1OAXL

Fv structure of the ige spe-7 in complex with acenaphthenequinone
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
AVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPRHLFTGLIGGTNNRAPGVPARFSGSLIGNKAALTITGAQTEDEAIYFCALWYSNHLVFGGGTKLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN E
total genus 24
structure length 108
sequence length 108
chains with identical sequence M, N, O
ec nomenclature
pdb deposition date 2003-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oaxL00
1E27A 4TTDD 4HBCL 4ZMAT 3WFHB 3AREC 5TE6H 1A2YB 3DYOA 1G7PB 5JIIA 3T0EB 1NGZA 2F58L 4MYWB 5D93B 1MCPL 5C0DB 1AH1A 1OW0A 1JUFA 1JF1B 4G7VL 3KYOB 2VH5L 3SDYL 1EGJH 2JCCA 4LCWE 5FHAL 4ZUWA 1F42A 4G42B 5JIHA 1FGVH 5E5MA 5I8EB 1A3RH 5J4MA 4PJGF 2VLJE 4I5BA 1AKJD 1DE4B 5DWUL 1P7HL 5ALCL 3TZVD 4XC1H 3QEUB 2ZCKH 3TCLB 3IFOB 4FNLL 5F7YC 4J3XA 2NY5H 4DAGL 2FO4B 5I8OH 1BREA 1XIWD 4WTZA 5GJTH 3U4BL 2DJSA 2H26B 2Z4QB 1IARB 3GB7B 4JRYA 4GAYA 1JVKA 4HD9A 4RMWA 5D7IB 4FQIH 5D9SB 3AY4C 2XZCH 4L8BB 3CU7A 4DKAA 4LGSB 1FFNB 5JOEA 4JRYD 3U6RB 1TZIA 1WC7B 4JM2B 5IHBA 2R69L 3DUHA 1U8MA 2GJ6D 5GGRA 1N7MH 1JI1A 2NYYD 2DQDL 2YWYA 3QWOA 3MROB 4ZFOL 3W82A 4PJHB 5KZCD 2V2TA 3PV7A 3OG6B 1YECH 5EU6A 3G08A 5C08D 5T1LA 2DLHA 3QIBB 1JNNH 1NMBL 4PB0L 5KSAB 1XFPA 3L3KB 3QQ9D 3O2WH 4UT9L 4JO2H 4YHZH 4M93C 4EIZC 1J7VR 4NNYA 3U46B 4NHCL 1JYVA 3DX7B 3OR6B 4PR5A 1F00I 2H1PH 1KACB 4YHPB 2G75A 1HH6A 3IDNB 4YXKL 4Z77A 4RFNB 1HKLL 3STZB 1RZKC 4RFEB 1Z2KA 3ZHKA 2EDFA 4F2MA 5A1AA 2IQAB 4QRTA 4QTHB 2RGSA 5HGAB 4OZIB 4N0YH 4CN6A 5I1IH 3LV3B 4AG4L 2DQFA 1JZ2A 3GM8A 3SDCB 2AERT 4YXKH 4ZUTA 3IDGA 2BVPB 4P23B 4IDJL 1MELA 3L3HA 3DRTA 1NFDA 3RIFK 3BESR 4UIMA 2FIRT 5DEZA 1EA9C 3FRPG 4NPYA 1MPAH 3VG0H 4ZAKC 3K1DA 3K0WA 4JJHA 3MLTA 4E9LA 4N5ED 1P53A 2CIIB 5JIPA 3WHE0 3RZCB 4YNYA 4AEIL 2ICES 4NQEB 3AM8C 3C08H 5F72S 3QYCA 5BOPA 5H2BA 2CLZA 1FNHA 4ZG1A 1T03H 1QBMH 5F6HI 4P4KD 3ZKMD 1LK2B 5ADPL 1MCIA 1A1OB 3L5WA 2JJTA 5I1DB 3HAEA 2ZUQC 4JPWL 4UBDD 1ZMYA 1TJHL 4ZPVA 1A6ZB 2YKLH 3KWWB 5D96C 1NC2A 2Z9TA 1NLDH 1ZT4B 1G7HB 4N8CL 2JE8A 5IMLA 3JUYA 4S1SL 1RZFL 3OKDA 4WFHE 4U7SA 4HHAA 5JXEC 1SEQH 1UT9A 3D85D 4OZFH 2E9IA 2HRLA 5D7IA 3AS1A 1UM6H 5KG9A 2V2WB 3VFSB 4ZFZB 3WO3B 4XBPA 2JIXD 4PGEB 2UY7A 3OL2A 3ARWA 4GMTH 4EQ3A 1TJHH 3RDTD 4MNQE 2QQNH 3EKCA 4MXVE 4X98B 5ACMA 3TH3T 2Q86A 1A6TA 3SDAC 1PW3A 1GZPA 1S8DA 4NZRL 1FYTA 3T4YB 4X7FC 3VFWA 1I85A 3DMMD 4G9FD 5HDOA 4V1DD 1KCSL 3CVHA 3U46A 1ZT1A 4OZGE 4YDIL 1UADC 4JFFB 4P4RA 3BIKA 4ORGB 4Q2ZA 5FKAB 4DKEL 4K3JL 2G75B 2MCPL 1RSFA 3D0VA 5EUKB 3VCLA 4ZS6D 3NIDF 4Y4HD 4XNYH 4DZBA 1CL7H 3N85H 4I0PA 1J9CT 1IBGL 2EIBA 4UDUB 5GIRA 5TQ2H 3WSQH 3O6KH 1R3JB 3T0WA 4P23D 4OZIA 1DSFH 3P9MA 4KJPD 2VXTL 4JY4B 3M17B 3A6BL 2HN7A 4N9OB 4BYHA 5EC2B 2VOTA 2X4NB 2E27H 4BQ9A 3EOAA 3NVQA 4HQQL 4OFDA 3TIEB 2VLRA 4LLMA 4HKJA 3DV4A 4KTYA 4PJ9A 4L9DA 5D4QA 4D8PA 4NPYB 3HNTH 2X4PB 5EO9B 2HT4D 4HUKB 1I3GH 2HFGH 4Z7VF 1U95A 5CZVH 2FJFB 4LCCC 3JWOH 4DQOH 4GT7A 2ED7A 5D7LB 4DKFL 1OGTA 2H1PL 5MERA 1PBYA 1IL1A 3HNSL 3OX8A 1T1ZA 5DUMH 4U1MB 4ZFFB 3T2NL 1UB5A 3VDBA 3NA9L 1R0AL 3C60A 3V5KB 1BFOA 1JRHL 3BPLC 3H7BB 4PB0H 1CT8A 4WEMB 5D70H 1KJVB 2VE6B 1IGIL 2CDGA 2YUZA 1AD9A 3GUTB 2MJWA 2Q3ZA 3MV9E 4XVJL 5HVHB 4HDIA 3RAJL 1FQ9C 3RTQC 5ESAA 4APQB 3EYOA 2EDOA 1BQHG 1WITA 3MRNA 3M1BB 4XPFH 2O61A 3UTTB 3H3PH 1CBVL 4NOFA 1BLNB 3AGVA 5LGJA 3KPRE 4BH8B 4Z78A 5AEAA 5DWUH 5GGVL 1AJ7L 1S7VA 4JFPA 4UZGA 2ITCB 3SHSA 5L8KB 5I75B 2Y07H 4JPKL 3RWIB 5BJTB 3R4DA 4JFZH 4HUUA 4KJYA 1TJGL 5LGHH 1PFCA 4K8RL 2AW2A 1QSFB 3MLVH 4J3SA 3SE8L 5A2JH 4MSWA 3STBA 4KK8D 4DVRL 5KAQF 5CLWA 5EWIL 5B4MD 1DQDH 1SYVA 4Y1AA 3MLUH 5CHNA 1YN7A 4MA7H 3WE6B 1G7QA 4QOKB 5T3XD 2IANB 5FB8B 1GZPB 3F8UB 1XGTB 2MFNA 3O6LL 3BRGC 1R3LA 3V52L 3VFWB 4K7FB 1S7XB 2G5RA 4M6OH 2VN7A 2AQ1A 4Z7VA 1PG7H 4NRYA 5C2BL 1G9MH 3A67L 3K74B 2J4WH 5LVEA 5LXGH 4LSRH 1MFBL 1J0ZA 2HKFL 4N0UB 2R1YA 1WWCA 3BKCL 3VCLB 2QR0B 3QUYD 2I9TB 1I3RB 3WEXB 4OCYL 5E5RB 5KOMC 4XI5C 1JYWA 5AYQA 1JN6B 1MAML 3GKWL 3N1GC 1LDPH 2BOCA 2WUCH 1T1YA 3RKPA 1GGTA 3QNYA 4PJ7E 4G7YH 2VXQL 1MAJA 3TIEA 3MJ7B 2C7UA 3FOMB 5SV4A 2H26A 2UVEA 2Z4QA 2DYPD 3BX7C 4X6BB 2YD9A 1NC2D 1D5XA 1NBQA 4QXTA 3MRQA 5TF0A 1FYHB 4KZEH 5C0EA 1YNKH 2XZAH 4I77L 1RZ8B 5HPOA 2MQ0A 4MNHA 3SQBA 5ITBL 1NDGB 1ZSDB 2IGFH 4JAMA 5E2UL 2V7NA 2XWJB 4D9QD 3GMRA 4WO4B 3WUWG 2DBLH 1ND0B 3NCJH 4JLRA 4X4YA 2ZOLB 5D6DC 1EX0A 3RNQB 2AJZB 2DM2A 1T7WA 5GSRA 2CDGB 3DO7A 4R4BA 2AJ3B 2R9HD 1RD6A 4IBLT 5FYKH 2IH1B 6FABH 5JLZA 1VPOH 1LO5A 5IBUB 4KQ3L 4H1LB 2X42A 2GJZA 4MXQC 2R1XB 2UWEA 4IS6A 3KPMB 4DN3L 4X6CA 2A0LC 2AAVA 5IT2H 5JNYB 1RY7B 3VDCA 1S7VB 4JFPB 3UJTH 3PXJA 4F58L 4JHAH 2BVTA 3K7UA 4QWWD 1MHHB 1HEZA 1JGUH 1QLFB 5DO2C 3JWDL 3RKDD 2JB6A 4PJ9C 3UTTE 1XGPB 2FDBP 1QQDA 5DD5H 5FHAH 4K7PH 3UTSB 3MYJB 5HYJE 3KLHD 4LSVL 3WUWA 4TSBH 5MENE 1KBGL 4ZS7H 1G7QB 1ZT7B 4FQ1L 4TSCL 4RFOH 5C09A 2BVPA 4P23A 4PJ5B 3SDDB 3AMLA 2OL3B 3Q1SL 3FO0H 4XWGL 1OAKH 2UWEE 2P5ED 5J1AB 3OKYA 5DMKB 4K7FA 4OCRH 4S1QH 4WU7A 2VLRD 2JJSA 5HY9B 5ID0B 4ONFH 4PTUA 1JWMB 