1OAXL

Fv structure of the ige spe-7 in complex with acenaphthenequinone
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
AVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPRHLFTGLIGGTNNRAPGVPARFSGSLIGNKAALTITGAQTEDEAIYFCALWYSNHLVFGGGTKLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN E
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Mus musculus
total genus 24
structure length 108
sequence length 108
chains with identical sequence M, N, O
ec nomenclature
pdb deposition date 2003-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oaxL00
2D7QA 5ITBH 1L7IL 4QKXB 3WJLC 3LV3B 1YNTA 1F00I 2VDPL 1OB1A 1KIRA 4ZFZA 3GBML 1MFBH 5KSBA 1QSED 4JJ5A 3MV8E 1DBMH 3OKMB 2BNQA 1E4XI 3MYJB 4XPFH 4HQQL 5H94A 3MREB 5T1LB 1BX2A 4JPKL 1S5IH 3JWNC 4Z7QE 2C1PA 4QRPE 1KB9K 1FL5A 2HAZA 2J1KA 4MQXD 1CFVL 3A6CH 4X6FA 4R7NB 5C0BD 1BWWA 1I1CA 1D5IH 3G5VA 2XZQH 2FYYA 3AREA 3OB0H 1XR8A 1DVFA 4GXUM 5CILH 2YKLL 5F97E 3UJTH 3KPNB 5A3ID 1H5BB 1PEWA 3HNVH 3K8LA 3MRLB 1UEMA 5KBNC 2V7NA 4L5FH 4Z78A 4Y16A 1QBLH 4NZJA 4AMKH 4JREC 1UXSB 1WWBX 4X6BB 4IOSD 1DEDA 1T21A 3AVEA 3RAJL 4LLMA 3OHXA 2V5YA 3UX9B 2DQDH 2VL5A 4OCMC 4NPYA 1CG9B 1MRDH 5D2LA 4JY5L 2YR3A 5EBWB 2FO1A 1ACYH 5EU6D 1HH6B 5EIVA 5J6GA 5E8DH 1BZ9A 1IQDA 3GIVB 1KTDB 4JKLA 1GAFH 5LGKA 2Z31B 3LKQA 1WF5A 4L3ED 4DN3H 1IC7L 2IEPA 2Z8RA 2XFXA 2FJGB 1U8QA 1UJ3C 2VSDA 3NAAL 1BIHA 5E2TL 3U48A 2CGRH 2X9XA 4KK8C 1NH6A 1KIUA 4LMQE 2LTQC 4PFEA 5KSBF 1XGYL 3FQUA 3LB6D 3VDBA 2NY4D 1MWAH 2P5WE 4LQFL 1XGPB 4TSCL 5HHVH 3O4OB 1TVHB 1T5WB 5CEXA 1C12B 5HDBF 5HI4C 3BO8A 4JQXC 1NC2D 3RP1A 3IB4A 4K2UH 4HUUA 1C1EL 3WN5C 4FA8A 4PJGB 1H3VA 1JRHH 5CD3B 4PJEF 2H2SC 3X14A 1CFQB 4KAQL 3SOBH 5HHME 2IAMD 1OP9A 2Q8AH 1M7DB 2AEQL 4YHOL 1B6DA 1IC1A 5E2JA 2XWJA 5DJYB 1NMAH 4RFOH 1T80A 5DD0L 1FFOB 4YHKH 4PB0H 3JUZA 4N0FA 3C6LC 3BQUB 3KJ6H 1GPOH 2CIKB 3VWKB 3O4LB 3HUJA 4DUWA 3N9GH 3RVWC 5DJXA 1IKFH 3GSWA 1B0GA 4XCCL 1ZGLP 4FQLL 1P69B 5GS1B 1FN4B 2IPUK 5D8JL 4I18B 1MSPA 3S8WA 1INEL 1I7TA 4OF3A 2B5IB 4KTEH 1I1YA 3QULB 3DV4A 4UTBL 4XNUL 3B9EA 3MZGB 2FX7H 1T0MA 2Q86A 3VFTB 1JNNL 3IDXH 3RGVC 4MNGA 1RAMA 4PREB 3IS0X 3VG9B 4DQOL 5C71A 2EDOA 2R2HA 4P2QA 2ZUQB 5J1AB 4PJCF 3TJHD 4M3KB 1LEKB 4OF7A 5GSVA 3KYMA 4TULH 1GRWA 5M7QA 3LMJL 2F54E 3L1OH 4LCYA 4PRNA 2OJZH 2UUDH 4PRID 1AI1L 4P46D 4ELKA 1F3JA 3HZKB 5HDQH 3OJMB 1A7NH 1P2CB 3O8XD 3RWIB 1MCEA 4ESKA 1DBAH 4G5ZL 2VTFA 3FB6B 4JFFD 4PG9A 1BQSA 3KPPB 1N3NA 3L3IB 1IL1B 1RUML 1NDGA 1ITBB 1JPTH 2C3XA 3GSRA 1FNSH 3DSNA 3ILPB 2FJFA 1QSEA 4NYLA 1IAOB 3UTTB 2DM3A 3HA0A 2YSSB 3RHWK 4G8EB 5DHYA 4UT6H 5C9JA 3HNTH 1N0XH 3C5SB 4WTZG 5HGDB 1OTUC 2N56A 4EI5D 3DXAE 3BVNA 1H8SA 4YH6A 1I8IA 1JBJA 3ZZ1A 2E27H 1A1OA 1HINH 4EXKA 5C0BA 4LDOB 4I48A 3ZKMC 2Q76B 4MNQE 3RUGB 1YMMB 1A7OH 5ACLA 2D31B 4JRXB 3LN4B 5DK0A 3TBWA 5FB8B 4XVTH 2X4SB 4PTTB 3OGOE 4BSJA 4PLJD 3JV5A 4PJ8B 4R0LB 5INCA 4MA7L 4NQCE 1WZ1H 4L4VB 5DVLA 1EXUA 1GVIA 1RUPH 4ONFL 1RU9L 3REWA 2FBJL 2YPKB 2RQ8A 1OSZB 5BQ7B 4G3YH 4HK0A 3MRRB 3NIDF 1NC4D 5JOFA 5KW9L 2QADD 4HXAL 4HZLB 1LHZA 2VDLH 1MJJA 4YXHH 1E4WL 1RIVL 3BPLB 2IFFH 1R5WB 1UB6A 3EYFB 4YNYA 4ZTOH 5EU6A 1K2DA 4TSAL 3VD7A 4ZOBA 4FQJH 4FABH 4MLIA 1E6JL 2W0KA 3TNNA 4C83B 5F1OB 1U0QA 1A1NB 4OLUH 1C8PA 2KH2B 4M61B 5ANMA 4L3EA 4LDLB 4LEXL 3QEUB 2I60H 2EDTA 3C60D 3IFLL 5SWZB 4QWWD 4HDIA 3B9DA 4ZAKB 1IARB 5DHVA 2R9HD 3DNKA 1OARL 4DVRH 3V9FA 4M4RA 5MI0C 4H0IA 3FONA 2HTLC 3S5LB 5KSUA 1EA9C 4P5KA 1N5AA 3CU7A 1NC2A 1VFBB 5HVWA 3GSOA 1KG0A 5I71C 5H35B 3JV4B 3BAEH 2AJZA 2EDBA 1CS6A 2ZCLH 1WBZA 4KY1L 1LK3H 1DE4B 1JUFA 1OGAB 3L95B 2IAMA 1RZGB 3BT2H 5C0JB 5IJKA 1MIML 4U2YA 2X4QB 2YBRB 1I8MB 3MXWH 1FNLA 4JO2L 4RSVA 1I9RL 4Y2DC 1J7VR 2YRPA 4F15C 1YY8B 2D7NA 1BQLH 5I74C 4X9IA 3I3DA 5EOCH 3IU4L 3I50H 2YWZA 5GS0C 2EDKA 1UENA 5EORL 4K7PH 1R5IA 5ALBH 1OVZA 3I6KB 1P7KA 5JW4M 1NUDA 3CVHL 4ZUTB 3IFOB 4LLYA 1X5ZA 4HUNB 2MNUA 4EDWL 1FG2B 3QDGE 4QRRE 4Z7VB 5KVFH 3JWDC 4ZPVB 2AI0H 1CT8B 1QR4A 4OCYH 3WLWC 4PP2A 2C3VA 4QY8B 3E1F1 4S1RL 5JZ7D 4Q9CA 4E41B 4KMTL 1CFSB 4U1SA 3V0AC 3L6FB 4TTGA 1M05A 4WI7A 1VCAA 5T5FL 3FMGH 3T3MF 3BYYA 1YPZE 3RVTC 4KTYA 4Z0BH 2IPUG 3HZYA 1A4KB 3MRGA 5ACZB 5I66A 4P48A 3OJVC 4R4FH 1EERB 4AL8H 1KGCE 5K33A 1Q9LB 3RTQB 4UZGA 4NZRL 1P4IL 1U8NB 4PRIA 4YPGB 5DRXA 4HJJL 3FAWA 3LN9A 3WLBA 4P46A 4GAYB 4EUPA 3O8XA 3OJ2C 1T2QL 5GRUH 5EO1A 1NEZB 3CFEB 4WWID 4JFFA 2R29L 4B5EA 4MD5B 4H8WH 3MLXH 4PRHB 3U6RB 2R4RL 1KB5L 5H37G 2CRMA 5JLZB 1G0XA 3WUWB 3KYAA 3VI3F 3RY4A 5IKCB 2VSCA 4PRPB 4MJ6A 1GZQB 3VFRB 5JMRA 3VCLA 5KVMC 3ZKQD 1INDL 5DJDB 4YK4C 4EI5A 1BOGA 3HAEG 4YGVB 2HN7A 4NBZB 1I8KB 3BEVA 4X8XA 3QXDB 2GSGB 2IBZY 4WW1A 1JNLH 5DJAB 2XZZA 2HVJB 3QUYD 2DWEB 4X9GA 2Y5TA 5C6TH 3VXSE 3UTQB 1VERA 4K7FA 5MEND 4NKMA 1ORSA 4CU8A 5F44A 1J88A 2C1OA 2X4RB 1VEOA 5E5RB 1QVOB 1T66C 4E5XB 5T3ZH 3WFHB 2X1PA 2BHYA 5J9PB 4WEMB 1P7HL 1BGXL 3IAQA 3WE6A 4GKZB 1AGDA 5CIPH 1CXIA 1GGBL 2VOTA 2YKLH 4KI5D 3W5NA 3LAFA 1NC4A 2A6IB 2WM0A 4HG4K 1RZFL 5EO0B 3DRTA 4F7MB 3X3FL 3PGDA 4NN6C 4HCRL 4YO0A 3B9VA 2A74A 3X13A 1JGDA 3D39E 2AABH 3NTCL 1BD2D 