA 1ZLUK 2AERT 15C8H 4L3CA 4ODTH 4M6NH 3ARPA 1NFKA 3QIUB 3EOYG 2I9LB 1Z2KA 3ILPA 4CU6A 2D7QA 2ZWLT 4EUPG 3L9RB 4G9DB 1BX2A 1RJCA 4KKCC 1MAMH 2VDOL 3PJSA 5I19L 4OGXH 4YK4C 2BVEA 4DWHA 4S1SL 5MEPA 5EUKA 4C56A 4JZOA 3WL9A 4G5ZL 2M26A 1YNLH 4Y19A 1DDHA 3MXWH 4HPOL 5BMFH 2AJUH 3RUGA 1MNUL 4MLIA 4N8CL 1MRCL 1GH7A 4HKJA 3MRFA 3F7YB 1DQML 4XCYB 4PJXF 1URLA 1VHPA 3L3HB 4RRPA 2AJ3B 1OAYH 3MACL 3VXUB 1F45A 3VRLE 4DGIH 2FECL 4RFNB 1MRFH 4L8SA 1YEJL 5DK0B 2EDKA 1TTUA 4OD2B 1P7QD 3GMNA 3BIAX 5C6WH 1CL7L 4YDIH 2HWZH 1MI5D 1FZKA 1IGCL 3S3PA 1J8HD 2QL1A 3N1QC 2DQIH 3CCHA 4H5SA 3LKSA 5JHDD 4GRWF 3HZYB 4ODHL 2I25N 3SQBA 2R69H 3WS6C 1MJUH 5LGHH 2VITB 4LVOB 1YN6A 3F12A 3D0VB 1QPXA 1IAOB 2H3NA 2CKBH 2HN7B 1EZVX 2F5AL 5C08A 1HH9A 4XVSH 3RUGE 3RGVD 4XNYH 3UJTH 1ED3A 3C8KB 1UH4A 3DSFL 4JFZL 4RMUA 3C5ZC 2ATPB 4EDWH 1LEIA 3LKPB 4JDVB 3BYTA 4QTHB 4XMKL 3IB4A 4FABH 1LDPL 4HH9B 3NCJL 3FMGH 3WFZA 5TDPA 2A6DB 1CCZA 1FVCB 2R56L 5I73C 5FOBA 2DTML 2APTA 4G8FA 3GSOA 4CVZA 3I3DA 1CG9A 3B2VH 4RAVA 1RZIA 4OBSA 4L3EB 4N0CC 1QNZL 2ICWB 3PIQB 1H8NA 3RZCB 1KC5H 1FNSL 4G9FA 4JKKA 5C09B 3FN0L 1JRHH 2DWEA 5T5FL 2C1PB 1I7TA 3DX7A 4GT7A 4XB7A 2GK0B 2YBRA 3WNPA 1E4WH 1OAXH 3PHQB 5C71A 1U2CA 4CN1A 2VLKE 4P2OC 3SCMA 5I2IA 5E94A 4ONFL 4JRXE 4MX7B 4R8WL 3EFFA 4OGYH 1I8KA 1IVLA 4OGZA 4OD1L 2NY5L 1A6TB 4ZD3H 1ITCA 4WFHD 2R2HA 1C16B 4L8BA 5FB8A 3PABB 5ADOH 1T22A 3MOBL 3MGOA 4MB3A 2BSRB 4R97B 1V8HA 5C0CB 1TTFA 1JNHB 2VZ3A 4U0RC 2YWYA 3PWVA 4FP8H 4WW2A 3QQNA 2ADJA 3ARBC 2J2ZA 5DC0A 1JGEB 1JPTL 4NYLB 1I1AD 2XQYG 1FL3B 3FQRB 3W9EA 5B4MC 2FCBA 3OB8A 1P84J 3MJ8A 4GKZB 4N8VG 3VGEA 3IDGB 3L5JA 5FDYA 1BD2B 4OCSH 5CP3A 3OSKA 4YWGL 4NQDE 4MAYA 1CWVA 4HK3N 3WIHL 2V5RA 3IKCA 2D4FA 4Z95L 1CI5A 3U7WL 3VI3E 3PL6A 5JLZB 3PGCB 1E6JH 1UACL 5GRZA 1J12A 4F7PA 1T04B 4APQA 3CFJB 5E8NA 3BKML 1HOCB 3BHBB 4LKCA 4TPRL 3D85B 4Z78B 3E3QE 4Q9RL 2W0PA 