1OAXL

Fv structure of the ige spe-7 in complex with acenaphthenequinone
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
AVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPRHLFTGLIGGTNNRAPGVPARFSGSLIGNKAALTITGAQTEDEAIYFCALWYSNHLVFGGGTKLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN E
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 24
structure length 108
sequence length 108
chains with identical sequence M, N, O
ec nomenclature
pdb deposition date 2003-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oaxL00
3L9RB 4FXKA 1E27B 1UH4A 4JFOB 1GCFA 3B2UD 3RWJA 4AENB 5SV3A 5JPNA 1BLNA 4ORGB 2VDLL 4PS4L 4CKVX 1NAMB 4OZFB 4FP8L 4N1HB 3MLYL 3QDJE 2ESVA 4FXGB 1J88A 1QD0A 5L88L 2WUBL 3BP4B 5CSGA 3BZEB 5LGKA 4AZ8A 3VFUA 3BEWA 4XCFH 1I7UA 5KZCD 4WI3A 5AUMA 1RUMH 3S3JA 3MV8A 1IQWH 4YXLL 1JMXA 5IVOA 5DRWB 5E56A 3LQAL 1EZVX 2QSTA 3PWVB 2I07A 1N6VA 2AEWA 5DMGC 2A77H 3LRSA 5C0RH 1JFQL 2A6DB 4J4PD 1KUMA 1MWAB 1MREL 1MHCB 1ES0A 3G5VA 3BISA 3NCFB 5HHOB 5T3ZL 3F58L 5AWNL 4PGDA 3PE9A 3QEHB 3EYQD 3UTQA 4KJYA 3D69A 5I1KL 5TPWL 5AZEH 2FX9L 4K7PL 1GL4B 4OFKA 4XNQA 2YPLD 4AYFA 3WHXB 2E7LC 2F8OA 3U46B 1J05B 2XN9D 1G7IB 5I1EH 5IQ7H 1L7TH 3SGDH 5IVXB 4R96B 4F8TA 4ODTL 5BRZA 4X6DB 3GSRA 4OZFG 1YPZA 1BIHA 3MSPA 4YX2H 2NQCA 3VWKA 3RU8L 1UVQB 3QUYA 1Q9KA 2N56A 5DEFA 2O5ZH 2VLLB 5I17B 2CLRA 4PLNC 5IBTL 4X5WA 3CPLB 4XPFH 5LXGL 3S3PA 4Z5RB 5ACLA 5KZCB 2EH7H 2NW3B 1CGXA 2AXGB 4OJFL 3NN8B 2VITA 3WN5C 2QJDA 4HLJA 4OGXH 1S9YB 4PRBB 4P2OA 1IAKB 4JO4H 4M93B 1KIQA 4XNZB 3TA3A 3CLEL 1QBAA 3H6JA 3T4YB 5E8NB 5I8OL 2VDKH 3IB4A 4P5KB 3SKOB 1FFNB 3S96A 4M4RA 4HCRL 4YHLH 4Q6IB 2APTA 3NA9L 4WHYH 3MNZA 3GMOA 1A1NB 2KUTA 2YWYA 2NLJB 5CWSB 2D7QA 3C6SB 2DQFB 4OCRH 1MRCL 3KXFE 3S4SA 1RURL 1KT2B 4N9GA 4F33A 1T1ZA 4LSQH 2YPLB 5HI4D 1Q72L 3KYKH 3REWB 4D0CB 4HDIA 2XN9B 2EEAA 4LCCB 1BX2B 3ARPA 2NZ9C 2O5YH 4LSRL 1LNUA 2GTWA 5GS1A 4JRXE 4HH8A 2IQ9L 2KPNA 2QQNL 2V2TB 4JFYB 1DVFA 1KG0B 4OF8A 3GI9L 2W0KA 3ABZA 1NMAL 4FQHA 4HIHA 4BQCA 3ARGC 3QIWC 1F4YH 4OKVB 5FYKU 3F62A 4LEOA 4ZTPH 2VH5H 2VNCA 3RWJB 1C5DA 3VXQA 5JPNB 1BLNB 1A6PA 4QF1B 3F5WA 2X89A 3QFDB 5D9SA 4G6AD 1F4HA 3K1KC 1IM9A 2I60L 5B3NA 4HG4K 1LDSA 3OXSA 1U8OA 4QNPF 5I8EB 1KEGL 4HKXA 1LK2B 3VFUB 3BEWB 1A1MB 5AUMB 1DCLA 4MQXC 3EO1A 1A5FH 1FGVH 1YY8A 1IGFL 2UYLA 2VR5A 1NCNA 2J6EH 2I07B 3TA3D 4AQOA 3LRSB 2IWGA 5MEQA 3VXTA 3OJVC 4QY8A 4W6XB 4LRIC 5L6YH 1W72L 4YH6A 5TGBB 1K8DA 5HHXH 5ALBH 1QFWL 1E6OL 4ZUUB 5F1NA 4PGDB 4LHQB 3WDIA 2BNQE 3RZCC 1G9MC 3D39E 3D69B 1RZJH 2LU4A 4CJ0A 5CIPH 4DOHE 1XR8B 4XNQB 2E7LA 1OM3H 4OM0H 1R5VA 1DQQB 3MRRB 3NIGF 2PYEA 5IW3A 5SX5K 3TVMA 1DVFD 3GSRB 2Z35A 3JTTA 3IFLL 1IAII 2AAVA 3PXJA 2D03L 5C0DA 3HMWH 1EHXA 1F4WL 3ARTA 1IKNC 5DEFB 1IGIH 5EU5A 1KB5A 2DICA 1OT2A 1U8LB 3U4AA 4X5WB 1EPFA 1HYSC 3KG5A 2J8OA 5SWSD 3QXUA 4YHPA 3CCHA 4LQFL 2X89D 2WBKA 4NM4L 1N5YH 2QQKH 3WN5A 2VLME 2MPAL 4JFEA 4P2YA 3W5NA 4P2OB 4NOBA 5IFAH 1L0XA 3TA3B 1G9NL 3GSWB 3QHFL 1J0IA 1HYRC 3I2CH 3N85L 4IDJH 3C5ZC 4RQQB 3RWEA 3S96B 3TV3H 2X4QB 1LDPL 4JM4L 1OSZA 3MNZB 1NL0L 3GMOB 3GSXA 4HPOH 1S7UB 4S2SB 1Q0XH 2YD3A 3B5GA 5DMGD 2YK1L 5IIEA 4F2MB 5F7MC 3S4SB 3GB7A 3EYOA 4PRDA 3OR6B 4MJ6A 4HDIB 1U95B 1TZGL 2EE2A 1DSFL 1A6ZA 4Z76A 3ARUA 5GS1B 1FGNL 2Y25A 1CDJA 4GKNB 4XMKL 1DVFB 4PGBB 5DFTA 3WIIH 2DOCA 4FQHB 3ARGA 3QIWA 5DJZB 3VFGL 3G6JB 4PJXE 4MB5A 1F6AA 2XT1B 3TVMD 5HJ3A 3QDJA 1DQML 3RVXD 3RGVC 5SWSB 5IFJA 2CK2A 1BP3B 5ESVA 3PGDA 5FYJL 2X44D 1X5JA 4HFWA 4ZFOB 4KK5D 4MB3A 4TVPD 4JLRA 3RA7H 3HB3D 1IM9B 5DD5L 1U8OB 4NUJA 1WT5C 4XBPA 1R3JA 1KF9B 3EO1B 3HLAA 4JFED 4RAVB 1YY8B 3MRNB 1DL7L 3LN5B 3RIAK 3IRPX 3RVWC 1BOGA 1S7XA 4WUKH 1MPAH 5D96C 3S4SG 4NO2A 1TJHH 5EH1A 5E8OA 3BKML 4QY8B 3LRGA 3GNMH 4HQQH 4JY5H 3N1PC 1J1XH 3HAEA 3HZMA 5FO9B 3VGEA 1PEWA 4X9GA 3BZFA 4HUWA 4XNMA 3RZWA 2GT9A 3RZCA 3VXMD 4KH2A 2D0GA 2D9QB 3D5OF 4BQBA 3LIZH 4ONHB 4WCYL 3T0DA 4WI9A 1R5VB 1HKLL 1NKRA 1GSMA 1RZ8A 3K2UL 3FRUA 4MQ7A 5A40E 3TVMB 3S36X 4K9EH 5JW4N 3JTTB 1HEZB 3TBVA 4XAKE 4DW2L 3ARGD 3H3PL 5ESAB 4YIQB 1IKNA 1U58A 1EMTH 2R0ZL 2WLZA 3MACL 4JPWH 2VXUL 4NP4H 5DJ8A 5EU5B 3WNOA 5CBAB 3DO7A 2OXGA 2DI7A 4IJ3C 5I15H 1YEFL 4B53A 1N6QH 5I76A 2HH0H 43CAA 4U6YB 2FWOA 4YHPB 3CCHB 4MX7B 1RZ7L 5HSFA 2WUCL 2ADFL 1FVCA 1YY9D 1XCQA 3JWOH 4KTDH 1YDPA 4JFEB 5HDOA 3O8XC 5DRNB 2R0LH 2WMPA 3RVVC 4KFZC 4OB5L 3TNMA 3BPLC 5DVMA 4EDXB 3C5ZA 4KJQC 3RWEB 4YNYB 4WY7H 2HT3C 3K4ZA 2GCYA 5LAXA 3MA9L 1KCLA 4YDJA 1GXEA 2A1WH 4NFBA 1BFSA 3BUYA 3GSXB 4M7JL 3ZKMC 2CXGA 5C70A 3VXMB 4P59L 4GW4B 1KNOA 1CQKA 3MJGX 4DN4L 1GGIL 2EDWA 2E9WA 4JRXA 5TDPA 1LO5B 4PRDB 3ZO0A 3QG6B 4MJ6B 5HYJE 1MJJB 3C8HA 1LO0H 2DN7A 1AGFB 1K4CA 2NMSA 4MAYA 1E4XI 2ORBH 5IHBA 4YFEA 1S8DA 1JHKH 1AGEA 2ENYA 3R0MA 3S3SA 2AI0L 3GSNH 3KPNB 3ARGB 2ICWB 2Y4SA 4LQ1A 4R9HA 4CDHA 3DGCR 4NKDA 3SEPA 5HJ3B 1WZLA 4DZ8A 1C16A 1YEJH 3Q5TA 5IW6A 3NBNA 5IFJB 5ESVB 3PGDB 4MJ5B 3Q6GH 3Q6FA 4M48L 2X41A 2E5EA 1F58L 5D93B 1P4IL 5DHYA 1E6JH 3LKRA 3DX7A 2Q1EA 1DBAL 1IGTA 3IDGB 4TUKH 3BT2H 5IMMA 1FFPB 4NUJB 1WT5A 4XBPB 2CK0L 2PTTA 5C6PB 1T0MB 