4OCMC

Crystal structure of the rpn8-rpn11 mpn domain heterodimer, crystal form ib
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
VQLQESGGGLVPAGGSLRLSCVDSGRTFSSTVMAWFRQAPGKEREFVATIRWSGGNTYYADSVKGRFTISRDNARNTVYLQMNSLKPEDTAVYYCAGGTYYGTLSYKYDFWGRGTQVTVSSHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 26S proteasome regulatory subunit RPN8
publication title Crystal structure of the proteasomal deubiquitylation module Rpn8-Rpn11.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase, protein binding
total genus 29
structure length 125
sequence length 125
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ocmC00
1A4KB 3LQAL 3EO0A 1PY9A 3EYVB 1ZA3A 3CU1A 3NIGF 4KK9C 5GS0H 3QJFA 1QBLH 3RHWF 5DJYA 1LK3L 2E9JA 4YO0B 2GSGA 1QPPA 4GS7C 1QSEB 2R0WL 1A64A 4HD9A 3MJ7B 1KTLA 1YEHL 4JDZB 1YMHB 1SVZA 5ANME 3N9GL 3PWUB 5GZOD 2CLZB 5TGBB 2XZQH 2DQEH 4TSCH 3CFDB 1NC4D 1YEDB 3G6JB 4Y16B 1KJ2B 5I1AB 4MCYB 4WFEE 3EJJX 5D7SL 5D96C 4KZEH 3BVNB 4HUXB 4F7TB 3QQ3B 3IDXL 4ERSL 4R0LC 4RGOH 2WV3A 4GW4B 4KI5C 4LCUA 4FMKA 1S7UB 4R2GC 3UJJL 1LDPH 3I85A 3T4YA 1LO4L 1E6OL 3MYZA 4UQ3A 3W81A 2W65B 3CXHK 1ED3A 4Y4HC 4P9HC 4PG2A 3R1GL 4AENA 1MJUH 4X4ZA 2ADIB 2EIEA 3MRJA 1PKQE 3PWNB 1RD6A 2XTLA 3MJ9A 3WE6A 2VN4A 1CIUA 1K8DA 1NC2B 1T5XB 3C9NB 1YEKH 4QNPE 2P43B 2VLRE 3SY0A 4YH6A 2IQ9H 4U1IA 1A7OL 1Z0NA 2A0LD 3BJ91 5IB4B 3MRQB 1FVEA 2RCSH 2AEWA 5KSVA 4Y88A 3VFMB 1RPQA 5AAWA 1XF5A 2JCCA 3N06B 5FXCH 4G6ML 4WNQA 2Y9RT 3GB7A 1IAII 4Q9QH 4K3DH 1XGRB 3OKNA 2A9NH 2FX7H 4JAMA 3PP4L 5HY9B 1YYLH 2CPCA 3L3JA 5MI0B 4OUUB 2WK2A 1V7NL 3JWOH 1YEJL 1JNNH 3AVEA 2AKRA 5EZJA 1AQDA 1XGPB 5CP7A 4KUZL 3TA3B 5IFAH 4Y5YA 4J3WA 4YHLH 2CDFB 2D4DA 4LOUC 2VXVL 3QG6B 3HMXH 1FL5A 2IMMA 4WW2C 3ZYJA 4Z77B 4QHMA 4N68A 2YA0A 2Y5TA 5GS2D 3RZCA 4XPGL 4A6YL 3P4NA 1VEMA 3BDYL 1XZ0A 1KNOA 2YUVA 4UIKL 2WWKT 5JXEA 5CEYB 3IETB 4JM4H 3DHMA 5A3IC 2HFEA 2XZZA 4N0CC 3RIAF 1Z5LA 3CSPA 5GS0L 3NA4A 3REWA 1QBLL 1LO0H 3IVKA 3X13B 1RZJC 2I9LA 1BJ1J 5FGSA 2IAMD 5EO9A 5DQJB 2VLKA 3IGAB 2BVEA 3DUSB 2VDOH 3DXAB 5C0GA 1MRFH 3CFCH 3D3VE 4JPIB 1HH6A 5IIEB 1MCRA 3ARED 2FSEA 2DQEL 4LBEB 4TSCL 1HEZA 3VXNA 3QUYB 4X6DA 5EH1A 3UTTB 4L8DA 4X6BB 4GRWF 4OCXH 1CXKA 4KZEL 3FAWA 5EU6D 5TQ0H 4WFFE 4L3EE 1XF2A 3RHWK 1W8NA 1KGCD 1EO8H 3JXAA 1I1FB 1VGEL 1B9ZA 2NNAB 4LU5H 1N6UA 1LDPL 5C7XH 1JN6A 3MROA 4LPUA 4M9PA 5FKPB 4YHIA 2R1XB 4QXTA 1F4YH 4JANA 3K74B 5FECB 4Y19E 3SKOB 3NVQA 5FK9A 4NSKB 3RZCC 2W9EH 5DC0A 4TN9A 3MFFA 4P57A 2VQUA 1F2XK 4XGZB 3EDKA 4XNMA 4H8WH 1R5VB 3GI8H 4P23D 5EBLB 1YEKL 4BFIB 4GW1A 3B5TA 2MPAL 3O41A 4NKOA 2QADC 2IQ9L 1AXSB 5D2NE 3LQMA 3U2SB 1SQ2N 3PE9A 4HBCH 4LPTA 4LVHB 4IRJA 3N1PC 1XGTA 3IJHB 3NN8B 3GSUB 4X9FA 2RCSL 1T1XB 3CDYA 4XNQB 1OY3B 3G04A 2UY6A 1FFNA 5B3JE 2V9QA 3W5NA 1CDUA 2J88H 4FQJH 4P4KA 1K5NB 3ARGC 1A1NB 4K3DL 4XAWH 2A9NL 2FX7L 5E94B 5AD0A 1EPFA 2CIIB 5HHPB 4KJQC 3JWOL 1R3KA 2P5EE 3BGFB 1BPVA 4ORZC 5CS7A 5ESVA 5C6TH 1UM4H 5I1HH 5DJ6A 3K4ZA 2HTKC 2I25N 4I5BB 4LHUD 3L5IA 5IFAL 3HKFA 2N1KA 4P2QE 1CN4A 1H5BA 3GO1H 1B0RB 3TH3T 5BV7C 3HMXL 3QI9B 4DOHE 4XHQA 3RVTD 1KC5H 3NFNB 5HGBB 3CFBB 4YDLC 1DCLA 2FO4B 1KEMH 3OPZL 4LVNC 