1SJEB 1WWAX 2IMMA 3U7YL 2QHRL 5BW7A 4TNWF 4HUMB 4P2RB 1RFDH 1HEZB 1RUPL 4IOFC 4X7TA 3IFLL 3PNWA 1HE7A 1HYRC 4U6HB 1RU9L 3V4VH 1CD1B 1IGIL 4JGUA 5DD1H 3UYRH 4WDIA 5M7QA 2BSSA 3C08L 4QRTA 5E9DE 1JI2A 1RQ5A 3ZE2F 3L3KA 4QRSB 4NO0B 1CLZH 4KI5C 4JM4H 3QDHA 5EZLA 5F7KC 1DBKL 4MD4A 4JM2D 3IFPA 2D9CA 4LNRA 4HIIA 4YDVB 2J1KA 1NCAH 4QRRA 2R29H 3VXOB 4E42B 2JJVA 2JELL 2VNCA 3CSYB 3GSUB 4Y16C 3VFSB 4OUUB 2DD8L 3BH9A 4NZUL 2P7TA 3SDDD 4A6YA 3ULUF 5L88L 4X6DB 5BZWA 1CVRA 4EN3A 5EO0A 2BVYA 3RA7L 4PRPA 3LKRB 5HHPB 2EH8H 3D1MC 4JRYD 1M7IB 3BPCA 3V8OA 2HFFA 3FQXB 4JHWL 3TVMB 4GAFB 1T89C 4XRCB 2IMNA 1DQLH 1PDKA 4LSRL 1CDGA 1NDGB 5FA3A 5DFTA 2A73B 1SVCP 3V6FB 1TPXB 1FZMA 4N0UA 2OSLB 2AI0L 1MCKA 2CLRA 1HKLL 4S10A 1FLTX 4KTYA 3UTSE 1BOYA 4X80H 1MFDH 1V3MA 2LVEA 1IEHA 1U8MB 3UCRA 3QH3B 2Y25A 4AJ0A 1DE4B 3O6FC 2E8YA 2V2XB 3HNSL 1BLNA 3GMLA 3PHSA 3HB3C 3FAWA 2VABA 3EJZD 4WI4A 2A6IA 1TDQA 3EOTL 2J8UA 4PB0L 3ULUL 1V3JA 1E28A 5DFVC 3FRUB 2LTQB 3TH3T 3SO5A 3W0WE 1RJYA 1U3HA 3MRPA 2WLYA 4LNVA 5IMLB 1N4XH 3B9AA 5FUZH 5LKNA 5T3XD 1XF3B 2JIXA 4X6BB 4NQVA 4IDJH 1DL7L 3LEYH 2DJUA 3BQUC 2WP3T 2D0HA 1RPQA 1SEBB 5EC1B 5CBAB 4YHNB 3FAXA 4Z9KB 2WUCL 5D2NB 4MNHA 2VSCA 3D9AL 4GBXC 1ZOXA 2C3XA 1NBYA 1NCBL 3EZ8A 3QUXB 5J13B 1WEJH 5AZEH 3BESR 4Y88A 3MLRL 4MXVF 3OZ9H 5GS0H 5GIRB 4M7KL 2DI8A 2IFFH 4GSDL 4L4JA 3QAZC 3JWOC 1FGNH 4MQXD 1CD8A 2EDEA 5IEHA 3QZWB 4LLYB 4QHLA 5LWYH 2PYEA 4OFVA 4E9LA 3K2UH 1A9BB 2EDTA 2PW2B 5EFIB 1SMAA 4HIJB 4PJAA 4L3CB 1I85A 2FO1A 5HYFA 2EXWD 3ARFB 3ILPB 1N7ML 1BX2B 2IADA 2XY2A 1CE1H 1CIUA 5GHWL 3PJSB 3OWEA 4BQBA 3BN9C 3MUGA 5J12C 4HUVA 4K71C 5MEPB 5DWUH 4C56B 4JZOB 3VFWA 3WL9B 4OB5H 3QDAA 2I24N 4Y19B 1A3LH 1DDHB 3VXRE 3UO1L 2IAMD 5CZKA 4KPHL 5IESH 3RUGB 2Q87A 3IAPA 3QRGH 4TN9A 1CGSL 1A6VH 2RB8A 4HKJB 4OV5A 3MRFB 3G9VA 1TITA 15C8L 4LLVA 5T3ZD 2NYYC 4M6NL 1NMCB 4CUCA 5BQ7A 5L7XH 