1CGSH 1R3JB 2DM7A 3B9AA 1I1AA 2BCKA 3T3ME 4BSJA 3HLAB 1NFKA 1QLEH 4DKFH 3QJFA 4BH7A 3T08A 3CZJA 2HYMA 4CNIA 4EN3D 1S7XB 4QNPE 3PDGA 1DQDH 1WV7T 3VGBA 4KHTL 1F2XK 1ETZA 5E8OB 35C8L 5DQ9B 4RWYH 4FQ2H 3C5ZD 4FFYL 4KKBC 3TN0D 1NJ9A 2BNQA 3D39A 3KXFD 3HZMB 1XGUA 3AMKA 3BZFB 3TYGL 1A7OH 1N4XH 2AK1L 4M6OH 1SJVA 4LCWD 4RGNC 2XRAH 4XVSL 5DLML 1AKJA 3O0RL 3SPVA 2YRZA 4JREC 4YHMH 3VFMA 4JRXD 1G0YR 3GSUA 3OTTA 2OZ4A 4HUVA 5BZDB 4TSBL 5CJ5A 4UNTA 1VADA 1CU4L 5CHNA 2AGJH 4EUPA 1P4LB 2P5WE 2BERA 5DK2A 4MAYD 1RZ8B 2F53E 2DYPA 3EKCA 3MUGB 2EE6A 4PB9H 4DUXA 3CVIL 3ZE1E 4HJ0C 3R0NA 3TBVB 1EEZA 2AEQH 4O9HH 2AXHA 4CVWA 4NO5A 1J1PH 3OF6A 1U58B 4JKPL 2V2WA 2X40A 4HK3J 4AL8L 4EVNA 5I76B 4L1HA 3DI2B 43CAB 1RZKH 4NGHL 3SDAD 1CFNA 1N8ZA 4F57L 1XCQB 4NKOA 4MLSA 4XC3H 1XF4A 5FECB 5DO2D 4LARH 3TGXA 3O8XA 1FG2B 3JTSA 4R3SB 5HDBE 4RFEA 1RUKL 2QTEA 1TVBA 4PUBH 4URTB 5C86A 3TNMB 4EN3B 2FJFA 4L9LC 2GAZA 1KJVA 1FO0A 1I1AD 3C5ZB 4XZUB 3TN0B 4HHAA 4B50A 3TIDA 3DGGB 1WAAF 4IBLT 2GCYB 3KXFB 3HI1A 2Z0BA 2KZWA 5JXED 3X14A 2HWZL 2P7TB 1BD2D 4MZ2A 4XNXL 3KLHD 4LCWB 1AXIB 5F1SA 1KNOB 4KUCF 3T65B 2BNQD 3D39D 2VIRA 2JF1A 5CJQL 5DJDA 2AEIT 4JRXB 1JWSA 5TDPB 3DWTA 3R06A 1YNTA 2BSTA 1DP0A 1WC7A 4QTHA 3JWNC 3H9SA 3TCLB 1K4CB 4N0YL 3T0WA 1T6VN 3LSOA 4MAYB 3QG7L 3ZHDA 5CEXA 2AJSL 1ZLWH 3V0VA 2VZOA 3K80A 1P6FA 2ADGB 4UOJA 4ZPTA 1SEBA 3IFPA 3MJ7A 4NKDB 2DYPD 5FKPA 5E4EC 2P1YA 4ALAH 1YYLH 5IW6B 2EIBA 3UJTH 1JMZA 4RDQF 2VDOL 3SDAB 2Z8SA 2DQEH 3SE3C 4HH9A 4O5LH 4HKZA 4N0RA 2MSPA 3NGBC 3OF6D 4HWBH 5DHYB 5DFVC 4JZJC 3X11A 3DX7B 2Z4QA 4JJHA 2VLMD 1IFHL 1IGTB 3RNQA 2R9HD 4D0BA 2EICA 2PTTB 1RK1A 4MXQD 5EC2A 1F4XH 2AW2A 1I1AB 5GS0D 1OAUL 4O2CA 1OB1A 3QJFB 1ADQH 4X5LA 1AIFA 1BD2B 1I7ZB 4L8SC 4YR6B 3OKDA 4G6KL 3QISA 5FHBL 3ES6A 3BN3B 1OWRM 3WDHA 3FKUS 1MCEA 1NJ9B 2BNQB 4KPHL 1P7KA 3D39B 2R2CA 2NY4C 5E6ZA 3MNVA 3BD3A 3ULUL 4KKLD 3T3PE 5BMFH 5EZIH 4DOHB 1CFTA 1LO2H 4FQ1L 1FYTE 1OHQA 4ELKA 1IC5H 1KLGA 4O2FA 3HMXL 1NC2A 5DJ2B 2VDMH 3WUZA 3SPVB 4X4XB 1YEGL 4M00A 5T1DH 4U6XA 1EBPA 3VFMB 3GSUB 1YN6A 1B6UA 4ZUTB 4JKMA 2DMCA 4JO2H 1T2XA 4QTIL 4KHXH 5C0FA 5ICYA 5FO7A 1VADB 2NXZC 5CHNB 1BJ1J 5JA8B 2Y5TA 2HA1A 2DYPB 2IQAB 1OAXH 5DUML 3KYNA 1CXKA 4EEEA 3DSNA 4XNYL 5JO5B 2VZVA 4NNXB 3MRLB 4GLRH 2VUYA 3O3EA 4XWOC 4LMQI 2BVOA 2MCPH 3KYMA 3RWGA 4ZDHA 5KW9L 1W2KT 4EVNB 1EGJA 2WLYA 3MGTA 3KPRE 4RX4A 3MZGB 3BD4A 1CFNB 1N8ZB 3QZWB 3JV5A 5A2JH 3UAJD 4HJGB 4XP5H 5F9OH 3OKKA 1FG9C 1XF4B 4ZS7H 2B0SH 2O26U 5I1HH 4P5TA 1ZTXH 3MYZA 4XPTH 1T83A 1HILA 4LMQE 4AT6B 3RWIA 2FJFB 2GAZB 3KHQA 1KJVB 1FO0B 4TNVK 3KS0J 4WHTA 3HI1B 3OAZH 1TVDA 4QCIA 5CBEA 2Y07L 2VRAA 1MOEA 2IADB 4GSDL 5HYJA 5E9DA 1I1CA 1I9JL 3WLWD 3CMGA 4NOFA 4WENB 3WUWB 4JE4B 3O3UN 2ZOKB 3HI6H 3WXWL 4JPKL 1NBZA 1OTUD 2NYYC 4JG0L 3F12A 3R06B 2BSTB 2AKRA 3VA2C 4EUPG 1WC7B 3OB0K 1AP2A 1A6VL 4Y5XC 1NC2D 4A6YB 3GJFH 3GK8H 4L4TE 3LSOB 4EQ3A 4PJXB 3TJEL 4YE4L 5CEXB 1AO7A 2E27H 5T3ZE 3ARBC 1V05A 5E2VH 5L9DH 4OZIA 4J3WA 4OV5B 4AG4L 5J12B 5MENA 4XAKD 1KN4H 2ICCA 4ZPTB 1SEBB 3IFPB 2FHCA 4X7DC 4XTRC 4Y1AD 3IJYA 4MS8D 3PL6C 1FJ1B 3QZWG 2GK2A 2APXA 4EXKA 4B7LA 2F54E 3SE3A 5D5ME 1ZK9A 4PRIA 4HKZB 3IDMB 4GQ9L 3AMLA 1NLDL 4JZJA 3X11B 3HKFA 2Z4QB 3O2WH 4K3EH 1RUPH 3ALXA 5ERWB 4U7SA 3RJQB 5F1IB 4D0BB 5ANMA 1RK1B 1FFOB 2IFFL 1LO4L 1WFOA 4O2CB 4NN5B 1FZKA 4X0KA 4P5TD 5DC4B 3QNZB 5JIIA 5CD5D 1SQ2N 3HZVB 4L8SA 2Q6WA 5ACMA 3WUWG 1EDQA 5F71A 4CU8A 4S1RL 4P9HL 1AQKH 1P7KB 1RZFH 5E2TL 5E4IA 3G08A 2G2RA 3MNVB 4L3AA 3S36H 1OSPL 1CFTB 1KLGB 4BK4A 5HYJD 4O2FB 1CBVH 5E2UL 1NC2B 3V6OC 2NY3C 3KPQA 3GHEL 4U6XB 1YNKH 2XG5A 2F53A 1HK6A 1IILE 1YN6B 5TQ2L 3UTPD 3TP4A 3DVIA 3X13A 4AJ0A 1U8NA 5ICYB 1X9QA 2EDQA 2Y5TB 1TETH 1NDGA 4XC1L 4Y1AB 4KTEL 4M3JA 3TBTA 1ZGLP 3O3AA 2QSCH 1DDHB 3JBG7 3O9WD 3PXHA 3VGDA 3PHSA 4PJBA 3O4LA 2YD1A 5I1GL 4JFFA 2DQTL 3ULVC 3QXTA 1WSST 3WXVL 3O3EB 1KTKE 3QDHA 3M1BA 3QDME 3MGTB 4R4FH 4ZUWA 5IT2H 4WU7B 4O51A 4TNVF 4IRZH 1NCTA 3OKKB 4N5UA 3QFJD 3OKYA 3OAYH 4P5TB 4Y89A 3TFKD 1KC5H 3L5HA 2I9TA 1FORL 4OD1L 3SO3B 3A6CL 2XKNB 3BH9A 2LVEA 3SDXF 1QBBA 4RISL 4OZFH 4AIOA 5HPOA 4UOW0 4LDEB 3CNKA 4W70A 4C54A 3BGFB 3W82A 5HYJB 5E2WL 4F7TA 2NY4D 4JGMA 4FZ8H 3INUH 1QFWI 2X4NB 3F12B 3KPLB 4BKLA 5I19H 3VWJA 2FL5A 4Y5XA 1ZGLM 5JQ6L 4OBRA 1ZLVH 3TT3L 1MAMH 2P5WD 5DR5H 5SWQA 4TNWK 1MWAH 2EYTB 3O9WB 4O58H 4BZ1H 4P23C 5EC1A 3U0WL 3MUHL 3UROR 3VXPB 3DMMD 3IJYB 4AQ1B 2IFGA 3PL6A 4BH8B 2XZCH 5CEYB 4IS6A 2DQUH 1JNNH 3IU4H 3QFJB 3V4PL 1HDMB 2JE8A 5CKAA 4PYGA 1JGVH 2WM0A 3MFFA 4YBHA 4WTZA 1INEL 2EDHA 4U33A 1FQ9C 3IFOA 1S9VA 4ODUB 5DT1H 1SMOA 1H8OA 1G6RA 3D1MC 1ZHKB 4TSAH 4YHOH 1G7QA 4PGZA 4X0KB 4OM1L 3U30C 2FGZA 2QHLA 4L8SB 5GISH 2RCSL 4NCDA 5DMJB 5F6HI 4KRNA 2CKNA 2NY4B 1WZKA 2G2RB 3U0TA 3BKYL 1WBYB 4AMKH 5DD6A 4X7SL 2E6PA 1N0XH 2UY7A 1HHHA 4LVOC 1X5XA 1O0VA 5MI0C 1FVDA 4UQ3A 3QA3A 4NNPH 3DVNA 1FCGA 1AY1L 2P5WB 1FAIH 5JNYA 2CUIA 1LO3H 2CRYA 3IDIA 4M6NH 1K5NB 1S7WA 1XGTB 1MRFH 1U8NB 2GITA 3VWJD 4Y4KC 4UAOB 1B4RA 4LK4A 3UBXI 2Z92A 1NDGB 1YEHL 3SDYL 2XY2A 3DMMB 1R3LA 2D7TH 4F58H 5TE7L 3TBTB 4TRPH 1G0DA 