4E5XB 3BW9A 2BJMH 5ABDE 2ICWI 3SO3C 2XT1B 5KOVC 4NRZB 2FECI 4JM4L 2G60H 2SEBA 1OGTB 1HNFA 2AJVH 2I60H 5F70A 4HLZG 2L4OA 4XNYH 4P46D 2HT3C 4RAVB 3X3FL 3MNVA 4RWYH 3DGGB 1H3PH 2CLVA 2XNAA 5DK3A 3VXMA 1LO0L 4OZIF 3OXSA 2VJXA 2NY3D 4P4RB 1JNJA 3U48A 2J6EA 4Y7MA 1FAKT 4LRIA 3SE3C 5HVHC 3BP7A 2VDOL 1XR8A 3MNZA 3P0VL 3MMEB 3QO0A 3CFCL 3E6FA 1S9WB 5EIQA 3K2UL 3O6MH 2GTZB 4MS8D 1KPUB 1TPXC 1L9MA 1JNLL 2R0LH 4PJIF 2ZSWA 4KI5E 4OCXL 1XCQB 2APVA 5LBSH 1I1YA 1SYVB 3RGVC 3VGDA 1AGFA 5TQ0L 1IVLA 1SVCP 3GSVB 4XB7A 4OFPA 4BQBA 5B39A 3RY6A 3OTTA 4WI8A 2BNQE 4M8VA 3JWNC 1EO8L 1DN0A 3RFZC 1T2JA 2Y25A 4HUUB 1HHJA 4K23H 4LU5L 4N0FA 3J8F7 4JQVC 4XXCA 4XWOD 3RVUC 5JW4M 5IVXF 5C7XL 4RDQF 3VFOB 3VRJB 3RX8A 2Z8WC 3GBNH 5GRJL 1CLCA 1YY9C 4I3GA 4Y5VB 1XEDA 1F4YL 2IQAA 3WIHH 5CGYC 3AS1A 4JCMA 1RK1B 2P46B 1CXFA 2W9EL 5DFVD 4GRWH 3OAYH 4HUWB 3OAYK 5I16A 3MODH 4H8WL 4NJ9H 3GHEH 3GI8L 2UZXB 5DTFA 3IAGC 3PWLB 2NY4C 4HBCL 1WCQA 3CU7A 1HHGA 1MJ7L 2NY5H 4HZLB 4PGEB 4AH2A 4ZQKA 4ELKB 4JFXB 2AEIT 3IXAA 5TFSL 1HIML 5GPRA 3FB7A 3QXDB 1CIDA 4LPXA 1T6VN 2J88L 4LQFH 4FQJL 4LGPB 4KJWC 4J4PA 4XAWL 1DSFH 4BJLA 2HRPH 3OJDB 3EHBC 5I73B 2JJVA 1ZKAA 3GEWB 1B0GA 2VIRB 4M5YH 3QPQD 5C6TL 1DQDL 1UM4L 5I1HL 5J56B 1ODAA 3QUZC 5EIIB 4Z7OE 3MACH 4HWZA 2Y5EA 3SOBH 2X4TA 3GO1L 5FDWA 3O2DH 2V2TA 1UXSB 3RL1A 2C1PB 3RWDB 1FZMB 3WNPA 4TUJA 2ZKHH 4KROC 1KEML 1Z9LA 4XXCC 5DK2A 1XR9A 1FO0H 2Q76A 2RFXA 3TBWB 4K8RH 3LN4A 1HXMA 1D5XA 1ZWIA 2G60L 4G42B 1S5IH 2X4PB 5J6HB 5I1DB 5JPMB 4YXHH 1C12A 4XNYL 4XX1E 4WUUA 3S5LB 5ISZB 3GRWH 2LVEA 3VD7A 1GCFA 4FG6C 3VRLF 4GG6A 1H3PL 1B2WL 1OM3H 1CT8A 2JB5H 2UUDK 4ELMB 5HVFB 3NPSC 4KQ3H 4P2RB 2J2ZA 2GJ6A 3HG1D 3P77A 1M7IB 4LHQB 1RJZA 4YHYB 3BSZH 3JBG7 1G84A 4WI5A 3ECBA 5EO0B 3VFWB 2JCCE 3LKRB 3O4OB 1EHNA 3SDDA 3U30B 2NXZD 3TYFB 5ERWB 3MJ8B 2OZ4H 4P5TB 3QNXA 5TDNB 2R0LL 3AM8C 1UKTA 5LBSL 3MRHA 4UILH 4MXWH 4YHNA 1H8SA 1H3WM 4PJHA 3K8KA 3MNWA 5F88B 1TZGH 3PWPD 1YY8B 1AC0A 5D1ZC 4NGHH 4GUPB 4F7PA 5D1XC 3IU3A 5CGMA 4K23L 3FJTA 4LLUA 5BXFB 3CC5B 1QLFB 1NFIB 5DEFA 5TJWK 4Y4FD 1BWMA 3SGEI 1JL8A 3QZWB 2A77H 5IJVA 5BMFH 1SYSB 1DBAL 5E9DD 5D1QC 3UTPE 1MFNA 2ZG2A 3GBNL 3KYAA 3MLZH 4I77H 1MSPA 4DKAA 3WIHL 3MUJA 3B9EA 1UB5A 2DM7A 1BZ9B 1A22B 3FMGL 3SGJA 4EUPB 4P5MB 2ESVB 2KBGA 3MODL 1KCSH 4G8IB 4NJ9L 2E7HA 3GHEL 4HAGA 2E27L 5I15L 4PJEA 1MVFA 4JFED 4L29A 3RL2A 3MV8B 2C26A 1NAKL 3QCUH 1CICD 2R4RL 1JPFB 1G9EA 4XP9L 2J8OA 5HI5C 3MGOA 1IAIH 3RJQB 2NY5L 2VLKE 2XPGB 1OWWA 4ZFZA 2I07B 1QQDA 1JPTH 4X4XA 1SM3H 1A6WH 3UC0L 1KBGH 4F3FA 2P8LB 4N9GB 4X6DE 2NMSA 4LQFL 4JLRA 2OBGA 1DSFL 4N90E 1RZKC 2HRPL 4M7LH 5LWYH 2QKIB 4JRYE 5D7JA 4TTGA 4M5YL 3SN6N 3SE4C 5C0FB 4O2CA 4PRNA 2M2DA 2EDKA 3VMPA 5FOBA 1BLNB 1G7JA 3SOBL 3TCLA 2EYTB 3O2DL 3WDJA 4ODSH 5F3BB 1QO3B 4CNIA 2ICWJ 1MAJA 4HKXA 1NUFA 1YPZF 3U46A 4NC0B 2ZKHL 4XBEH 4APQD 5E00B 4CN1A 1FO0L 1CLOH 2ADGA 4URTB 3RGHA 1IL1B 1T89C 4S0TD 1YNTA 3RQ3A 5HD8D 1S5IL 3C6LC 3RY4A 1U6AH 1CYGA 4X5XA 2AS5M 1AD0A 3LPGA 2D31A 3GRWL 1AGEB 4KKNA 3QUML 2X9XA 2JB6B 2NY1B 2PW2A 5IHUH 4FFWC 2JB5L 4F2MA 4KQ3L 2UWEB 4GXUM 4H26A 4OGXH 3BSZL 3QULB 3TO4D 1QBAA 2NLJA 2EXYD 3T08A 1FCGA 4K3JH 8CGTA 