1K4DA 3PUCA 2FECL 4YIQA 3BJ91 2Y1VA 5MEOA 1J0YA 3TBYA 3RAJH 5SWSD 2A1WL 1N8ZA 4CU7A 4NN7C 4XBPA 2H8PA 2ORBH 1H3UA 2W07A 2AK4B 4U7KA 1F4XH 4JY5H 4WDIB 3ABZA 1SQ2N 3C60A 4JFXA 2JJSC 4B7LA 3QDJD 5EZLB 4FQXD 3ARGC 3QQ3B 3PNWB 5HYSG 5HSFA 1UM6H 4DN4L 2FR4A 2DBLL 1HHHB 1ODAA 3LRHA 4X6CF 5TDOA 5K9QI 5LXGH 1TQCB 1XF5B 3BHBA 5KTEH 3DX7B 5ESVA 2G9HB 1XF4B 3TNMA 1MOEA 1LO4H 1IAII 1DQQA 1HSAB 4GUPA 3L3JB 3O0RH 5E2TH 1N26A 2ZJSL 2FSEA 3EYVB 1XGYH 3QG6B 2Z93B 2IMNA 4JVPA 5I1LA 5T1KD 4PJAA 2R56H 3GUTB 4TSCH 3MLRH 1CGVA 3AS0A 4KDTA 3QUMH 5D7IF 3G08B 3BGFC 2ICWB 1X7QB 3SKOB 2D7TH 3V5DB 3U82B 1C1EH 5TE6L 4ZUVB 1F45A 1TLKA 5E9DE 2VLKD 4YDIH 2OR9L 4K7PY 3LN5B 3RKPA 5I1DB 4O2CA 4Y4HD 4RGOH 4OZIA 4YHOH 3FTGA 3L3KA 4P2OC 2BSRB 4OCXL 3K81A 4S2SB 4DKEL 3J8F7 4KRPC 3VMNA 4HWNA 4L8BB 3TFKC 5BMFL 3MOBH 3C6SA 2DQGL 5DD0H 3NIFF 2G5RA 4N8VB 3PJSB 4DJMA 1R3KB 1U2HA 2F5AL 4YDVB 2DQHH 2FIRT 3OR6A 2NTFA 5FDWA 1RIUL 3TWCH 5D9SB 2HWZL 3AB0C 1D3CA 4XPAH 1TNMA 5BRZD 5CGTA 1F97A 1WZLA 1FYTB 4O5LL 4K07A 1INEH 1LO3H 5F88A 5E70A 1V8HA 4LSQH 1DFBL 4UTBH 4XNUH 4KJYB 1II4E 4YPJA 4N5UA 3G5YA 1KCUL 3L5JA 1IAIL 4TNVK 4WNQB 2ZG3A 3BRDA 1U93A 4KJQC 5D7LE 3X3GL 1TVBB 2ZNWA 1NBYB 4V2CB 2UVEA 1UGNA 2JJVA 3RU8L 3WD5H 1K8DB 2CRYA 3IS1X 1H3TA 1MWAA 3V4PH 3FQNB 3KDMB 3KR3H 2NY2B 3FKUS 1XF1A 5AEAA 1VENA 3LS5H 3ZDYE 1T0NB 2VRAA 2APTA 3CUPB 3ZKSD 1CR9L 2QR0A 4G5ZH 3VGDA 3TO4C 3UTSB 3E3QE 1T3FB 3KPSB 1MJ7H 1A6UH 5HYIA 1JRHI 3IDJB 4Z0XB 1KYOJ 3PXJA 5EU7E 4OZIF 5FM5O 1DUYB 1KN2H 3B5HA 3HMXL 4NQEE 1YEJL 3DVGA 4BM7A 5F7DA 3PL6B 4JZJC 4YR6A 4Z7UB 3QUYA 1L0XA 2Z91A 5MENA 1JTTA 3OMZA 5JHLL 2OSLB 3C9NA 2CLVA 4D0CB 4YC2B 5LJYH 3MRFB 3AROA 3U30B 3VWJD 1GC1L 4HKBB 4Y89A 5I17B 5IB1B 1HHGA 2OR7A 4LAQL 4NWUL 5F7FA 3P0GB 4Z95L 3X11B 5TE7H 2Q7YB 4E42A 4MA7H 5IFAH 3QCUH 2P7TB 1QSZA 4RIRB 1M7IA 5E8OB 2FBJH 2D03H 2MCPH 5IBTH 3MNZA 4L8CA 1BD2A 3S4SB 5K9KB 4QHNB 4LGRB 3W81A 4ZFOL 1FDLL 5F7KC 4LLUB 5SWSA 5KW9H 2UZIH 4I5BA 1H5BC 1X5FA 2D3VA 3H6JA 5D70L 1E4WH 4UAOB 4JM2F 3BXNB 3N50A 5I76B 1G7IB 5J6HA 2A83B 3B9KD 3QDJA 1IC4L 4FQXA 2A77L 3HTLX 4BZ2H 1WFTA 1E6JH 2Y5EA 4JFPB 4F37F 3ROOB 2VISA 3L5WA 2JE8A 4RFNB 4LEXH 4LQ1A 3SGEH 3IVKA 5D5ME 2BC4A 2BK8A 3RDTB 1SJEB 1SYVB 3WS3A 1BF8A 3SDDD 5IB4B 3K4AA 4YHYC 1KJ3L 1JHTB 3PWPB 1MAJA 3BH8A 4XCNB 5IWLC 4QRPD 5T1KA 4JO4H 1JMXA 1ZHNA 5IK3B 1AHWA 4I2XA 2ADGB 43CAB 3S36L 1G9ML 1QFWM 5CP3H 2I27N 3FT3B 5FA3A 4GG6B 2R0WL 2G75B 5HI5D 3CCHA 2QEJA 4L4JA 2E9WA 4ELMF 3ES6B 2BVUA 3QJFA 4XAKE 4DGYL 3ZE2F 2VLKA 4NQDE 4TTDC 3O4OC 4UTAH 2H32B 5LG1A 2XKNA 4KK5C 1A21A 2RGSA 4LVNB 3OKYA 3PWUA 4Y4HA 2KPNA 4Q6IB 1BLNA 4JO2H 5CZKA 4HBCL 2XWTB 2YD9A 5DR5H 2F53E 1FIEA 4M6AA 2NY6B 2PW2A 2JB6B 1QFHA 4LOUC 1YYML 3IU4H 4M1DL 4AYFA 4YHIB 5T3ZD 1UACH 3Q2CA 3SDXE 3SGKA 1AFVH 3C5ZD 3CDFA 3CX2A 4M8QA 4Z7OF 3MLTB 3QDME 5IMKA 1WT5C 1XAUA 3EGSB 3LKPA 4ODVL 3SEPA 5HDLA 3E8UL 4ZQKA 1U8MA 3DETC 4N1EA 4U1GB 3BUTA 5D1QD 2MKLC 1CDYA 2OTWB 2YD1A 3BOVA 5BRZA 3VU2A 2PYFA 1G0DA 3MLVL 4WEBH 5I1EL 2N7BA 3BQUC 3UTZA 4ZUWA 1CE1L 1PX3A 4ODHH 1JWUB 2A9ML 3VWKC 4S1RH 4N0UB 2QQLL 3DURA 5L2KB 1AIFB 4LLQA 2WW8A 3FB7B 3U46A 1W0YT 5T5FH 4DGIL 2P5WD 2VLRB 3QO1B 4Z76B 4PV8B 5GS1C 4J3WA 3UO1L 4I18C 3WKNA 4UQ2B 5IESL 2IH1A 4AEHH 4JFEB 1AQDA 1F3DH 3WNOA 5DA4A 1XH3B 1DTUA 3NCCB 3GJFB 2VUOA 1CD9B 3VG9C 4NZRH 2LVCA 1P4IH 2YPLB 5HJ3B 2YD2A 4HJJH 2UY6A 3NZHH 1MF2L 2LQRA 3BP7B 3SPVA 4UOW1 3WO4B 1FFQA 3PP3K 4ZYKA 3F5WB 4OLVH 4ZNEE 3B43A 1JHKL 3P77A 5F9OL 2R4RH 1KB5H 1PD6A 3P11L 5C3TA 1K6QL 3T2NL 4OFIA 4PJXA 1MAKA 1MHHA 4UILH 4OQ1A 1CD0A 3V7AG 2V2XB 4UU9B 4IRJB 4TUJB 2PW1A 2WZPD 5F9JB 3ROLA 1Q9KB 4A2LA 5I8OH 4N9GA 3WIFB 1PG7X 1IM9B 1U8LA 3ZHKA 1FL3A 3GSVA 1DSFL 5CHNA 3VWJA 4RWHA 5I1CL 3T0EB 1LO0L 1QRKA 1TFHA 1RZJL 2NY1C 2VABB 5D1ZC 3ULUF 1GGIH 3L9RB 4BSWA 4HIJA 2VJXA 1VEPA 3PV6B 1PLGL 3RNQB 3IDMB 3B2VL 3WS6C 3ZKND 1JYNA 1BGXH 2X4PB 1GGBH 1V3JA 4WO4B 3QEQE 2WV3A 1RZFH 3X3FH 3JWOH 5I8CA 2R1YB 4HV8A 1LP9F 1ES0A 5E56A 3TC9A 3CDGB 4FTVB 3HG1E 5JIHA 2VAAA 3DBXB 3FL7A 3MA7A 3B9KA 1RZ8A 4OSUL 3J7HA 1R3IL 4KKNA 4NKQB 3SDAD 3RBGA 4CMMA 4PJ9D 1UZ6F 2ZZUT 4HIEB 2RR3A 5D6CB 4HJ0D 2DI8A 1XR9B 4HEME 1CDHA 3S97C 1VPOL 4KUZH 2BZDA 2GT9A 4RRPG 3SDCD 3BPLC 12E8L 3SDDA 3QBTB 2CO6B 1KELL 2X4OA 4EVNB 2QBWA 4IHOB 1KLUA 2DBLH 2XQBH 1EUUA 4PJXF 4TPRL 4M7LL 3NFPB 4WWKB 3Q6FA 4QRPA 4ZXBC 1ZSDA 4M7KH 2DM4A 5J0BA 1HEZB 1CDUA 3MC0A 2SEBB 4MNQD 5JOPE 1JZ4A 1MLCA 4CVWA 1EAPA 5MERA 2R1XB 5EIIA 4JY4B 4HC1L 3VFMA 3W39B 5DLML 3MRQA 3QIBB 5FGCE 4G7VL 3E6FA 4NQCD 3W0WE 3BESR 4LHUD 4U0QB 1CXHA 3HPLA 1XFPA 4PJFB 4UBDD 4MX7B 5EOTA 5JTWA 3M45A 1YN6A 4L4TB 4YHML 3M1BA 5TE6H 5ID0B 4Z5RB 4X0KB 2GCYB 2IQAB 1J0IA 2AXHA 4ZNCD 2DKSA 5EZOH 4DGVL 4BSVA 2OK0H 4BYHA 5D4QA 2A6DB 3C5ZA 4ORZC 5CZXC 5F7EH 3TA3D 2PXYB 1MRCL 5CIPA 5T3XH 5D7SH 3FJTA 2WUCL 1XGQA 4NQSA 5BMFH 5D1QA 3QO0B 1SBBA 4XI5D 3PHOA 3PWNA 3QWOB 5IEHB 5IVXF 1SY6H 3L7FB 1RMFL 1NFIA 2F5AH 1KT2A 4PJ7E 3N1QC 4QF1A 3IJYB 4GO6B 3G9VA 3PWVB 4OIBA 3F7VA 1RFDL 5HHNA 4GW5A 3B2UD 4HAGA 4WFEE 5DUBA 4QCIB 2P5WA 5CGMA 3BP4A 1JTPA 4HWZA 2R15A 3ARDC 