2V7HA 4MMZC 4PJCA 3TNMB 4EUPH 3LCYA 3HB3D 4QRSB 3MOBL 5EU7E 4H8WH 5MEND 3VFOB 2O5XL 1IGTB 5EU5B 3CH8A 5F7DA 2FBJL 2AKRA 2A6JB 3GMLA 3FJTA 1NC4D 3WNLA 2PO6C 1NCBH 4OIIH 1ED3A 2NCMA 3R06B 4PJFA 5T33H 5C6WH 3CFJA 1K4DA 4HZAA 4HWBL 2Y25A 4U6XA 3TYFA 2BOCB 3TNNA 1C16A 1A6ZA 1KCUH 4U1NA 4Y4KB 1GGUA 4L8CA 3HE7C 1B0RA 2EIZA 3SE4C 1GL4B 2NY0C 2DKSA 5FUZL 5GRUH 3LQAH 5IMLB 3C6LC 4KUCD 3HE6C 3V95A 5INCB 3D3VD 1I9RL 3VFPB 1XF3A 5JOFB 2VNCA 3CFIC 4NO5B 3LPFA 1MVUB 1T20B 2CGRH 3FONA 4XBGB 3PWLA 2Z8VC 1NMAL 1BX2A 5I1AA 4ZFZA 4G8IA 1EJ6A 4ZXBC 5B3JE 4KK8C 1UCTA 1S9YA 4MD4A 3UC0H 2B4CL 4RX4A 4QHLB 4YHIA 4X98A 4NO0B 3IRPX 3RPIA 2OK0L 4EZMA 3OAUH 4F57H 1ZHBA 4HF5H 3HRZA 2YC1B 1Z9OA 1HQ4A 4RX4D 1SYSA 2WBJA 1KNOB 4K7PX 5DO2D 4F33B 5LQBH 1A7QL 2PKDA 4IRZH 3WD5L 4P3CH 4XP1H 5D93C 3VW3H 4H1LA 5CILL 1KLFA 2YN5A 3TBYA 2LAAA 3BIKB 4Q2ZB 4BSWA 2HKHL 1KB9J 1XF4B 2DWDA 3PABA 4E41E 3QO1A 3L9RA 4PRNB 1UVQA 1CXHA 3UTSD 5LG1A 3FO9A 4UDTB 4OCWH 4H8WL 3TJEL 4F15C 2Y6SD 2ATKB 4K8RH 3G9AB 1O5DT 3ARFD 1YEDB 1PZUB 1NL0H 2HP4A 3RGVA 5ID1A 2ICWJ 2VDQL 4K3HA 4X7CC 3VXQB 4UB0L 1UEYA 1I1RA 2FJHB 4Y5YB 3NPSC 4WTWA 1WTLA 3WDIA 4X8XA 4HH9A 2ADJA 1UXSA 2GITA 25C8L 2VLRB 5ICYA 2IADA 1UKQA 4M43H 3QDJE 1GOFA 2P5WD 4JFHE 1ZE3C 3MNWB 3S34L 1QSFE 5EU4B 3ZT7A 3QEHA 1X5ZA 1YJDC 3ARDC 5FGSA 2HT3C 5HYJB 4W68A 3QDGE 4R26H 3FMGL 5DMYA 1MIEH 4ZOBA 4LSSL 3VFUA 1BVKA 3OMZA 1JGDA 1M71A 5D1QC 3R1GL 3T0DA 2F53B 4QOKE 4X9FA 1B0GA 4B7IA 4B50A 2WV3A 4MX7A 1FN4B 3IJSA 5DJ8B 4LCUB 4B0MM 1QPPA 4OKDA 4Y5YC 4X6FB 3GGWA 1ZOXA 2HVJA 2FEDD 4QRRE 3BGAA 1WZ1L 3B9KC 1U91B 3FB8A 3TNNB 1F11A 3ZDYF 3EO1A 5JPMA 4L8SA 1OAUH 5E6IA 2SEBA 3HHRB 4XP4H 2X4TA 3VXMD 4LU5L 1QSEB 5H94A 4KKCC 4HW6A 5F70A 1HHIB 4GW5B 3VFPA 3QO0A 1MRDH 2B1HL 2FNBA 4G9DA 1MEXH 1VCAA 4XCYA 1PG7X 1OAZL 3MV8E 5DK2A 5CGYD 4MSWB 3KHOA 2YPVH 1NGYA 4G8IB 4M93B 3LN4A 1I9IH 3NCYP 2AK4A 2F5AL 1YY9D 5DVNA 4BSJA 4FXKA 1MCFA 2PETA 4QHLA 2CLVA 4Z7WE 1PY9A 5HYQB 5DFWH 3H9SB 3VXSD 3D69A 4KK5C 5IEKB 2VXSL 4FFYH 1NGPL 3V5HB 5CFHA 1QR1B 4HCRA 5KVDL 4OZHB 3GJFH 2NLJA 4KMLB 3HG1E 4AMKH 1YEGL 4MAYC 1DZBA 4P59H 2YPKB 5FYJL 3KXFA 2VLMD 1VACA 1KIUA 2FX9L 4KKAC 2BK8A 4LCYB 2JB5L 5J89A 1LEIB 3RGVC 1XF4A 2DWDB 3R8QA 1EAPA 4E42B 2YA1A 1RK0B 4JFQA 2FL5A 3QHFL 5T3XL 1MY7A 2ZUWA 3SE4A 2I9TA 3BDXA 3WYRA 3C9NA 4F7CB 5D5MB 4Z7WA 3QP3A 1C5DB 1BFVH 3QUYB 5ID1B 1LO4L 4PJBB 1T1YB 5D7IE 5CZXD 2HLFC 2DM3A 1PEZA 5DD1H 5DJDB 2DLEA 5ILTL 3VGDA 2HLAB 4K8RD 1TJGH 5LGHL 5KJRH 3MJ7A 4I3RL 5IF0B 3EYSL 2PN5A 3NCCB 4DAGH 1FZMB 2R0ZH 4M1GL 4OQTL 1YDPB 3T04D 3GMPA 2V17H 3FQWB 1S7TB 4U4BA 1BAFH 4JQXA 3CC5B 1EEUA 3L3GB 3GJFB 2E6PA 2B0SL 1RMFL 2XIDA 1A6WH 3D18A 3HG1D 4HIIA 4KJQD 4QHUB 3QXWA 1WWAX 4RWYH 1BPVA 1CD1A 1IAIH 4NHUB 5AD0B 1CF8H 1ND0A 5FK9A 1PEWA 3QRGH 1IGIH 1UQSB 5GRJH 5I15L 3DO7B 1Q94A 4O02L 1F90H 4XP9L 2IH1A 4PD4J 3H3PL 4FQLH 4PJ8C 5CILH 3FB8B 2GJZB 3MCG1 3MRGA 4L1HA 5JW4N 3KG5A 4YHYB 4JFYB 2VUYA 3QDGA 4X6CB 4YAQA 4RA0C 4XPBH 1NUDA 5DJZA 1C5CH 2YUVA 3ZDXE 1MRFL 2BSTA 1T1WA 3VXUD 3VJ6A 3IDJB 2ZWLT 2NY6D 4KUCF 5IM7B 2J1KA 2J6EH 5D1QA 2VWEC 3H9SD 4JGUA 5C0BE 3SE9H 4P5TC 3WN5B 3GBNH 2W38A 3DSNA 3O4OC 5GS2H 3WXVL 3WUWB 1A14L 4RQQB 3B3IB 4WNQB 4YC2C 3H9SA 3ZHDA 3GMOB 5INDA 1Q9OA 4JPIB 5I71C 5SX5H 4Y16B 1QR1A 3WFEH 4E0RB 4I18A 4LQFH 1P7KA 4ZDHA 2FCBA 3QWQB 1QEWA 3GSVB 4Q97A 5EZLB 3VRIA 3QUXC 2QSCH 2P5WA 4M5YH 2R4SL 4Z7NF 3RUGB 3MRHA 3X14A 1DL7L 5HHXH 4PTTA 1E27B 3SGDH 3MV8A 5BVJB 2IALA 5LCVH 1HHJA 3SPVB 2APWA 3VRLF 2AKRB 4PJEE 3V4UH 2Z8SA 3ARED 2PR4H 2D03L 4M7LT 1U8QA 2VAAB 4XPBL 3MOBH 3ZKMC 1FVCB 4GRLC 4YDIH 1FE8H 2H6PA 3ARVA 2APVA 5I8EA 1NMCC 3C5ZB 4RMTA 5C6TH 1VGEL 1XF2B 5TE4L 5BOZG 5C9JA 1WCBB 1NUGA 3PHQB 4ODXA 5GGQH 5IW1B 3W5NA 2GK0A 1ORQA 3SQOL 2MCG1 5BZDB 4XXCC 3J7HA 1AR2A 3EYUH 4X7DC 5I1KH 5C07B 4R90H 5F9WB 3AS3A 1X5AA 3MZTA 3N06B 4L4VE 2FR4B 5IBLC 5CJ5A 3HR5A 3U0TA 1U36A 5E8PB 4NQSB 1UWXH 5F93C 1CFVH 5FYKU 4ZNEA 4P9HH 5CEZH 3HI5L 4GKNA 4XMLL 3UTQB 1JHLH 5CJXC 4U0RB 5AD0A 4KRPC 4JQVC 3C6SB 4YHIB 4WFFE 4HPOL 3MRDB 1TDQA 5TE4H 2R0ZL 1FZKA 3E8UL 1LEGB 4POUB 4K7PY 4U2ZA 5JZ7C 4QHNB 4KZDL 1MFDH 2FHBA 1KXQE 4HWBA 4JPKH 4BQ6A 4ERSH 1EJOH 4GBXC 1DANU 3CVIH 4Y5XB 3QDGB 5EA0H 1FO0B 1P4BH 1WAAF 1QBBA 5FM4A 4GUPA 4XXDA 4KVNH 2QQLL 4POZC 3IDUA 1X5HA 1FL5B 3PG2A 4PY7B 5SWZE 3GSNA 3ARDB 3UYRH 2F8VA 3L5JA 4MAYB 4UTBL 4AL8H 1F6LL 3HE7D 5DXWA 3HFML 4PRPD 2IQAA 4QTHA 4QRTB 4Q9RL 2PW1B 4NQDB 2XTJD 1YEDA 4GRLD 1IILE 4PP2A 4LPYA 2IPUK 1U3ZA 5F7MC 3ZKND 1L7IL 1TZHB 2IBZX 4X4MA 1CQYA 3T2NH 4HQQH 4LSTH 2XZZA 5I9QB 4X6DF 2DN7A 4EEEA 1T0NB 2IFFH 1MJ7H 4UOW1 2I5YH 3RVUC 3PHOB 4HKZA 3MUHL 5FGCB 4DW2L 5A2LH 4D3CL 1KV3A 2EXWC 2JJWA 2ESVA 3V0AC 2I27N 5CINH 4FOMA 1DJSA 2GAZA 3T2OA 4NN6C 3FCTB 3PP4L 3D39A 4R6UA 4KGLA 1ACYH 1RUMH 2XWTB 4ODTL 2EH7H 4R9HA 3RWCA 4MCYA 3JTTA 4NBZB 1BZ7B 1RFDH 2G9HA 2F5BL 1CGXA 4UAOC 4M5ZL 5DHVB 1EBPA 1I1AA 1DQQB 3T3MF 1HKLH 3M07A 1GIGL 3JWDC 5JHDB 3JVGA 2O26U 4S10A 1CE6A 5E2JA 4PRID 3KDMA 4FTVB 1H3UA 1ZEAH 4X5WA 4LASL 4U7MA 4P5TD 4OIIL 3GGWB 4OD3H 1F6FB 4XP6L 2FB4H 1UKTA 4XP5H 