2EZ0C 2OZ4L 2B0SH 4MQ7A 5C0CD 1ZHNB 5E0QA 4MXWL 2E7BA 1JPSL 2UZIH 3FO1A 5ETUB 1PKOA 5HHMD 3RBSA 4MNQE 1HHIA 4WJ5A 1TZGL 4TUOB 1NUGA 3G6JF 4NGHL 5DD0H 2Q87A 2PCPA 2JK5A 2CMRH 3G5YB 5GISH 5F97E 5IB1B 2IBGA 2OL3H 3CSBA 1S9YB 4EDXB 2A77L 2R1WB 3RKDC 5C0IB 2K7PA 4I77L 1EXUB 5D7IA 2WWMC 4YGAB 5FV1L 3ARDA 2IPUG 3L9RA 5DK0B 3MR9B 4L8BA 3ELAT 4DWHA 3LRSA 3JV6B 2PO6D 1KCSL 1Q9KA 5JA9A 3PQYB 2DLHA 5FGRA 1J05B 1OTSD 5IROC 3VXME 1FNEB 1IGYA 3QCUL 3ZMRA 2A6DB 5DJ2B 2BRQA 1LK2B 3DSFH 1PGRB 4Z78A 2E8YA 3I3EA 4J8RB 1IAIL 3H9SA 3QEUB 3IRZA 2NY0C 3VG9B 5DD6B 1F00I 3BN9D 1T5WB 4MAYB 1SM3L 1N4XH 1A6WL 4AL8H 1KBGL 3LS4L 4DW2H 2GI7A 4BSVA 3EYUH 5J12B 5I8EB 2V2WA 3DRQB 3FZUD 4JN2B 3F6IA 4R90H 4M7LL 5IWLC 4MQTB 1S9XB 5LWYL 3IKCA 4A2LA 2NZIA 2DQFB 4JO4H 3BEWA 3L3OB 1NCDH 4HPYH 4R4BB 5MENA 1LEKB 3MRCB 1I8IB 2AK4D 1I9RH 1FC2D 3QUMB 3MV7B 1KTKE 1AP2A 4U2YA 3W11C 1NKOA 3GIZL 2CLRB 1I7TA 2FJGA 4ODSL 4MLSA 5DMKB 1EO7A 4R3SA 4MD0B 3TFKC 32C2B 4NUGH 5JIHA 1VACB 4PV8B 5C08A 4XBEL 3CVHA 4PJBB 4QTHA 1T20A 2MSPA 1IM3A 1CLOL 3K2MC 4U1JB 1A6ZA 2FJFB 4KK5C 1CDGA 5JHDB 2AV1B 2RGSA 1AXTH 3MQIA 2NTFB 4XCYB 4RA0C 1WTGT 5SWZB 5CBAB 2OK0H 1SEBB 5C0AD 1BIIA 3RTQB 2H3NA 3E3QC 1CQYA 1KPRB 3WNMA 5EBWB 1FYTD 4JDVB 2IH1A 5GGSB 2ZUUA 5CZVH 4Q9CA 1ETZA 1F11B 1IKNC 4AIZA 4HX1A 4WV1B 1CGWA 2EEAA 3OHXB 1OAUH 4Z7OF 2B0SL 1UJ3B 2LE9A 3DETD 1ZA6A 1S7XB 4MGXA 3UAJC 2HT2D 3MZGB 5DXWA 1PEWA 1AHWA 2UZIL 4HDIA 1U8NB 3OR6B 3ROOB 2DJ4A 1K4DA 5T33H 4NBXB 4M7KH 3ULVE 1NMAL 5DD0L 4QYOA 1BEYH 2GFBB 3OF6D 1P4BH 2CMRL 3BRDA 4WHYH 3AMKA 3MLYH 5GISL 1PAMA 2OL3L 2OJEA 3L5WB 4PV9B 1RIUH 4X7TA 2BY2A 3MRLA 4L4VE 4ZOCA 2Z93A 2E9BA 2H1PL 4AEFA 1DEEA 4NKMA 3IFOA 4HFWB 2YUZA 1X5AA 5F6IC 3T2PA 4NNXB 4UBDD 5CLWA 2VABA 4WUUE 5IB2A 2GIYA 3UZEA 3MLXH 4WWKA 2C4XA 2JCCF 5DDHB 5KW9H 5JW4R 1DE4B 3DSFL 4P2OD 4EN3C 3M1BB 3BKML 2J1KA 3LKOB 4H1LA 3RIFK 4F33B 5C0DB 4CMHC 3C8DA 3MO1A 5IMMA 2F5AH 1XAUA 4DW2L 2NW3A 3WNKA 3EYUL 3WLBB 4JHAH 1UH4A 5EUOB 3BWAA 3D87B 4R90L 3SHSA 3EO1A 2XG4A 5IMKA 4JO4L 1YDPB 3HNVH 3TN0D 4RIRA 4JN1H 1NCDL 4HPYL 3MBEA 4HMDA 1JMZA 2O5XH 4U3HA 1G9MH 4I48B 4YBLC 1I9RL 1IE5A 2X6MA 2JE8A 3VE0A 4CJ1A 3W2DH 3QEGL 5EZIL 4HS6B 4GRLD 3RRQA 3JUZA 4LEOA 5ITFA 1FH5H 2COQA 4OM1H 2FECL 3UJIH 1R3JA 3C60A 3W0WB 3UP1A 4FQIH 1HHHB 1Q0YH 4NUGL 1BQHG 2OP4H 3WUZA 1S7WA 3WS3B 5L2JA 1R6VA 2EC9U 1WQVT 4L4TD 4NQCA 4LLDA 4G9FB 5IBUB 5DRXB 3QQ9D 1N3NA 4LVOC 4JPKH 3BRFA 4PGDB 1AXTL 4MJ2A 2IFGA 1ZT1A 4PJEE 4HUMB 5E1AB 4ODBD 1P5VA 1U8HA 3F8UB 3FFCD 5ESQA 4ORGB 2HTLD 2OK0L 5FA3A 2C3VA 4OZGA 1BM3L 5IP4A 5ESAB 3MRKA 2F53A 2XWJB 5CZKA 3VWJD 2GTWA 2L0DA 3ULUD 1MJ8H 3A67H 3PV6B 2Z31D 2DB8A 4JHBA 4Q6IA 5KG9B 3BOVA 1MFAH 3LQZA 1PG7H 4FXLA 4ZUSA 5CZVL 3O6FB 2PN5A 4H0GA 2D7NA 1R24A 3LV3B 1OAUL 4CDGC 3ZSSA 1J8HA 1MREL 3D0VA 1IGTA 5HDLA 5GZOC 3CSYA 1R5IA 4ZNEA 3BP6B 1FVCA 3LD8B 1A9EB 3RNKB 2ATKA 3F12B 3SGEH 3P4OA 1KEGH 4RQQA 4ENED 3O4LB 5T33L 3E6HB 3EJYD 1T21B 5EULV 3L3GA 4KRMB 4WO4B 4M7KL 5F7DA 5T1DH 1JCKA 1BEYL 4HEME 1P4BL 2WWKO 2IANB 3OL2A 3MLYL 1T0NA 5DWUH 2HWZH 3BISA 1M05B 4CADB 4JFFE 5T1KB 3DUUB 1NGZB 3IDMA 5DF0A 5DJXB 3VCLB 4M03A 4G7YH 4PJ5D 4S1RH 3CUPA 