2PCPA 1AP2A 1INQA 4PLKC 3QQNA 3BWAB 4KHXH 4R7DB 3OXRA 4PBWD 4JHZA 3U4AA 1OW0A 1D5ZA 1HQRA 3UJJL 2EE9A 3GMNA 1KCLA 4FQPA 3ULSB 8FABA 3QNXB 3RU8H 3LPGA 4OZFB 5E4IA 2WMPA 4ODBD 3MRKA 1RUQL 3MLZL 5DDHA 5FYJH 5IM7B 3QUMA 1IGCL 4BFEA 1E27A 1NGWA 3TN0B 4XNXH 5CMAA 5DMGD 1GZPA 4J4PD 2NZIA 4X7TB 4PRBB 1NCBH 1JVKA 4QHMA 4ZO9A 5I0DA 4X7DC 3PP3H 3RWJB 4JANB 3QDGD 2DMCA 2W65A 4QRRD 3KPOB 5KVDL 4FZEL 3Q3GA 3V79C 1S7VB 3BEWB 4J3SA 1WC7B 2ZWLT 1TJHH 4YFDB 5IJVB 1UYWL 3LQAL 3FB5A 2N4IA 4JQIH 2WINB 3FFCE 1YJDC 3IDNA 4JRYE 3SQBA 1G84A 5TDPB 5JHLH 3GNMH 3BGMA 3O3DA 3RFZC 1NCTA 4JFOB 3LDBB 4OCSH 3MV01 4JQVC 4JZNB 5DJZA 2XICA 4YDLC 1GC1H 4ZDHB 1KTRL 4P4KC 1KGCD 3VXUE 4HIHA 4N1CA 1FAIL 1OTSC 3KPRE 2LAGB 1PQZB 3U36B 5JHDD 2VN4A 3H9HB 5GHWL 1LMKA 1Z5LA 4Y19B 1ZLVK 1BP3B 1FDLH 3IDUA 2RAMA 3GI9H 4ZOCA 3SDAA 4GRLD 5KSAA 4PJ9A 2IQ9L 3SBWA 1IGJA 5CEYB 2AS5M 2A6KA 3T77A 1OTTC 2APXA 5D70H 1GIGL 5GS0L 5IQ9A 3EOYG 3I9GL 3SDCA 3RWDB 1IC4H 1JWMB 4NT6B 1RK1A 2AV1A 1OLZA 5L7XL 3EAKA 3UXFA 1QA9B 1BWMA 3S5LG 3Q1SL 3TBTB 3H3PL 4LVHB 3EDDA 3JWDL 1RZKH 4MNQA 4F3FB 2ED9A 5GRVK 4FS0A 3V4UL 2HFEA 4MMXC 1HYSC 4RGNB 4Z7WF 2J6EL 4V1DE 4GW1A 4ZG1A 3IDGA 1HHIA 2CKBB 4NQCA 3S36H 1LK2A 4LHUA 5I15L 1QLFA 1U91B 5EN2A 5JR1L 3VE0A 2R0WH 4NJAL 5E6IC 1X6NA 3HMWH 1ZHBB 3ARFD 4RAUA 4ZUUA 1JI1A 3QI9D 3RPIA 2Z92B 4DGYH 1NMBL 1RVFL 3G6JB 3NGBB 3DO7A 3HI5L 2I07B 3D39D 4MJIB 4HBCH 3TA3A 3UROR 4JM4L 3CXDH 3HPJA 4S0TD 2A38A 3O9WB 4LSSL 4JN2A 1I4FA 5HPMB 4PY7B 5IIEA 4RFEB 5HHQB 2GUOA 4M1DH 5I6XC 5GZOC 5EWIH 4AT6B 1FE8L 3O2DL 2EDNA 2JIXB 4YBHA 4ODVH 4FQQA 1N5YL 3TBSA 2BVQB 5IROC 1D7FA 1JNHB 3A6BH 3U2SA 2FJHA 3MV7B 3EOBB 3NA9H 4HUWA 4K23H 3PHQB 4JHBA 1FVDB 5GGTL 3WXWL 3NOIA 1FRGL 2VKWA 2A9MH 5J3HC 3D69A 4RMRA 4HGWB 4IDJH 4P2RD 1UWGL 1NSNL 4CVUA 4DGIH 1TENA 3D3VB 3RRQA 4ETYA 3LIZL 2GITB 3UO1H 3VH8B 1A6ZA 5E2VH 2WBJD 3OGCA 3ZE0E 3H2WA 1A7PL 2K7PA 1QSFE 3DGGB 5FHAL 3DVFA 1NEZG 3LVEA 1NBQA 4I1NB 5E1AA 3QDAA 5C08E 4GKSB 5JW4R 3LEYL 4K8RL 2M2DA 2UWEA 5CD5D 2F8XC 2OLDA 2PTTA 4G8GE 3RIAF 4OLYL 2FEDC 3WUWG 2GFBA 5E9DD 3GMRA 2AKRA 4PJBE 5CP3A 2VLLB 3JTSA 5KS9E 5I1AA 5TDNA 5E8NA 1A9BB 3HB3C 1M71B 4HF5L 1FVEB 3TIDA 4J4PA 1OCWL 3DV6B 3HE6C 3KHQA 1HXMB 1U8HA 2E7LA 4I0PC 4KC3B 2NY2C 2V2WA 5MEPB 1KB9J 4EKXA 3QDGA 5I30H 1K6QH 4NP4H 1T03L 3DVNA 4JCMA 4AENA 4U1JB 3QR2A 3OKNA 2VZSA 4JJ5B 4YEFA 3MCG1 4M48H 3FHAA 5H94B 4JKWA 3GO1H 1DQLH 2ED7A 3E6HB 2W60B 4GS7C 1TPXB 3WJJC 3I84A 5D93B 1YPZA 3OB8A 4FFVC 4X6DE 3MXVL 3UCRA 2CIIA 4Z77A 1DSFH 1EHNA 4MLSA 4PGEA 1DCLA 5JW5A 1LO0H 2QHRL 4ACPA 3M07A 1XR8B 1DVFB 4QYOB 1J05B 3VFNA 2ZPKH 3BUYA 4D0DA 2NXYD 2AV7A 2E8ZA 2A9NH 3ILQD 5JHDA 5IOPA 1CFBA 4N0YH 4HIIA 4U31A 4Z78B 4YC2C 5J11B 4Y16B 3O3EA 3U30C 1CICB 2OZ4L 5DWUL 2HT2D 2GHWB 3CNKA 2FX9L 3LOWA 4WI3A 3RIFF 1T21B 4GRLA 2VLJD 1BQHG 4LLMB 3OHXB 2BSTB 3RKDC 1F02I 2H2PD 2CSPA 1KJVB 4FOMA 2VL5B 4L1HA 5D2LB 4OKVB 3QXWA 3V6FA 4AIZA 1R3IH 5FGRA 5J6GB 4ZS6D 1GOFA 4JG0H 4WW2F 1BZ9B 2COQA 3QNYB 3HR6A 1I1AC 3DVIA 3BFOA 5ITFB 1S3KH 2XZCH 3LKQB 4P3CL 4FG6C 3KPMB 3C08H 3D2UB 2BP3A 4XNMA 12E8H 1K8IB 4WFHE 4WIQA 1DR9A 2PF6A 4HPOL 5F7LB 5FYJD 4HXBL 2VXVL 3TZVB 2NXZB 4AEIL 1A9EB 1KB5A 1NANH 5HYJE 4Y5YA 1CI5A 5I8EA 4U1IA 1A0QL 3FQUB 1RULL 1PKOA 4MA3B 1H0DA 5GRJL 3NBNA 2ED8A 3W11C 2HG5A 2X9YA 3UJIH 3RDTC 5CEXB 4W4NA 1AC6A 4U1MB 3RX7A 2VDNH 3ARFA 1Q38A 3DHMA 5DLMH 3QI9A 4WGVB 3JZ7A 1S8DA 4XCEA 4O4YH 4MWFA 5ETUB 2IPTH 3X14B 4FRWA 1UH4A 4MVBD 3D39A 3VFSA 1T7YA 2EYRA 1KXQE 3IU3A 4RQQA 2F58L 1UH2A 1P53A 4JAMA 4DGVH 2VQTA 4JVWA 4JKPH 5MEQA 1MQ8A 1FNGB 4N0FB 1MRCH 2YOCA 2XZAL 3NZ8B 3HUJB 3FQTA 3QWRD 5DJXB 1LE9A 1I9EA 2ZUTA 4GW4A 2OMNA 1T6VN 1HILA 2KBGA 1B0GB 5KOVC 1ZT7A 1RMFH 2YD3A 2Z8WC 3L3HA 3MBXL 3VFOB 3FRPG 4PP1C 2ENYA 2GJ6A 5C0EA 5IGXL 3DV4B 2DB8A 2KQMA 4P2RA 5C0FB 5LGHL 3D0LA 2Q86B 2DM2A 1RFDH 4U1GC 4ZTPL 4OF0A 1IEAA 1EEYA 2FWOB 5DI8B 2WWKT 2EKSB 2WBJA 2R2HB 2M26A 1YUHA 1FYHB 3NH7L 1RPQA 2AJUL 5GSVB 3PQYE 2HMID 3B9AA 1YC7A 2DQIH 3VFVA 4LCYB 5BJTA 1Q0YL 3UJJH 4PRNB 4XAKD 5E9DA 4NQDD 2YA0A 5B38A 2DQTH 1R3HA 4ELKB 1F3JB 2DIAA 5DD3L 3T08A 1OQOA 3QAZB 3S88H 1BJ1H 4OFPA 3HE7B 5JXAH 1C08A 1BVZA 5JXED 5GZND 1YEFH 4G8IA 1NDGB 1AGBB 2JLLA 1FZJB 3GSRB 4PTUA 4POZD 3MACH 1I3RB 2J4WH 2EECA 3MRPA 4LRIA 1JGEB 4PIRF 4AM0A 4LDEB 5DHYB 2HLAA 2EC9U 3S98A 3BGAA 3H0TA 5C9JB 1CL7I 4ZUSA 5AWNL 1U8IA 1LEIA 3BVNB 5KN5A 5GIRA 3VMOA 4OD3L 4FZEH 1I8IB 3CH8A 1YEDA 1A1OB 4PJHA 3Q5OA 3MNWA 5C0BB 5JPMA 5FKAA 3AMKA 4I48B 4JM2C 4IRJC 4MQ7A 1JYXA 5MHSE 1VGKA 5DK0B 3TBWB 1SY6A 1L0QA 5FDYA 1VGEL 1MFCL 2CRIA 3S4SG 1EXUB 3KYNA 1CLZH 3REWB 2BNRD 3WNMA 1EJ6A 2IGFL 4XNQA 4OFVA 2DTMH 5DMKA 1FAIH 1JN6A 1P1ZA 5EZIL 4C58B 2VLJA 1SJHA 4M9OA 1RJZB 3OSKA 4KHTL 1MJJB 1KXTB 2YUVA 1U2CA 1JZ6A 3UDWA 1UB6B 5DMIL 4YNYB 5KAQG 5BV7B 3AXLA 1CTOA 2VXQL 4YHLL 1J5OH 1K2DB 1AO7D 1KUMA 5BVJA 4OLXH 1QR1A 5EZJA 5INDA 4QXTA 4XPGH 1XF2B 3TNNB 1IZKA 1LVEA 1GIGH 5GS0H 2QSTA 4WV1C 4MGXA 5ANMB 4O58H 4L3EB 4JFQA 2Y06L 1G6RL 4CVZA 5JQ6H 3MLSL 3DMMC 2FIKA 1GGUA 3NCJL 4XMLH 4HFWA 1EVUA 4GXVL 2VZTA 3LEXA 3OAYH 5GGUB 2NY4B 