5BVPL 5CD3A 4DTGL 3O3AB 2XYCA 3ESVF 2EIDA 4NKMA 1VDGA 1UM6H 1MCCA 3KPRA 3O6FC 4G80A 1UM4L 1D5IL 3P0VL 5HHPA 3PL6D 4PY8J 1QZ1A 5HTSA 5J06A 1EK3A 1VFBA 2X4OB 2NXYC 3CJJA 4ONOA 2FEDC 3KWWB 5EZOL 4PR5B 4MD4A 1XFPA 3QPXH 5LCVH 2PKDA 4IOSD 1CICC 1S5HA 1XGYL 5DJ0B 2NY7H 5CLTA 5JW4M 1JPTH 1F02I 5FYJE 1BWMA 3KAAA 4KKCC 5KS9F 1MFAH 4WV1C 2F9BT 5CEZL 2HRLA 2R2BA 4LEXL 5J8OA 3L7EA 1CK0L 4LRNL 3L5WA 2DIBA 1FYTD 1M71A 3ULUF 1V3LA 5KAQG 4L4TA 4WFHE 2JCCE 1UKSA 4TNWF 1SVCP 5MERA 1S78D 2JJTA 4G42A 3VWJB 2FL5B 2H9GB 3BXNA 3O3DB 4HJJL 2YD4A 2O5XH 5ADOL 4PJIF 4QRTA 2NY3D 4PGCA 5F1OB 4CL7A 4PJFF 5EOCJ 1Z3GH 5HGHA 2Q8AL 5IWLC 3G04B 2F54A 3U7WH 1FAKT 5I73C 2DJUA 5D5MA 4M7KH 3FQRA 1AHWC 3MBEA 3PL6B 3JWDC 5D1XC 2YUWA 2XV6B 4NQVB 4HWEL 3LQZA 5MP6H 2OR8A 4JN1L 5F9WC 1RFDH 5E99L 5D6CA 3KPRD 1FL6B 1Q1JL 2OJZH 4DVRL 5D8JL 5DJXB 1N2RB 2CMRL 5I2IB 1TPXC 1A64A 5I6XC 3IETA 3MFFB 2SEBA 3Q3GA 4OKDA 3ROLA 3W5MA 1QVOA 1GHFH 2MWCA 3QNYA 1NBVH 4X5XA 3PHOA 3V6ZA 4XPAL 3ZDXF 2EYRB 1I8MA 2YA0A 4L3ED 4OCYL 5EFIA 5L2KA 1FZJA 4GAFB 1FYTB 4LHUD 4MNHA 1GZPA 4JHZA 5F7YC 1P6AB 5LBSL 1UM5L 3ZKQD 4RNRB 1IEHA 5DD6B 4JPIA 1LMKA 2CO7B 1HHHB 1RIHL 2K7PA 4JFPA 2H2SC 4YC2C 5T1LA 4LKXA 4FQXD 1A4KB 3V9FA 4JN2B 1ORQA 3TZVC 2NY3B 1J18A 3DVNB 5D2NE 4L4TD 5JNYB 4NZRL 4PJ8D 1S7WB 5C0NC 4KZDH 4MMXC 2GITB 3HZYA 5T3ZD 1OAKL 1T7YA 3T0EE 2Z92B 1WBXB 2BY1A 4K7PY 5J13B 1R3LB 3NCYP 1JTPA 2XWBA 3OHXB 3EOAA 1Y6KR 2DAVA 2R1YB 3VGAC 2NX5E 2W9EH 1T66C 5CS7A 2OSLA 3QDMA 4M5YL 4NKMB 2VXQH 1RZGB 1NMBL 3KPRB 4JFHE 2DQJH 3RTQC 1DUZA 3FO1B 3MBED 4IRJD 4WI5A 1Q9LB 2HJKA 5HHPB 4WTZG 1BEYH 3BKJL 4G9FE 2W60A 5CGTA 2VDPL 1UH3A 1VFBB 2YC1A 2ENSA 4PRHE 1LVEA 4MD4B 5GGTL 5K93A 4KY1L 1LK3H 4L3EB 2A9NL 2A6JA 1CICA 3BOVA 1MSPA 1YYML 2D0HA 1FNEB 2X6MA 3QUMA 4ZQKA 2B2XL 3QO0A 5JLZB 4LHUB 5KJRH 1OP9A 1U8JA 1CFBA 2VDQL 4KVCH 4WV1A 4R0LB 2HLAB 4FHBD 4JANB 3L7EB 4R8WL 3OKLA 1JPGB 4I0PC 2VLKE 5FOBA 4XP6L 5H35A 2XA8H 4E5XA 5T3XL 2GUOA 1MNUL 3EUUA 3D85A 1PLGH 4L4TB 1L7IL 3N9GH 4PJ8B 5J7CC 1W72A 4XPBL 3MJ8A 5T5FL 4G42B 5KSVB 1NC4A 5BOZG 2A2QT 2DKUA 4J6RL 3AROA 4QRTB 4HULB 3D6GA 4PGCB 5I75B 1J12A 4DVBB 2FATL 3JWDH 3NFPA 5AZ2L 3L3GB 1U8IA 5IWLA 5FV1L 5D2LF 5IVZA 3ZKND 4LLUA 1CT8B 1ZEAH 2F54B 4JRWA 2QQLH 3MBEB 4IRJB 2IBZX 5MHSE 5K9JL 3KYAA 1YNLH 2DLFH 2CKBL 4WI4A 3WFEL 3B6SA 4JEGB 5ID1A 5EBMA 5LGHH 1ZLSL 3TWCH 3V4VH 4OAWA 3MQIA 3O2VH 1BGXL 1BQSA 1D6VH 5ENWB 3VFTA 1TVHA 3BSZH 4KRPC 3STLB 3CMOL 2DLTA 3ROLB 1QVOB 1QFPA 1Z5LA 2JJWA 4RA0C 3FQUA 3RVTC 4BJLA 4GRWF 3HS0B 1NCDL 1I8MB 3U30B 5KVMC 1P4BL 3DVGA 3MRHA 3FCTB 1AJ7L 1BBDL 4PJHE 4LPXA 1T0NA 1VPOL 1GZPB 1FSKC 4HKJB 1MIML 4GJTB 4LLAA 2ZZUT 1D6EA 1BVZA 3IXAB 5D2NC 4CW1A 4ZG1A 4AH2A 3TJHC 2GI7A 3EZ8A 3AB0C 1F13A 1CYGA 4LVOB 4XP9H 2HP4A 4JFPB 3BP7B 1PEZA 3L5IA 4UBDC 5DA0B 1ORQB 1GC1C 4LCUA 3T0EC 4C58B 3D85D 2OMNA 4K3JL 4Q74A 1RZIB 2A73A 5FYKL 3SGKC 4DKEL 5C0IB 1QR4A 4ZTOL 2R0WL 1NC4D 5MEPA 1CDCA 4QLRA 5H8DA 2EDYA 2OM5A 4V1DE 4G43A 4G6JL 4Z0BL 2DQDL 1FL5A 3C5SA 5C07E 2YR3A 3ZTNH 3MYJB 1QSEE 2W60B 1BFTA 1CGUA 1VKXB 2RBLA 2HFGH 1I7RA 2X1PA 2YC1B 2EXWD 3EOBA 4X6CF 4XH2A 5E5UB 5JHDE 3OPZL 4JHWL 3R1GL 1AGBB 2ZUXA 3CFCL 5HHQA 1W8NA 4P3DA 5KSAC 5FGSA 2A6JB 3I50H 1T22B 3AREC 4KK9D 4PLKD 3CVHA 5IMKA 2VLJE 5FGBC 5DS8B 4ZQKB 3MODH 3QO0B 1SY6A 1U8JB 2GEEA 4K3HA 4OCSH 5A2FA 3C8DA 3KLAA 1XCTA 1OTSC 2R23A 4P0DA 2JCCA 3CC5A 4ODSL 4I0PA 1SBSL 2F15A 3GZKA 4PGEA 1I9IL 4HIXH 3D85B 4U1NA 5KS9E 1QNZH 1W72B 1V7NH 5AD0A 3MJ8B 4OLZH 1CF8L 1D5XA 3DBXA 1NC4B 2IH1A 2Q8BH 3ROOA 1AE6L 3VDCA 3NZ8B 1G1CA 3MRQB 3ULUE 2W9LA 3PWJA 5FB8A 1FPTH 4PRAA 1UKTA 2OR9L 5IVZB 4LLUB 2FJGA 2AV1B 3EO9H 1IC7H 1K6QH 5H37H 1P7HL 2XPGA 1G7JB 4LSSL 4D0DA 4FOMA 4ZS6C 1EO8L 4PJIE 4K07A 4FFVD 4PJFE 3O4OC 5F9WB 4H0HB 4P9ML 1NBYB 3I3DA 4DQOL 1DR9A 3GO1L 4YK4B 3V5KA 3B6SB 5ID1B 3IXTA 5EBMB 5J6HB 2V17L 2NTSP 4OAWB 3ZDZF 2QADD 1RUQL 1C8PA 1CGWA 1JI1A 4NIKB 5DMKA 5BV7C 3WSQL 5C0CD 3GIZH 1JGDA 1MCOH 1Z5LB 1QBLH 1FLRH 4NZTL 1JHLH 5FYJD 2DM2A 3S37L 4JHAL 3DV4B 3CDYA 3U6RB 1OF2A 4G3YL 1UEMA 3MRHB 3DVGB 4S1DD 3ZYOA 4JRYE 4F15B 5HGDA 5CINH 1S9WA 4Q9QL 4XMLH 1IAMA 1T1WB 1T3FA 3EAKA 4MCYA 4ONFL 2DQGH 4X99A 3KPPB 4YZFE 4GG8A 2Q76B 4FG6C 2FHBA 5D2NA 3RVUC 4AEHH 2BRRH 3OSKA 2J1KA 2Q7NA 4WFHD 4XPHL 3VDBA 4AH2B 2Y5EA 2ICEA 4OIIL 4YC2B 1QKZL 2D3VA 4I3SL 3T0EA 1C1EH 4LCUB 2DQCL 4RFOL 2C1OA 2D0FA 1KSRA 3LPFA 2A73B 4GG6F 4POZD 5IBLC 3LPWA 3V6BR 2NX5A 1VFUA 4H5SA 5D7SH 2YPVH 3HFMH 3C5JB 4M03A 3P9LB 4G43B 2QQQA 4PY7B 4TPRL 3UBXB 4G9FA 4DCQB 4I3RL 4Z77A 4K3DL 4O4YH 4RDQG 4FFWC 1A7QH 4HLZH 4PRHA 5FYLH 1FL5B 4U1IA 2VZTA 3VU2A 4MDJA 4OLUL 1T21A 4NDMA 2QADB 2H26A 2OL3L 2XZQL 2GK0B 1JL8A 3S5LB 4XVUD 5C0CB 1I7RB 4GRLD 3EOBB 4XH2B 3FJTA 1X6NA 3HTLX 1NAML 3VI3F 3FQXA 4N1EA 1OTTD 2VZUA 3WNMA 4P3DB 3ARRA 3QCVH 2R15A 3AREA 2P45B 4I5BA 5I18H 5K9KA 1GGBH 1XGRA 3VD5A 5FGBA 3U83A 2D2OA 2VLKA 2W92A 4G9DA 1MLCB 1AQDA 4HGKC 4ZFFB 5C2BL 1KN2H 4KXZI 4Y5VC 3QBTB 2W91A 1MFCH 1XCTB 1WCQA 1YN7A 2R23B 2YUVA 3FN0H 2JCCB 3CC5B 5TFSH 3WFDL 3HNVH 1CR9L 3WIHH 4K94H 4Q6YA 2YD2A 3X3GL 1IGML 4U1NB 