5GS0D 3O3DA 3IAQA 3VFNA 4EI6B 5CEXA 1B88A 3MLXL 4UDUA 4RX4A 4RMSA 1FL6A 3THML 1A21A 5KW9L 5SV3A 2DIAA 1KG0A 1JGEB 3S96B 3HZYB 3JV0A 4ZPVB 3MJ9H 2BNRD 4I13B 4K94C 3ARTA 5J1AB 4JFDB 3MOBH 2A0LC 2YD3A 3OR7A 2P45B 4JHAL 4ODUA 1A4JB 4HWBA 3VH8A 43C9A 2ITCA 4DKEH 1U8LA 3MRIA 5EC1A 4JPVH 3HNVL 4JY6A 4JN1L 2V5SA 5I0ZA 3QO1A 2O5XL 2B2XH 3TGXA 3B6SB 3TO2B 4NYLB 4EZMA 4PJDA 1YC8A 5F72S 1G9ML 2D9CA 1HINL 1NFDA 3U82B 4PJ8D 1OAZH 3IFPB 4HIIA 4ZO6A 1J0IA 4MSWA 4JE4B 1FH5L 2HP4A 4I0PD 3UJIL 3V5HB 3T65B 4WWID 4FQIL 1Q0YL 3OG4B 1U93A 3TBYB 2OP4L 5IR1A 2F74B 3V6ZB 1MUJB 5D7IE 1D3CA 1C5DB 5JMRA 3HE6A 4XMLH 5H94B 3DROA 4ZFOB 5C07B 3FFDA 4EI5B 5IM7B 4JPKL 2HVJA 2UYLB 3GMLA 3U4BH 1ORQA 4LNRA 3E3QE 5DSCB 3CD4A 2UVFA 3PJSA 1JK8A 2FB4H 4JQIH 3ALWA 3H9SE 3I6LE 3QEQD 1U9KA 2H9GB 3HB3D 1MJ8L 4MJIA 5D93B 2BVUA 2VISA 4MDIA 1MFAL 1EHXA 2IAMC 3FQTA 4PLJD 4OGZA 3VI3F 5TH2A 5B8CB 5DHVA 1AQKH 5ACMA 3QAZB 3VFRA 5CBEA 1RUAH 3FB8A 3IXTA 3DV4B 5IFJA 2CKBL 1TTGA 3UYOD 3AREC 4GW5A 4PRAA 4JM2B 5MENE 1SBBA 1KEGL 4JQXA 5MEOA 5J6GA 3EOBA 1A2YB 3PGFL 5IK3A 4RMRA 4LLMB 1EFXD 2ATPA 4Q9RH 5T5NF 4ALAH 3B9AA 2PUQT 1HSBA 3BH8B 5DWUL 2HWZL 1DLHA 2FGZA 5C08E 5BRZD 1RUPL 1G7LB 3O6KL 1FDLH 1CXLA 4GS7B 5TPWH 5JZ7D 1G7PA 1U58B 4HHAB 1I1RA 3SGKA 4AT6B 4G7YL 2ZOLA 4S1RL 1AKJD 1P4LB 1NGXB 3DVNB 3VFTB 3QUKB 1HKLH 3HLAA 2D7QA 3LCYA 1FZKA 3OZ9L 4XT1C 5E6IA 1KCRH 4GMSL 4HIHA 4OGAD 2FIKA 3U83A 1W72B 1QSVA 5DRWB 4P23C 5KANG 4QGTA 2F5BH 2I24N 5EO1A 5D96B 2OJZL 3KYNB 3EYOB 2RBLA 4LAJH 1IEAB 1OPGH 3MRDA 2R2EA 4M61B 3TLRA 1VFBB 2WBWB 3BGMB 1JTOA 3V7MA 4EJ1C 3R0NA 4KU1A 3MOBL 1XF1A 2KH2B 1X5JA 1VB9A 4GQ9H 2HFGL 4R2GB 3LN5B 1CE6A 3CSGA 4X6FB 3VJ6B 5E95B 1Y6KR 1MCSA 1P84K 2PYED 2JIXB 4KDTA 4DVBB 3S5LG 1CTOA 3ULVF 4JPVL 4X9IA 2DWEA 4GBXD 3BPOB 1OHQA 1JTPA 2QSCH 2HLAB 1K6QH 4DZ8A 4PJ9D 4EEEA 3PDOB 4M7LT 1OAZL 4CVZB 3ZTNL 1I7UB 1KN4H 3ARBA 3DURB 3V4UH 5KAQF 2JLLA 1MEXH 3GMPB 1M71A 4JQXC 1HDMA 4U7SA 1BD2B 4OFKA 3WJLC 1QTYT 2A74B 1BX2B 1MI5B 3PDDA 3RVTC 5IV2A 1KACB 5F7WC 1ZLVK 1KF9B 2IPTH 4ZSOA 4GG6F 3VMNA 4XMLL 1KFAH 4JFQB 4U6VH 5ITBH 2CKBB 6FABH 1P1ZA 1IGFH 2AV7A 2BP3A 1UYWH 3TBSB 3S88H 3V0WH 1E4WH 1ZT7B 2VE6A 3HC0A 4HIEB 3PHQA 4MD4B 3SGKC 3SE8L 4LCCB 2P24B 2FB4L 2Y7QB 4YXLL 4P46C 1II4E 4JQIL 4I18A 3V0VA 3SDCB 2H2PD 2W60B 3QZWG 1TJIH 1AE6H 1Q1JH 4NRXB 2JJTA 4UI2A 2NY3C 2YSSA 4XC3H 2VMFA 5CJXA 4PRHD 3VXUB 4ODTH 2BFVL 4PJHF 3UROR 1WV7T 4MCZB 4WW2B 1RUAL 5FGBA 4EUPG 2OXHA 2F54B 2UWEF 1BGXH 3BGAA 4YE4H 3U4EA 2YMXH 4MS8C 5HDQH 2J6EH 1WZKA 4QF1B 1S7QA 2FL5B 4NQTA 3FB5B 1GZQB 4HXAH 1Z9OA 4ALAL 2WBKA 3QEHA 3NCYP 3GGWA 1UQSA 4NFCA 1MCCA 5F7LB 2ZP0T 4MQXD 4OFVA 1WGOA 2HMID 1D5BA 2IADA 4XWOC 3GSXA 1ZVSA 1KENH 5BV7L 4PJEF 5HHOA 5C6WH 3RPIB 3SY0B 1FDLL 4KJYB 4NQCE 4ZYKB 1Q94A 1QEWB 1EJ6A 4TNVK 1FAIH 1EEZA 3D2UA 5D2LA 3OKOA 3KNBB 1NUDA 1QA9B 1HKLL 4N1HB 3WN5C 1KCRL 2CGRH 5DFVC 4LPCA 3ME0A 3V7AG 4OZGE 3SDYH 1G6VK 2F53E 3WUWG 5CHNB 3U6RB 4UDTB 1SHMA 1MRCH 3WEXB 4NKIL 4EXKA 5EU3A 1KV3A 1OPGL 4RISH 1IMHC 1WZ1H 5F3HA 3WV0A 4BM7A 4GOSA 5E8NB 1HWHB 4GQ9L 3O9WA 1BQUA 1J8HE 1NGPH 2CIKB 3ZDYE 2A6JB 4K3GA 1N7ML 1F4HA 3C8KA 1FG2B 1X6NA 4ZNEE 2ENSA 4G8GB 