1T7VA 3BVNB 1OQOA 4OB5H 1F11B 5I8KH 3U36A 5DQJA 1PQZA 4PJFE 3F12A 5I1CH 4WFED 5GS0L 3L95A 4RWYL 1F4XH 3MGTA 4ZYKB 3IDIA 2F9BT 3KNBA 1KJ3H 1OARL 3G6JF 4G9DB 3S4SG 4XCYB 1D9KC 1C1EL 1UYWH 2EH8L 3K4DA 4NQSA 5D7LE 4MXQD 1H0DA 1CXLA 3AU1A 3PDOA 2IG2H 2VISA 4GKNB 4FXKB 4W70A 5ETUB 2HMIC 5EBWB 5EU6D 4H0IA 1YY8A 3S37H 4RAHA 4Q9QL 3AVEA 4R90L 2YD7A 1A6TB 4MDIB 2Y07L 4ODHL 4BQ8A 4PLKC 2YA0A 2C3WA 1BOGB 5I74C 2X9XA 3I75B 5BV7B 1T6WA 2X41A 3TIDA 1A9BB 1VGEH 1FRGL 1BOYA 5HHVH 2XV6B 4S1SH 3WFZA 1KN4L 1IEHA 2VN4A 4P4RB 3U0WH 1ZGLP 4TUJB 1WIUA 1CLCA 4HS8H 3FQXA 2DDQL 3MRJB 4OB5L 2H41A 15C8L 5FYJH 1P69B 3BYYA 1CIDA 4U0RC 5C0JA 5ABDE 2ZNXA 5MEQA 2XOTA 4EJ1C 1EO7A 2IMNA 1X7QB 1RIUL 4W4NA 1TZHA 4PPTA 2GJ6E 3SBWC 4H1LG 1E0OB 3OQ3B 5JHLL 3S36H 2AABH 1G1YA 4GS7B 1P7QD 1U8IA 3CSGA 1JK8B 4NQXA 1KN2L 4PJIF 4RZCA 3IYLW 1YNTB 4PJ9B 4PGCA 4JRXE 3H9ZA 1ACYL 5DVMA 5LCVL 5C09D 4PRDA 2BMKB 2AJUL 1FFRA 4S11A 4OD1H 1P1ZB 4M02A 5IFHH 5IW6B 3RWCB 4X9GA 4MCYB 1LEKA 3UBXI 1GGBL 2I5YL 4HWUA 4IIQC 2IAMC 1XR9A 3EJZD 4F9PA 3GJEB 1F4WH 3FQRB 4OZGA 1BFOB 3BD3A 4XWOD 3JV0A 3I3EA 4QTIH 3ZDXF 2DRUA 1H9VA 5H37G 5E94A 1JWUB 1AQDB 4I0CC 5FFLA 4OCYH 2YZ1A 4PJ7A 3BP4A 3P4NB 5EUOF 3ILPB 5KSBF 1BQUA 4E5XB 1T5WA 2DQDH 3U36B 5D2LA 1A7OL 1O7SA 4IOFC 5JPNA 5IMMB 3PJSB 5I71B 4R2GC 4NCC2 4O00A 4YK4B 1P4IH 1JWSA 2JIXA 2WBWB 5JZ7D 2A73A 5GS0C 3GZKA 1QRNB 2CJUH 2FEDC 5IB1B 4XVUD 5TGBB 5CWSB 4LLAA 3U9UA 4DGIH 3PGDB 1OP5K 5HYFA 5TJWK 2ZG1A 2V6HA 1SJXA 3CDGB 4R26L 1KLGB 1I7UA 1EMTL 1QUNA 3BZEA 1URLA 3H9HA 1HKFA 3QXAB 5J6HA 4I1NB 3QCUL 3SDYH 1XGTA 5CD3B 3OF6A 1PX3A 3RWEA 3S35H 1P7KB 4ZDHB 3SJVE 5MEOA 4KXZI 1FNEB 1R3HA 5I76A 3O11B 3CJJA 1QNZL 1DDHB 2MTPA 4Y4HA 1WICA 3OKMA 2XG4A 5DDHA 1UM4H 3FRUB 2NY1C 1MWAH 2WQRA 2ED9A 4LSQH 3V8CA 2BNRD 1OY3B 3KPSE 4CVXB 2GT9B 5EU3A 3D39D 4ELMB 1MAKA 3NIFF 3SGEH 2X9WA 5EH1A 2R56H 1YYLH 1Z9SA 3UJTL 1GSMA 3OB0H 4GSDH 1T83C 2DF3A 4LHUB 4OF7A 4D9RE 1RZJL 1NCDL 4WU5B 4L4TE 3L3OB 3KPTA 5MHSD 3LPWA 3V0VB 1BBJA 3ECBA 2CXGA 4LARH 5IW1A 5BZWB 3IU3A 2C7UB 4KHXL 4JG1L 1ORQB 3ZE1F 4CW1A 2CQVA 1BHGA 3BJLA 3RL1B 2XWBB 4X7SL 1OLLA 3MRQB 2WWMC 3F5WA 1RZ8A 4JO4L 4JDVB 1ZGLM 1C8PA 4JN2B 1WFNA 4IEFB 5E1AB 4ODTH 4LPVA 1LO0H 3QDMA 1EZVX 3ZHLA 1NSNH 3QUZC 2X9YA 1FPTL 4GW1A 1MNUH 2VERN 2AJZA 1FZKB 2H2PD 2I24N 3BP7B 4UV7H 4FQCH 3RUGF 5JW4Q 4HX1A 2F54D 2VL5A 1LEGA 2AJ3A 3BISA 3EOBA 1J1XH 3SCMB 3ZYJA 3VMPA 2PW2A 1MIMH 2OMBA 5L2JB 3GMQB 1NCBL 1LDPL 4JQVA 1KUMA 5ANME 3HR6A 4Y5XA 3NCFB 5JR1L 4LNRA 3KPMA 3VU2A 1IM9B 2ILLA 4F7MB 3KLSA 1CU4H 4NKOA 4LIQL 1OB1A 1AQKL 1K2DB 1T3FB 4JM2D 3MV01 3ZKQD 3P0YL 3ARDA 1P84K 4UT6H 3IDMA 1QLFA 2O5YL 1A3LL 2CDEA 3S5LA 1IEAA 4O2CA 2W0PA 3UTSE 5EFIA 1F8TL 1Z3GL 1CK0L 4PJGE 1CLOL 4IM8A 4U1HA 1DBMH 5HI3D 2XZCL 4G6KL 1J8HB 3VMNA 4I4WA 1TFHA 1JZ3A 2XPGB 4Q7DA 1NCDH 3VH8G 4UBDC 2AS5M 1YEEH 4UILL 2VLJA 4ZNCD 3MMEA 4HKZB 3PHOA 2ICEB 1OP9A 4UINH 5CS7A 4FQXD 1VEOA 5DQ9A 4YIQA 2OQJA 3OKKB 4ZOEA 2BY2A 5MEOB 5ENWA 2Z92A 1MWAL 2RCSH 1KLUB 1PSKL 3D39B 5E08L 4LLYB 2KBGA 4LLWB 3OKMB 4BUHA 1BD2B 3V8OA 4LHUD 1KEML 3QUXA 4Y2DC 1NLBL 2VDMH 5E2WL 4ELMA 1TQBC 4G5ZH 2ID5A 1LO4H 2A6JA 3TEUA 4NDMA 2P8LA 5C0ND 3BP5B 4DK3A 4LHUA 5A16A 4GRWF 3VA6A 1RZGA 5FCSH 4GKOA 1MLCA 3O8XD 2EE3A 1WBZA 4PRAB 2W92A 1FAKT 4ZFGH 2AJXH 4HLJA 4Q6IC 2BVQA 5D1ZA 3P30H 3V7MA 4NZDA 3VWKA 1AGFA 4K23L 5IQ9A 1UH4A 4HK3N 1BQLH 1IC1A 3MUY1 1W72B 4O2FB 4CJ0A 1U0QA 3T1FA 3S9DB 5K59F 3U2SB 4JRYE 1K3ZA 4HC1A 3PWPB 5GGUB 4JEGB 2XTJE 4KY1L 4V2CB 2OP4L 1MVUA 1T20A 2X4UB 3I02A 2AV1B 3RA7L 3VG0L 3FB5A 3HNSH 4BQCA 2Q3AA 5HPMB 2BDNH 3B8YA 1PAMA 1Q1JL 1A6VL 3BSZL 4L8BA 3D1MC 4WWKC 5HHOB 5J12C 3S3JA 2G5BA 4FFVC 4H25A 2VABB 1UM5H 3QI9D 2E7BA 4V1DE 1MCRA 2GSGB 1I3GL 3E0GA 5CZVL 5E9DB 4M8QA 5IOPB 3KS0H 4NN7C 1EK3A 5B39B 3L5HA 3MV11 1K9TA 3O4LE 4JREB 4M7JL 1WLHA 5DC9B 1T2JA 2A38A 2YC1A 5EU6B 4Y8AA 1N0XH 1MHCB 4ZTPH 2C26A 2BOBA 3GSWB 3IF1A 1NGQH 5GRZA 2D9CA 3D9AL 3OV6A 4M03A 1S7QB 2R23B 4MB4A 1AP2A 2PTVA 1CZ8H 3EFDH 4LEOB 5EDXA 3IFPA 1OGAB 4PD4K 4XP4L 3BAEL 4Y88A 1TVHB 1CL7L 3N85L 4NQCD 4GAFB 2A9NH 1J1OH 3FO9B 1DVFC 2V5SA 1JNNL 1NMBH 1OAYL 3RWJB 4O2CB 1CWVA 2XYCA 3T0EC 5EO0A 1BQLL 3EAKA 5HYIA 2EIEA 1XIWC 5EFIB 5J0BA 5D1QD 4PRHA 4G9FB 4JDZB 4LBEB 1SJVA 1T04A 1MCNA 1CG9A 1D7FA 2ADJB 4BK5A 3Q5TA 3DX9A 5C0AB 5HVFB 1T7XA 2X1PA 2W0KA 4AIOA 1BD2D 4UIMB 5ESVB 5GGTL 5FF6A 5IFAL 3MLRL 3GK8L 4Z6AT 3H3KA 2BMKA 2G2RB 3QEHB 3HZKA 1HWGB 1OPGH 3WJJC 5ISZB 2NMSA 1J8HE 4PJ9D 1EEYB 4ONOA 3K2UL 4OCRL 2C1PB 1AGDB 2NY3B 2WSKA 3BWAB 4UT7L 1BVKB 5D5MF 5DGRA 3LD8C 2YD3A 3S7GA 2YSSA 1UCBL 5GRVK 3KYAA 5FGBC 3TCXA 3OJMB 3HS0B 5HVWA 2YPLE 3B2VH 3C8DA 1SHMA 1TPXB 3CPLB 2WBJC 4HJJH 1AQDA 5E94B 4DVRH 3GHEH 4LCUA 1R24B 4X4ME 3T0ED 3AREA 3SDXB 3VDAA 3AAZB 4QT5B 3PWPD 1FG2A 1KJ2B 4ZQKA 3ARTA 5HSFA 3IXTB 3DX8B 1N6QL 2D9QB 3MOAH 4GMSL 1BECA 1QSEA 4KVCL 3OKDB 3BYTA 3H2WA 1DQML 1DBAH 2ZCLL 3V2AR 3ZTNH 1XF5A 4UT6L 3MRFB 3EOTL 3PWPA 3T2PA 5IVZB 3L5XL 5FXCH 4OLUH 1E28B 3PUCA 1S7UA 3PGCA 2Z31C 4F7EA 5KG9B 2XRAL 3VFSA 1N2RA 5HHOA 2DQTL 4X0KB 5CWSA 2BSRA 2C3VB 4G6KH 