5GGSB 1I3GL 2RB8A 1ZWIA 5KSUB 3JWDH 1HH9A 2XTJC 3WMSA 1C5BL 4P5KB 1N5AB 2Q87A 4F57H 1NC2B 3V4VH 1R0AH 4XRCA 1KG0B 4Q9RH 4OGYL 4PJGE 1ZLWH 4QXGL 3O11A 2B0SL 4MMZC 1HXYA 4GKNB 4KGJA 2VXTH 1WBZB 2IALA 3SCMA 1O0VA 1JUFB 2IAMB 3PGFL 3SE3C 2IG2L 4R97C 5L88L 3QEQD 2BVPA 1DQDH 3CH1B 4YHNA 5FO9A 2WWKO 1NMBH 3IRPX 4ZMAT 4IJ3C 3QG7L 3CZFB 1NFDA 3EO1A 3OAUL 2ATPA 3MJ8A 4H25A 3HI5H 3EKCA 3T8XA 3O4LE 1TMCB 4LPCA 3HG1D 4Y1AB 1R5IB 1P5UA 4JM4H 4Y5XA 4EZMA 4KK8D 4LSSH 1P7KB 3ZDYF 3QWRA 3S96A 3VW3L 4LLYB 1W0WA 4UT7L 4F8TA 1PJ9A 3RJDA 3VD9A 5D71L 3CMGA 1IE5A 5DTFA 1FE8H 2VZVA 2ADIA 2KZ1B 5ICYB 3H9SE 4XCFL 4CNIB 5F3HB 5JPNB 1N5YH 3WCYA 4PP2B 1QRNB 2C3VB 3U4BL 1MFEH 5K93A 5SV4A 4U1SB 1YEIL 1HQ4B 1M05B 1GHFH 2H2SD 3ESVF 2X89D 3WXWH 3JSSA 5ECJE 1FRGH 3MRGB 2X1QA 5A1AA 2BVOA 5I66B 4FQ2L 3WSQL 2ZP0T 4ODXB 3VDAA 4HKJA 4XHJC 1Q1JL 1OF2A 4XXCC 1AD0B 3QPQC 3BIKB 1DBKH 1BMGA 1ETZA 4P23D 4KZDL 3C6LD 3AUVA 1NGXB 4NQDA 3W0WD 5GGQL 1A7PH 1LNUB 4BZ1L 4PRIB 5DRXB 5GGRY 4P46B 5JIPA 1HIML 4PGCB 3O8XB 3LEYH 4O02L 5EO1B 1T2JA 5DC4B 2EXWC 4HK3N 5I1GH 5JXEA 4J23A 1MHPH 3HRPA 1MCWM 3UTTE 1JGUL 3ULUC 2C7UA 3DX6B 4HF5H 1J1OL 1MQKL 5F89A 1AQKL 1OCWH 3RGVD 2Q7NA 4MJ6B 4POUB 5CBAA 4ONGL 3VCLB 4IIQA 1OAYL 2LU4A 4Q97A 1KC5L 4XPTL 4EI5B 1CZ8H 5ICZA 5K59E 4ETQA 3KAAA 1AJ7L 3TN0C 1XGTA 4S1DD 3BEVB 1IC5L 3RUGE 3TIEB 1YMME 3GBNL 3KLAA 4H1LH 3S9DB 3CFJA 4HH9A 4WU7A 4R90L 3QRGH 5DRWA 4O2EA 3FQWA 4LRNH 3MSPA 2VXUL 4HG4J 5D5MF 2Y5TB 4WFED 4LHQB 4K7FB 4NKMB 1ORSB 3V8OA 4L4VE 2EDYA 3K0WA 4YBLC 4MSWA 2C1OB 1FC2D 4N90E 3WNKA 6FABH 5C6WH 3NABH 5DVOA 3GI8L 4MDIB 3WJLA 2BNRA 2X4TA 2CLRA 5AZ2L 1SMOA 3WE6B 3MRJA 2HT3C 4M1CC 4PGDB 2CLZA 3BN3B 5C09B 3MA9H 2V9RA 3PGDB 2QADB 2UZXB 1BIIB 3LDBC 1YN7A 3W9DB 4YO0B 2A74B 1JGDB 5FKPA 2OZ4H 1OTUD 5DWUH 1VADB 2V9QA 3Q5TA 2JB5L 5JNYB 4LPTA 1W8OA 2FX9H 5MEOB 1AO7A 4G6ML 4ZNEA 3D6GA 3N1MC 2IBZX 4WHYG 4XBPB 3GB7A 5I1KH 3ZKMD 1BJMA 5SWZE 4WTXA 4AEEA 4EQ2A 2AXGA 3C60B 4JFXB 2I24N 1VFAA 3QP3A 3SDXF 2E5EA 3ORJA 3P4MA 3TPKA 3O6LL 5TDOB 3U7YH 4F2MB 3CSPA 4J6RL 3BHBB 5ESVB 4P3CH 3TNMB 3CSGA 2R23A 4MB3A 1DQQB 3QHZL 4G7YH 5FYKH 4NN5B 7FABH 2EDJA 4FFZL 3VFGL 1A0QH 4JRYD 2BFVH 2Z35A 4QGYA 1RULH 4RGMB 5HHPA 5I1LB 4PJAB 1T20A 5GRJH 3U7WL 3GMLB 5IT2H 1OGAE 3AFLA 4OM1H 1C16A 4N0CD 4PJCE 3MOAL 4AIXA 1KN4H 5KVGL 3QIWB 3EYUH 3FFDB 3MUHL 3FQRB 3VXUD 4U05A 3QEQA 4K71B 5F6HI 5F72S 3G9AB 3HCVA 4WVRA 3UBXA 2G5BA 3H42L 2W9EL 5ALCL 1KJMA 5BVPL 1A7QL 1UJ3A 1R3JA 3HG1A 4O2CB 4UIMA 4J3XA 4I9WE 2HRPL 4CDHA 2APWA 5H2BA 3FTGB 3L3KB 3HRZA 5D7JC 2I26N 4F7TA 1FJ1A 3C6SB 4QRQB 4Z7VE 2HTLD 4Z8FL 1IGML 1F3DJ 1T5XA 3STZA 3DRQA 4PUBL 4JQXA 4U6XA 4AEFA 5FDWB 1G6VK 4LCUA 4E41E 5FECA 2GYSA 3O9WC 2CD0A 3ARQA 5C0NC 3EYSL 2P24B 4IOIB 5DD1L 1H3WM 1ZLSL 4P5TB 1ZXQA 1FSKB 2X89A 3MBXH 1TZHA 3LPWA 5BZWB 5ESQA 3GJEA 1XCQA 2YK1L 4Y2DD 4HUVA 4M00A 4ZO7A 3KXFD 2VDKL 4TNWF 4WI2A 4K7PX 3G5YB 3RX5A 5DMYA 2GW5A 1Y0LA 4HKXA 5GS0D 3K3QA 2VQ1A 2BNUA 1S9YA 1YJDL 4P23A 3C6LA 3U79A 2VC2L 3N85L 5DQ9B 2AEPH 3W0WA 5T1DL 4M9PA 4QHLA 4OZFG 3CD4A 4ODSH 2BY2A 1NANI 4NZTL 2YMXH 3MBEC 4LCCA 4NRZB 4X80H 2VDOL 2X44D 3NIDE 1MWAB 5E99H 4XVUC 2OCFD 1I7RA 4CRPA 2XY1A 3WLWD 4AY0A 2PTVA 4PRPE 5DD3H 5IW6B 5C0AD 1A4JA 3N1PC 3WO3B 4NM4L 3RGVA 1HYRC 4RZCA 1HSBA 2HJKA 4WI4A 3GZKA 3MRMA 2E9BA 3HI6L 4HMDA 4OBSA 4OV6F 5GISL 4PJ7A 3DVGB 2VITA 3KLHC 2P45B 2X4UB 1K4CA 3TJEL 3WUZA 2FLRT 2O5XL 2E9JA 3CLFL 1FZMB 5AWNH 4YR6B 1I85A 3QUYB 1ED3A 3VD3A 4OD3H 2Z91B 3O6ML 5MENB 1H15A 4E9LA 3FO2A 3C8KA 3MJ9L 5A2IH 3ZTNL 3C9NB 2F15A 2OP4H 3WFZA 4OV5A 3SJVB 35C8L 5M95B 4I8DA 2LU7A 4LFHD 1BM3L 4NM8H 1NPUA 4KPHL 1DANU 4E42B 5DSCB 1MHCB 4A6YH 4UINL 3RVVC 1RK0B 3F58H 1M7IB 5C08D 5B39A 1T7WA 2IGFH 2JF1A 2VDQH 2AJVL 2WLYA 1BD2B 1UQSB 3MNZB 4G8FB 4X99A 3UYPA 5J8OA 5L2JA 4EDXB 5EZIH 1DVFC 1FLRL 4NUJA 4I5BB 3DUSA 4I77L 1A6VH 3DHJA 3GSXA 1CFTB 1NBZA 5J11C 5J6HB 1F2QA 3QDJB 5DJ8A 1CICC 2VXQH 1KBGH 4FQXB 4YHLH 1FVCA 4AJ0A 5IB5A 2D0FA 3RZWA 2LVEA 1T66D 2VISB 5ADPL 4ZPTA 1JJUA 5GGRA 2IH3B 3CFCL 2Y06H 1Z0NA 2BC4B 1G6RH 1LO2L 3PWLB 4LLWB 4U1KA 2VZUA 2BSED 3U83A 3O6KL 1Q94A 4XC3L 5F6IB 1XGRA 4HGKC 5GS2H 2IJ0C 1JWSA 2I25N 3NCJH 3EIFA 5C7XL 1G7MA 2R2CA 4PJ7F 4AQ1B 4JRYA 5BS0D 5T1KB 1I3GH 3TT1H 1ZHNB 2VO5A 2AGJL 2R2BB 3GGWA 1PDKA 1QYGH 4TSBL 4FNLL 3BPNB 3H9ZA 4LVOB 1C5BH 3O2VH 2J2ZA 1IGTA 5FA3B 3LS4L 3RWCA 4DZBA 1TZIB 4HD9A 3CCHB 2R39A 3TZVC 4PV9A 3VXUA 2NXZC 2HH0H 4GMSH 4QXGH 1G7QA 3JTTA 3GKWL 3BMVA 1U3JA 1BAFL 1DEEB 1RQ5A 4H20H 2GKIA 2W0FA 3ARGD 2W9LA 3QHFL 1WCBA 2IG2H 5E00A 3PWUB 4Y4HB 3V52L 1BLNB 3QZWA 2ZUVA 1G7JA 2C4FT 1MI5E 3DO3A 3MFGB 5C0DA 5B4MC 2DWDA 2YA1A 1TJGL 2VDML 4PLNC 3V5HA 1J1XH 1EFXD 1RIHH 1T1ZB 4RCAA 1G1CA 1J1PL 5IMKB 3LKPB 4LKXB 4ZQKB 3TP4A 3HHRB 3SQOL 4DZ8B 1Q72L 3VW3H 2FH8A 1GGTA 5C0IB 4F58H 5D71H 1FYTE 2B2XH 4XP1L 4MQTB 1A6TA 5BRZB 5SWQA 4MA1C 4NRXA 2MQ0A 2DL9A 1FO0H 2ZOLA 1P9MC 4YDJA 3PABB 1U8KA 5E5MA 2CXGA 4Y2DA 5EU4A 1Y6KR 2GK2A 5K9JH 3KXFA 5JORB 2C26A 3WHE0 4TOYL 5HYJD 3DURB 1NFKA 4LLQB 1WV7T 1F4YL 4WHCA 4PB9H 3U46B 1UT9A 2R0ZL 2L7JA 4PRDA 2X4NA 5I2IA 3BKYL 