4H1LA 1HH9A 1Z2KA 3IDUA 4YDVA 4LSPL 2R1XA 3NFSH 3DBXB 5I30L 4JZOA 1KCKA 2IH1B 4UTAL 2ZG2A 3ARSA 3UBXG 1QPPA 1YMHB 5GZNC 4AEIL 2W07A 5FB8B 5CJOL 2NX5D 4M1DH 5DWUL 5F21B 1BQHA 3X17A 4J1UA 3NIFF 3LKNA 4JO3L 4XBGA 4M7ZC 3S5LG 3QHTC 5GGQL 3GMQA 4G9FD 3W2DH 1EFQA 3GBNH 4DAGL 1KYOK 5B38A 5EBLA 3V5KB 1UWEH 5D2LE 4YWGH 4PRHD 5DVKA 1F8TL 1JNHA 3TNNB 1CLYH 4WEBL 3S35H 4UT9L 4JPVH 8FABA 4XCYA 2OQJA 3LB6D 4F7CB 5HI3C 1MJUL 4JFZL 2NY5H 4HFUH 4Q0XH 4PJHA 2DF3A 1HXYA 4K2UH 1OF2B 3PGFL 1AXTH 4DN3L 2J8HA 3ARED 5HGDB 1ZT7B 2AJYH 3NAAH 2OTUB 3P3YA 4WW2F 4HV8B 4MXWH 3DI3B 3WS6C 2WWMC 1T3FB 2ZG3A 2VLKD 4KDTC 4X99B 5EBWA 4GG8B 4NFDA 2LAGB 3MRCB 5GS0H 1A7BA 1R3IL 5D2NB 3GKZA 1QQDA 3AB0B 2ICEB 1AC6A 4KDWA 4AK1A 5F7UA 3HHRB 2VL5A 3C2AL 3O2DL 4P49A 1MRDH 1JWMB 1RIVH 1QYGH 4V1DA 2BMKB 2OP4H 1NMCC 1HWHB 2Y06L 1F90H 4EI6A 1YQ2A 2J8UF 2NX5B 5CAYB 1M7IA 4GOSA 4WVRA 2J3SA 5AAWA 3I3BA 4W4OC 3MJ9H 4OFIA 1CVRA 4PLJD 5EWIL 5C07A 4HWZA 3V6FB 2J5LB 4G9FB 4Z77B 1GH7A 3K7UA 5KTEH 1UG9A 4I8DA 3TCXA 1NGXA 5L7XH 1AD9B 1TCRB 4PRHB 4KQ4L 5JHDA 4U1IB 3AFLA 4MDJB 3ZE0F 4M43L 2ED8A 4Z7WE 4A6YH 3PV6A 1WWBX 5TE4H 4E0RB 2FO1A 4HS8H 1NCCH 1CLOH 5EU7C 3FQXB 1FIGH 2EDKA 1CTNA 4H8WH 3FTGA 3K8MA 2HFFA 4OT1H 4GKZB 2QHRH 3AREB 1OAQL 3UPRA 4HS3A 5K9KB 4OLWL 1JPSH 5F9JA 5F3HB 3AY4C 3K3QA 4MJ2A 2VLKB 4X6CE 2FSEA 1UA6H 3WKNA 3QUKB 5IM7A 3T2NL 5GRJL 3UPCA 3VRJB 4MA8L 2YN5A 1T03H 1YEIH 1NFDE 4M9OA 4MA1B 3GM0A 2VZ1A 3D87B 1RU9L 4H1LB 4M7LH 1QR1A 3P77A 2E7HA 2IANE 2A77L 2E7BA 4G8IB 4JZOB 1GPOH 5JR1L 1IEBA 4V1DD 1U93B 3U1SH 4Z7UE 3B2VH 3JXAA 2HMID 3E2HC 4J1UB 1V8HA 1JK8A 5AZEL 1VGKB 3LKNB 4OFVA 2X2YA 3QI9A 4P4KD 4U6HA 5C07D 1U6AL 1RJLB 3CX5K 4LIQL 1QSED 2ZUWA 2R56L 3BHBA 3C6LC 3PWLB 4UZGA 4YXKL 4Y2DA 4L5FH 3T8XA 5IQ7L 5JHDD 1FBIH 1JNHB 3QQ4A 3GSOA 3RX5A 12E8H 1I8IA 3QUXC 1S7QB 1CZ8H 4ZFGH 4R90H 8FABB 2IGFH 4XCYB 1VACB 4OZGF 3BJLA 4JRYA 4YX2L 2VLJD 3BMWA 5GJTH 3B8SA 4I18B 4UI2A 4JR9L 5DRZB 1B2WL 3QRGH 4ZAKD 3QR2A 3VW3H 2B7DT 3M8OH 4KROC 2IMNA 2AVGA 4PJAF 4KDTA 4H1LG 4DJMA 3GRWH 4PBXA 5DVOA 4QHMB 5EBWB 3D9AH 2BNRA 3CLFH 3GI8H 1FC2D 4JO4L 3RRQA 5B39B 5TF1H 3KPMA 1QQDB 4LSTL 1J0JA 2F19H 2Y1VA 3GMPA 4XI5D 1G7PA 2K1MA 2KQNA 3CXDL 3PQYE 4JDVA 5E00A 2VL5B 1AH1A 3FMGH 2DLEA 4XHQA 3DUUA 1JJUA 4V1DB 4FQIH 4NQDA 3OR7A 3NTCL 4OZHE 3ULUD 1XF1A 4CDGC 3E3QE 1KEMH 3CFEA 5CZKA 2R4SH 4W4OA 2OCFD 3J8F7 3X3FL 1A4JA 3NACL 4P4KB 1HZHH 2G75A 5C07B 3HUJE 3NCYS 1QSEB 4GRMA 5E0QA 4IMLA 2V9TA 2CDFA 4RGOH 3L3DA 5JHDB 3HNTH 3GMLB 3QI9D 1TZIB 5C6TL 2H1PL 3O41A 1J1OL 2PXYD 4R6UA 4Y2DD 1EAPB 2VLJB 4NRZA 5JHLL 3FTGB 2ZCHL 2HFFB 3UJJH 1IBGL 3GKWL 4ZAKB 4H0GA 4JRYD 1O7VA 3U9PL 2B39A 2FSEB 1JHTB 5B39G 4UDUB 3ULSA 4LOUD 3KR3H 2ZSWA 3D18B 4HMDA 3UDWC 5IQ9A 1TTFA 5KS9B 1Z9OA 3U7YL 2EEBA 3AAZA 4NN6C 1DBMH 1FN4A 5IEKA 1CD8A 3HG1A 4G8EB 4GXVH 4XHJD 4W68A 4H88L 4FNLL 1QR1B 4HAGA 4S1SH 1OLZA 1WJ3A 1V3MA 1H5BB 2YXMA 4KJPC 2LQRA 4UTBH 4ZO7A 5L6YL 3SDCD 2WK2A 3WKMH 2XTJE 2P24A 1IEBB 4OIAA 4LLMA 5ALBL 3H9ZA 1A6AA 3DRTA 3AU1A 4PJIB 3D0LB 2ATPA 3SJVE 2OTWA 4X80H 4PJFB 2C3VA 3MOBH 1ZT4B 4RSVA 3HZKA 3QI9B 4U6HB 5E1AA 5IHUH 2AJUL 2PXYB 3N1QC 4KV5F 3BHBB 3C6LA 1I85C 1UJ3C 3EJJX 5FA3A 4Y2DB 2GJZA 2Q20A 3VD4A 4U1KA 2DS4A 1I9RH 3QQ4B 3GSOB 1I8IB 3VI4E 3QUXA 2DQHH 1XH3A 5JUEH 1KB5L 2UVEA 5DDHB 3G9VA 4G8FA 3HRZA 4MVBC 4Q7DA 4R26L 4JRYB 1CIUA 1QLFA 2IBBA 4NWTH 4CN1A 1YECH 3FOLB 1NDMA 1IGIL 4Q9RL 2VXVL 3LDBC 2P48B 4GAGH 4HEME 4I0CC 2L0DA 1T5XA 3A6BL 5M95B 1FIEA 2I9LB 2PO6C 3VG9C 4PBVC 2R0KH 5IB1B 1A9BA 3MRDB 2F5BH 5FGCE 2ILLA 3S88L 5HBBA 5DJCA 4KZEH 5D70H 3BVNA 1MHPH 3MLSH 4GFTB 1CD1B 3RL1A 2H3NB 1OCWL 5FUZL 5EIIA 4UIKL 2M1KA 5E7FA 4FQQA 1NMCB 4HPOL 3OR7B 2WINB 3EFDL 1JV5B 5C0JA 5CZXD 4YBLC 3SE9H 1BQLH 1B88A 1UWGL 1TNMA 2G75B 3V0WH 5DJAA 5IB3B 2AS5M 4Z7WA 4KAQH 4GRMB 1U8KA 1KELH 1ZHLB 4DKDC 3L3DB 4Q97A 3WFBH 3WD5H 4UU9A 5IVXF 1GGCH 3N1MC 1JYXA 4TVSa 2DMBA 1KJMA 3QAZC 2BFVH 1I1YA 3DVFA 1EXUB 3LKQA 5HHNB 4OFYD 3QNXA 1C12B 3L3HA 1N7MH 1FE8L 1IM3A 5DA4A 1CFQA 1WGOA 1F6LL 1UJTA 3FT2A 2DQIH 2IPTL 2DDQH 4NC0B 2DKSA 1RQ5A 4HXBL 3PWPE 3VRIA 3RA7L 4YHYC 1NFDA 5FUOH 5IV2B 2CGRH 2CJUL 4JB9L 1IGJA 2CUHA 2H32B 3UDWA 4QXGH 4DEPB 5IQ9B 4Y4FD 3ZL4L 5CJ8A 2APBA 2X4TB 2YPKB 1FN4B 3RAJL 5K59F 1RJZA 4OSUL 4OD3L 5GS3A 4PRNA 4R2GC 1XZ0A 1G7HA 5T33H 2AJ3A 4WUKL 2NW2A 3BX7C 3OX8B 3MLRH 4TOYH 4Z7UA 3R8BB 3PWUA 1PKQE 1C08A 1G9ML 5D7IE 4JY5L 3E0GA 1XAUA 1F3RB 3C87A 4YHKL 4HKBB 1A6AB 2YMXH 2A0LC 3AVEA 3AU1B 3DRTB 2OTWB 1B0RA 2R2HA 2C3VB 4YPGA 5T1MB 2JB5H 3HZKB 4HEPG 5D2LB 5CMAA 1NCAH 1PGRB 2YUZA 5E1AB 1HOCA 4UB0L 2EZ0C 3B43A 5FYKE 5ISZE 1UJ3A 4WHDA 5FA3B 2D7OA 2GJZB 4XWGL 3B9KC 1R5IA 4U1KB 2JELL 3CK0H 3WNKA 2AJVL 5SX5H 2BVYA 1FNSH 3FO0H 4KMLB 1XH3B 4ENEC 4LVNC 4KKAC 4IOIA 3HRZB 5KOVC 5IGXL 1UCBH 1IKFL 2AK4D 4LGRB 2ZNXA 4LSUH 4O02H 1QLFB 4WFFE 4JPWL 1EMTL 4ONGH 4UNUA 3VXSE 3IDXH 4P46D 2BOBA 3A0OA 3LCYA 4PY8I 1T5XB 4GRWB 4Y4FB 4LDOB 5F72S 2PO6A 1HXMA 3CSYA 3VE0A 4OZGE 4UINL 5L8LB 2A6KA 3EHBD 2PUQT 5DC9B 1A9BB 4Y7MA 3H9YA 2EEDA 4PS4H 2D4DA 1ORSB 4FP8H 3TO4C 5DJCB 3BVNB 2M2DA 1S7VA 