4EDXB 3PGDA 5JR1H 4MCZA 2L7UA 3QHTC 1JFQH 3JXAA 4OD3L 4ZD3L 1U8HA 5E99L 5HYQA 4S2SB 4KMTL 1I7UB 5IIEB 1BZ9A 2IPUG 2CO7B 4I2XA 3BZEB 1F3DH 1S5IL 3BH8A 1JYNA 1HHHA 3MRKA 1UEMA 32C2B 2DBLL 3V4PL 1DBJH 2Z31D 3RWEB 4LVNB 2NLJB 4FHBD 2EYTB 1WBYA 5I76B 3GSWA 1MF2H 2W9EL 3CVHB 4FQXA 2R2BA 3LKQA 3WXWH 4J1UA 4WFGD 4E42A 1A14H 4BFIA 3D0VB 5EUKA 1MREH 3RVWD 3S5LG 5IR1A 4MLSA 5BS0A 4KROD 1MI5A 3BOVA 5L2KE 3CU1A 1FZJB 3F7YB 4HUXA 1IEBA 4J2XA 2IFFL 1A9EA 5CJQH 3HE7A 3MA9H 4F7CA 4WDIB 5CD5D 3V0VA 3V5DB 5J06A 4GRWH 3BUYA 4JO4H 5DJDA 5IMOA 5DS8B 2PYFB 5ISZD 3IU3B 4LVOC 5DRWA 5I6XB 3RRQA 3PL6A 1XGUA 5F7WC 1HK6A 1MCWW 1JNJA 5K33A 4IMLA 2F19H 4O4YL 2R2EB 4PJDE 5FDWB 4BKLA 4RDQF 5EBLB 5ISZA 1P4BL 2W0FB 5C9KA 3CC5A 4OF8A 3GJFA 2ORBL 4BZYA 4GLRI 5BW7C 2DYPA 5ADOL 2EDRA 2ZPKL 4P9HL 5CGMA 4XHJC 3KLHC 4PJIA 3KJ4B 3T0XA 3MRBA 2YSSB 1NEUA 4NC1E 3WFCH 4KUZL 2P47B 1TTFA 5FOBB 5F1OB 3VXSE 3QIWA 3MRCB 5EN2A 2DIJA 5C86A 4Z7QF 4LKXA 5DMJB 4ONHB 1OT1A 2CDFB 5DTFA 5T3ZL 1BEYH 1TQCB 3VFVA 3RTQD 2W9DH 1LNUB 2XY2A 4NZUL 3S4SB 4KUZH 4KPHH 4PBWD 3VXNB 3FKUS 3TPUB 4U1KB 3MRFA 5IJKC 1LDSA 3DBXA 5DF0A 1E28A 1DCLA 5BV7C 4YH6A 1NCAL 2BSRB 2C3VA 4GG8A 4NUGL 2LVCA 3UX9B 3FFCB 4MA8H 3RWFB 2E7LC 2IQ9H 4D0CA 5DHVH 4CADA 2FX7H 5CCKL 1K8IA 4XPHH 5IIEA 4LLQB 1OCWL 1X5JA 3V6OA 3GIVA 5DJ2B 4NIKB 3NTCH 2FWOA 4CRPA 4XX1E 1I1CA 3KGRA 1GGYA 4I18B 3CK0H 3LEXB 3GKZA 1YNLH 1RIVH 4HKBB 4JM2F 4LCCB 1LILA 1VFMA 2PF6A 5BO1H 2UZIH 5KTEH 4V1DB 3K80A 4FQCL 5SWQA 3CLFL 4FRWA 2W1NA 4OD1L 1ZLSL 1FL3A 1G9MC 4XI5D 1LVEA 4G8GE 4CMMB 2OCFD 2HG5B 4NZTL 4UT9H 1N5YL 3KJ6L 5A16B 3O2VH 4JZNA 5JW5A 1MLCB 3GHBL 1UWGH 3MODL 1YN6A 2H8PB 3ZDZF 5DYOA 2HT2D 2UZIL 2UYLA 2BJML 3EYQD 1E6JH 2BNQE 1I1YB 5BV7L 4HG4K 1BBDH 4MJIB 2Y36L 1BQSA 3N1PC 4QF1B 3EDKA 4ZSOA 4YGAB 3L6FA 1WGOA 1XGUB 5FYJD 3WV0A 5GRJL 3PWVB 3TH4T 1AO7D 4K3JH 1CTNA 2DM7A 1MJUL 4WHYG 4MNHB 1NGXB 3EJYD 1BFTA 2G5BB 5D96B 1KCKA 4CVWA 1B2WH 2BNRE 3KPSD 3UTQA 5E9DA 2NY0D 1CFSA 3MRDA 4Y89A 5HHOD 3BW9A 2BRRL 1U42A 3CVIL 1FH5H 3CDYA 5F7NC 1XIWB 2B1AL 2YBRB 4HZLB 4HXAH 1CICA 1U58A 3IKCB 5F1KC 4QHNA 4WTXA 5GS0D 5C71A 3DUSA 5DJ6B 5JLZB 3H0TB 1MCPH 3BEWB 2VLKD 2BC4A 4Y16C 4OTXH 3X3FL 2E7HA 5DK3A 4TNWK 1FFQA 2WBJD 4XNZB 4GUPB 4P2RE 3D0LB 2FJGB 2C4XA 3HAEG 1TVHA 3B83A 1OT2A 2F19L 4NO0D 4ODHH 3BGFB 4WEBL 2EKSA 5KAQG 3P4OB 2CD0A 5CGTA 2M1KA 3DI2B 2JB5H 5JDSA 5I74B 4HAGA 4PP2B 1DLHA 5IVXE 4D94A 1S3KL 1RUKH 4JANA 2IAMD 3EJZC 4Y5VB 4WUUD 3CH1B 1JNHA 2QQKL 3QJFA 3RDTA 2VJXA 3PWUA 2AI0L 1F6AB 1X5IA 1UACL 2GI7A 1E6JL 1BP3B 1T0MB 2BRQA 2EDKA 2FWOB 5F9OL 1L9NA 3ISWA 3O3AB 4J3OC 1DFBH 1KC5L 4C83A 1B4JH 2RHEA 3ARFC 4FFZH 1WEJH 3VE0A 4PJAF 4WEUD 4QWWC 4JFEE 4AH2B 1QBLL 1PLGL 4QRSA 4NN5C 1CFNB 1DVFD 1IGFL 1FGNH 4H5SB 3VFOA 1DQQA 4EI6A 4WI2A 1NMCB 5D1XD 3PP3K 5HHXL 2BP3A 3LIZH 4K9EC 1E4KC 4CMMA 43CAB 4KRNA 2ZUUA 4GS7C 2WIMA 1MCLA 4OT1L 2XXCB 1IAOA 3L3DB 4KMTH 3QFDB 4JGJA 5HHQA 5D1XA 1LK3H 1QPXA 5DYOB 4RGMC 1E4WH 3RGHA 4PRBA 4MB5A 3QIWD 1XR8A 4U1NB 3CMGA 1HDMB 5HGDB 3L3JA 1LO2L 4JGMA 2FGWL 1AKJA 2EDLA 2IBZY 5CINL 4M7LH 4QF1A 3GSQB 4BFGA 4ZUSB 4MA3A 4JZJC 4K94C 1A6AB 4WWKA 2DKMA 3L6FB 3INUL 3HUJA 5T3XE 3VXME 3NIGE 1TPXC 4HWBH 1I8KA 4HG4J 2HJLA 4U1SA 4WW1A 3MFFB 3SDAD 3WFDL 3MOAL 3RA7H 4LARL 1ACZA 3QZWA 1CI5A 1WV7T 2VLLA 3MJ9H 3THML 2AEQL 2CKBB 3QPQD 4MD4B 1WZ1H 4M6OL 2E8ZA 3QISA 1T7YA 4NQVB 3MBEC 4LVEA 4GKSB 5IB3B 1NJ9A 2R0LL 5JOPE 2J8UE 2AK4D 2H9GA 3QQ4A 1DLFH 5GSVA 1CICB 1U58B 5F96H 1A5FL 2F54A 5FO8A 3MNVA 4ZTOL 1N6UA 1F13A 2HJFB 5C08A 4LCWD 1XCQB 4ZOCA 2DLIA 4LAQH 2NXYD 3TBYB 4YPGB 1CD8A 5C0GB 1U3HA 5DRXB 1A7RH 4M9OA 1QFWL 1CGSL 2IPTL 3O3EA 4LKCB 4HIHA 4LSVH 4GRLA 1G7JB 2NNAA 3FQXB 2DJ4A 4PV8A 4U31A 4PG9A 4GBXB 4PLOB 3ZLQC 1U3HD 4WUUB 1YC7A 1J88A 1J87A 2PO6A 1KELL 2A83A 5T1KA 1A02N 1KYOJ 3UTZA 3CNKA 1CBVH 3DMMB 2V2TB 2ESVD 4I0KA 4NN7B 1ZK9A 3GSOA 1FE8L 1MH5A 3VD7A 3X13A 2CK2A 2DICA 2ZUTA 3LAFA 1QP1A 1T0MA 4OCXL 4RGNE 5DQDH 3OKNA 3HUJE 5DJAA 3BPCA 2NXYC 2CSPA 5SWZA 3O3UN 3STLB 3MACH 2DQHL 5DR5L 1WWWX 3ULUE 4N9GB 4ALAL 1FNFA 5HDBF 1IGJA 3S3SA 3MRBB 2CUHA 3SGJC 3GJEA 4JFFE 5SWZD 1ADQA 5SWSB 3VD3A 1VADA 5E2UH 1W8NA 5E4EB 3EHBD 1JWUA 3MJ6A 5AG9A 4ISVB 4ONHA 4EN3A 1JHKL 5T3ZE 5C2UB 1J0IA 3MGOB 4HGKC 3VFVB 4E5XA 5I1LB 3EO1B 2ZOKB 1Y18B 3MLTB 3F62A 4S1RH 5C6PB 5DEGB 2MSPA 5FYLH 5LKNA 1MRCH 1QOKA 1E4JA 3CFKA 1MJ8L 3RQ3A 4JREC 3CUPA 3C2AL 3U4EB 4OZFG 4QYOB 3KR3H 2WNGA 3CFBA 3UJIH 3G5XB 3D3VB 1IE5A 3ES6B 2KH2B 1NGYB 3GI8H 5B22A 1LK2A 4APQD 1X5KA 4YBQD 1KB9K 2O5ZL 1W0WA 2D2OA 1P6AB 4ONFL 3MJ9A 4JB9H 4QRUA 3NFSH 4W81A 1OTTD 3QI9A 2A0LD 3PF2A 3VWJA 3BKYL 1GC1L 3M8OL 3IVKA 4RDQG 1D5MB 1JF6A 4XPAL 15C8H 2V9RA 5IEHB 3F7RA 5GSVB 3VI3F 2IAMA 2QHLA 4GAJL 3VXUB 2OJZL 4ZO9A 5K59E 4J6RH 2ZSVA 1V3JA 3QQ3A 4J3UA 3O11A 2HH0H 3CSYA 2BNUB 2HA1A 1MLBA 4LCCA 3EFFA 3JV4A 1YYLL 1HYRC 5DDHB 3FRUA 2LTQB 2I9LB 4HFWB 3RX5A 4NKIH 5AYUH 1M7IB 4R0LA 5IB5A 5F6IC 5FGRA 1OAKL 4XRCA 4RAUA 4P2CG 1A3RL 4R7DB 5F71A 4PV8B 3CFEA 4WENB 2NXZD 3IETA 4RAVB 3WS6A 3U7WL 2R8SL 3EO0A 3MV8D 4ZOAA 2IPTH 1WF5A 1NH6A 1G7LA 1S8DB 3ULSB 