2X9XA 3DUHA 1MAML 2IBZY 4OLUH 3NZHH 1ZTXH 3SO3C 4KRNA 4L8SB 5DEFB 1FFNB 4G7VH 1I9IL 2HRPH 1YNLL 3GMNB 3MXWL 5BMFL 3DARA 1ZHKA 2AJUL 5E2WH 5FHBH 1MOEA 12E8H 3VDBA 3NCFB 3RP1A 1FZKB 4GFTB 8FABA 4EIGB 1INEH 3KYMA 4IRSC 5FM5O 4MYWB 3D87B 3CCHB 1U91A 1QSFE 4H5SB 2HTKC 3LKSB 4K9EC 1ORSA 4LVNB 3AC0A 3CX2A 4XPGH 5DT1H 3WSQH 1CGWA 1MRFL 5FIEA 3F12B 5BOPA 3JUYA 5JR1H 5C08B 3UTZA 3RPKA 1HH9B 4Z7UA 5KG9A 1J0KA 1KLGA 4YDIL 2HWZL 4K3EH 3O4OC 1YPZE 1LEIB 4FG6D 4QOKA 3BKCL 5DQ9A 2BERA 5IBUG 4CMHC 5C70A 2DQIL 5ERWA 2EE9A 1OQOA 3V0AC 1BJMA 2H1PL 2UZYB 5C86A 5TDPB 2AEWA 1B2WH 4WO4C 3X14A 5D72L 1R24B 3ZKMD 5FOBB 1EAPA 3FB7A 1XF2A 4G8FB 3GSOB 1CG9B 4RAVB 1RZIB 5LGHL 4PJGA 3TH4T 3D39D 5IB3A 1Q9WA 3RNQA 4I2XE 3F58H 5DLML 3RVWD 5KJRH 1E4XH 5FGRA 1OF2A 4G9FB 4NM8H 3IXTA 2F9BT 4XVSL 4IRJD 2DWEB 5DMGD 1I7TB 4XNYL 3UJTL 3QG7L 3DX7B 4BFEA 2YBRB 2FBJH 1C5BH 2AK4D 4F58L 3T2NH 4FABL 4GRLA 4JPWL 3SCMB 5I2IB 2CJUH 5E94B 3FO1A 3FMGL 4N0YH 5IB4A 1I8KB 1DVFA 1HI6A 4R90H 3QPQC 1JHKH 1AQDA 2A77L 2C3HA 3B2UC 2R2HB 3B2VL 3VFNA 3H9YA 2CMRH 1FBIH 4YZFF 5B8CC 5FB8B 1JFQH 1T22B 4R4BA 3WIIH 4TRPH 3MGOB 4UOJA 5I15H 2HMID 1KC5L 2ESVA 1FZJA 3DTXA 1JRHL 3PWVB 5K93A 1NEUA 2GYSA 4KVNL 5K9KA 1E4WL 2ADJB 1OAXL 3KLSA 3QXDA 1J1PH 1OP9A 5FYJH 3W9EB 1W8OA 2F15A 4PJXE 4CBPA 2R0KL 3MJ8B 1LNUA 4PJ5D 3LMJH 4DCQA 1EGJL 2JK5A 1S78C 4OGYL 3TO2A 3QYCA 3VWJA 4MAYB 2K3TA 2ZKHH 1GAFH 3QISA 3IKCB 3K1DA 5TDOA 3PP3H 5ADOL 2MTPA 2DL2A 5EIVA 3PL6B 1JZ4A 1JTTA 2YZ8A 1W0YT 4M02A 4F7PB 1FFPB 4JM2F 4APQB 5I75C 2YUXA 5E8NB 4PV8A 4NT6A 2NY6C 4LKCB 4P59H 1NFDF 5A16A 4HKBA 2K7QA 4N8PA 2O26U 1NAMA 5F1NA 3TO4A 3BE1H 2CRIA 5I74B 4D9LH 1K2DA 1SY6A 3G5VB 1R5IA 4HIXH 5BS0D 4X7TB 5EPMA 1N8ZB 3PNWB 4OCSL 5I1GL 3KG5A 5JHLH 5HYJE 1QHPA 3JTTA 1NC2D 2B39A 5IBLC 4WTZG 3IVKA 2BJMH 3QEHA 4WDIB 2YRLA 4GQ9H 2BSSB 3LRSA 4RMSA 4QRTB 4DKFH 3L3KB 1LE9A 2DQEH 2XZCH 