2IAND 3MLYH 4OZHA 4ZODA 4DZBA 4NWUH 5GGUB 3RL1B 5L88H 3BQUC 2WUBH 3VMOA 1OAZH 4FQQB 4POUB 2BVTA 3HUJA 5C0JB 5I74B 1KGCD 2YHGA 4MAUL 4YXLH 1OGAA 3LQAH 5HPMB 3DX8A 4CVZA 5EUOE 1RAMA 3CXHK 3EOTL 3K46A 5DJAB 1M7XA 1JFQH 1NCBL 1B6DA 4QOKE 5IB2A 4M6ML 1MREH 4WI6A 4M8QA 4UU9B 3QIBC 3SCMC 2HT4C 4KK6D 3ELAT 5T3ZH 2MOVA 3F58H 4NO0A 5AWNH 1TQBC 3GSNL 1YPZF 5DMIL 2FBOJ 5TPWH 1I1YB 2AK4B 4GS7C 2FX9H 1LE9A 3C08L 4K7PH 5D71H 4EI5D 3GUTB 1VGEH 4X6CB 4KRMB 1IM3B 4QRRD 5CP3H 1CFQB 1QSZA 1YEJL 1S7RA 1ED3A 4NZDA 4K8RC 1D5ZA 3LS5H 4ODTH 1NFDB 5HVHB 3EJYC 4GKSA 5C92A 2EDBA 4RMQA 4TUKL 3MCLL 4P99A 4PRPD 4GAJL 1WTLA 3FONA 4XVTL 2IANB 4HS6A 3IKCB 1MHEA 1RJZB 5IBTH 5CUSL 4DKFL 3PQYD 4PRNB 4GMSL 2QL1A 1G7HB 1QEWB 3FZUD 1CI5A 2AJ3B 5CEZD 2ERJC 4Z7UB 4OJFH 4YBQC 1HCVA 3SJVA 2Z8WC 3EJZD 4FQ2L 2R29L 5L0QC 4YHZL 1AR1C 1G7MA 2GSIA 3CLEH 4YDIL 2BJMH 1DFBL 2A9ML 1N4XL 4XX1E 5I8OH 4OF6A 2XRAL 1K2DA 1CDIA 1B0RB 2KDGA 3BP6B 4HCRH 4NQSB 3NA9H 5CMAB 3V5HA 3UYRL 1M7DA 3SOBH 1EZVY 1HOCB 1MEXL 4CAGA 3RGHA 5F7EL 1RURH 2ADIA 4M62H 5F9AC 2EDEA 1RI8A 3BO8B 4LVHB 4EI5B 4PB9L 4FQPA 4NO0D 3G5YA 4QRRB 1WFUA 4NQEA 1ZHNB 4KV5E 4LSRH 1J1PL 4J3TA 5DHVB 3NA4A 2QQNH 2BSRA 3MLVL 5EN2A 3LDBB 3DXAD 3GI9H 2ADJA 1Z6JT 1NMAH 1IAIM 1DANU 1YQVL 4PRPB 2RIKA 5KSBE 4QHNB 2PCPA 3CSYB 1HXMB 1F45A 3MXWL 4LCYA 2HTLC 3D0VA 4N8VA 2DB8A 1FO0L 4D9RE 1AXSA 2A6KB 2GY7B 1C5CL 2G5BB 3PQYB 5C0EA 4L8BA 4XXDA 3TO4A 4N90E 5IF0B 3GJEA 5IEHA 5ITBL 5C0AA 2W65A 1J5OH 1FVEA 3BQUA 1WTGT 4R2GD 2PYFA 2O93L 2XTJD 5I1CL 2YZ1A 1ODAA 2HT2D 5DJYB 4NC1E 2VR4A 1R24A 3PF2A 1IVLA 4HGWA 5ID0A 3I02B 1JGUH 1BJMA 3MOQA 4CVZB 3I9GL 1G84A 4R4NC 4PIRF 2H6PA 1BBJA 1UC6A 5DD1L 1OW0C 4ACPA 4S1QL 6CGTA 4PP1D 2BP3A 1NSNL 3QIBA 4M8QB 2ZOLB 3QUZC 2OJEA 3HE6C 4JAMB 1QFWH 3QH3B 1E6OH 4NO0B 5DK0A 4IRSC 1N0LA 1BPVA 1PAMA 1LE9B 4K8RH 3FRPA 1MELA 4EXPX 3MTRA 5CSBA 2W1NA 3MRKA 1S7RB 4HUMB 1HSBA 2DQEL 2BVPA 4IMKC 1D5ZB 4HWBL 2WIMA 4GH7B 4MWFA 4XCEA 3IFLH 1F4WH 4U0RC 3FONB 3O3BA 3BGMB 3RWFA 4HS6B 5GPRA 5F7LB 2F8XC 5I1AA 1NPUA 4K71C 1PKQA 4CADA 4WO4D 1T89C 5D7IA 3CDFA 4PJDE 4R2GB 3QXAA 4LQFH 2XTJB 3MRJA 4NM4H 1HHGA 2MPAH 5J1AB 4H20L 5T3XD 1P2CB 2HVKB 5BMFL 1G9NH 2D7MA 1RUAL 4XCNA 4Z7QE 3K4AA 1DE4B 2X4PB 3QHFH 5ISZA 3N85H 3ZDYE 3F7VA 5C0GA 1LDPH 4NQCE 4JM4H 5T1DL 1NL0H 1M7DB 4HWUA 5FV2A 4PYHA 2F74A 2B4CC 3O6LH 3D25A 2HT4D 4P2RE 3PHQB 4J3OC 1UZ8B 1IL1A 2EECA 3G5YB 3VXSA 4ZUVA 4YEFA 5BZWB 4NFCA 3RWHA 1TZGH 4X6EA 1EGJL 1DSFH 1ZT1A 1UH2A 5EU4B 4BFGA 3OZ9H 5EN2B 3PWPD 1AGCA 2MCPL 2ADJB 1GIGL 1DLHA 3BAEH 3VFGH 5F6IB 4K3GA 1OQOA 5FGCB 4YFLF 5AYUL 3VFNA 1X7QA 3RQ3A 5BVJA 4LCYB 1PSKL 1HHKA 2Q86A 3QDAA 4WW2B 1DQMH 1HN1A 4OLYL 4ZS7L 4WO4B 3GMRB 5I1HL 1X5GA 4XPTL 4XXDB 5ITFA 3QIUC 5FYJH 5F7NC 1OQXA 1CVSC 5J3HD 2FB4L 5IROA 5IEHB 4WJ5A 2W65B 4IIQC 1FVEB 3UZQA 4RRPA 4XB8A 3RJDA 3LEVL 1SMAA 1CD0A 4QRSA 4AIXA 1K3ZA 1K3IA 3MV8E 3MUY1 4PJ5A 5CKGA 3BN9D 5EUOA 1T2JA 4QOKA 1R24B 1YEDA 2HJLB 3FO9B 2EC9T 1HSAB 3O45A 1Y6MR 2YZ8A 5TJWK 5HI5C 2EC8A 4YHNA 1WZMA 3ECBA 2EKSA 1OW0A 3BKMH 5FYKD 3V7AE 2NCMA 3HNSH 5T1KA 1KPVA 3GK8L 3P2TA 3HE6A 4HSQA 1VESA 2X1XR 1U8PA 2DL9A 2NPLX 4BZYA 2CIIB 4LLVB 5L9DL 4MCZA 2IALA 3SGDI 2P8LA 4I3GA 3ILQC 1T4KA 4Z18A 1ZWIA 2A74B 4JG1L 4RGMC 4BFEA 3QWRA 2CKBB 3PWPB 4WFFD 4AM0B 4WCYH 5GGRA 2PR4L 4C55A 2WAHA 2R1WA 1FNFA 3VXSD 3FB8A 3MRKB 2HTKD 4OF0A 1FL3A 4N8VG 3CDCA 5BRZE 4QHKJ 4PTUA 3PWNB 2BVPB 4WGWB 1HKLH 5DQJB 3RI5K 4F7PA 3EDEA 3H9HB 4U2ZA 3HE7C 3LHPL 5KVGL 3VGGA 3OXRB 3WMSA 2VXSH 4UT7L 4MWFB 3O2WL 4XCEB 1RUPL 3BZ4A 4X7CC 5BS0E 1XF3A 5DD0L 5F7WC 5INDB 2HN7B 3O3BB 2IG2L 2R0ZH 3MACH 3CFBA 4NN7B 3RX8A 5JMOC 5MEOA 3SDDC 4HW6A 1PKQB 2BDNL 1T89A 1YEFH 3MLZL 5D7IB 3LS4L 2PW1A 3SKMB 1KTLA 2LFGA 1RZ7H 2XTLA 1HHGB 2WUCH 1IE5A 2ADFH 1UACL 1NUGA 2G9HB 3BPNC 4Y4HD 5GQBA 5DYOB 4W81A 2UZXB 4OB5H 2OYPA 5CILL 3VD9A 4XCNB 4EDWL 4F7MA 2X1OA 1EUUA 4XAWL 2HRPL 2ZCKL 1J0HA 2CO6B 3VMPA 3F7VB 4QOKD 1INQA 4QWWC 2B4CH 3M17A 1SJXA 4Z95H 2X4RA 4M7JH 3UTZA 3PV7A 1HI6A 3VFPB 1CLZL 3T09A 4P59H 3FRPG 3PP3K 2F74B 5L8JB 2ARJA 4E42A 4DN4H 1JYVA 3P11L 3WLBA 3EYVB 4NBYB 2JKXA 3VXSB 3EFFA 4ZUVB 3ME0A 5IOPB 2FD6L 4JY4A 3RWHB 4X6EB 5AG9A 4CVXA 1ZT1B 5KSBA 4N9OB 3MJ6A 2VE6B 5FFLA 4OZGB 3QWRD 3V5DB 3BP5A 4C4KO 1KJ2H 2AI0H 5C2UB 4JJ5A 2WBJC 1DLHB 2XQYG 1EFXD 3PGCA 4RZCA 1JZ3A 3VFNB 1K4DB 1X7QB 1QFUL 1A2YB 2Q86B 3FHQA 3V2AR 3GGWA 2DL2A 4M1CC 3ARDC 1KLUB 1KC5L 4BM7A 3QIUA 4KJWC 3W9DA 1T2QL 1A8JH 4MJIE 5B21A 1XGPA 1TTGA 1F58H 1P4IH 4Y19E 4WJ5B 4G6FD 1R3HA 3IDYB 1DBAH 4EQ2A 1BQUA 5B3JE 4Y4HB 1JYWA 4JVPA 4PJGE 1N6UA 2Y6SC 5F7FA 5EZLB 2CK0H 3T1FB 5EUOB 3SE4C 5HYEA 1HQ4B 3E8UL 4QOKB 4F80A 5LVEA 3O45B 3TPUA 2A83B 3T2QA 5HVFB 1S5IL 3CIQA 4KHTH 5JPMA 2EKSB 35C8H 1HKFA 1L9MA 4FFYH 1D9KD 2VAAA 3S6CA 5JZ7C 5T1KB 3EYSL 3QRFM 1B4JL 4L4JA 5J56B 1U8PB 4KKNA 1EIBA 4N0CC 1M4KA 1SYSA 4DKAA 2AK1H 4MYWB 3H42L 4XVSH 5DLMH 4UDTA 2P8LB 4HC1H 5GGSA 3O0RH 4ODXB 3RI5F 2LTQB 4APQC 5M7QA 2Z8RA 1T4KB 3U4EB 1ZWIB 2JLLA 4X7TA 3EIFA 2R1WB 2NR6C 4LPCA 4TSBH 3FB8B 1AGDB 5TF0A 2BOCA 1EFXB 1FL3B 1BVKB 1CU4H 4BSWB 1JUFA 2C7UA 