1T89A 1YN6B 2OTUB 3TM6A 3MLXL 1QFPA 5BVPH 4HXAL 2JJSC 5GGTA 1DUYA 1QA9A 1K6QL 1CLOH 1MH5B 3RWDB 5BZWA 2B7DT 3MRPB 1H3TA 1YZZA 4IOSD 4P2RB 1N59A 1BGXL 2XWBA 5MEPB 1BJ1H 4U1GC 1MCKA 3WMSA 3IKKA 4M48L 1UB6A 3DJ9A 5C08E 3O6FA 2CXKA 4I0PB 1NGXA 2XACC 3STLA 4OKVB 1YQVH 4MD5B 2C1OA 4JN2A 3D18B 1G9NH 3QUYC 3GSNH 3LKSB 4WFGE 5I1HL 3UJIL 4HF5L 3MO1B 2QKIB 2IGFL 1DBML 1IGJB 1QO3B 3BO8A 1I1FA 4NSKB 5J56B 3GSUA 1VHPA 1H5BC 4D9LL 4JN1H 5DRNB 1HIMH 4OGAC 1TETH 2X4NA 3LMJH 3Q6GH 2DIBA 2XTJC 1ZKAA 4ISVA 1QVOA 4QXWA 4KK9D 1NCWH 3EZJB 1Y6KR 3QZWG 2BVOB 1D3CA 3CFCL 5E2VL 3EJYC 1XGQB 5JO5B 4F9LC 1JNLH 2MHAB 1Y18A 1KIPA 4UIKH 3QCVL 3C2AH 3I6KA 1LE5A 5DZOA 3NGBB 4YBHA 3FTGA 3TT3L 4B53A 2NW2B 4XWOC 4GRMB 4XCFL 2HWZH 2PYEB 5TF1H 3IDXH 3NIGF 1ZTXL 3U4EA 5CBEB 1IEAB 3IXAB 3RVXC 3VGEA 3D3VA 3RUGE 4D9RD 1FVEA 2FECL 1S7WB 2BDNL 3D85B 3SOBH 4DTGH 2B2XH 1FV1A 3QHZL 1X6NA 3LN9A 4KY1H 4YK4C 4H88L 4UIKL 2NY1B 5ESAB 2DM4A 4NWTL 1M1SA 2HYMA 4CL7A 2O5XH 1YECL 4AYFA 1F3RB 2H32A 4P5KA 3IVKB 1D5ZA 4N0FA 4JFEA 3VA2C 3PV6B 3KPQB 4MAYD 1JIBA 3BHBB 2BNRA 4NKMB 3QBTB 3LDBC 1BGXH 5IBLD 2OP4H 3ARGC 4O2EB 3EFFB 3VE0B 4NQDD 3LKPA 4ETYA 1HQRB 4PTTB 5J7CC 3KPLA 1M7IA 4PJAE 1G7IA 4Y4HC 1CFNA 1SJEA 5BVJA 4WGVB 1U6AH 4L1DA 4XAWL 2X4SB 4R7DA 1HYSC 3I6LD 3U4BH 2P8LB 4MJ5B 3QXUA 3UMTA 3EO0B 4ODSH 3EYVB 3ZT5A 5ALBL 4KTDL 2AJYL 1WZMA 1KELH 2OTUA 5D1XB 4NQTA 3LZFH 3KS0J 2XA3A 2BVQB 2OBGA 3CX5J 4HS6B 2VDOH 3K2UH 1HDMA 1I7RB 4YFLI 3RGVD 1EFXA 3WS3B 5IQ9B 3JWOC 3MRPA 3VI4E 2WK2A 4PLKD 3GSQA 4P2RA 4TNWF 3QXVA 4IRSD 5CP3H 7CGTA 2EDDA 3FT3A 3LRGA 3PL6D 4XAKE 1M7DA 1SMOA 2K3TA 2Q1EA 3HCVB 4J7RA 5JHDD 1JZ8A 2RIKA 1QLEL 2YRLA 3CGTA 3FB5B 2E7LA 3IJHB 4K3EL 3MUGB 3VGAC 1QTYT 4MNGB 2KQMA 5F96L 1I3RA 4DOHE 1WIOA 3OAZK 4EI5C 1T03L 1IQWL 4DUXA 1CFBA 5FAAA 5GS0H 4G3YH 1TZGH 2X70B 5EZIL 4MXWH 1AQKH 3W9DB 1NJ9B 2FEEI 3EIFA 5KSVB 4J6RL 3DYPA 4OCWL 4AEHH 4M1CD 3QUZA 4XB8A 3RNKB 3RP1A 5DFVC 4OZ4A 2COQA 2B5IB 4CVZA 1AHWB 2CRIA 5GRWA 4NJ9H 5CJXA 1IAIM 3L3IA 1KENL 1T22B 1FFPB 1VSCA 2LU3A 1D5XB 2DQUH 4PY8I 4E41B 1Q0YL 4TULL 4YPGA 4HBQA 4JY5L 2WWKO 3RTQA 1VKXB 2NXZC 3GI8L 1JL8A 4JR9L 3WSQL 1A6UH 3GNMH 3MLSH 1XCTB 2AJUH 1RFDL 2BNQA 3OAUL 4F57L 4PG9B 4LPWA 2WIIB 4HIEB 4PJ5E 1EGJA 2NZ9C 3T65B 1ES0A 2DLFL 3D87B 5JHDE 2DQEH 5E2VH 4GXVL 5FM5O 1VA9A 4UOJA 1NBVL 1YQ2A 1BZQK 1K5NB 3IU4L 4YHLH 4C57C 5GS1B 1OW0C 1NMAH 5E8DL 4YHNB 1T04B 4XCFH 1RIVL 5F97E 3BPOB 3ABZA 3LVEA 1JFQL 4NZRH 5ESVA 5FF6B 4AT6A 2VZOA 1FLTX 3RVTD 5EC1A 3K2MC 1F3JA 2DDQH 3BPCB 3HZMB 5I1HH 4FFZL 4PJIE 1M05B 2GAZB 4DKEH 1FJ1B 3PWJA 1YQVL 5JA8B 3G6AA 3ZL4H 3EYFB 1EEYA 5DT1L 3JTTB 2VXUH 2JB6B 1FBIH 1VFOA 4YR6A 4GAGL 5IV2B 1AE6H 1TETL 3BWAA 4Z9KB 5J11B 1K8DB 1SJEB 4FXGA 1NFDE 3E3QE 3G5VA 3ARSA 3IAPA 2EDBA 2MMXA 1P7QB 4JFDA 3BRFA 3VXUE 2OTPA 3Q6FA 1A4KB 2Y5TB 4G5ZL 4HCRL 3WIFA 3RWGA 5FYJU 5DD6A 1IKNC 5IB2A 1I75A 3LN5A 5GS3A 5HYJD 4ZQKB 1G9EA 3QH3B 2OI9C 1EFXB 5L88H 1VFBA 1U8PB 2RFXB 3T3PE 2QADB 2V9TA 3B2UC 1YEHL 4LRNH 3MGTB 3FT2B 5CP7A 4Z7UB 4CU8A 4KC3B 1MFNA 3SKNA 5ALBH 3TLRA 1EIBA 3HCVA 2ATPB 2D7TH 2VDNL 3M45A 4H8WC 3MCLH 1AO7A 4K71B 1TVDA 4KK5D 1MY5A 1IGCL 5FECB 2BRRH 12E8L 2X09A 1LP9E 1S9WA 1D5MA 4Z7QE 2D7NA 2DLTA 2D3VA 2EIZB 1AE6L 2GY5A 4GQPH 5FO9B 1JHTB 4JFED 3PIQB 4NWTH 2APXA 5D9SA 2UZYB 4KDWA 3QDGD 4XRCB 1NKOA 2GHWB 1XCTA 4EUPB 1KCVL 5EORL 2BNQB 1Q9LA 3QJHB 1QSEE 4C58B 2FLRT 4XCNA 3B6SB 2YR3A 4D3CH 2D4DA 3T65A 3DX6B 2VXQH 3QIUA 3QIBC 4DCQA 5KSAC 1TTUA 3T3ME 1ADQH 1X7QA 1GH7A 5J9PA 4XX1G 3ULSA 5C09E 4ZTPL 4YGVA 1YUHB 4H20H 3GSXA 2AQ2A 4AY0A 1A0QH 5L0QC 3NCEB 3HZYA 1MRCL 3UXFA 3TZVC 1OF2A 2CK0L 4XVSL 5GXBB 1FNGB 5EC1B 4YHPA 4IMLB 3V0WH 3SGDI 2AXJA 1M05A 1EXUB 4TUOB 1FORL 1G6VK 2EXWD 3ROOB 4PG2A 4RFEA 1NCCL 3JTSA 4X6DE 1A64A 1MCOH 4HXBL 1ONQA 2FHCA 4JKLA 4DEPB 1QO3A 3BO8B 4X6CE 1KN2H 1Y6MR 4F80A 4NSKA 3GSUB 5FOBA 3VXQA 2BZDA 5A43C 4U1GB 3HLAB 1WIPA 3A6CH 4H1LH 3LKOB 3EOTH 3ZKSD 2AJXL 1GGIH 2WINB 2HVKA 2Y5TA 5HHOE 4QRPB 5DTFB 4FFVD 3FO0L 3FFDA 3P9WB 4XWGH 2FGZA 4PRHE 3MNWA 1CDHA 2YD8A 4OV6F 4TUKL 3G9VA 1HE7A 2DQJL 1KGCD 1KIPB 2Q7YA 2ICCA 5IMMA 3X3FH 4PUBH 1EGJL 4Y4KD 1AHWC 3RZCA 2YZ8A 2BCKA 4WEBH 5CJ8A 4NQEA 2HFTA 1JGDB 2A73B 4IRJB 2B1AH 3FO2A 4ORZC 2CLZB 2F53A 4I3SL 4WTZG 1C7TA 4NWUH 1CS6A 3CSBA 1TQBB 3C6LA 4TUKH 3P77A 5TGBA 4P9HC 3WNPA 3MXWL 2HRPL 1OD7A 5C6TL 1YEIH 5HGHA 2VH5H 4JFDE 3ARGB 3HAEB 5TDOA 4UILH 4CADB 3C8HA 4EXPX 1D6VH 3WHE1 4HPYH 1D5ZB 3ARUA 3QB7C 5EIVA 3GIVB 3EYUL 5DJ2A 5E6IB 5I1KL 4IIQA 1I9JH 2NY1D 2Y06L 2X4TB 3VGBA 4B41A 2NX5E 2AEQH 3MV7B 3RWHB 1Z3GH 1ETZB 5DD3L 4HHAB 1WT5A 3TWCH 5D5ME 2NY2D 1XGRA 5DMGD 1HQRA 4PJBE 4GJTB 4LLUA 4P3CL 4XP1L 2F74B 4CVXA 3U9PL 1XT5A 2HFGL 1DEEB 4XBPB 2HJKB 2OLDA 4EUPA 1QHOA 4FZEL 2YEZA 1V8HA 2CLVB 3V4UL 2OK0H 3QEGL 1LE9A 4LNVA 2R4RH 4WI7A 4LSPH 4OBSA 3VRLE 1ZA3A 4I77H 5DUML 2J88H 2H8PA 2PO6D 5KSUA 3QPXL 1SBBA 2PTUA 4W4OA 4KMQA 1X5LA 4OZHA 3RVUD 3GSXB 4HLZG 5F7LB 4DN4H 1HSAB 5EUOB 3ZKNC 1VACB 4JM2C 2Q7NA 1ZGLA 5E6YA 1P9MA 4ENEC 3PWVA 1J5OL 5E8NB 1RUML 3VGFA 5F9JA 3U1SH 4NC2B 2NX5D 2OSLA 2OXGA 2EDJA 