4ODWA 4P2OD 5IVNA 4KRPD 2R2EA 3EJJX 3WSQH 3TFKD 2B4CL 4NOBA 1U58A 1GGCH 5J06A 3O3UN 5TGBA 2OM5A 3EFFB 4KZDH 4OJFH 1BREA 3K2UL 2DTSA 1IAKA 4GH7B 1C5CH 4BZ1H 5FYKD 1QLRB 4OZHA 3BD4A 5I73C 4BH7B 4G6JL 1HIMH 1C5DA 5C0AA 3SPVB 2X9WA 2VZ1A 3UTSE 5FF6A 3KPSE 4L9LA 2EH7L 4JPVL 3O2WL 4O02H 4ZFGL 5DUPH 5KZCB 3KPQA 3AU1A 4OD1L 3QPXL 4ZYKB 3SKNA 3GK8L 3WFEL 5IVZA 3ULVF 2WK2A 5CSBA 3SY0A 1JGUH 2CR6A 2N1KA 1VACA 1FV1A 1YA5A 1J1OH 1PKQA 1MQKH 2AQ2A 1MHHB 4MZ3A 4K94L 4OF6A 4ONGH 1L6ZA 4Z7UE 2DN7A 1KC5H 2VH5L 4XPTH 1BOYA 3HE7C 4KJQD 2DQCL 2OJEA 2H3NB 4IOFC 2MQ3A 4LSTH 4MHHG 4RISL 1JYVA 1J8HD 3CX5K 1H8OA 4N9GB 5CJQH 4KDWA 4FQIL 1IAIM 3WKML 3GBNH 5L9DH 1FL3B 5DJ6B 1X5LA 3GSVB 4R90H 2YRLA 3CFKA 4IRSB 1W0VA 4BQ8A 2VXUH 1WIUA 4HWBL 4WW2C 1JMZA 4ENEC 1AC0A 1HWGB 4X4MA 4JKKA 3PWJA 1KIQB 2H26A 4HIJB 4XPHL 1CBVL 3TO4D 3GI8H 4QRSB 4DCQA 3PQYD 4NO5A 5C08A 5CBEA 1AE6H 4OTXL 3NACL 2J7LA 4JO3L 1GH7A 1MFNA 2B8OT 3BW9A 1ZLUH 2WLZA 1YNKH 4PJBA 4B53A 5KS9A 5I8CB 4HGMA 1AD9B 3NIGE 4M93B 1I9JL 1S7SA 2VAAB 4KXZH 2X40A 4FQ1L 2JB5H 2RFXB 1RZ8B 3B9KB 3RWFA 3FN9A 1UC6A 3VG0H 4JFDB 4CMMB 1MJUL 5GGVL 3WNNA 2EEAA 1SM3L 1OPGH 3MCLL 5ELIA 3C2SA 3I6GA 3QCVL 2GT9B 3LZFL 1CGXA 2DKUA 1FNEA 3PWPE 2X4OB 3TCLB 1EBAA 4R4NC 1KLUB 4MD0A 1AGEA 3DROA 4AK1A 3I02B 5TF1L 4J6RH 5BS0A 3Q6FB 4QRPB 5CP7A 2JCCF 1T7VA 3QHZH 5TFSL 4GG6E 5LBSL 3W82A 2B1HL 3R06B 1RUAL 3IRZA 2X70B 1MLCB 1X5JA 5MERB 5EIIB 5CJXC 3CC5A 4G43A 3VFMB 4XGZA 1EPFA 1S5HA 1MFAH 4K9EL 4P57B 5FCSH 5EOQL 3ZHDA 3E6FB 2FX8L 3HS0A 4H1LA 5L8JB 5DT1L 3ARGA 4M7JL 3EDEA 3HPLB 3OKKA 1YECL 4M4PA 5EOTB 2GAZA 1YN6B 4JY6A 1JCKA 1Q9WB 1NLDL 3M1BB 2NY7L 2V5SA 5EBMA 3ZE0F 4D3CH 2NTSP 4XX1G 1A02N 1OT2A 1N4XL 3H42H 1EFXA 3P3YA 4JG1H 5ALCH 1QBAA 1RSFA 2DJ4A 4DAGL 5BVPH 1A7QH 2YS4A 3C5ZB 3D85D 5IBLD 5TQ0H 4D0BA 5CIPB 1XF3A 3EDKA 4JFYB 4PJBF 4NQSB 3DSFH 2XWBA 3GSUA 4JLRA 1B0RA 1IILE 2P8PB 5A2FA 3KJ4B 4Z8FH 2BDNL 2UZYB 3ESUF 2ARWA 1NFIB 2OZ4A 4QF1B 4N0UE 3QJHA 4CN6A 3QYCA 1P4LA 1U95A 3F7VB 5ACMA 5HYJA 4X6EB 1BZ7B 1IT9H 2VLRE 1ZLSH 5HHNB 4GFTB 1EV2E 3BDYH 4TTDD 4UDUA 3HC3L 4GW5B 5DUBB 2MHAB 4KK5D 1YEGL 1P6AB 2VKXA 4HWZB 1AP2B 4JFEE 1INQB 3P0YH 1YEEH 4GRMB 4P2OA 5DHXB 5JO5B 1AXTL 2EH8H 2VDKH 4PG2A 4LOUD 3U4EA 5JIKA 3OXRB 1EH9A 4UNTA 4X6DF 3CLEL 2WUBL 2YPLE 1QPXA 1D5ZB 1HQRB 2VC2H 3N85H 3GMNB 5C8JA 2OTPA 5T1DH 2HTKD 2BJMH 3DX8A 4RAHA 1SEQL 3PXHA 8FABB 1IZJA 4NWTH 3DETD 2BOBA 2H9GA 4XVJL 5GS2D 2P47B 2CK0L 1IGIL 5DURD 3PP4L 1QTYT 3QUMB 3FOMA 3R8BB 1E27B 1WEJH 5F9WB 4RMWA 1NGWB 2ZSWA 3TYFA 3FB8B 4IMKC 4ONOA 4MJ2A 2DD8L 5ISZB 2F19L 6CGTA 2Q3ZA 1D6VL 2EE6A 3SN6N 3VGGA 5DQDH 4QHMB 2MPAL 3PV7A 3OKLA 3VRLE 1J8HA 2W65B 4XBEH 3RY5A 3G5XA 3H9SD 5GJTH 3Q3GB 2H45A 1EGJL 3SO3B 1CVRA 3QH3B 3GSQA 1JFQL 3DYOA 2O5XH 3MODL 1QFPA 3CLFH 1UJTA 2BRRL 3FB5B 2OI9C 4HPYL 3NPSB 4OZGA 5HD8C 1I7ZA 2YD6A 3O3DB 3ZTNH 2P5EB 3TO4A 1EZVX 1AGCA 1TVDA 3PQYA 2D7MA 2RBLA 2QQNH 4ELME 2XA8L 2J5LC 3KWWA 4LP5A 3P2TA 1BM3H 3QQ9C 2H6PA 3IXTA 4KPHH 4FTVE 1EEZA 1T1WA 3O41A 2QKIA 4BFBD 5CCKL 5EU5B 4JZJA 2EDWA 1Z5LB 1MJ8L 3LV3A 2ZCHH 4N8PA 5F1SA 3SDAB 5KSAB 4PJ9B 5CKAA 4I77H 4P4RA 1IGJB 4MB5A 4KI1A 4IRZH 3T77B 4Z7OE 2XTJE 1QHOA 3RVUC 3MYJA 3PIQA 4KFZC 5IQ9B 1E28A 1KFAH 3WL9B 3SDCB 1RURL 4QTIL 4X8JA 1RK1B 1MY5A 2NR6C 2AV1B 1ZVYA 3FT4B 2E7MA 1MPAL 2F74B 4PJDF 2NY1D 4XMPL 1CE6A 5D1ZD 4M6MH 5F7YC 5ADPH 2MKWA 4UT9L 4PR5A 1YMMD 2FGZA 5DD5L 5E7FA 5IMOA 1HKLL 4MNQB 2Q8BL 5D6DA 5GJSL 2BX5A 1SHMA 4HS8L 2RIKA 1NAMB 1H5BA 1MH5A 3RL1B 4L4VD 3OB0K 3IDGB 1HHIB 3F6IA 2AGJH 1D9KB 4KMLB 4TSBH 4FNLH 4PJFE 4LHUB 1QLFB 1Z9SA 4L4TE 4ISVA 3LS4H 4NN5C 1BQUA 4X6BA 1JYWA 4Q0XL 4OCNC 3GKWH 4RAUB 4ZUUB 4U6YB 5ID1A 5EPMA 1KCSH 4NCC1 4KDTC 3QHFH 4OI9A 3DO7B 5EBWA 3D85A 3V0WL 3SHSA 3TA3B 3QIWC 15C8L 3QQ4B 3GIVA 3HPJB 1I3UA 1EEQA 1KTDA 2C4FU 4JN2B 4ZXBD 5IWLA 4EI6A 1I4FB 3RY6C 1TJGH 2VDMH 4J12A 4XVSH 3TH2T 5DS8A 4A6YA 5IIEB 4Q6YA 2GUOB 4WUUD 3S37H 2FJGA 2J8UB 1TZGL 3ULUL 1Z6JT 2PR4L 3T0DA 3IETB 4FQQB 3SQOH 2YPVL 1PSKH 1Q72H 2E3VA 1OP5K 2MOVA 2FJHB 4WY7H 4XP1H 1B9ZA 1XGPA 4HUWB 4EN3D 3QFDA 4UV4H 1TVHA 2DQUH 2HJLA 2W92A 1UCBL 1IGFH 5DYOA 5C07B 3OWEA 3D69B 4JO1L 5M94B 4N5EC 3RJQB 4MNHB 2ITCA 1RJLB 3CVIL 4ERSL 1F4YH 4GT7A 5BXFA 4P5TC 3ULUE 3BKYH 5CZXD 1G6RA 1WT5A 4EUPG 2Y4SA 1A2YB 4OCWL 3U0PA 3EBAA 3P0VL 1PZ5B 3PG2A 1CFNA 4U7MA 5DJYA 3OF6D 5IHZA 2FLBT 2UWEB 3ARRA 5E4EB 1CGSL 2W38A 1OM3H 1FH5L 3GMRB 1GGYA 1N64H 3O6FC 3JTSB 5I1AB 2BXYA 4G6JH 5E8NB 4MDJA 2MQCA 4JR9L 2ZNXA 4OD1H 5LKNA 1KENH 1S78C 3G6AB 3GK8H 3WFEH 1FN4A 3ARDD 4S1QL 3VXME 1K3ZA 2V2WB 4I18A 1NGZA 1CN4A 1CQKA 1EMTL 4LBEA 3GRWH 3I2CL 1KEGH 2EIDA 3DVNB 1IBGL 2E7BA 3H9SA 3UC0L 4AENB 1XZ0A 4GRWF 3F62A 4TRPH 2WIIB 3UYRL 4E41D 3DIFA 2V9TA 3RBSA 2AP2A 2R0KH 2YZ8A 4F7CA 4OD2A 2DQCH 4N0RA 4Q7DA 5EUOB 4FQIH 3V5KB 5J1AA 4GLRH 1YPZB 4YHPA 3MLPA 3T2OA 1LEKA 3V6ZB 2CIIB 3S35H 4CADA 4PGEB 4U1NA 5JW5B 1KLGA 1PG7L 2NW3B 3QA3A 3D1MC 4D0DB 1TTUA 1FO0A 2ADFL 3HZKA 1RJYB 1YQVH 1P2CA 3OXSA 4XWGL 5JHDB 1CBVH 4Y19E 3FB6A 4PJGF 4OTXH 4MD4A 4DKAA 5HHXL 1KSRA 3F12A 3L3IA 2CUHA 1IL1A 5KVEL 1XCTB 