1Q72H 3DO7B 4BZ2H 3DI3B 4FFVD 3WNNA 1IARB 4OUOA 1GZPA 1K6QL 3QPQC 2C9AA 2FD6H 4XP1H 1F3JB 2XA8H 2BSRB 1T4KA 1KN4L 3V4UL 1UXWA 1MEXL 4OLWH 2ARJB 1A14H 2QADB 1S9VA 2XKNB 3IDGA 3RWJA 3QIBA 3UTSA 5IHZA 4BK5A 2IPTL 4JVUA 4KTEH 2YBRA 4QO1A 1KFAL 4U6VL 5ITBL 4NKQB 2F8VA 3HFMH 6FABL 1IGFL 1PQZB 4U0QB 3ULVH 2I9LB 3IFNL 3S88L 4O4YH 3MOQA 5GGVY 2AEQL 3V0WL 3I6KB 3ARGB 4L9DA 4X7CC 1BFVH 4OQ1A 4CW1B 1U8MB 5HYSG 1CFNB 1G7MA 1KN2H 1IJ9A 1D9KD 4AEIH 1AE6L 1Q1JL 4WTZA 3QDJD 5GGSY 3JVGC 4XC3L 5HPOA 3B9KB 1NDMA 4DKDC 4JRYB 1FFPA 4ODTL 5BV7B 3Q0HA 4TUKH 3U0WL 2X42A 3CFJA 2VDMH 2FYYB 2C4FT 2O5YH 3KXFB 1BGXL 3QDGA 4YE4L 3SKNB 4YDLB 5EU6E 2NXZC 2YMXL 2EKSA 2HJLA 2J6EL 5FKAA 4LVNB 3O9WC 3HPJB 1F6AA 4L9LA 2DM4A 1ZHBB 4PJDE 1UA6L 4LEXL 3SCMA 2HKFH 3SO3B 1NFDE 2VXTH 4DAGH 1TITA 4L3CB 5ID1A 4HXAL 5EC2B 4EKXA 3TESA 4FZ8H 3KS0J 5F7HA 4NNYB 3NGBC 1I3GH 4WI6A 3L6FB 1JF6A 1DEDA 1BMGA 1JF1B 1WVZA 3GNMH 4W4OA 2PTUA 2V5TA 1KENL 3S35H 4Y4FC 2FWOA 1XGYH 2X4SB 3AY4A 2YD6A 4K8RD 4C56A 1N0XH 3HUJA 3QUXD 2YD4A 2G9HB 2YD7A 1S7VB 4FTVB 5HVHB 4MZ3A 5I1LB 4OZ4B 1YEEH 1OB1A 4G8FA 5L0QC 1JHLH 3LMJH 4MMXC 4C83B 5JXAH 1E6JH 3GSNL 2CGRL 4KWUA 3WFHA 5LAXB 1F8TL 4NJAH 4XCFH 4XC1L 2DF3A 3ZL4L 1TPXB 1QLRA 3FHAA 3K3QA 3SDYL 2DYPA 1JWUA 1YC7A 2GKIA 2F15A 3SJVD 3RGVB 1QBBA 1MRCL 4MJIE 4PREB 4LNVA 2OYPA 1AIFA 1INEH 1CICC 1S78D 4RISL 5LGHH 4UUJA 3SDAA 4ZDHA 4LP5A 1H15B 1FZOB 3ZDZF 2ENYA 4YFEA 5ESVB 2FLBT 5DRNB 2W0FB 2QJDA 4MNQB 4Z7UB 3WSQH 2YPLB 1W0WB 3V4PH 4G8EA 4BZ2L 4J1UA 3SEPA 2C4FU 3D25A 2DMCA 3K1DA 4NFDA 4R9HA 1YYML 4U6XA 4ZUUB 5DJZB 5EUOF 3TBVA 2E7LA 1QHOA 2DIJA 4MJ6B 1RUQH 4XP1L 2XA8L 1JVKA 4X6EA 2EH7H 3SCMC 3E2HC 5HYJA 2MHAB 1A14L 3T2NH 4S11A 3BPCA 1QSZA 4MNHB 5EOCJ 2XTJE 2NY4B 2Q7NA 2ZUWA 2ED8A 1X4XA 3LSOA 4M4RA 4NFBA 3DLQR 3VXOA 4KTEL 1EIBA 5IQ7H 3D6GA 4APQC 4W4OC 3HI6H 3EYFA 5KTEH 5DD1H 5EUKB 5E99L 3ULVL 3CFKB 4IRSD 1ZHKB 4R7DA 4YJZL 4O4YL 3T77B 4UNTA 1NH6A 3B2VL 5HD8C 1AD9B 2YA1A 3BP7B 1BFVL 3DV6B 4XXDB 3P73A 4G43A 3T2OA 3MA9H 3C6SB 4YZFE 1KN2L 4HT1H 5GGRB 2F19H 2YC1A 4AEIL 2VQ1B 4Q9BA 3QUZB 2AJZB 3D39A 4QY8A 1MLCA 1MVUA 4YNYB 1WBZB 3NMEA 1MCWM 4KUCF 4TUKL 4DVRH 3TO4C 4NO3B 2OCFD 2VDML 4AK1A 4AMKH 2O5YL 2EXYC 3EOAA 1HZHH 1R3HA 4Y89A 2XXCB 1BZ7B 5FO7B 1HHJB 1GVIA 4KROB 3GSNB 2R2HB 3FQXA 4M93B 2HKFL 1KJVA 4DGYH 2P8PA 3VD4A 4S0SD 1A0QH 5BS0A 4NM8H 4B0MM 2R29H 5FYLE 3KS0H 1XF4B 2VXTL 4DAGL 4H5SA 5BZWA 1DTUA 4OBSA 5AWNH 1D6VH 2HAZA 4XAKD 4FZ8L 3D5OF 4ZO7A 3CZJA 2DQCH 4U1MA 3UPRB 3M17A 1GOHA 4GAFB 3GNML 3NPSB 4ZSOE 1XGYL 1CU4H 2ADJA 2WSKA 2YPKB 1AO7A 3L5HA 3V5KB 4X80H 5GGQH 3LMJL 1OGAA 5JXAL 3ARWA 2K9UA 5JO5A 4NN7C 1J1XH 1MHHB 3SKUD 4XCFL 5ID0B 4MYWB 4OI9A 2E6PA 5MEQB 2PO6C 2Y36H 3DMMD 2I26N 1OTSC 4DEPC 1HILA 5T1MA 1WIPA 4ODVH 1NDGB 3FQNA 3RWFA 3ARFD 4ONOA 1QNZH 4KMTH 4BH7B 1INEL 2WLYA 1GOGA 4PRIA 4RAHA 3C5JB 4LLYB 2VLRD 4Y2DD 5D1ZB 3HE7A 1AJ7H 1U8QB 5D1XB 3WXVH 2NY6D 3BN9C 5DUPL 1QSFB 1IM9D 3L7EA 5TE6L 4NZUH 3WSQL 3LKNB 3MCLH 2YOCA 5JDSB 3FZUC 5D1QB 2X4TB 5TDPB 1Z6JT 3V4PL 4F7EA 4O2EB 3VDBA 1MAMH 3GMQB 3ZKQD 5CLTA 4X4YA 1YMMA 4Y8AA 3UMTA 3QWOA 3OF6A 4XCEA 1RUQL 4FZEH 4L4VB 5H8DA 1U3HA 5EOCH 2EH7L 5D6CA 