4S0TD 4LVHB 1KIQA 4M62H 1KC5H 3BQUB 3MZGB 4URTB 1UZ8B 3C9NB 2ADGB 4DW2H 3KPRA 4P46A 4OM0L 1X5YA 5EORH 1RIUH 3QAZC 2EO9A 4JY4A 2I07B 5DD3H 4XP9H 2QQKH 4P2QA 1ZHLB 1QRNE 4XNYL 1QACA 4ODVL 4MHHI 3O0RL 3W39B 2HVKB 5IFJB 4YBLB 3HMXL 4BM7A 3IAQA 1KXTB 4FP8L 5AUMB 3OXRB 1M6OB 4MXWL 3MRMB 4D8PB 1D5IH 2IQ9L 3VGHA 1L0XA 3MCLL 1S7TA 3QDHA 4BK4A 3ZTNL 4ZPTB 1H3PL 3ARRA 4AIZB 2W0LA 1YPZA 1SQ2N 3Q1SH 2I25N 4UNVA 3VXMB 4LRNL 1K6QH 3V6BR 4KH2A 2WWMD 4L8SC 1I8MA 2C3GA 3V9FA 4NKDB 1BJMA 1CGUA 4UUJB 4HV8B 4AEFA 3VXPB 3AY4A 1RZJC 3P77B 4BELD 5I19L 3S35L 4Y2DB 2LTQC 1TVBA 4JFXB 1DN2A 1RJZA 5SX4I 1Q9WA 3D2UD 4KHTL 1F2QA 5E00A 2DTMH 2NY7H 4CDHA 1JHLL 5IG7A 3SGJA 4OLEA 2BHUA 3C87A 4NKIL 1NL0L 4OTXL 4O9HL 1F3JB 1TJIH 3D2UA 1YEJL 4X5LA 3FQUB 3OJVC 4LGRB 2Q8BH 1EEZB 4LLWA 2GEEA 2XTJB 1BD2A 3DXAE 3FB7A 3JZ7A 5ERWA 2A9MH 4YR6B 1I7TA 2J8OA 2Z8RA 4U6YA 5IBUG 5IV2A 1U8JA 2NPLX 5DSCA 2HTLC 2M8XA 1XGYL 5HDQH 3R8BB 4P23C 3B5TA 3DVIA 4R4NC 3VFGL 5I16B 3H7LA 4GG6E 3V0WL 4GAGH 1N3NA 4FA8A 4FFYL 3QUKB 2EXYD 3GMOA 4XVSH 1R5VA 4PJGA 1RQ5A 3WNMA 2IANA 3G5YA 2HFFA 3NCJL 5IWLC 1F02I 5IB2B 3LN5B 3D3VE 3O2VL 1PX4A 5HGDA 4PJHF 3L3JB 3GSVA 2X7LA 3MRRB 1U8PA 5EUOA 1EERB 4NRYB 3MA9L 1MPAL 2E7MA 3UJJL 1FO0H 4EBQL 3U2SA 3CLFH 3SKNB 4OLYL 3KPSA 4Z7OF 5K9JL 3UEZA 3F7PC 4DN4L 2Q76B 2X4UA 2KQNA 2HJLB 2B39A 1YPZE 1T1XA 4JCLA 4OZFB 4N90E 2YRPA 1YEKL 3E2HB 1SY6A 1FVCA 3ROLA 1QSZA 2HTKC 4WW2A 3GDBA 3C6LD 2X2YA 3C5ZA 1IRAY 4GXUM 5IBTL 2X1QA 5KTEL 1H3GA 2GK0B 3OKOA 1MHCA 1HN1A 2F54B 1VB9A 4D0DB 1ZVHA 3QEQB 4ENED 4ZAKD 4NQDE 12E8H 3LSOA 5LXGL 1A6PA 2FR4A 2EEDA 3BZ4B 3HR5B 3U0TB 1YJDL 4HJ0C 4P2OB 1A7PH 1IKFH 4XMKH 3CFDA 4U49A 5F7HA 1RIHH 1A47A 1NGWB 3G6DH 5D72L 3BN9C 5L7XL 4JLRB 2ZOLA 4JKWA 4WUUA 4ZFGL 5AG8A 4YHML 2EXYC 5GSRB 5HTSA 3DVGB 1OTSD 4XNZC 5IW3A 4L9LC 2Z31B 4PRHB 3W11D 2DWEB 5HD8D 5L88L 2A6DA 5EG6C 5BRZE 2OI9B 1YEEL 1FO0A 3MXVL 3TF7C 5JNYA 4XXDB 1DN0A 2R8SH 4AJ0A 3NIFE 1EXUA 4KROB 3U82B 4MAYA 1G0DA 4HBCH 2BFVH 4MJIE 5L8JB 1I7TB 1SVZA 4U6YB 3G5ZA 2PW1A 1ONQB 1XGPA 4K9EL 1GXEA 3TPKA 3O6MH 5L0QB 1ZLWK 4OF3A 2NX5A 3VRJA 2FATH 2FSEB 3NFNA 4X4XA 5DMIH 3TH2T 2OL3H 3L1OL 1D9KA 2NY5C 4XPAH 1ZT7A 3MJ9L 3THMH 4U1JB 3ZTJH 1NCUA 3GMMA 2ORBH 2R2HA 4R3SB 3W9EA 1RZ7H 4JY6B 3SDDA 3BAEH 1FNSL 2D7MA 3BUTA 3HPJA 3OPZL 1FG2B 1KJ2A 4WHYH 3QNZB 2H2SC 4KDTC 1D9KD 3F7VA 1NBZB 2R4SH 2NZIA 3MRRA 1HHKB 2FH6A 4QNPE 3H9YA 2M2DA 5GS1C 3MLWH 3CUPB 4BSVA 2FGWH 3ZYZA 2ENYA 4MJ6A 1TCRA 5D2LE 5I1IL 4KDTA 1KJ2L 4MAUH 4IRJA 3VXOB 4PB9H 2Q76A 1MQ8A 3TBWB 1FSKC 4Y4FA 5GRUL 1YNKL 1KB5H 3OR7B 2Q6WA 3QRFM 1KTDB 1ZS8B 1MQKL 4YDLC 5DI8B 1A22B 5K9QI 4IRJD 4IOFD 3ROLB 4YDJB 1UM5L 5B3JF 5DZNA 4Y4FD 3QEQD 5KSBE 4PREA 4JG1H 3CZJA 4JN1L 4LCWA 3I50L 5HGGS 2ICWI 1QBLH 5E95B 2ZSVB 3QEQA 1ETZA 1OAZH 1MLBB 3L7EB 4JR9H 3LSOB 1DFBL 3BZ4A 3CDCA 3TBTA 4DKDC 4X6DA 2YXFA 4JRXA 3MRLA 4J23A 4Z0BH 3CFDB 3QDJB 5HDQL 4PJDB 1FFNA 1F90L 4F9PC 3ARBC 1FIGL 2J4WL 4H0GA 3HNVH 4LDLB 4RGOH 3P4LA 3QIBD 4NQCB 5KSAD 3ARDD 5TE7L 1ZA3B 1ZHBB 4LPXA 5DHYA 3SKOB 4KZDH 3SCMC 1CF8L 1UWEL 3TBSA 1DUZA 3V6FA 3WFBH 3QIBA 5KSAA 3BUYB 1DUYB 3MA7B 3I3DA 2PYFA 2VDOL 4K2UL 1KIRB 1NDMA 4LLDA 4WO4C 2P1YA 3X12B 2NY7L 1ZGLB 4Q74A 4RMUA 3ULVE 4XMLH 1NFDF 3I84A 2PXYD 3QI9C 1YC8A 2W59A 3C5SA 3DO3A 4BKLB 4ODSL 4PRNA 3MREB 3DSFL 3LB6D 5DJXA 3STZA 3MUZ1 3KAAA 5GHWH 1I4FA 4GKZA 1XEDA 4NT6A 1KIQB 3LKSA 4LCIH 4RMSA 1TIUA 1MCEA 2LU7A 4WUKH 4Q6IA 5D7KE 4CNIB 2GYSA 1UCBH 3AXLA 2ZUYA 5ITFB 5A3ID 4P2QB 2EKJA 1YMMD 1D9KB 4PYHA 4TVSa 4DGVL 4LKXB 1QVOB 4FABL 4RZCB 4IRZL 2VIRA 1LD9A 3TN0D 1M6OA 4JY6A 1H15A 3O8XA 1A7PL 3LKRB 1CU4L 5E4IA 1N8ZB 1YMMA 3S4SA 1FAIL 2AV7A 3MRIB 3VWKD 1QBAA 4NFDA 3BKYH 3T4AB 1AXSA 4U1KA 1M71B 3RI5F 3QQ9C 4IDJH 2CRYA 3MTRA 3IXAA 4NKDA 2QSCL 4FQQB 3WNNA 4Y4FB 1B0GB 3D85A 3VXPA 3PDDA 3QUMA 4PJFF 1FV1B 2P46B 5DRZA 4MX7B 5DJ8A 4Y19E 1CLYL 4X6FA 4N0YL 1TVBB 2ED8A 3RWFA 4PJEB 4D0CB 4G8GB 5C0RH 1IM9D 4LHQB 1NPUA 3KWWA 4P5MA 4HT1H 1OP5H 3MLSL 5D2LB 2AABL 1U93B 3V7AE 4L8SB 2OTWB 1HOCB 1KFAH 2AJVH 5IG7B 1ZT4A 2G60L 2AEPH 3PV6A 5H94B 3O4LA 5IK3A 4OLXL 1MQKH 4KJPC 3ZYOA 1KCVH 1JGLH 2GFBA 2JIXB 1EEZA 4FG6C 4PJ7F 5EOQH 4WI8A 3T0BA 4NJ9L 4V1DA 1PLGH 1GAFH 4M7JH 5LWYL 5IB1A 3KJ4C 4Q9RH 4N0CD 1IC5L 4KI5E 5FUOL 4PGEA 4R0LC 1S9XA 4MJ5A 1KEGL 3MLPA 4OIBA 4OAWA 1A6VH 1N7ML 3BSZH 1CD9B 4LK4A 1BQHB 4LHJB 3QXAA 3V5HA 1KF9B 4GMSH 3Q3GB 2WANA 5C8JA 1ZLUH 4O02H 4FQHB 3HI1B 4MZ2A 3SY0B 4QXGL 5AZ2L 1VGKA 5I15H 3QFJA 5DLML 2H2PC 1T2QH 2AK1H 4K3DH 5DA4A 4GMTL 3PWNA 5KBNC 3N1FC 1X5XA 3RI5K 4HMDA 3V79C 2VDKL 5CIPB 1S5HB 5CSZA 1ZHKB 3RU8L 2V2XB 1LP9B 1OP3H 3MREA 4YO0A 5FA3B 1EDQA 2IMMA 4YZFE 1HZHL 1N64H 4NT6B 1WAAE 4G6JL 3TT1H 2DTML 5KS9E 4LF3B 1BM3L 4MQTB 3EYSH 2FHFA 5EZJB 3SDAA 1NAKH 1EEQA 4LAJH 3M17A 2VDKH 3RAJH 1KPRB 1NQBA 2ZP0T 2VRAA 4KI5D 1T2QL 2AK1L 4FP8H 3OKOB 4ZNEE 1JPST 4D0DA 2R9HC 2VIRB 4XP5L 4CMHB 3D25B 3BEWA 2P7TB 4G8FA 4MVBD 1SY6L 3FQWA 3LKRA 5EBMA 5MHSE 1OGAE 2DBJA 4O4YH 2P24B 1IGMH 1KJ3L 1A1NA 3P0YH 1FBIL 4PFEA 1F4XL 3VFTB 3CD4A 1OGTB 2Y7QA 3WIHH 4A6YL 3HNTL 2FLBT 1TZIB 1WC7A 