4HT1L 3FO9B 1TQBB 4CGTA 4GRLB 5B22A 3SDYL 1M6OB 5I1HL 3BP6A 1KLFA 2ITDB 5IMLA 1WFOA 2CKBL 2YSSA 4WUKL 3V0VA 4PRPD 5T5NG 1ZVSA 4KKAC 3HR5B 4HLZH 3C5SA 4K3GA 1IKNC 5IFJA 4NKIH 1ZT1A 1CLOH 1KJ2B 4LL9A 5D1ZA 3UTOA 1SM3H 4BZYA 3MCLH 5IVXE 4GAGH 2VAJA 3WS6A 3RZCD 4JFZL 3UAJC 3BI9X 3LZFH 1YMMA 4P4KD 2FO4A 4XNMB 4IMLB 4RX4D 3BRGC 3LN4A 4FQXC 1C7TA 5FB8A 3EO0A 2NX5D 1OTSD 3K4ZA 5K9OB 5TF1H 4U1IB 3IF1B 2W0PA 2EE3A 3D18A 1V3MA 5F93C 4L4VA 4HAFA 5E8PA 4KKLC 5TFSH 4EXPX 5LBSH 5I19H 2HG5B 2OTUA 2QJDA 4FXGB 1OSZA 2O5ZH 5BQ7A 2EO1A 3HI1B 5F6IC 4XP6H 4MHHI 4KVCL 3MGTB 1L9NA 4LCWE 1OTTD 5HYQB 3QI9B 3G6JE 4DVBA 3BZ4A 1BFVL 4PJEA 4MWFB 1FORH 5E2UL 4MJIE 4QHKI 4M7JH 5B21A 3BPNC 1VA9A 4LVOC 3D39B 3VFSB 4JDVA 3VMPA 5EFIA 1NLDH 3OKDA 2NY7H 3BH9B 4ZXBA 3LKOA 4RQQB 1A1NA 1N4XH 1F42A 4M61A 5BZDA 5MEQB 4WUUA 4DAGH 1KACB 3QEUA 3MLYL 1S7WA 43C9A 2GTWB 3MV7E 1FGVH 1YC8A 2ERJB 2K9UA 3FQTB 1HYSD 2OX5A 4XP4H 1CTNA 2QQKL 3BSZL 3EO9L 3WDHA 1JTOA 1HILB 5C1MB 2EDHA 4EN3A 3KS0H 1DP0A 1ZT7B 1NGQL 1B2WL 3FO0L 4KXZI 3TPUA 2BVYA 5E6ID 2GJ6B 4GRWB 5C0EB 2OL3H 2QLVB 1FZKA 5C3LD 4P2RB 1WAAE 4OIIL 3D0LB 5K59F 3GMQB 4DK3A 1MAML 3D3VE 4CN4A 1OP5H 1IEAB 4NFBA 3RUGF 3HC3H 1YEGH 3FOLA 2V17L 3L95A 3P40A 1RZGA 5CKGA 2YBRA 1I8MA 1M4KA 4PJCA 1AXTH 1YUHB 1NLBH 1RZJC 1UWXH 1D6EB 3OF6A 1E4XL 3ZL4L 2YXFA 3L3GA 1YNLL 5GZOD 3DI2B 5E9DB 4ZFFB 4D9RE 3B4NA 3SKJL 1SEQH 5B38B 3BPCB 3WEXA 4KQ3L 1R3HB 5DFTA 5E08L 5FK9A 1IFHL 5HGAA 3T3PE 1MI5D 4QXUL 4HBQA 1B88A 4HIXL 1H9VA 1C08B 3ARDA 3I6LE 4KKCC 4Z7VA 4G8IB 5J3HD 1CT8A 1Y6MR 4JRWA 4N1HB 2B1AL 4JHWL 1F58L 4JN1H 2F19H 4E41A 1CFSA 3UEZA 1NCWH 4JZOA 3H0TB 1EEUA 2MPAH 3L6FA 4ZOAA 3C5JA 1G7LA 1QFUL 1U8IB 4KVNL 1LEIB 4NC2B 4NO2A 5KN5B 5GIRB 4PS4L 1F8TL 1QFWI 1YEDB 1EGJH 4PJHB 1JFQH 3MNWB 2R69L 5FKAB 1BBJB 4PJIB 2FEDD 4MQ7B 3ZT7A 3OKEA 4C56B 5DVNA 1ZGLM 4Z7WE 5GSRB 1U8NA 3HB3D 2XA3A 4YPGA 2NXYB 4NNYA 4HZAA 4ODUA 1ZOXA 2Y07L 4GMTL 3FRUA 4GAYA 5FGSA 3HE6D 4KJPC 2BERA 3Q6GL 4RA3A 4I0PD 2EXYD 3EFDL 2NY2D 1F4HA 4WEUD 4IRSC 5C2BL 4WJ5B 5DMKB 3M8OL 1JN6B 3B6SA 3IJSA 2I5YL 4N8CL 3U6RA 1SBSH 4AH2A 5JLZA 4L29B 2VLJB 1SJHB 5J13B 5TE4L 3QXTA 1I9IL 5D2LE 1B0WA 1A7BA 4PRPA 1UM5L 1GZQA 3VFRA 5CCKH 2BRQA 5DJ0A 3UTSD 1X4XA 1T04A 3DECA 1L7TL 5DJDA 4HX1A 4YXKL 3HC4L 3IKKA 4S1SL 3AXLB 4TVPH 2HLFC 2MFNA 4OGAC 1NMCB 1QR1B 5EZJB 5INDB 4QXTB 2JELL 4FFVD 4TVSa 4UNVA 3B8SA 4FN0A 4MA8H 2F9BT 3QXDA 4JQVA 2AJSL 3RZCA 4M93C 3REVB 1JZ7A 4JFQB 5DJAA 4P4KA 4QTIH 1DLFL 5JW3H 5AZEL 3IDYC 3HLAB 4RX4A 4Z7VF 4CVZB 4P3DA 3WIHH 2DWEA 2HVKB 4BFGA 2FIKB 4XMPH 1MCOL 2NX5A 4HFWB 3LEXB 1BBDL 3IDIA 1E4JA 2FATL 1QVOA 1HNGA 4P9HH 5J9PA 1DQML 1PY9A 1IJ9A 1HH9B 3NPZB 2NW2B 4GKZA 3NN8B 2UVFA 1ONQB 5GJSH 2ARJB 1SVZA 4H8WC 1JHLL 4JEGB 3RGHA 3RKDD 2A6IA 2YEZA 4F7MA 5TQ2H 3UPRA 3T0VA 3T4YB 3O11B 3WNLA 3FT2A 2WWMC 4FZ8L 1WWWX 5EG6C 3LD8B 3SCMB 1DL7L 4LGPB 1OAZL 1I1AD 2BVPB 5FO9B 4FG6D 2W9DH 1NFDB 5CLTA 2XI9A 4H25B 5J7CC 2H1PL 4U49A 3MNVB 3T8XB 4DTGL 4KRMB 3HUJE 3QQ3A 3V0WH 5EO9A 4Y5XB 1O7VA 2EZ0D 1M7XA 2Y36H 3BKML 2WAHA 3GMOA 4XCYA 3S96B 1CU4H 1UKQA 5DEGA 4Y5VA 1W0WB 1XF4A 3G04A 3W11D 4MAYC 1ZA3B 5DTFB 1IQWL 1FIGH 5F7HA 1HSAA 2ADIB 2GK0A 3RDTD 2VXSH 3A67H 3ULUH 1F4WL 3C5ZC 1YEHH 2Q20A 5E6IA 5B3NA 5I9QC 1L6XA 4GSDL 3EYVA 4I3SH 4P5MA 2Z93A 1KEML 4X7SL 2QSVA 3O3BA 4KK6D 3W2DL 2IAND 4NQTA 2ESVD 4KZEL 3U0TB 3QFJE 4XNZB 1UCBH 3LQAC 3ULVC 5ERWB 1X7QA 1V7ML 1X3DA 4MXQC 3WDJA 3V5DA 2NY3C 4JO1H 2BVOB 2DIBA 5CUSL 5I0ZA 1J12A 4EEEA 4JDTH 4ODTL 4ZUVA 1G1YA 2GJJA 3CVIH 4APQC 3BE1H 4ERSH 4WI8A 3LHPL 1QKZL 2Y6SC 2ADJA 3ARUA 4YUEL 3MLWL 2FD6H 1JGLH 5I1IL 4NQDB 4LNVA 1HHKA 3P0VH 5SX4H 2BSRA 5IROA 2EIBA 4KTDL 1P4BL 1HE7A 2FGWL 4LSUL 4LU5L 1MI5A 1JZ8A 5IFHH 1CGSH 4YXLH 3BX7C 3WXVL 1OW0C 4N8VA 4PP1D 4J3OC 1R3KA 4M6OL 4YDVA 3O45A 3AGVA 2YUZA 2C7UB 5F9AC 4XPBL 4JR9H 1JF5A 4MXWL 5F89B 4OLWL 1EJOL 4PJ5E 5CBAB 2DYPD 4QTHA 3KLSA 4P2CG 5L6YL 3K1KC 3GMMB 4TQEL 3VGAC 1QLEL 4I3GA 4LLDB 4U6HA 5LQBH 5ICZB 3TGXA 4ETQB 5F9WC 4LPWA 3UC0H 5TPWL 4WENB 1NCDH 1EO5A 4UUJA 5I18L 4F7EA 3WFCL 3KLAB 4WRLA 1MIEL 3CFJB 4HH9B 2HFFA 1CGWA 4O2EB 3FQWB 5FUCC 4LGSB 3SE9L 2VLRD 1J87A 1AXSA 1DQTA 4XNYL 2NLJA 4G9DB 4J1UA 5CJ5A 5FO7A 3MMEA 4H5SA 4MSWB 4NBXB 1A6WH 2VERN 3HE6A 1P84K 2EIEA 3SO3C 2CDGA 2XACC 1M1SA 4I0PA 3FQNA 5DQJA 5LCVH 1AY1H 1PG7H 2BNRB 2ENSA 2CLRB 2X4TB 3S34L 5ESAB 2YPLD 3BJLA 4X9FA 2C5DC 1W72L 3NPSC 5FIEA 2R1WA 1RHHB 5AYUH 3MROB 1S9KC 1YN7B 1FBIH 3UTSA 1F13A 1TJIH 4OUUB 5KVEH 3WJJA 4HT1H 1AO7B 1E4KC 4HSQA 3SDYH 1DUYA 4PYHA 5I1HH 5F9DC 1DN0B 2C4XA 3OV6A 5HY9A 5ANME 1HDMA 3GB7B 5GRWA 5MP6L 4L3EE 2CKBH 5HGGS 4JM2D 2WNGA 4U4BA 4IRJD 2XRAL 3QUZC 3D9AL 1MRFL 1E6OL 4Z7UA 4YQXH 1Z9LA 1T83A 4JGJA 2RJMA 4B50A 1GYAA 4X6CA 3RIAK 3P4MB 3WNPA 2OSLA 5KSAC 5HVGB 1IM9D 1X5XA 2F8OA 3SBWC 4QRTB 3RNKA 2JJWA 4UMGA 4D0CA 4JFZH 1L7IH 2OXHA 3MRFA 2APVA 1FFRA 4HKBA 2VDPH 2CDFA 5IB1A 3GBMH 4G9FB 3GRWA 2IFGA 1OAUL 3Q5YA 1AGFA 2Z35B 4JHAL 5HBBA 5HHPB 4HQQH 5ICXA 3SGJC 1T20B 3MCKA 4QHUA 4JPKH 5D7IA 2BY1A 2JK5A 1C16B 3HNSL 4DK6A 1CD1A 5K9KA 1PBYA 4G6AC 1T1YB 1CFVH 3MOQA 2XPGB 