1H3VA 1JNNL 2DQUL 4PTUB 1UB6A 4F7PB 2FR4B 4U3XA 2ED9A 3DPBA 3TM6A 1G6RL 3CVIH 3CFDA 4D9RD 1RJYB 1MY7A 1W0VB 3MCG1 1UT9A 3WL9A 4PJDA 3BZ4B 1XF3B 4RRPG 2FZ3A 1RPQA 2DBLH 4N90D 4NC2B 3CFBB 4G6FB 2R2EA 1JTTA 3SDDA 4JKPH 5MEOB 3MUZ1 4JY6A 1EEUA 4AL8H 2EDXA 2ITDB 1CFVL 4NGHH 1KTLB 1JZ2A 3CD4A 3MCKA 3BESR 1X5ZA 3WYRA 4F57H 5C0BE 5GISL 2ZWLT 1MHHA 3G9AB 1EA9C 2WBWB 2JK5A 4NQCA 2XXMB 4AIZB 1V5JA 2XKSA 4AMKL 3B8YA 1CL7L 4MDIA 3RKPA 4F7MB 3RPKA 1BAFL 1D9KB 1Q9WB 5CJBA 1INQB 1I8LC 3M17B 3DETC 1SVZA 2UWEE 4KK8C 2HWZH 1UCTA 5DVLA 1V7ML 1LO3L 4XNXH 3UTZB 1HI6B 4M6NL 1MRFL 4EOWL 4LPWA 5IW1B 4E42B 5CJQH 3DYMA 3TBWB 3WLBB 5L2JA 1KFAL 3ULVL 3FB7B 1QO3A 4WU5B 3VFSA 3O6KL 4KI5C 5C6WH 3EFFB 3QEUA 3SKNA 4IHOB 4JY4B 4N0FA 3RUGA 5JDSB 2ICWJ 2OL3B 3JZ7A 4X8JA 5KSBB 4MA7L 4NZJA 3R4DA 3QG7H 1IEAB 2AJSH 2WBJA 4JJ5B 3UCRA 3PGCB 2CDGA 4RZCB 4YFLI 2FX7L 4X98A 4QT5B 1JYNA 5IR1A 3MO1A 1I9EA 2VXTL 3MFGB 3P0YL 3TH2T 1MLBB 3QPXL 2XQBL 3GGWB 1SYVB 3ARDA 1LEIA 3OKOA 1MI5E 4NCC1 2VDOH 4XX1G 1PZUB 3W9DB 1XGPB 1JPTL 1SJHB 5TQ0L 4PJ7A 4BZ2H 1R3HB 1IFHH 2QKIA 5K9OB 5FKAA 2BNUA 1ZA6B 4YLQT 1OPGH 4H25B 1A0QL 3LVEA 3GSVA 5FDWA 3QSKB 2VLRE 3UTTE 1CFSA 1N59B 2D7NA 1IAOB 4JZNA 5EA0L 5EU6A 4ODVL 4NQCD 3IF1A 2VSCA 4R7NA 1B9ZA 3VFOB 4G6KH 5FHBH 5JPMB 1AI1L 4F9LC 2CLZB 2CXKA 4KPHH 1A22B 3LPGA 3ULUH 3CDGA 4R4BB 3OBAA 2F5AH 4V2CB 2Z93B 1RZJC 1URLA 4P2RD 4FQ1H 5I1DA 2MNUA 1KB9J 3TPKA 2EE9A 3VXUD 1Z3GL 3HMXH 4UDTB 5GGSB 4APQA 3W0WD 1RY7B 1YEGH 4OUUA 3U7WL 1WIOA 3REVA 4X7TB 2JB6B 4QTIH 3GHBH 1C7SA 3G6AB 5CGMA 1RFDL 4X4YA 1HIML 2W9DL 5BS0A 1FZMB 2CDEA 1UB6B 5HHVL 1ITCA 3GEWB 5HYQA 1KTDA 5DUMH 1KCSH 2X70B 2E3VA 4XNYH 4PJDB 3HPLB 3LMJH 4QRUA 2ESVD 2P8PA 4PPTA 2IBGA 5FO8B 2AEPL 1MVFA 4QRQA 4YDLB 5KW9H 5EORH 4G8GE 4KJWD 1JGEA 3MV8D 1KPRA 2F58L 3VD7A 6FABL 1R3KA 4GUPB 4WFEE 4KVNL 5I1IH 3OWEA 3DTXA 1AD0A 1MVUB 5E70A 1G7LA 4NQCB 3QQ9C 2APVA 1X5IA 4MZ3A 2XOTA 4MDIB 4P5MB 5D4QA 3JV4A 1EJOH 5IJKC 1PZ5B 2D9CA 4ZOBA 3MNWA 1I8LA 1CD9B 4CRPA 2D31B 4IOFD 3BEVA 2Y07H 4P2RB 3HPJA 4GSDH 3QO1A 4M61B 4XGZB 4OIBA 4KZDL 5IHZB 4Z0XB 3VXUB 4OZIF 3W0WB 3T0AA 4LNRA 3WXWH 4JPKH 2R69H 4JDTL 3OJDA 3I6KA 4LAQL 4Z78A 2NTFA 3SKNB 1A6VH 2D7PA 32C2A 3PIQA 4X8JB 4FXKB 4JM2C 2DQJL 5BRZD 4D9QD 2E9BA 3ZSTA 5DUBA 4YE4H 5KVFL 2Z91A 3T3MF 1QOKA 3RWDA 3VWKD 4AG4H 5B4MD 3QUYD 4X98B 1L9NA 2DRUA 1PBYA 4RAUA 5IR1B 2ESVB 1FNLA 3MGOA 5BS0D 3MO1B 4MJIA 2HJFA 1QA9A 5E6IC 3QUML 1JGLL 4Y19A 1I7UB 1PG7H 1LK3L 1LEIB 3OV6A 3OKOB 4ZNCD 1P7QA 3MV8B 4PJGA 3U9UA 1HH6A 2ZUQB 4R97B 2BXYA 3TH3T 1NLDH 4P2OD 3I84A 3CFJA 4KMTL 5D7JC 3IVKA 2QKIB 4KVCL 5FKAB 2BNUB 4LNVA 4QHLA 4U1LA 4U3CA 1NBQA 4OI9A 3SGEH 5HD8C 2H32H 2IFFH 1LO4H 3G5VB 1ES0B 2XA8L 2J6EA 1CFSB 2VKXA 1TMCB 4RFNC 1AFVL 2FRGP 3CAFA 4KXZH 3VFWA 1U41A 1FNGA 5GGVL 4R7NB 3UTQB 4KJYB 4ZNEE 2YKLH 3ZT5A 5KAQF 4F9LA 3ZE1F 3B4NA 3MRFA 4P9HH 4S1RH 3OKMA 1QFWM 5FYJU 3PG2A 1JP5A 3VJ6A 2YA1A 1OSPH 3JWDL 1CTOA 5CIPA 5I1DB 4WWKC 3DIFA 4S10A 5E2UH 2CD0A 4PJBF 4APQB 1ZEAL 4LSDA 5BRZB 3GHEH 4HF5L 1YPZB 5TQ2H 2BSSA 3W11C 1YNLL 3VWKB 2APWA 4QEGA 5HDBF 3QUYB 4YDKH 1Q9KB 2DLFL 5BS0B 2CLRB 4NRYA 4XC1H 1P84K 2CDEB 4K9EC 5LGHL 3V4VL 1RVFL 4KTEH 3RBSA 4JFQA 1LWRA 4FQCH 4I2XE 4KRLB 4NYLA 5C1MB 3HN3A 5I1GH 2VITB 4QRUB 1NUNB 1IM9D 2Y9RT 4MJID 5C0BA 2EDDA 1KIQB 43C9A 3JWOC 5I8KH 1P7QD 1JGEB 3EBAA 4DUWA 1R3KB 3V7AG 4M1GL 2LU3A 1H3XA 1KPUA 4GRWH 3DTXB 5GHWL 2OLDA 4ZMAT 4E9LA 1FORH 2UWEA 4H26A 4HT1H 4OD1H 5E5MA 1REIA 1T04A 2RR3A 3JV4B 1JZ8A 4N9GB 3RDTC 4F33B 5IJKA 4PJEE 1T1ZB 4NRXA 4RISH 5FOJA 4Z7VE 3MNWB 1QACA 2EE3A 5DK3A 5DURD 5F8RC 4CMHC 1A14L 4PD4K 4O00A 3BDBA 1LNUB 5GRZA 2GTWB 3ISWA 3NIDE 5E2WH 5J11C 5GZOC 4J7RA 5EBGA 3ETBF 5GIRA 5EB9A 2ZKHL 3BD5A 4NNYA 3AS0A 3H9SE 4HIHB 4Z78B 2V9RA 1ZGLA 2PYED 1LEGA 3AS3A 3WV0A 5JQ6H 4LEOB 32C2B 4JM2A 2PF6A 2VDRL 1IARB 3TT3H 4YUEH 5A2LH 5FUCC 1VERA 1C5DB 3VXQB 2YSSA 5ECJE 1Q9OA 3F5WB 5EG6C 5D9SB 4LF3A 3U0WH 1MI5A 5F97E 3BWAA 3MGOB 5E6IA 4MJIB 3CVHL 1QA9B 3IFNL 3OXSB 1TDQA 4X7EC 4HKXB 1SY6L 3RY5A 1TXKA 1P7QB 3C09C 3U9UB 3T3PF 5C0BD 1MQKL 2UYLB 3K8LA 3V4PH 1RULL 2RHEA 1JRHL 3IVKB 2VLRA 3KLDA 3UTTA 5HDQL 2W0FA 4WHYG 2EDOA 5MEQB 1INEH 4QHLB 4U1LB 3VXTB 4LRIA 4ZOEA 1K8DB 4HXAH 5ETUA 5DURB 5F1NB 4OM1H 1VHPA 4Q2ZA 2VYRE 1CDYA 1YC7A 3VFWB 1FNGB 2H8PA 5M94B 1V7NL 2RCSH 1ONQA 4OLZL 3STZA 4RGNE 3OKMB 3BKYH 1W0WA 1LP9E 3VJ6B 4X7SH 4OCXL 2PYEB 2NZ9D 1KCRH 3DIFB 1FPTL 3S37X 4PFEA 5BQ7A 1NLBL 3GDBA 4HZLA 4ZXBC 3ULVF 3OAUH 2Z35B 5C0DB 3QIWD 4OUOA 3ARVA 2XA3A 1XIWC 3W9EA 4Q9BA 4OZ4A 1EERB 4MD5A 1KB5B 4D8PA 1I4FA 3OKNA 4K23H 3QDJD 3L3JA 4I13B 5TE7H 4JFQB 4DTGH 3IJHA 1UZ6E 3V52H 4G8GA 3WN5B 1MI5D 5CGYC 3QEGL 5F3BA 1UM4H 1D5IH 4M9PA 3P0VH 5ACZA 1FLRL 5C0BB 4RBPK 4GW5A 1RZKC 1JHLL 1NCWL 43C9B 4WUUE 3ZYIA 5DHVH 4MQXD 5CINL 4B41A 1A7RL 5EZOH 5F7DA 1J10A 4J8RA 4XMLL 4DK6A 1OSZB 2BY0A 5EIVA 2DQGL 2FLBT 3VGFA 1GC1L 5IIEB 1WWCA 2ARWA 3HC0A 2UWEB 2YBRA 2BRRL 1T04B 3RDTA 3GB7B 5DEGA 2JIXA 4NRXB 4MNGA 3EYOB 1N64L 4YXHH 5CEZH 4RAHA 5E9DE 2CR6A 1KENL 4LEXH 4QXUH 1HINL 4HGMA 3RZCD 1A6ZB 5DJ6A 4Z76B 4Z9KB 1DQLH 