4JM2A 4JRXD 5GGRB 1MSPA 1TMCB 3BP7A 1B88A 1J1PH 1ORSB 1W72H 2VYRE 2X4RA 1U8OB 5K9QG 5DRZB 5L8LB 4KZEL 2FD6L 1U8LA 1YPZF 3JV6A 3UBXB 2YHGA 2N4IA 5C0CA 4PJEA 5D7JC 4G8GA 5I1GH 2E6QA 5K9OB 5T1KD 1ZLWH 4M8VA 3MR9A 4P5MB 3MC0A 4LNRB 4M7ZB 1U93A 4X6EA 1HOCA 2CLRA 3OR6A 2OTWA 3DX7A 1G9NC 4R4FH 1LO2H 2ZJSL 1I1AC 1V05A 1HNGA 3B9EA 3DGGA 4KKAD 1K2DA 3O4LB 5IJVA 5IROC 3AM8A 3PP4H 1NAMH 1FJ1A 4XVUC 5F3HB 4OGXH 4YE4H 2GFBB 1I7ZA 1NBYA 1RJYB 3S5LB 4LDOB 2VXTH 1JV5A 1QRKA 4Z7NE 4FFWD 4GG6F 2VZUA 2YUWA 2LE9A 5I6XC 3BGMA 3K4AA 4AENA 1A1MA 3QPXH 4HGWB 3QUXD 4D9QE 5C92A 3UPRA 1GHFL 4C56D 1AI1H 4WNQA 3MLZL 3N9GH 4MQSB 1OVZA 5KANG 1YY9C 4PJHE 4QOKA 1WEJL 2J8UB 1OCWH 3VD5A 4LEXL 4Y16A 4OSUL 2Y5EA 5GS2D 4J3WA 4X9BA 3EUUA 3QNZA 1S7XA 3E8UH 5DR5H 3BIAX 4LPUA 4G80B 1MFBH 1DBAL 2HKFH 2NY3D 2ZCLH 4RISH 3RUGA 3X14B 1L9MA 4WJ5A 1B6UA 4MA7L 5MP6H 4YX2H 4KKCD 1CVRA 1UZ6F 5HVHC 3CZFA 3OAZH 4U1SB 5FA3A 2JJVA 4CDGC 5BVPL 3BKJL 3KXFE 3QUML 4JG0H 3QUZD 3BRDA 2XT1B 5D2NA 3VI3E 5GZOD 1YEIL 3TO4C 2OZ4L 4PREB 1MJJB 1EAJA 5D1ZB 4G6JH 3TT1L 5C9JB 3PHQA 4ODXB 5I8CA 5E0QA 4K07A 1V7ML 1A7BA 2EE6A 4N5UA 3VWJD 2UY6A 5T1MB 4BA8A 2R0LH 5EPMB 3WJJA 2HT3D 35C8H 3CLEL 3BKJH 5C0GA 2P5EE 3EOYG 4GXUN 1NDGA 1ZSDA 4J3VA 2V7NB 3O3EB 4LKCA 2VABA 4F7PA 3P3YA 4KAQH 2N56A 3BDYL 1A5FH 4L3EA 3QJHA 1CYGA 4YHMH 4X4YB 4M8QB 4OCMC 4NQCA 5IOPA 4HC1H 4PBXA 3A6CL 3QIUB 4P4KC 4DCQB 5T1KB 3QDJD 3DTXB 5DHYB 3ZL4L 1YUHA 4L3ED 4L3CA 1P4LB 3O0RH 1LO5B 3HZYB 3ARBA 1NCCH 2P44B 1UZ6E 2R23A 5C70A 4LEOA 5EBGA 4DGYL 1U9KA 3VH8A 1OGAA 3HZVA 4I48A 4NRXB 3DGGB 1L4IA 2QADC 3KPNB 5BO1L 3D9AH 2NY4C 1MUJB 2CO6B 4GKZB 1V3KA 3PQYA 2ZKHL 4EBQH 3TBVA 4GXVH 2VDPL 4OUOA 4ONGL 3IRZA 3QCVH 2DB8A 3DVNB 4MVBC 4R4FL 4IOIB 1DVFB 4LBEA 2GUOB 2HN7B 1VADB 1Z9LA 1AIFA 4NGHL 1TCMA 3LEVH 4OIAA 1VERA 3U9PH 2AK4E 4MNQD 2WINA 4TTGA 1SJHA 1P2CB 3DX9B 3GM0A 4M3KB 5C0AA 1S7SA 2WQ8A 3QG6B 4ZXBD 3FFDB 1Q1JH 1C08A 3C8KA 3MGOA 4M4PA 2YD4A 3BDYH 1R5IA 5EO9A 4R8WH 4ZUVA 1N0LA 4LSPL 3QULB 2FJFA 1N8ZA 1YMMB 2AJSH 1R3KA 2OJEB 4G80A 5B8CC 1JWMA 3PXHA 5TDPB 3CLEH 2EDNA 2J6EA 1AXSB 2Q8BL 1V3MA 1RZJH 4MDJA 1X4XA 2XN9A 4K23H 3O3BA 2FEEL 4XCCH 3S96A 3O6ML 1OSZB 1KN4H 5HHPA 1K85A 3B5GA 2P43B 1E6OL 3ES6A 3O45B 5BS0E 2NYYC 3CCHB 1OWWA 2DI9A 1UM4L 3AAZA 4QT5A 2K1MA 3UTTA 1KJMB 2J8UF 2IPKA 5E9DD 3CXDH 4Z95H 2EYSB 3CMOH 2BERA 5LBSL 3CXHK 1QFWH 3V7AG 2RJMA 1A6WL 4G8GD 4ZYKA 2IG2L 3KLAB 4OD2A 1BFVL 1CICD 1FG9C 3F58L 4XGZB 1EVTC 1QSFA 1XGRB 2VKWA 1PKOA 2GJ6B 2VLKA 3C2SA 2AXGB 1LWRA 3MNZA 3SO3C 1H3PH 5IB5B 2VMFA 5B3NA 4HK3J 2EE2A 3I6GB 5L7XH 2GTZA 5DMGC 4J4PA 3KYKL 5M94B 4PS4H 4XXCA 4LSUL 4XNMA 5DLMH 5TE7H 4QCIB 1QSVA 5CSBA 4C54A 2OR9H 2BHYA 3DTXA 3EDFA 5C8JB 3ARFA 3O3DA 3QQNA 1QBML 1VGKB 4NRZB 5EOCJ 1JGEB 5SWSE 4HWZA 1IGYB 2UUDK 1GPOH 3RY6C 3PWNB 2DQIH 2AQ3A 4M5ZH 4G8EA 1YYML 4J1UB 1BVLA 3VH8B 4NM8H 4GLRH 1FLRH 3HZVB 3P73A 3QO1B 1QKZL 4N0UA 1ZHKA 1PKQA 4X6CF 2YWZA 2PYEE 5DEFB 5FHBH 1TITA 5IR1B 2C1OB 3WCYA 1O0VA 1DANT 4LF3A 4Y4KC 3SDCD 3KPRB 2VLKE 4LOUD 4D2NA 4P46B 4P9ML 1JF5A 4OLZH 3VXTB 3O6KL 4UV7L 1NGQL 1J18A 5GRVL 4ZXBB 3WJLC 2VITB 1AIFB 3WFEL 3SDCA 4POYA 3E1F1 3W39A 1SJHB 5DRWB 5F21B 3PL6B 5J57B 4P46C 3I2CL 5CUSH 1QKZH 1W8OA 3ZKXC 3RZCD 1A4JB 3REWB 1OTUD 4PRDB 5EU4A 5EBMB 2MHAA 1QZ1A 2A6KB 3RVVC 5IESH 5M7QA 4AM0B 2OXHA 5IW6A 1EH9A 1PKQE 4DGYH 2XWJA 3E2HC 2DYPB 4YNYB 4YPJA 2AGJH 3GMRB 4WO4A 5GRYA 5JIKA 3VXMA 5BRZB 3LB6C 5TDNA 4WWKD 3DV6A 4PJCF 1F4HA 3A6OA 1J0YA 3FQRA 4OZGB 1BF2A 1FVEB 3B5HA 3HE6D 4JHWL 2AXFB 4WO4D 2NTSP 3MRCA 1FN4A 1SEBA 3IJSB 4Y2DA 4Y1AE 5FYLE 3BP4B 2HVJB 2IWGA 3ILPA 3SGEI 4N1EA 3W11C 1BJ1J 1RZIA 4Z8FL 5E56A 1N26A 4ELME 4M4RA 1P9MC 5T3ZH 4X6EB 5KVEH 4F15B 3VFMA 3AS0A 1N64L 2ITDA 3BE1L 2R29L 3TPUA 3C09C 1I7ZB 1J0HA 1PGRB 5C0NC 5IUSA 4S1DD 3S36X 3IAGC 3J8F7 3LKPB 3CMOL 5LBSH 4LQ1A 3MV9D 1JV5B 4L4VD 2F58H 2YKLL 5GJTL 5FYLD 1RI8A 4ELKA 1JZ7A 3GK8H 4AENB 3U9UB 2CRZA 3BKMH 2OR7A 1T7ZA 3NACH 3P2TA 1ZLUK 5I73B 4WWID 1WFTA 2EZ0D 4NFBA 3MV9A 4L4VA 5L6YL 4WCYH 5MI0B 2Q86B 3D69B 5IEKA 4LLQA 5C3TA 3U7YH 1RU9H 1Z0MA 3H9HB 5GISH 3WFBL 5ILTH 1ERNA 3EW3B 3T4YA 4RIRA 2E5EA 3N50A 4JFDD 5KN5A 1INEH 4Y4FC 5E6ZA 5DMKA 1MJUH 3HC4H 5K93A 2J3SA 1CGYA 4O5LL 4Y4HB 2AXHA 1JYXA 1TLKA 2YPKA 4DUVA 4PTUB 3DI3B 3BI9X 4QHMA 2EC8A 5GGRY 3P73B 4LRIC 3KPRD 1MCCA 5F9AC 3OAYH 1F45A 1T1XB 4WW2F 5F7DB 2PXYA 1HCVA 2QTEA 1NFKA 3BT2H 3L7FA 1HI6B 4X5XB 5AAWA 2FX9H 5JW5B 2QV2A 3U1SL 1S7RA 1T80A 5EOCL 1S78C 1C16B 5BQ7A 4ZFOA 3PGFH 4KJWD 5I8CB 2XKUA 4MJIA 3BP6A 1AHWA 1KCUL 4OCSL 3TESA 3VFRB 1ZTXH 3LIZL 4IDLA 5L9DH 1A4JA 3REWA 5JOFA 3UZEA 4NO5A 1WWBX 1FO0L 4GAYB 2NW3A 3DRQB 1BWWA 2CKBH 2OZ4A 3P11L 1OSPL 3O41B 1G9NL 1VESA 1IL1B 2W65A 2UVFA 1FNLA 5BRZA 1NGWA 4I0PC 4NO0A 3SBWA 4JY5H 5HYSB 2DOCA 3QWOB 1CT8B 3DETD 5AAMA 2AXFA 3TVMC 4XTRD 5HHMB 2YBRA 2ZNWA 4HZLA 2YD5A 3DNKA 5D1XC 1H5BB 1P4LA 3CSPA 2QL1A 3QIUD 1Y0LB 3GSNL 5D2LF 3LEYH 5SV3A 4ZS6C 4JFYA 5KZCB 5ANMA 4QKXB 4XPTH 3DURA 2ITDB 3FT4B 3L9RB 2RQ8A 1HH6B 2APTA 2D7PA 5D6CB 5ICZA 4M7KL 1RHFA 4M61A 4OF0A 4PV9B 5CGYC 4F2MB 2W60B 3F58H 