4U1KA 2DI7A 3ZZ1A 1VFMA 3OJVC 3T2NL 2W07A 4LLWB 4RRPG 4ZO8A 4XP4H 5DI8B 5J7CC 4PG9B 4KPHL 1ZS8B 3O11B 1J7VR 3CNKA 5HHOE 5JHLH 2DMBA 4Y4KA 1IEBA 1GAFH 1QKZH 3VWKA 5IQ7L 2ILLA 1VADA 4OZGF 4F7MB 1OW0C 3HI6L 3OB8A 3RVWD 5KTEL 5DD1L 4NQVA 4UT7H 3FO0H 1NFKA 3O3UN 5A16B 1RJZB 2EIZA 1CGYA 1K4CB 3MA9L 3CVHH 1FPTH 4HT1L 1ZSDA 3QXWA 5EZOH 2IC2A 1P7QA 3ZDYF 3HRZB 4U1LB 4PGCB 3GKZA 4KDVA 1X4ZA 4QOKB 1G6RA 3QFJB 5LGKA 4DVRL 3FOMB 1LEIB 4AMKL 3VGHA 3RWIA 2R69H 4QRRA 1HZHL 4M6MH 3G5XB 2BY3A 4LSVH 3WKMH 2X70B 4GAJH 1FNLA 1HNGA 3DETC 5DJAA 5F7YC 3D3VD 2BMKB 4DGYL 2HT2C 3LH2H 3LKSA 4NM8L 4CAGA 2R29L 4CBPA 1I7RA 3BX7C 3D69A 5ICYB 3C6LB 5AZ2H 2AEPL 1BQLH 5AWNL 1D6VL 5I76B 1DZBA 4LCWB 2YR3A 5E2JA 5GIRB 5AG8A 4JM2F 2DQCL 5FDYA 1RZ7H 3F7YA 4LAQH 4K55A 2VTFA 1F4AA 3P9LA 3LS5H 2VL4A 4WFFD 3RNQB 3QNZA 5DVMA 3UTSE 4L3ED 4PP2B 4AM0B 5KZCB 5DJCB 3O8XD 1CU4L 3B3IA 1PW3A 2GUOB 5DQ9A 3CH1B 1CD1B 4X80L 4D0BA 1ZAGA 5LXGH 5HI4D 4OZHB 4HKBB 3VWKC 5I19H 5B21A 1HE7A 1TJGH 2JF1A 4ZFZB 1J1XL 1P9MC 4UBDC 5IKCB 4HWNA 5I2IB 4Y19D 5TF0A 4W70A 3OMZA 5HGGS 1U2CA 4ODVL 5CWSA 12E8H 4AIOA 4CN4A 1QNZL 1OCWH 3D18B 3GJFB 4XPAH 5AAMA 1NAMB 1FIGH 1RVFH 5KVEH 4ODWB 4P2OC 4M4PA 1A7NH 4JZJB 2RQ8A 4FQXA 1AJ7L 3G5ZA 4JJ5A 4NQDA 4YDVB 3WXVL 2VLJA 4PJDF 4ONHB 2OSLB 1UKSA 1CI5A 1NFDF 1UENA 3QDGE 2Y07H 3MCLL 1JE6A 1AFVH 1B6DA 4NO0B 3G6AB 1OWRM 3DX6A 5JW4Q 4H1LH 2QBWA 1MAML 3T0XA 2X4QB 3LZFH 2CUHA 3KPSB 3TN0C 2YS4A 4JFFB 3SDXB 5D7LA 4FZEL 5IW3A 4F9PC 3CPLB 4WHYG 1QFUH 3KLAB 1R0AH 4WU7B 2F8XC 1OF2A 1NEZG 1RZFH 5E4EC 4HS3B 2P5ED 1EH9A 2VWEE 4GRLC 2BSSA 4XP4L 2XRAH 2WIIB 3GSRB 1G7QA 8FABB 4C56E 1AD0B 5JHLL 3DTXA 2D31B 3HUJE 1QRND 3HTLX 1MHEA 1QKZL 2WZPD 5EDXA 2NQCA 2QQKH 4P2QD 2NY0B 4DCQB 4G3YH 3RI5K 2H32B 2PW2B 1NKRA 1MCFA 2VR4A 1I9JH 2JJSC 2DWDB 4UT7L 2VZOA 3QQ9C 1WEJH 3K80A 3KPPB 1YUHA 4F58L 4ONFH 1J11A 1FVDB 3CVHL 2PYFB 3ET9F 3DVGA 4LASL 5EZOL 3VXRB 2HTLC 1A5FH 2IH3B 2FNBA 2CUIA 4MQ7B 3FT2B 4NZRL 4WEMB 1FE8H 3ULUC 4YDIH 3L5JA 2ICEA 3MCKA 4OZFB 4TRPH 1PBYA 2GCYB 2X4NA 4TSBH 4XPHL 4FQXC 4M6ML 4R7NA 1ZGLB 3WKML 2R0KH 2ZCHH 1IT9H 1FG9C 4HK0A 1IILE 2J8UB 1HI6B 4DQOH 1ORSB 3NFPB 4YQXH 2PR4H 3MRPB 3LH2L 4WW2F 1HQ4A 5DD5H 3REVA 4M7JH 3WLWD 4TSAH 4KK6C 5AZ2L 4ENEC 3QDMB 2EYSB 1BQLL 2HRLA 5HYJE 5I1GH 4POZD 3EJYC 1MJJB 5E8OB 1RZ7L 3RWCB 4LAQL 5EG6C 1U8KA 2NY7H 3LS5L 2V2XA 5IBLD 5F1NA 2JJWA 5CD3B 2OR9H 1UZ8A 2BNQD 2ZSVA 3T3ME 4P59H 4Y4HD 5FO8B 3MRFA 4R6UA 5DGRA 5D7KD 4YZFF 4XPFH 2C3HA 3HAEA 4KMQA 5LXGL 5J13C 1OAYH 5I19L 4XBPB 1TJGL 4QXGL 4Q97A 5GS0C 3ZKXC 1LE9A 12E8L 1MLBA 3KPLB 1WK0A 4ESKA 1OCWL 4YIQB 3D39E 4XZUB 4MWFB 4XPAL 1RVFL 3KDMA 1DANU 5KVEL 3CFEA 3MLTA 1TJHH 4BUHA 4MD5A 1FRGH 1NGWB 5D6DA 2BOCB 3DHJA 3FO9A 3HR5A 5GJTH 5L2KB 3IDNA 5JLZB 2Y07L 3KPRA 4W68A 2NX5A 5HHVL 1AFVL 2KDGA 4FHBD 2B7DT 4ODXB 3W9DA 3I50H 1WWWX 3IJSA 3TVMB 1F97A 5DRZA 5HJ3A 5K9OB 3EBAA 3LZFL 5DT1H 5BS0E 3LEXB 5F6IB 1TVHB 3VFUA 1T1YB 2KPNA 4Z7WA 4HWBH 3ABZA 4QTHB 1A7RH 1CGUA 1QFUL 2R1YB 2Z35A 1T20B 4WW1B 1KULA 4PJ8C 1RZFL 4Z0XA 3T2QA 4HPOH 5MEPA 5E8EB 2XRAL 4I0PC 4EN3B 2DDQH 5EU4A 2WBJD 4JVPA 4MXQD 1DQQB 2XACC 4GKSA 4KHXL 4NQEA 5CIPA 1D5MB 4PJAB 