1QBBA 1EEZB 1MSPA 4XGZB 3VA6A 5EZLB 4MD4B 3EYUL 1ES0A 1GOGA 1C12A 3IFPB 4LNRB 4O5LH 4HIIB 2JTDA 2EICA 4ZUSA 1RFDL 4QRRB 2FIRT 3RPIA 2ADGA 1OGAE 3AUVA 3BEVA 2IPTH 3HE6A 4RGNC 3V4VL 3BH9B 1FYTD 2P7TB 4YBLB 4A6YB 4GG6E 2CO6B 2H2SC 4EN3B 5EO0B 2DMKA 5DD1L 4PRPB 3UYRL 3AFLA 4YAQA 5I1IL 3N06B 1IAMA 1QRNA 4WNQA 3N85L 2P42B 3BPCB 2A1WL 2HFFB 5E7FA 1R3HA 4JG0L 1CLZL 1IKNA 3U9UA 1S9VA 1A7OH 4OM1H 4P4RA 1PAMA 1ZE3C 3SGKA 1KLUA 5FA3B 4Y8AA 1EEUA 5I76A 3ZKQD 2X09A 3NZ8A 2OJZH 3THML 2X4UA 1FZMB 4N0UB 5GGTA 1L0XA 1U93A 2CLRB 1L7IL 3WO4B 5BJTA 3I3EA 1U95A 3V6ZA 1CDHA 2VC2H 1DUYA 3X11A 2EH8L 5HI4C 3RVXD 2CUMA 3VGFA 4KTDH 3GMLB 5T1LD 3CFDA 1A6AB 1DQLL 4YX2H 5IP4A 5HYEA 1BQHG 1LK3H 5B22A 2A6IB 2J8UB 3DV6B 1BFSA 1E28B 3RX7A 2B5IB 3RX8A 1RJYB 1U3HB 3MRPB 2XTJE 1BIIA 2JIXB 4Y4KA 3RDTD 1K6QH 4OI7A 5D1QB 3H42L 1LEKA 4X80L 4IRZH 2WUBH 3O81A 5CIPH 5EIIA 4DKDC 1FG9C 2EIBA 2ARJA 2AEQH 3RVVC 3LH2H 4JFFA 4OZFG 5D1XC 3VXRB 6CGTA 3QPXH 4PJ9C 3QNYA 3I85A 4MNHB 4AEEA 3QFJA 1FFQA 3JV6A 1NBYB 2PR4H 5C9JA 4MNGA 2DI9A 3CLEL 5D7IA 3JV0A 4XXDA 2H6PA 5HVHC 5FUZL 2QLVB 2FBOJ 4OZGF 4OSUH 2DLFH 4IDJL 3TBVA 2V7NA 4G6KH 4L4VD 4LLAA 4HS8H 2OBGA 4Y1AA 2YUWA 3ZE2E 2CDGA 5C0BE 5IEHB 1XH3A 5CEYA 3VXTA 4QHLB 2PYEB 3OKLA 5FYKU 4GKNA 2GSGA 3W5NA 5LGKA 2DQDH 4TNVK 1Q72H 4PJAB 1JI1A 3O2VH 2WMPA 5D71L 1WEJL 5AZEL 1B88A 3ULUE 1KIRA 1XFPA 5D7LD 1AKJA 4FXKA 5GS0L 3QIUC 3IDJA 2IFFL 2IADB 4ALAH 5J9PA 4IHOA 3MUGB 2OI9B 1A02N 3GBML 4HUVB 1LHZA 3VFWB 1AE6L 1B4RA 2DQFA 4BYHA 5LWYL 4HT1L 1R3JA 1ZHBB 3UPAA 3K2UL 4BQ6A 2ICWJ 5KSUA 4QY8A 5FCUH 2OR8A 3R4DA 2G60H 4OV5B 2FX8H 4LLVB 4BZ1H 1AFVH 5BQ7B 3MRJA 1CFTA 3EW3B 4OT1H 5FO7A 5FGCB 1CE1L 5DRWB 5CBEA 5I1HH 4NM4H 3WHXA 1F6FB 4UILH 4HV8A 4RFNC 3HR5A 3PQYD 4TQEH 4MXWL 3S35H 4OB5L 4BQCA 2HT4D 1D5ZB 2A6JA 1YNKH 4I2XB 2V6HA 1A3LL 4P3CL 4FQCH 3PHOA 1ZHKB 5IESL 1EO8L 4TYUA 3QRGL 1B4JH 2VLLA</