2YA2A 1E4XI 4ELKB 5HGAA 1K8DA 5JDSB 4P48A 4I18C 2YMXH 2IAND 5E8EB 4HGMA 4YLQT 4BZ2H 3LV3A 5ESQB 1JGVL 4Y5VA 3F7QA 2FJHA 4Y5YA 2HH0L 4RQQA 3GHEL 4JFZL 3RVXD 3V6OE 1RURL 1HHGB 3H8NA 1S7SB 5D2NE 3W9EB 5DFVD 1CXFA 4U7KA 1B9ZA 3TA3B 1Z9MA 1CK0H 4RIRB 3UBXG 1EHLL 2L4OA 2OQJB 4UB0H 3LY6A 4FTVE 2IJ0C 3ZE2F 3F7VB 5AYUL 1KLUA 2A77L 4LVNC 4QGTA 2XFXA 3HN3A 2P5WB 3OJDA 3G6JA 3MRHB 3QFJD 1RULL 4MDJB 3VFUB 5FIEA 3O3BB 4YHOH 4HCRH 2A6IB 4IRSB 4H5SA 2FBOJ 5HHPB 2Z35B 2ZSWA 2X05A 3U0PB 3KR3L 1AO7B 2EEAA 3ILQD 1ZANL 3JV5A 1CR9H 3Q2CA 4X5XA 2XKSA 1U8QB 1MIML 4F8QA 1DL7H 2O5ZH 4PRAA 2BJMH 1FYTE 3ULUL 3HE6A 4GOSA 4XB7A 1XR8B 1XF2A 1NC2B 2IBBA 1MNUL 3OJ2C 5HYSG 2EYSA 4HT1L 3SE3A 1NSNL 1U92A 2H3NA 2ERJC 1DEDA 3SJVA 1L7TL 1HHIA 3FHAA 4K71C 1E4WL 4L9LB 2W9EH 1EZVY 1F4YH 5GGUA 4K8RC 4QXTB 1JHTA 4P3WA 1I8KB 3I02B 2I26N 2VLKB 3TBTB 1NGPH 2B1HH 1PD6A 1JRHI 1T83A 3ULUD 1WAAA 3HAEH 2VLRE 3I6GA 4H25B 4PJDA 1YNLL 2HT2C 3K46A 4X83A 1CQKA 4NQVA 4XMPL 4TVPD 4XCNB 4QCIA 2XY1A 4GKSA 4OZIE 4KROC 4RGND 3NAAH 1MCWM 3AFLA 4YGVB 3QQ4B 5CCKH 4OGZA 4RNRB 1INEL 3O3DB 5ACLA 5JQ6H 2ZCHL 4Q0XL 3RIAF 3MA7A 2BXYA 3OHXA 3VXSB 2BXZA 4HWZB 1S7QA 2R56L 1IQWH 2R1XA 4ESKA 1OF2B 4H0HB 4MD0A 4ODUB 3DURB 5FYKE 1LEIA 1N6QH 5HJ3B 2PCPB 4C4KO 4GRLB 1EJOL 1QG3A 1MHHA 3ROOA 5KW9L 2LQRA 2ZUVA 3O6LH 4XZUB 5GIRB 1PVHA 4UQ3A 5CKGA 4FABH 2JCCE 3HC3L 1D5BB 2UV3A 2W9LA 2XNAB 4LPTA 3S97C 3IS0X 4RMVA 2JELL 3GSOB 5F9WC 1JGUL 4M7ZC 1FGVL 1DBKH 3NFPB 2FIKB 2OM5A 4YWGL 1DLFL 2IFGA 2D31B 4UU9A 4EI5B 4P5TA 1YDPA 4EN3D 3GMPB 5D6DA 2BVEA 4FQ2L 2A6KA 4QLRA 1IZJA 1IT9H 3AB0B 3L3GA 4JFOB 2P8PA 3OJDB 5ADOH 1EFXD 3TFKD 5MERB 1DQJA 4P57A 4QHUA 5GJSL 3OX8B 4NHUA 1CXKA 3JWDH 4ZFFA 2CUIA 1KG0B 3AS2A 4IRSA 4LL9A 5KOVC 5DHVA 4OZHE 4HEPG 2Z35A 2ZSWB 3C60B 3U0PA 4Z0XB 1JPSL 4CBPA 3HG1B 5BXFB 1AD9B 2FH8A 1R24A 5CJOL 4HDIB 5IBTH 5I17B 5IROA 4APQA 2I60H 5D70L 3C5JA 1HILB 4OBRA 3P11H 2QSTA 1RZIB 3N9GL 4NO2B 3HE6B 5I1LA 5CBAA 1PY4A 4OV5A 1F8TH 3MRGB 2CKBL 4Y2OA 1MFCL 5LGJB 2LU4A 1CFTB 1CXIA 1AD0B 4LASH 1PQZB 3KPOA 3PHSA 3IFLL 4P3DA 3B9AA 2PYED 4DWHA 2H3NB 4FQJL 3DARA 3CFKB 3MCKA 4LLVA 4S1RL 3WD5H 3D39E 4IHOB 4P9MH 3MODH 3TO4B 5E5UB 2X89A 2R0KL 3UJJH 5K9KA 2NXYB 1I9IL 2DIAA 2R1WB 4R96A 5H37H 5J3HC 2XZAL 2ADIB 1AGEA 2VDRH 5EBWA 3MV9B 4L4VB 4PGDA 2BNQD 4OAWB 3GSRA 1UFUA 3GBNL 3F65A 3BKCH 5TQ2L 1T66C 5IMKB 4BFBD 2DQHH 1HHHB 3MRKB 4IMKA 1R3LB 4TPRL 5IQ7L 4S1DC 1UKSA 4M6MH 1OTTC 3OHXB 1W72L 4R7NA 4LVHC 3SEPA 4Z7VB 2LAGB 3LPGA 1CVSC 1NKRA 4MD0B 4TUJA 4YHOL 4HWEH 5HJ3A 3WIHL 4A6YH 2X1WL 3P30L 4KRLB 3MRJA 2QR0A 4K9EH 2QQLH 3ULUF 3IETB 3RIAK 1HI6A 3NH7L 1U8NB 4JO1H 4XC3H 4QXUL 3WEXA 5HHME 4KAQL 4LSSH 4POZD 3PQYD 4HKXA 1JPFA 4XNUL 1CXEA 2OR9L 3CVHH 2RBLA 3L1OH 2DJUA 4HS8L 2JCCF 3GO1H 3RGVB 3TN0A 2XNAA 3ORJA 3W2DH 4NJAH 5BQ7B 1QNZH 1IZKA 3QNYB 4HUVB 1BMGA 4RSVA 2P49B 1CTOA 3TJHC 3S34H 1A7RL 1JK8A 2HAZA 4RMRA 4PJBF 3FOMA 3LOWA 4EI5A 4EVNA 1JI2A 4M3JA 5SX4H 2JELH 1YEHH 3NACL 1UB6B 2V17L 3BD4A 2W0FA 5E8PA 5HYJA 1A1NB 4M7KH 3SJVD 2J7LA 4AIZA 4YC2B 2Y7QB 3O41A 3EO9L 4I3GA 1UWEH 2CJUL 1I1FB 3RIFF 3AMKA 4NOBA 2Y1VA 2ZG3A 2XN9D 3U7WH 4HV8A 5DRNA 2AEWA 3ME0A 2X4RB 4JVWA 1U8OA 2D0FA 5EN2B 5BCAA 1G7MA 3LS5L 4PJ7B 2E9WA 3JV6B 3ARXA 2Y4SA 3U30C 2FECI 5DK0A 3C08L 2UWEB 5JPMB 1G1CA 2CH8A 5FCUL 4RRPA 4P3DB 3PJSA 3T08A 4JVUA 4GW5A 1DP0A 3FQUA 4K94L 1EHXA 4R8WL 4ONGH 5DK2B 4NM4L 2NY2B 3BQUC 3V4VH 1T21B 3FRPA 4NO3A 2FYYA 5E8OA 3IDXL 3FFCA 5CP3A 2Q87A 3LEVL 3ZE1E 5ESQA 2F8OA 4FMKA 4U2YA 3UZVB 1JZ5A 2RB8A 1EFQA 4GFTB 3B9VA 4WFFD 4KKNA 4J8RA 3VD9A 2H32B 2V5TA 4P5KB 1J5OH 3G5YB 1P5UA 4NNXB 2D4FA 4XAKD 1AR1C 3TA3A 2R0KH 3O2DH 4NM8L 3KPQA 3A6BH 1CFQA 4QGYA 2BNRB 1CICC 4OLVL 3FCTA 1BIIA 5DA0B 1CDBA 3DOSA 3SDDD 2OYPA 1HIML 2G9HB 4HIXL 1CDYA 4LCYA 4HAFA 4P2RD 3WFHA 4NHCH 1G7IB 3NCBB 1XMWA 2CIKA 1FAIH 1RK0A 4JFQB 5EU3B 2FL5B 4PLJC 1GZQB 1IKNA 3K8KA 1NGZB 4NQCE 1NCTA 1C5CL 4EN3C 4FTVA 5JA9A 1JUFB 3R06A 3EYVA 4PJFB 4JZNB 2C4FU 4PS4L 5EZIH 5MENB 4FN0A 4NCDA 3KPPB 5J6GB 3ARZA 5GISL 2P5EA 2FZ3A 4G42A 3QDMD 5E5MB 3TJHD 4KVNL 1RZKL 1RUQH 4OLWL 5DVLA 1I7RA 1I1YA 3I9GL 3F12B 4N8VB 5ELIA 1RUKL 3SJVB 1DQDL 1X6LA 5T1MA 2X4QB 3K81A 5INCA 4NNPH 3NPSB 5IVXF 4HPYL 1NANI 4JE4B 4YFLF 4YFEA 5HD8C 2VC2L 3H9SE 5C0BD 4TYUA 3IJHA 1KXVC 5FA4A 4LP5A 2D0GA 3B2VL 2V5YA 2YMXL 3PDOB 3RJDA 3NCYS 1NFIB 1INQB 3N1MC 3OKEB 4KTEH 1S9YB 5DUBA 3HC0B 5ETUA 5HBBA 1OWRM 5C0BA 4F3FB 5A40E 1J86A 2X1OA 4KKBD 3MROA 5DURD 4MDIA 3DVGA 3N0PB 2EE9A 3EOBB 5IVNA 1GJIA 5EUOE 1G7MB 3I75A 5I19H 1KTLA 4PLNC 5I1CL 5T1LB 4EDWH 2DWEA 1IKFL 4XMKL 1T22A 1FZOB 4PUBL 3LEYL 4Y2DD 3TIDB 1KPUA 2D03H 3WIIH 1H3VA 2X10A 4PGBB 5HYEA 1GHFH 3WUZA 43C9B 2NY6B 3TV3H 3AROA 4OGYL 4NKOB 1JMZA 4WW2C 4OI7A 1TNNA 3PABB 4GG6A 1ZEAL 2PCPA 4WFEE 2BSSB 4Z77B 4OM0H 2B4CC 2E7CA 1K4CA 2WP3O 3WNOA 3IDMB 5IESL 4FQXC 3TBVB 5I1JL 5AWNL 1MREL 5FUOH 5B38B 2X5PA 4OGXL 1T21A 4NO3B 3BEVA 4P59L 1KCLA 1YEFH 5E8OB 4Y16D 3SKMA 4PJXE 3WFDH 5EOQL 3DHJA 4YHNA 4HIJA 1DBJL 2IADB 2VLJB 4NQXB 3NFPA 4M5YL 3GMMB 4JPIA 3L3HB 4UAOB 3V4VL 3MBXH 1C08B 3C8KB 3ZDZE 1R5I