4V2CB 5DURD 2QQKL 4U3CA 1VGKA 1AO7E 5GRVL 4CMHB 3NPZB 5E5MA 1OGAE 1I9JL 3ZTJH 1LP9A 1FGNL 1UB6A 3D0LA 3BE1H 1NCNA 3AAZA 3JTTA 2XIDA 1WEJL 1QUNA 5HDBE 1GRWA 5DS8B 5KSBA 1U92A 2AJ3B 3JTSA 3CIQA 1A5FL 4JO1H 4OIAA 4YBLB 2EDHA 2GYSA 1FE8L 3HB3C 4YBHA 1CFSB 4JDTH 5EA0H 2BY1A 2DBJA 3PIQB 4TRPL 2VZVA 4S1SH 4PLJC 5JOEA 4TSBL 4KV5E 3MV9A 4O2FB 4NHUB 2D03H 4FRWA 3FONB 1MAKA 4OF6A 3QWRA 5HGDB 2R0KL 4JKPH 2ZCHL 1IT9L 1J0YA 3LKPA 5T1LA 3QH3B 4PTTA 4DQOL 4YQXL 2PR4L 5HHNA 4WHTB 1LD9A 5DHVH 4LVOB 4PJXB 4TSAL 2P1YA 3UBXA 2XV6B 5I1GL 3OKDB 3R4DA 5IF0B 1BVKB 3ILQD 3HPLB 3HRPA 2UY7A 1XMWA 1PZ5A 3N85L 5D2LF 1IAOA 5I1JH 4QRPD 2NY7L 5CP3A 2BNUB 4LLVA 3U0TB 4MJ5B 4NWTH 3TC9A 1JGDB 3GMMB 5KN5A 2OR9L 2A83B 4P59L 5FUZH 1TDQA 4D0DA 1T83A 4HKZB 3U9UB 4X98B 3H6JA 3SE9H 1BBDL 3O45A 3RZCD 1J18A 1OAYL 5E08H 4E42A 5CMAB 2MKLC 4WY7H 5J57B 5EWIH 4OGAC 1PX3A 1NPUA 2ZCLH 4UAOC 1NCWH 5JXED 3OKMB 1N59B 4TVSa 1NC4B 1EEYB 4N0UA 2DQHH 3PWVA 3KPNA 5EBMA 4CMMA 4PRHA 1TJHL 4D9QE 1FRGL 1JV5B 1M7DB 5C8JA 1RZGA 4GAGH 1KJ3L 4FS0A 5GJTL 1A3RH 2YA2A 4K7FA 1CLZH 5HGAA 4QRRE 5JPNA 5JNYA 1ZEAL 2VLKD 4RAUB 3L5XH 1U8JB 4U6HB 1OARH 3I50L 5ITFB 1G9NH 5JORA 5JQ6H 3G08B 5C2BL 2HN7B 1UEYA 1IAKB 3GKWH 5DT1L 5GSRB 4GBXC 4X99B 3ORJA 4PTUB 4N90D 4Z7UF 4HWBL 4Q74A 1A7RL 3DX8B 4YLQT 1F3DJ 4Z76A 4PJ9C 3IDUA 4QHKI 5KS9A 3TCXA 3VD3A 2DDQL 2D7TH 1IGCH 3PHOA 4NQSB 5ENWA 1HHKB 3O3AA 1LEGB 2A73B 4NO5A 4F9LC 5FYLH 2C3VB 3QIWA 4PJ7E 3BE1L 4H8WC 4YAQA 4L8SC 5EIVA 3BFOA 2CDGB 1XIWA 3ULUE 3E0GA 4O51B 5GGRY 5J1SC 1TMCB 3QA3B 3MA7B 3T0EA 3T4AB 3WHE1 3PGCA 4JO1L 5I8OH 3ZHDA 1DDHA 1NBZA 4M6NH 3UPCA 2VLJE 1HWGB 1ZHLB 4JDTL 5EA0L 4HIJB 3VA2C 4IRJD 5IQ9A 3TNNB 4JRXA 5DYOB 5DJ8A 5CJ8A 2VDQL 3GUTB 1AGCA 3BZEA 2GK2A 2R0ZH 4JG1L 5GS1C 4QHNB 5E2TH 4P4KD 1ZLSL 5D7LE 2FBJH 3OKEB 3L3KB 1X9QA 4TVPH 3BZ4A 2ZWLT 1W0VA 2DQTH 1RZIB 4GKNB 1KLGB 4OFIA 3RVUD 4LSTH 2NXYD 1UADC 5ICXA 4MQXC 2HMIC 5FUZL 2BCKB 1JZ6A 2K3TA 5DMJB 4NZTH 4N8VB 1T2QH 4TQEH 2IAMB 5CGYD 2AJSH 3NH7H 3SE9L 5I1IL 3GMOB 3TPUB 4XB8A 5E08L 4LLQA 3QPXL 2ARJQ 3RU8H 3AREB 5EWIL 2ZCLL 3DJ9A 1NCWL 2CQVA 4JKKA 2BNRE 1Q9LB 1RUKH 5FCSH 5E5RB 1BOGB 1PX4A 4WI9A 1GGYA 1HOCB 1PYWA 3HS0A 3R06B 3WXWH 1RFDH 5EU6B 1KIQA 5FF6A 3LPWA 3VXMD 2LTQC 4U1NB 4FQ2L 35C8H 4HUVA 1A3RL 4QT5B 2O61A 3RDTA 1CLZL 2AJXH 2HVKA 3H0TB 4KTDH 4X7SH 1BAFL 3L5XL 3NFSH 4NCDA 5IEHB 3HZVB 3OXRA 5F7EH 5F89A 2R4SH 1OARL 2JELH 3TF7C 1G9NL 5BVJA 5JQ6L 1ACYH 2Q6WA 1SJEB 2EYRA 5FUCE 2KZWA 1OLZA 3GKWL 5AG9A 3TZVA 5HSFA 1F3DH 2QR0B 2E6QA 5E1HB 1JGUH 1F02I 4FFVC 5ISZD 3T3MF 4PLOB 1XGQA 1U8IB 4HSQA 3MFGB 3PWJA 4P23B 3DECA 4P2RD 2H26A 3MUHL 4LDEB 1A6TB 2PTVA 5DJ0B 3SBWC 3W82A 4ZUTA 5FYLL 1LNUA 4Z7QE 2XA3A 5HGHB 3IF1A 4RZCB 4PBWD 15C8H 3FQUA 4HG4J 4YXKH 2GAZB 4FG6D 1I1AA 4JFOA 3B9DA 4E41A 3DX7A 3BD3A 2AJUH 3VRIB 1NQBA 2NY5C 4M8QA 4ZUVB 3IXTB 4JKLA 2C1OB 1INQA 2XFXA 5I8OL 1A6VH 1D9KC 4OIIH 4DK6A 3OGCB 2ERJC 4MNGB 4PBVC 5D72L 1ADQA 1S7TB 4LHUB 4WU5B 1MFEH 1FL3A 2EDQA 3KPRE 2NX5E 3MGTB 4Q2ZB 4JY4B 3KYMA 3D85A 3KJ6H 1K8IB 3C8HA 4X6CB 2R0ZL 1MH5B 3NCCB 1DLHB 5E2TL 3X14B 2Z4QA 3FT3A 2FBJL 4J4PD 4NRYA 4Z7WE 1RJYA 5DZNA 3P3YA 1T04B 3F65A 1M7XA 5IB3A 