1G7PB 3QEQB 1I1AA 5HXMA 4K8RC 1BFVH 1H3PL 3HCVB 3CU1A 2G5BB 3I75B 2J12B 5LAXB 1D9KC 4Y1AE 5I76A 4LNRA 1KJMB 2A83A 1UJ3B 1IM3B 3DMMD 1R3JB 3HG1B 4UIMB 4NZUL 1FFPA 3EZJB 5H2BB 3HRZB 3ROOA 1FJ1B 1RY7B 3OKOA 5GXBB 3PHSA 3R1GL 2WQ8A 5IV2B 5FUZL 1FFNA 3MLYH 1A22B 3U9PL 3RDTA 2XTJD 1T5XB 1QRNE 3DRQB 5IB4A 4O9HL 2RCSL 4LCUB 1JHTA 4OGXL 5J1TC 5FECB 4D94A 1T7XA 5LGJB 2QQKH 1KULA 1BQHB 3EO9H 2IANA 4OI7A 2ESVA 1B2WH 3MRDA 1CF8L 43CAA 1TZHB 3FO0H 4I13B 2LFGA 1B90A 4Z7UF 3HC0A 5ESQB 2WQRA 4KV5E 3GJEB 2GTZA 4TVPD 4FXKA 4W81A 1JZ3A 4HUVB 4OIIH 3ES6A 4QOKD 1Y18A 4D9QE 1IC7H 4JFHD 4YFLI 2NYYD 3BZEA 1G9NC 1Y0LB 1MFDL 2VQ1B 2BNUB 1A1MA 1S9YB 4P23B 3C6LB 2V17H 4PRIE 5FGCB 3NAAH 3NFSL 1OAKL 3IXAB 3VXPB 4NO3B 4L4TD 4OLZL 4XXDB 4LF3A 2Y23A 1YYLL 4LQFH 1N6VA 4R8WL 3ZL4H 3OJDB 3UPCA 2UYLB 4LCCB 4LARL 4YHIA 4POYA 2P8MB 1I7RB 3SKJH 1SYSA 1I1RA 1U8JA 3GHBL 3MLTA 1U92A 4QHKJ 2APFA 3W9EB 1DBJL 5E08H 2HKFL 4DWHA 4JPWL 1A4JB 2J3SA 1IFHH 3QXAA 1A3LL 1UM4L 4QXUH 2DYPA 2HFGL 4RZCB 2HJKB 4KAQH 3MRMB 4XAWL 3QXVA 4HIXH 5E4EC 3NIGF 2AEQH 3SKUD 2CR3A 4MB4A 3B3IB 5C0CD 4DW2L 2AJYL 2IADA 1F58H 2P48B 5EC2A 3F7RA 4XHJD 4L3CB 2VITB 5J1SC 3QPQD 4J4PC 1K4CB 4CMHC 2VLRA 2Q3AA 4PV8A 1ED3B 4U6VL 2Y7QB 1ORQA 3K7UA 1KXVC 1U3HB 3HZVB 3TVMC 4XCCH 2R69H 4NC1C 4FQLH 3RI5K 2EXWD 5D8JH 3NCYS 1U3ZA 2I9LB 2BMKA 3NFNB 1ZAGA 1NJ9B 4MJ4A 5C09E 3CMOL 2YPLA 4GG6F 3ULUD 1JNNH 2OL3A 4I3RL 1KV3A 1MCIA 2CH8A 1BVLB 4DQOH 2ZG1A 3EFDH 3F5WA 4X99B 5HI3C 5C2BH 3M8OH 4N8CH 1JNJA 1ZHKA 5DVKA 4NUJB 1MFBL 3LMJH 3DUSB 2D4DA 4JM2A 4FHBD 3GSXB 1S7UA 3QUXD 4IRJA 2NY0B 5E95B 1DUZA 4E0RB 1WIPA 1NBZB 4U3HA 3HC4H 2Q6WB 1AI1H 1FVCB 2HKHL 1UH3A 2E6JA 5DRZB 3VXMD 2X42A 4OZ4B 2JELH 5BCAA 1TQBC 4XWOC 1IM9A 2A73A 2AJSH 3A6CL 5EU3B 1RZ7L 4ZPTB 4R3SA 4PRAA 4OAWB 1ZVHA 5GGRB 5I8KL 1DLFH 1RUMH 4NIKB 4U1KB 5AZEH 2M1KA 2HT3D 4M1CD 1Q94B 1MCOH 1XGRB 4F9PC 1JWSB 1G7MB 1MCBA 4PJAE 3UJTL 2VABA 4JRYB 3FQXA 4ONHA 4LHUG 2FEEI 3D0VA 3ZMRA 3DUHA 1MLBB 3IDMA 4L5FL 5E8EB 5B8CA 1DQMH 1HOCA 3GGWB 1WZKA 1NL0L 4DFIA 1QBLL 3RWCB 4ELMA 2LE9A 4PV9B 3VXUB 5CS7A 1EAJA 2WP3T 3ARBB 4WV1A 1EGJA 3B5GA 5FCUL 4FZ8H 4G80B 3VD5A 1WLHA 3DBXA 1R5VB 3VXTA 1WCBB 3DMMA 1ACYL 4LP4A 3MO1B 3QZWB 1UXWA 1G7JB 5E8DL 4HIEA 4ONFH 1RU9H 4F80A 5C0DB 3OX8B 3QI9C 1XR9A 4HKZB 2DQFA 3BKMH 5FV1L 2WSKA 4HXAH 3V6BR 4C55A 3NFPA 2PYED 3QISA 1RIVH 1PVHA 1MWAL 4FQHB 1HEZA 5HHVL 5EBLB 5SWQB 4TSAH 4NRXB 2ZOLB 5D2NB 4YDJB 5E5MB 5EDXA 4GSDH 4Y2DB 4TUOA 2FRGP 5EU4B 4F15B 1WUNT 3VRLF 4QOKA 4JY4A 1KEMH 3KXFB 3KPTA 3W39A 5I74B 5FFLA 3W2DH 3T09A 3ZTJH 3L5HA 3MV8D 3IFLH 1JRHL 1HK6A 5I2IB 1B3JA 4ODWB 3SOBL 3CAFA 3FAXA 5DZNA 1OARH 2DI9A 4L4TA 5CUSH 2Q8AL 3SGDH 3WIHA 5IHUL 2VDRL 4ODTH 5D7JD 2V7HA 5ID0A 4LKCA 2Z31C 3VFUB 1U58B 3LHPH 1NMAL 1QKZH 4LCWD 2DLGA 1NBVL 4YHKL 1R24B 4PB0L 5JQHC 3BD5A 1GPOL 1V05A 3FHQA 4OZHB 4YDKL 1C5DB 3O9WD 5C0AB 3QEHB 1GSMA 1P4BH 4WHTA 5C0ND 4LSUH 5FF6B 4L9LB 3QO0A 2GEEA 3KPQB 4KY1H 3AU1B 1WJ3A 4BA8A 3MR9A 3WXVH 3SKNB 3CX5J 1MIMH 3KNBA 2IPKA 1I9RH 4L8SB 1HWHB 3SY0B 5C0CA 4KTEL 2BY0A 3RVXC 1A6PA 4MJ5A 2EIZA 4XPBH 4MXWH 1PKQB 4X4XB 4XP9L 4WHDA 3MV7D 4XXCA 5L6YH 3N06B 4D9LL 3IDXL 3RL2A 5EORH 3P9MA 4J7RA 4QCIA 4ZO8A 5MENE 1LDSA 5JDSA 5F3BB 5AD0B 3CVHH 1VHPA 5CSZA 5HPOA 4ZSOB 5I18H 3SJVE 3MFFB 4EDWH 3MBED 2DQEL 1MIEH 4LRIC 2ZSVB 3L1OL 4XVUD 3SE9H 1U9KA 4Y0GA 2FHBA 1IEHA 4XNYH 2AK1L 5IW1B 3S7GA 4KUCF 4KMTH 5HDQL 1A7NL 2H26B 1DBAL 1BD2E 1HHJA 3TESA 3IT8D 3S34H 4X4ZA 4DCQB 5CBEB 4H0HB 4YK4B 4Y8DC 2VWEE 2B5IC 3AY4C 4PJFF 1MREL 1DN2A 4MCYB 1W72H 2NXYC 1WQVT 1F2XK 4N68A 3KLHD 2BOCA 1LP9A 3T04D 3VJ6B 4X7TA 4YAQB 1JZ5A 1JZ2A 3QDJE 3QUXA 1BF2A 2B7DT 3T2QA 1S7SB 4UT6L 4ZODA 1N0XL 1S7XA 3RWFB 2HT2C 2WP3O 4RNRB 4JDZA 2ZUQC 5HHMD 5IHBA 3OQ3B 3VXMA 3KPOA 5JA8B 1T2QH 2E27L 1PYWA 4K3DL 1S7VA 5TF0A 2R29H 3BEWA 1WC7A 5CJOL 3I6GB 1CGYA 1P5VA 4HWEL 1E6OH 1W2KT 5D1XD 1FNEB 2NQCA 3W5MA 1VESA 3ME0A 2X09A 3ECBA 4XVTL 5L0QB 4MD0B 1AGEB 1NMCC 1DBBL 3DROB 5IVOA 4NN6B 2ATKB 3RVVD 5BS0B 1N6QL 3MRCA 1INDH 4Y7MA 3LCYA 2XG4A 4ZDHA 1WBXB 1TNNA 4NRYA 4LLAA 1AKJB 2YUWA 4G3YL 1DQJA 5GRZA 3EJYC 1OAUH 2NY5C 4JHAH 3CC5B 4G43B 2P4AB 3U36A 4XGZB 3WYRA 1S5HB 4H1LB 5BW7A 3HNSH 3GHEL 1MCRA 1CICD 3BKJL 3RWHB 2IFFL 3ARGB 4CN1A 2AJ3A 5KSVA 4RBPK 1DDHA 5EBMB 2B39A 3FN3A 4GAJL 3D5OF 4HS6A 4OLUL 2F54D 2YC1A 2HYMA 5F1NB 4K55A 2I60L 2A2QT 1JWMA 4O51A 3LD8C 2FHCA 3SCMC 4NZUH 4XH2B 1RJCA 3RWGA 1VFMA 4ORGA 4ZOEA 1XF3B 3GSNL 4HCRH 1FCGA 4PJ8C 4R0LC 1YZZA 5I16A 2PYEA 4HFUL 4DVRL 3NTCH 4JLRB 5E0QA 1B0RB 5FUZH 5IVXA 3D2UD 3CFDA 3CSYA 4JB9L 4F3FA 2A1WH 4HLJA 2RCSH 3QJHB 4W6YB 3TZVD 1XIWB 4Y5XC 3H8NA 4WTWA 1P4LB 4H26A 1QNZL 5HYJB 4OI8A 3MV8A 2CKBA 4UDUB 1G0YR 2ZCLL 4DN4H 2BVEA 2BHUA 3BT2L 3DXAD 4P2OB 2VL4A 5D7JA 3NCYP 4QT5B 4JVUA 3U4EB 2Z92A 4CBPA 1BQLL 4D8PA 1MFDH 4LCWA 5B38G 3UP1A 3G6JA 5E2WL 4XNZC 2ZJSH 1ZE3C 4ZAKC 3DX8B 4NDMB 4K7PL 5ALBL 3O9WA 2BOBB 2H9GB 3VXRB 5HPMA 3QIUD 1FPTL 4UOW0 3K80A 4AT6A 5ABDE 1N2RB 4GBXB 3FOMB 3GHBH 2G2RA 1YDPA 2YN5A 1HNFA 4JGUA 2ZSWB 1DBJH 4Y4KB 4OCYL 2VE6B 1A3LH 1UM4H 3DTXA 1D5XB 3MV7A 2OR9H 