5D7SL 4G7YH 2YPVL 4J2XA 4KDVA 1CDBA 5D5MF 4NNYB 4G5ZH 3QIWB 5D6DC 3MRMA 4POYA 1LEGB 4Z8FL 2AV7A 2NY0C 3P30L 1F6AB 4HJJH 4O4YL 1AO7E 5ADOH 3GSNA 3QDJB 3RGVA 4BQ6A 4OZIE 3QPQC 3BMVA 5MENE 3KJ4C 4OGAC 4HFWB 4X9FA 2EXYC 4LF3B 3DARA 2Q8AH 4JLRB 1I1RA 1MI5B 5BXFA 3BWAB 4MGXA 4U1JA 1HYSD 2X1WL 3OJ2C 4PRIE 4HWEH 4JN1H 2C5DC 5E99H 3U36A 3MREA 4Q58C 3CSBA 4HWNA 5I18L 1GGBL 1Q1JH 4DVRH 1F3JA 3GMNA 3SQBA 2NY1C 4WFED 1BOGB 5ANME 1G9EA 4LDLB 5KSUA 1LE5A 1KN2L 3EZJB 4NO2B 1MCKA 3FFCE 4MQSB 4ZNEA 2W38A 2NY6C 3HAEB 2VDNL 1Q8MA 5ETUB 4XPAH 1VENA 1PFCA 5E8DH 4HUWB 4PJ9C 2HLFC 4RFNB 4XNMB 4Q2ZB 1DBJH 2ZUVA 4OCYH 2FX8L 2GT9B 3RZCB 3GSQA 3IKKA 1F11A 1ONQB 3EDFA 1CDUA 2V5TA 3OJMB 3MMEA 1UM5H 2APFA 1W0WB 3QEQA 4I0KA 3MLUL 3ZE2E 4RIRA 2V7HA 2YRPA 4MLIA 5J0BA 5JW4R 1BF8A 3FRUB 3LKOA 4MQ7B 5FAAA 5GZOD 3RY6C 4NZRH 3W39A 4WFGE 4BSVA 3KYOA 3GBNL 1H3PL 1XIWA 5ICXA 4I2XA 4OZ4B 5DJ8B 5C09E 4Y16C 3DO7B 5BV7L 3NOIA 2W0LA 4YWGL 3RGVD 3L3JB 4PJBE 3O4LE 2FWOB 4JFFE 3IJHB 5F88A 4OGYL 1FVCB 4P48A 4Z7NF 1NMBH 1YDPB 1U8MA 5F3BB 3S97C 2LE9A 2MHAA 4LKCA 4GW5B 4CN6A 1F97A 4OGZA 2VDPH 3VGHA 2DLGA 4I77H 4K2UL 5A43C 4LVEA 3HAEG 3T77A 2AJYL 5A16A 4MXWL 5GGTH 2X05A 5LAXB 4U1SA 3TYFA 4YDJB 3RVWD 4KY1H 3BUYB 4PJEA 5FCUH 4Z7VA 2A9NH 3JVGC 2F8VA 1YYMH 3HC0B 3K1DA 4N5EC 3P4NA 2OK0L 5EOQL 5A2IH 2B2XH 5DEGB 5A3IC 4NHUA 2X1QA 1JZ5A 2VDQH 4XB7A 3GBLA 4CMHB 4R8WH 4ELME 1I8KA 2OI9C 4I48A 2YD6A 1AKJD 2VQTA 1ACZA 2X9WA 5T3XH 5IMOA 4JGUA 4U1MA 1MNUH 1S8DB 4UILL 1AGEB 4JQIL 4BYHA 3MJ9L 1L7IH 2XWTA 5EU3A 1CG9A 1MJ8L 3WHE0 4XPBH 5D6DA 5T5FH 2VJXA 5FXCH 2AV7B 4RWHA 1QTYT 3MV7E 1GAFH 1JE6A 3GSNB 5L7XL 5BCAA 4Y0GA 4DZ8B 3RGVB 1C16B 1FLTX 2FATH 1ZMYA 1VEPA 3Q6FB 1X5YA 2Q3AA 4HG4J 2NNAA 4TULL 3LKRB 3FQNA 2V5RA 3X12A 4YJZL 5IMMB 1FIGL 4QGTA 4OT1L 4HWBA 2QHRL 2BCKB 3MREB 2CKBH 4BUHA 1F3JB 3GMNB 3O8XD 1ZLSH 1A7NL 4BH7B 3RVVD 4ZUSA 1BGXH 1CGTA 3KPOA 1LE5B 5IFHL 4CNIB 5D96B 1IJ9A 3T4AA 1VFAA 3J7HA 3IU3A 5D72L 1ETZB 4KJQD 4NJAL 1ADQA 2HT3D 3V79C 1H9VA 2C4FT 1IZJA 1XGUB 1NCDH 3ZKMD 4ISVA 2ZNWA 3L5XL 1P4BH 2ARJQ 3QDGE 1CL7I 2V5SA 2VAJA 5E03A 1FRGH 1LP9A 1NGWA 1AJ7H 1AKJB 2XWJA 4FZEL 1BBDH 4PG9A 1U36A 1VPOH 3WE6A 5KG9A 3FO2A 1MIMH 3MMEB 5H94A 1GPOL 4HUVB 4KU1A 3WFCL 3V6OE 4NT6A 2WWKO 4RIRB 3H9SD 3PUCA 3HR5A 3VXNA 4EUPB 1ZANL 3B2VL 5DK2B 3LKOB 2QV2A 1NEZA 5EOTA 2UVFA 4YHIA 3RY6A 4K3JH 1EEZB 4UIMA 4YQXL 1H15A 4BSVB 4NO5B 3KYOB 1JTOA 4P3CL 4ZTOH 1Y18A 2R0WH 2PTUA 3SE8L 4I2XB 1I7TA 3WO4C 4Y16A 4L5FL 4KI1A 1INDH 2V2WB 3D48R 4IJ3B 4OD2A 4RMUA 4G6JH 1YMMA 4Q9CA 5F88B 1U3HC 4UV7H 3ULVE 1CZ8L 4ZFGL 1RV6X 1HQRA 3HCVA 4WUUA 3RKDC 4NKOB 3RHWF 1U8MB 4Z0BH 1A3QA 3O8XB 3JTSB 1PJ9A 1KIRA 4LKCB 4RFEB 1TVBB 4LLYA 2IBZY 3SQOL 3BPLB 3P73A 4L9LA 3ZT6A 3L3IA 2JJVA 1FNHA 2ZCLL 5DUPL 4QKXB 4HHAB 2JCCF 3TIDB 1WFNA 3MX0A 3TYFB 2J4WL 3R1GH 4JHWH 3X14B 3ZYJA 3CFCH 5IG7A 4PJEB 1CE6A 3JVGA 3ARQA 2Q7YA 5HGBA 5GXBB 1DBBH 4O2EA 4KKBD 2FH6A 4WI2A 4OCMC 2VIRB 1UGNA 3Q5OA 5DJDB 4HUXA 1JWSB 5DZLA 4HIIA 5EUKA 4E41A 3C60C 4X6BA 1YNTB 1FDLL 4RGND 4C4KT 1WLHA 4QTHB 1I8KB 4I48B 1ND0A 3H9SB 4FQIL 4OQTH 5JOPE 1SBSH 4NKQB 1I9IH 5IMOB 1KEML 2R4SL 1MAKA 5DD3L 3V0VB 2XWTB 1ITBB 4XP4H 3GJFA 1CF8H 3TIEA 3MJ7B 5FDYA 2R4RL 1YEKL 5FKPB 1AE6H 4HJ0D 3HNTL 3LRHA 2WANA 1TJGL 4TTDC 3IAGC 5JIHA 4HH9B 3UPAA 2NNAB 4LSVL 3EYUL 4WI7A 3FQNB 1X4XA 4LU5L 3RNQB 3X12B 5E8PA 4RX4D 1NCUA 1XT5A 4L4VA 4DGIL 3UJJL 1T6WA 5EC2B 1BOYA 4WUUD 3EO0A 4DQOH 3GO1H 5F7HA 3FFCA 1OB1B 1PY4A 2V17H 2H2PC 5JW3L 4ZUSB 2YD7A 3KPOB 5GSRA 2YOCA 1AIFB 4L1DA 1ZS8A 1MUJA 3B2UC 3NABH 1VFAB 2AXFA 3OKDB 3ES6B 5E7BA 3WSQH 5IMLA 4NBZB 5FEBA 5L2KE 1CXFA 4JHAH 3A67L 3LEYL 3S37H 4ISVB 5I0DA 4QHUA 4G3YH 4RGNB 3ESUF 4ELKB 5E9DD 1NGWB 2BY2A 4JREB 3WO3B 4WNQA 1T80A 3WE6B 3ET9F 5KG9B 3FO2B 4OFDA 4ONFH 3DUHA 5C0FB 1F6FB 5FO7B 4XPHH 3KDMA 4YPJA 3GMMA 1D5BA 4XNZC 3AC0A 4OIIH 1EEQA 3VXNB 2DTSA 4X80L 1QKZH 2JJUA 5EO1A 1NEZB 5C09A 1FFQA 1AO7D 3KYNB 3ZT7A 2GFBA 3EYFA 5LKNA 5F96L 5MEND 1H15B 4LPUA 5IHUL 2DI9A 3WJJC 1Y18B 3EYQC 2BVOB 3KYMB 4N0UE 3RWGB 4ZDHB 3OKEA 5E2JA 4HIJA 4JCLA 1S7SA 1BM3H 1U3HA 1A02N 1VCAA 1CXLA 4PRID 2I5YL 4K3DH 5JOFA 4WUUB 5DFVD 1OY3B 3BW9A 3O6MH 5INCA 4OLUH 1H3UA 2I27N 1HILB 3RWIB 1TJIH 2OL3H 3P73B 2XZQH 4GAGL 4L9LB 1X5AA 1Y0LA 4EKXA 4PJCE 5IESL 5FHAL 4YGAB 4WDIA 1Q0YL 3FFCD 1NAMH 4WHTB 4Z7NE 3L9RA 4QCIB 5CBEB 5IG7B 1E27A 4JFOA 1J0KA 4XPGL 5CZVL 2R0KL 3B5TA 3DUSA 1D7FA 3VXRE 5HGBB 5E9DB 4O2EB 3G6JE 4ORGA 3BRGC 2Y36L 4OZFA 4ELMA 3S98A 4FRWA 1JF1A 2C4FU 1NBZB 3SBWC 3MLSL 3P9MA 5C2BH 4FXGA 2CRZA 4HIIB 3C60A 5EUKB 5D7LE 2AKRB 1QSFE 3BZEA 3BE1L 1VSCA 1AP2B 2OS7A 3WFDH 1ND0B 1NEZG 5DGQA 2HKFL 5DGRA 3IS1X 3MV7A 2XZAH 5CP7A 1WIUA 2F53D 1GGUA 1Z9SA 1AO7B 2GW5A 3ARBA 2DD8L 4OZIB 5MENB 2NXZD 1QFOA 3GJFB 4D9LH 4S0SD 4PREA 4ZD3L 1KXQE 4UTAH 5E4EB 1I3VA 1MWAA 5AG8A 1MHCA 3UP1A 5HHOA 2FCBA 3O4LD 4PRIB 5C7XH 4JFFD 1FCCA 3K74B 1FV1A 1DBKL 2FH8A 3NGBB 5CJOH 1WEJH 4FABH 3QEHA 4XWOD 4JZJB 4J3VA 1E4WH 2BFVL 4JO3H 5HGAA 4NM8H 1JWUA 5E8PB 4PJHF 5GGQH 5ANMB 3WHXA 5DVNA 3U46A 2V6HA 1B3JA 3SHSA 3FFCB 1FZKB 1F8TH 4TSCL 