2WBKA 4XAWH 1TXKA 4HMCA 4NUGL 1FVDA 3AS2A 4OCXH 4DKEH 2PETA 1J8HB 2VQUA 3FMGL 3WHXA 1EBPA 4DW2H 2AJYH 3G5XB 4Z0BL 32C2B 4HGWA 2DQGH 4U6TA 3MBEA 3ZO0A 1K5NA 4WU5A 5IG7A 4S0SD 4BFIB 3S3JA 5J57B 4BUGA 2GITA 3VH8A 3VRJA 1RIUH 3QFJD 5AYQA 3OL2A 3QUKB 4OZGB 3DGGA 2AAVA 1I7ZB 2HWZH 2DDQL 4R2GB 3KYOA 3O3AA 4LMQI 3TO2B 3TO4B 1AGCB 1B4JL 3LPFA 5GRUL 4O5LH 3ALWA 4GG8A 1TITA 4DFHA 3DI3B 4NSKA 3BZDA 1DFBH 2JJTC 1G7HB 3CMOH 4DKFL 4H8WL 2H6PB 1K3IA 2VLLA 3MGOA 4RAVB 3QNZB 1M71A 1KCUH 1EEZB 1IAIH 4QXWA 5T1MA 1HXMA 4JZJB 4RDQF 3X3GH 3HE7D 4TNWK 4IOFD 1VEMA 5FM8A 3G6JF 3UTPE 4JFDE 4LAJH 5MEPA 1R3LB 1S7TB 1WBYA 4P4RB 4XB7A 4U1JA 1YEKL 5CGYC 3PIQB 1E28B 1JNLL 3RTQC 2AERT 4PJ5D 3E6HA 2HKHH 5D1XA 3ZYJA 4X8JB 2W60A 5IB2A 2F5BL 4ENED 5C6TL 5TH2B 1CR9H 2EEDA 1CE6B 1J8KA 1MCJA 4NQVB 1RZ7H 1F6AA 4J8RA 5I8KH 1CDBA 4U1HA 4W6WB 5T3ZL 3MJ7B 4PR5B 3EJZC 3IFPA 2ICCA 5J12B 5IMOB 2AXFB 3HMXH 3N1GC 4QYOA 3LQZB 1YEJH 1J05A 2KKQA 3K1DA 2XN9B 4Z7WA 4F33B 1MH5B 2AVGA 3VXNA 1NKOA 1WAAF 3ULVL 2VR4A 1NL0H 1CICA 2AABL 2BHZA 4ISVB 2MMXA 4P9ML 1FHGA 3KS0J 2BSTA 1FL6B 2FHFA 1KJVA 1WIOA 2Y9RT 2ORBL 1U8PB 5EPMB 5ID1B 2E6PA 5T3ZE 1ERNA 1T1XB 5FCUH 2XOTA 2F54A 1S9WB 3NCBB 4LAQH 4NWUH 1F4XL 4KKBC 4OKVA 3B83A 4Z95H 4YHYB 3D85B 3FO1A 4R4ND 1XGUB 3OAZK 2ILLA 2OBGA 4HJGA 1UM6L 5IEKB 2D9CA 4EI6B 3QNYA 5LXGL 4RBPH 5DS8B 4A6YB 5ITFA 3ULVE 5KTEL 1DLHA 3BPOB 3KPMA 3D2UA 1LO4L 4G6FD 3T3PF 1K8IA 4IBLT 3H7LA 3O0RL 2VB5A 3T0WA 3TZVA 3TH4T 1A9EA 1MCLA 4OT1L 1TIUA 2P1YA 4MA3A 2R56L 3MLRL 3QFDB 5DEFA 2A77H 2HJLB 4PGZA 2OYPA 3QUML 4R26L 2HT4C 2V2TB 3EW3B 1FLTX 4I4WB 4Q9QL 2D7TL 5DYOB 3DXAA 4U1MA 5CEZL 3MRIA 4ZO6A 2GSIB 2ITCB 1UKTA 3AMLA 1EHLL 5BXFB 5ETUA 4YDIL 1KJ3H 3RA7L 1G6RB 1KPVA 5DJ2A 4RGOL 5IHUH 2VDRH 3VXSD 3U0PB 1CFNB 1TQCC 4RMQA 5IHZB 2CUIA 2O26U 2EDFA 1X5YA 1PZUB 2UV3A 3MOBL 5DURB 1SJVA 3QIUA 1G9MH 1NBVH 1CYGA 2E7HA 1OQXA 3DYPA 1LE5B 1FNGA 2X1WL 4P23C 5CEZE 1P9MA 1A47A 4Y1AD 3DUUA 3TH3T 2DQHL 1NCCL 3NZ8A 4YDKH 5ISZE 5IF0A 3TWCL 4MDJB 1UKSA 4OCRL 5FUCE 1QG3A 4JJHA 1JPST 5IBUB 1N7ML 4LCCC 1OSPL 1IEBB 4XPAL 3H3KA 5D2LF 3L5IA 3VFOA 4LBEB 1NGZB 1LO3L 2VNCA 4LSQL 2VZ3A 3H9SB 4M8VA 2QHLA 3BP5A 1QRND 1XZ0B 1TCRA 4XP9H 1YYMH 5C0FA 2PO6B 3MJ6A 4KJWC 4D9LH 3ARWA 3DIFB 4JPIA 2VR5A 4F7CB 4OD2B 4MZ2A 3JV6A 1Q8MA 3JVGA 2FWOA 3E8UH 5DI8A 3QFJA 2EKSA 2JCCE 2P5EE 2EYTA 4OKDA 3EOTL 4YHPB 2DQEH 4S1DC 3BN9C 3WD5L 4CADB 3MLVH 4BKLB 2I9TB 5I1EH 4U1NB 4D9QD 3V4PL 1KLGB 3KR3L 3MRHA 1CE1H 1S7QA 3QA3B 2AK1H 4J2XA 3TF7C 3AM8C 1I85C 4M7ZB 1PGRB 3P9LB 1AR1C 1ZA6B 2Q1EA 3LS5L 4PGBA 1FO0B 4KQ4L 2QQLH 1ADQL 5CWSB 3OXSB 3P73A 1U3HC 2LU3A 1HKFA 4X9BA 2DJSA 3VRIA 1KPUA 1I7UA 4MD4B 3SGEI 3HE7A 3F12B 1MJ7L 1A6UL 1KPRB 1MREH 4J3VA 5IESH 2ICEA 1AGBA 1VFOA 1FZJA 1SEBB 1NAML 3EOAA 1KN2L 3BP6B 1I3RA 3SGDI 4BQBA 5IMLB 3V0VB 1KTLB 1JGEA 4PY8J 4O00A 2GJZB 1ZVSB 1ZHLA 1QO3A 4PJ5A 1A3QA 4WW2A 5IFJB 1MF2H 5HD8D 2ZOKA 1ZT1B 2A0LC 1IVLA 2NY1B 3MUZ1 3HUJF 5D1ZB 1RUKL 4K3DH 1SVCP 5CJOH 2A6JA 1FNAA 1S9XA 5JUEL 1JHKH 2AXJA 2NY0C 5F9OH 4HWEH 3P11H 1AXIB 2FO4B 1CXKA 1YNTB 3QQ9D 1OB1B 3T2NH 4QRRA 1KIRB 4ZFZB 3BIBX 3IKCA 3EO0B 5KSBB 1DBBH 3E2HB 5TE7L 1N6QH 3D18B 2BNQB 5IFAL 3QCUL 5E8PB 1BX2B 3FCTA 1H8NA 3PDOA 2D03L 2MCPL 2OTUB 5IBTL 2Z0BA 5HYEA 2C1PB 4P0DA 1FL5B 5C09D 3UBXG 2UZIL 1BFOA 3CVHA 4X6FB 1RJZA 1G9NL 2B4CC 3RVUD 2XNAA 5I1CH 4DVBB 3BZ4B 3G5VB 4PJEB 2FYYB 3GHEH 3BKJH 3AREB 3OZ9L 3PL6C 3QSKB 4Y4FD 2NR6D 1T22A 4N0CC 2PTUA 1RZJH 4JDVB 5D7LD 5J89A 5EFIB 4BZ2L 3OKDB 2CMRL 1NCAL 1XF2A 4KROD 1PLGH 4ZXBB 2V7NB 3CFBA 3LKOB 3B2VH 4GAJH 3ARBC 5BZDB 1F3RB 2J8UE 4WFGE 4WUUB 4M3JA 4M43L 1S7WB 2AQ3A 1LWRA 43C9B 3GBLA 3GSNH 5CJXA 2BXZA 1W72A 4NPYB 4HFUH 3OAZH 1YY9C 5EIQA 5GGUA 4FMKA 1QZ1A 4K94C 1NUNB 4JO4L 1BEYL 3DX9A 5GGSA 5ENWA 4EN3B 4OSUH 1A7RL 5F1IA 1WITA 5C07E 4JB9H 2BSSA 3TPUB 3OAYK 2R0LL 1IQDB 5BOZG 1QACA 1ND0A 1FZKB 1QNZH 1VPOH 4NQED 2HJFA 5EC1A 4UAOC 5E1HB 4GKNA 2XFXB 1KELH 1U8QB 5EOCJ 3FOLB 4UTAL 1ZLWK 3QIWD 4MS8C 4PJCB 4TPRH 4M7LH 5D2NC 1TETL 3VXSA 3S37X 2UWEE 5DR5L 3CH1A 1AH1A 3L3GB 1T7ZA 4RFNC 2CXKA 3CZFA 5E2WH 3BO8B 3C87A 1UACL 5FM5M 1AFVL 3LKNA 4Y1AA 4HC1H 3WEXB 4HUUB 1RZIA 5FK9B 2LV4A 4XC1L 4G7VH 1TDQA 5HGAB 3R0NA 1FPTH 3LKRA 4R96A 5IHLB 3CXHK 1QQDA 5ICYA 3ARDB 4YHMH 4QRUA 4CNIA 5F3HA 3DOSA 4WEBL 5JPNA 1MCSA 2R4SL 4NC1E 5ILTL 4N5ED 2XWJB 5B3JE 5KJRL 1QRNA 4ODHL 4PLOB 3MV9E 1JF1A 2EDDA 2CDEA 4L9LC 4JZOB 4NUGH 4P5TD 4PJDE 1HQ4A 3C5JB 1BFTA 1G7LB 5EUOE 2AEWA 4LVNC 3QHTC 4LASL 1KCKA 1T6WA 4NKDA 4NO2B 4Q6IC 4L8SC 4RA0C 2WUCH 1OP3K 3LSOA 5JA9A 1MHEA 4AEHL 2NY6C 3GSWB 4HCRA 4ODXA 1JIBA 1AD0A 3BIKA 5HHOE 4NGHL 4CL7A 3OKEB 1I7TB 2FECI 3RWEA 1I1YB 1ZK9A 1NGXA 3O6FD 4YBQC 1LNUA 3D25A 1KJ2L 5JHDE 4IMKA 1T0MB 2DDQH 4NNYB 4ODUB 3NZHL 3FRUB 4PGCA 5B39G 1EX0A 5DUML 2MTPA 1B4JH 4MNGB 4ALAL 1S78D 3MUJA 3HN3A 4K9EC 3VA6A 5F96L 3GKZA 4GQPH 4OLVL 4DKFH 4P2QB 3B6SB 3IJSB 1UADC 4AH2B 5H37H 3KYMB 4KDVA 3DX6A 1ZMYA 2XKUA 4UILL 3WIIL 1LILA 2IBBA 5DJ0B 4HHAA 1T04B 2ZCKL 3ZT6A 3T1FA 4HX1B 3CJJA 3S35X 5KANG 3TLRA 3HAEH 5F70A 1ZS8A 5I8OL 2IWGA 3TIEA 1YEKH 1RUQH 2F53D