1B0GA 4WEBH 7FABL 5FUOL 4X6DA 2Q6WB 4DFIA 2CRMA 3P0GB 4P4RA 2WV3A 3QDGA 1MJUH 5IMLB 2AJXL 1UVQA 2DTMH 3G08B 4JFZH 3ZKSD 4G6AC 3T0VA 2VLLA 4IEFB 4QHUB 3U2SA 4DN3H 5EULV 2J2ZA 2FIKA 1QBML 3MV9E 3V6OA 4UOW1 4WNQB 4TOYL 3KPQB 3GM8A 3NN8A 2NYYD 3M45A 5JA9A 2F53B 2C3XA 3C60D 3X13B 2PW2A 5I0ZA 1IAKA 3T0BA 5JORA 2NXZB 3GMMB 1D5BB 1KULA 2YMXL 4M6AA 2P46B 5E8NA 4P5KA 2NZIA 3MV7D 2ICES 3C2AH 3O2DH 3ARBD 1PVHA 2GFBB 4Z7OE 4PJBB 1A1NA 2XZZA 3O4LB 1YUHA 3OGOE 1S9XA 2FBJL 4JFFB 3MXVH 4XTRD 4NHCL 3WO4B 3C6SA 2DQFA 3CFIC 5TDNA 5KVDL 4EJ1C 3M1BB 3OKEB 4ZOCA 5EWIH 5JDJA 1S7SB 4JCMA 1YEEL 2MMXA 3FO0L 2YPLA 4ZUWB 4TTDD 1MCQA 4O51B 3MV01 1RHFA 5JOFB 4XRCA 4D0CA 3BW9B 3H8NA 4O02L 5INCB 4UUJA 4P57A 5GS1C 1KBGL 2I9TB 3QWOA 4M43H 4JFYA 2V2TA 1KG0A 1DVFC 1MCIA 3B9EA 3BH9B 1Y0LB 1RIUL 4WDIB 3PP4H 2OBGA 4OKVA 1JRHI 4HPYH 4JVWA 2CPCA 3DUSB 1IGCL 1OAQH 3QDGD 3FN9A 1OAYH 4OLWH 4QF1A 3STBA 2ATKA 3QFDA 4ELMB 4F7TB 1MCFA 1JF1B 1J9CT 3CFKA 3SBWA 4NWUL 3P9MB 5LQBL 4BKLB 3C60B 1J0ZA 5I8EA 1L0YA 3T2NH 5HVWA 5GRJH 4Y5XB 1LK2A 1OAZL 3MA7A 3TBSA 5TE6L 1A1MA 4MA8H 1ACYL 4QYOA 3MV7B 1IC4L 5CP7B 4LL9A 4KWUA 5SWQB 2LAAA 1RU9H 3ARBB 4FQJL 4P23A 1GYAA 3NCJL 4RA3A 5EC1B 3VFVA 4TTGA 4U6VL 4PREB 5EO0A 1TTUA 4KUZH 3F7PC 1X5HA 5GRUL 1F3DH 4UT6L 5TGBA 5JR1H 4C57C 1MCJA 4IS6B 4M3KB 4ZUUA 2WW8A 3TT1L 4B7IA 1FV1B 5ALCL 3ULVD 2KL6A 2BVQA 5FK9A 2VC2L 4U0QB 5HGAB 1JWUB 1XR8A 5D71L 3GBML 1U6AH 1VGEL 1U3ZA 4XMPL 4LIQH 4YXKH 3LH2L 2R56H 3IFOB 1S9VB 3QCUL 4XVJH 1BMGA 4YZFF 1DQQA 3MRRA 1G6RB 1MFDL 1G7QB 3HI5L 4X7FC 1DLFL 3LS5L 1B0GB 2MKWA 2DI8A 3TVMC 1WFTA 3RVXC 1NGZA 4P4RB 5D1ZC 3QDGB 4OCWL 4HK0A 5E08L 5IB5A 4S11A 4KK5C 2QBWA 1X4ZA 2FYYA 3U0TB 3HB3C 1WWWX 3N50A 1RMFL 3DURA 4JR9H 4MXVE 1B2WH 2HG5A 1CXHA 1U8LA 3U2SB 4FQLL 3DHMA 2FIKB 1M6OA 4YGVA 2IJ0C 1FVDB 3L1OL 3CH8A 4UQ3B 3QA3B 4B0MM 1L6ZA 4U05A 5I8CA 5JOPD 1EJ6A 3LEXA 2Z31C 1GVIA 4JDZA 5CLWA 3IDIB 4X4ZA 1MY5A 4Y4KA 2PW2B 3DYPA 5JORB 1Z0MA 3NZHL 1UWXK 1BVLA 4LSTH 3GSWA 2BJML 5DSCA 1I75A 4RQQA 3CXDH 5CD3B 2X4QA 3OG4B 1TCMA 3G6DL 4N0UA 1U91A 4P23D 5GRWA 1S7UA 4S2SA 5I1JL 3SOBL 1YUHB 3NTCH 1S9XB 2V9QA 2F54D 3O6FA 1UB5A 1T7XA 4G80B 2R8SH 4F2MA 1SM3L 3BI9X 5TDNB 1SJEA 3D2UA 3X3FH 3NACH 4M62L 1UEYA 3MLXL 3BIAX 4LCWE 3OR6A 3NH7L 4XRCB 4PJCA 1U95A 4Y5YC 4UUJB 4P57B 1QRKA 1S5HB 2XNAA 4GKNA 4LAJH 3QWOB 5FYLE 5C6TH 4PGBA 2H1PH 1J1OH 3VXRA 2DJSA 5DJZA 3U0PA 5E94A 2XY1A 3G6JA 5K9QI 5LWYL 1QUNA 1T7ZA 2R2BB 1PQZA 2K9UA 1U3JA 5JHLH 2ZCHH 5AEAA 5L2KD 1IBGH 4PV8A 3L5WB 3GKWH 5SWSA 5D7LA 2FHFA 1QSFA 5DQDH 1M71B 2GKIA 2ATKB 3U9PH 4ZFOA 1P69B 4U4BA 3VD3A 5IKCA 1YY9C 4P2QE 3CFKB 3HC3L 5D93C 1J5OL 3MUJA 5MERB 4C59B 5B22A 4G6ML 3BXNB 3MA7B 4LPVA 3U7YH 5T1LD 3TBSB 3EW3B 3MRIA 1U2HA 4QYOB 4JO1L 4RAVA 1JGUL 3MRNA 1EVTC 3H3BC 3LN5A 4P23B 4Y4KD 5HGHB 4H88H 4FNLH 4XNUL 4ZOAA 3QXDA 5D5MB 3FQRB 1AHWA 3VFVB 1NUDA 5EO0B 5D1XA 3L6FA 1GZQA 4TQEL 3LQZB 5FO9A 5FM4A 1S3KL 3JV6A 1BD2E 3QDMD 5D6CB 1MFEH 3O6FD 1ZLUK 2EDTA 1YC8A 1QRNE 7CGTA 2BVQB 5FK9B 3WIFA 2XI9A 1ROWA 1B0WA 1C5BL 3ZLQC 3D2UD 4K8RL 3IETB 3K0WA 2SEBB 2NXYD 3Q3GB 1J0YA 4ONHA 3QHZL 2AJUH 3I85A 1BF2A 2FEDD 3QNYB 5AYQA 4X5XB 1BZ9A 15C8L 2P47B 4U3HA 4ESKA 5JW4Q 2WQRA 3PHOB 3V6ZB 2HKHL 4GT7A 4TVPH 1CICD 5DXWA 1KB5H 5EFIB 5L2KB 5D1ZA 1NGZB 1FZJB 1HEZA 3VXRD 4R26H 3A6OA 1MJ7L 4HK0B 4MNHB 3UC0L 4KKCD 5IB5B 1UENA 3MV9A 5ESAA 4YIQA 2IPUG 2FYYB 5CBAA 4Q9RH 3HC4H 2VXVH 3DURB 4JPIB 2HG5B 2B8OT 4XP1L 3A6BH 1G6VK 4U6YA 5D7LD 1QSFD 1M6OB 4MX7A 4YGVB 4LKXB 4ZPVA 5MI0B 4LGPB 5T1LB 3VH8A 2EIZA 3TZVA 4J3XA 5I8CB 2Z31A 1OP3H 3LEXB 2J88L 4JDZB 1J8KA 4LPYA 5DRNA 4KQ3L 1NKOA 1PYWA 4Y4KB 3HZYB 5GGVY 1N5AA 3S88H 1BVLB 5FCSH 4EN3C 5DSCB 4Z7WF 4DGYH 4EDXA 3CGTA 3TN0C 2XWBB 4YNYA 3EOAB 1WWAX 1OCWH 5FUZH 4N0UB 4UIKH 1U91B 2OSLB 3QDMB 1ZHBA 3P4OA 1ZE3C 3V8CA 3RTQA 1LILA 3EFDH 3O6FB 1UB5B 2FO4A 1F4AA 1DUZB 2RQ8A 3VXMA 3BYYA 1R0AH 2HJKB 2V5MA 4GW4A 5D1XD 4ZFZA 1SJEB 3O6LL 3D2UB 1UWGH 2XICA 3OGCA 2GQHA 2C3GA 3MOAL 2NXYB 1LO5A 4OLXL 3PNWA 3QG6A 1MJJA 1V3JA 3QJHA 3CX2A 4PJCB 4Y5YA 3VG0L 1AGFA 1MCBA 5IVNA 3OZ9L 1CICB 4MAYC 2XNAB 1NFDF 1U9KA 3QUMB 4MD0A 5GJSL 3KPNA 3VXRB 3U0PB 3BAEL 5E94B 2ICWA 1RSFA 4HBCL 4OF5A 4WV1B 5HYFA 1PQZB 4H0IA 1HHJA 4FXLA 1FE8H 3OKLB 4PV8B 4DGVL 5D1ZD 5FOBB 5H35B 5D7LB 4E5XB 1QSFB 2IPTH 4MJ5A 3SDAC 3BFOA 2GUOB 3MV9D 4HXBH 5IKCB 1BFVH 4CU6A 4Z7UF 4Z6AT 4CMMA 2CJUH 4JB9H 3ZSSA 1H8SA 5DO2C 1D3CA 3IDGA 4UV4L 1IT9L 4K94C 1CGYA 1RJCA 1UYWL 1FFPA 3WFZA 3ZL4H 5JOEA 2H2SD 5J1TC 4IM8A 5HYIA 3TZVD 1T0MA 1LEKA 3MRIB 3RAJH 1I1AC 2Z31D 4OSUH 3VA6A 3H7LA 3NFPB 4OD3H 2MFNA 1T1XA 1U8IB 5C0ND 1M1SA 3HAEH 5JXEC 1SEQL 5I73B 3QXDB 3KLHC 1AHWB 2Y23A 1TNNA 5DQ9A 3QCTL 3L3KA 5D1XB 3L6FB 1G9MH 1GZQB 2EO1A 2X09A 3HNSL 1T66D 4YHKH 3JV6B 3ILPA 1KV3A 1MF2L 4M5ZH 3RTQD 1RK0A 4LPTA 5EOCL 4LASL 3WIFB 3QULA 1TPXB 3VFTB 4DK3A 1F00I 1TVHB 5HVGB 5I6XB 3K2MC 3VMNA 1I3UA 4UB0H 3MROA 5BZDA 1BZ9B 2OMBA 3FQUB 3FAWA 2UY6A 4XWGH 3C8KA 2JELH 1A6WH 2AJVH 3LN4A 1P4LA 2V2XA 5HGGS 1PD6A 3MUGA 2VXSL 1EVUA 5D1ZB 1CS6A 2NY5C 4Y8DC 5IGXH 1T0NB 1IKFH 4LCIL 4Y1AE 3MV9B 1MFBL