5BRZE 5BOZG 5H35A 1I8MA 2EXWD 3UTZB 1Y6NR 2CO6B 2N7BA 2P42B 4P46B 3IDIB 3LY6A 4IS6A 4LSTL 4PJIA 4PRDB 4NQEE 2FIKB 2Q20A 3ULVD 2DQUH 5HDBF 4I2XB 1LWRA 2NY3B 4JGUA 2W0KA 4NZTL 4IRSA 4K8RC 1T2QL 1MFBL 3QUXC 4TQEL 4ZS6D 1LP9E 5KOMC 2AJSL 3NH7L 4IMLA 4QKXB 5C0BA 2AXGA 2PTTB 2HJFA 3JV4B 2R15A 1FV1A 4ZS7H 3EZJB 4YGVB 4QHUB 3RU8L 5IVXA 5KAQG 3MXVL 4RFEA 5KSBE 4I9WE 4CGTA 1RUMH 2G2RB 2H2SD 1Y18A 5DQDH 3BO8A 1RUKL 4F80A 4OZHF 1C16B 2DL2A 3PDGA 5HI5D 4WUUD 4KV5F 2ZOKA 1RFDL 3WXWL 4FQCH 3V6FB 1J8KA 3ARPA 1S78C 3NCMA 1ITBB 5A2JH 2VL5B 3GSOB 2GJ6D 2AJXL 2OXGA 3NIGE 4Z7VA 1BFOA 1T0MB 3MV9E 4KTDL 4X7SL 1LGVA 3NFSL 1EAPB 3V79C 3KYOB 4HJGB 2R4SL 1KB9K 3C5ZA 2ZJSH 1X44A 3SDDD 1ACYL 4RGNE 1DQLH 4O9HH 4Z0BH 5EU5B 4QHKJ 4MZ2A 1MFDH 4MA1C 1JGUL 2Q7YA 3WN5B 4OD3H 4OB5L 1D6EA 3VFSB 4R96B 4F57H 1E28A 4I4WA 2CSPA 5IG7B 2V7HA 5ALCH 1JWSB 1XCTA 5ICZA 3KPQA 4POUB 3SDXF 1P2CB 3BQUA 4S10A 1WIOA 3VG0H 4Y1AA 5AUMA 5C6PB 1NLBH 4DKFL 3SKJH 4HG4K 1FIEA 2I9TA 1QVOA 4HS8L 4IIQC 1KXTB 15C8L 2A38A 4QHLA 3L3HA 4IRSC 4AQ1B 4YXKL 4XBGB 1A02N 2YN5A 2EC8A 4NP4H 1P7KB 4N0UE 4D94A 1EK3A 3TJHD 4ZAKA 1MCEA 4PRHE 1A6VL 1I7ZA 5I30H 4OIIL 1BECA 5D8JL 3D48R 4U1SA 2J5LC 1MFEL 3S4SB 3BDBA 2E7CA 2X1PA 4F15C 1J5OH 1OQOA 4MDJB 1S7SB 4NT6A 4PRPA 3EDJA 5INDA 2APTA 2XN9A 3KJ6L 2WM0A 4KC3B 1KJMB 2XY1A 4V1DA 3MX0A 5C0EB 4XHJD 4RWHA 1EERB 1DVFA 4X4MA 3FQRA 2IEPA 4W81A 4YDJB 2AABH 4NO2A 1Z9SA 5D7JD 1JYVA 5DFWH 1Q94B 2YEZA 2BVOA 2J8UF 4FXKB 4BA8A 4Y5XC 4PR5B 5IW1A 5HYQB 3WD5H 5KSAB 3HCVB 4P3DA 4HJJL 3P40A 1YN7B 1AGDB 1V3KA 1EEQA 2DQUL 1KB5A 1J88A 2HLFD 3HG1B 3BHBA 5EU7E 5BCAA 1XH3A 5GJSH 1JFQH 1WTLA 3LHPH 2GJZB 2M8XA 4QRSB 3NCJH 4ZS7L 5F3HB 2VAAB 3ZLQC 1HXYB 3PL6A 4XCNB 5AYUH 1R3LA 1UH2A 1LO3L 1UG9A 2CRMA 2NXZB 2WQ8A 1BVLA 3OAZH 3OAZK 3T0EE 5C09B 3UBXI 1RUML 4KXZI 1FFOB 5DQDL 43CAA 3DMMC 4X9HA 2HJKB 2P47B 4UQ2B 2X1OA 4FQCL 7FABH 1DBBH 4YHKH 3CDGB 3PWPB 4S2SB 1GZPB 2NY6C 2XZCH 2DLEA 1CFVH 1GGUA 2FR4A 4IOIB 1T4KB 2C7UA 4BH8B 1BWWA 4U1HB 4Y4FB 1HH9A 4HH8A 2ZJSL 4Z8FH 1DQLL 1UCBH 4O9HL 5E9DB 3CZFA 4PD4K 4QRTB 4Z0BL 5F21B 1MFDL 5SWQB 2ARWA 5L0QB 3DX9A 3DI2B 4OD3L 3IDJB 4XVTH 4PJCA 3ILPB 4F57L 3W39B 3LN9A 1RJLA 4C57C 4KAQL 4JFEB 5ALCL 4P3CL 3RWGA 1T6WA 1H3XA 2P7TB 4ETQA 5F8RC 1CICB 4ZPTA 1VFAA 3STLB 1T22B 3OKKA 3ZHKA 2V17L 1KT2A 5KVGH 4HKJB 1HK6A 1B0WA 5C9JB 1NLBL 4YPJA 4FMFA 5L9DH 3RUGB 3CK0L 3RVWC 2H8PA 1J1PH 2Z0BA 4ACPA 2YRZA 3ARDD 4QRUA 4TTDC 1L9NA 4NP4L 2IG2H 3MYJA 1H0DB 1U95A 2BOBB 3BP5A 1WBXB 5I30L 4ZXBA 1KLFA 4MA8L 2CRYA 2BC4B 5INCB 2FZ3A 4H0IA 4PY7B 3H9SD 1J5OL 3I6LD 4PUBL 4XP6H 3M8OH 4OV6F 3ZKNC 3L3IB 4QCIA 2XWBA 2ZUSA 3QSKB 1EO5A 3UAJD 1A4KA 2OS7A 3EYVA 3OSKA 3Q6FB 4P2CG 4X5LA 5AEAA 3LIZH 1S8DB 4APQB 1A3LL 4R97C 1X5FA 1G6RH 2AABL 2VERN 3TV3H 3A6CH 4NBZB 4NUJB 1VDGA 1IC7H 3HI1B 1RU9H 2XY2A 5E2UH 2FX9H 4YO0A 5MEND 5FM5M 4B7IA 4LCYB 1W0YT 1QSEA 4Z7QF 1KIPA 2EDYA 3WD5L 1EMTH 2IGFH 3GJEB 1UC6A 5SV4A 3MJ7A 3GI9H 4PJXF 1L6ZA 4JDZA 1YMHA 3UDWA 1L7TL 1N5AB 2CLZA 5TGBA 2BSTB 3TPKA 3CFDA 3LDBC 3O8XC 5GJSL 3G6JA 1JFQL 4K7PH 1KJ2A 4Y16A 3LHPL 5C08D 4MCYA 5I1AA 3TO4B 4PRBB 3I6GA 2HA1A 3NCJL 1NEUA 1FNFA 5EORH 1LO2L 4J3TA 3BVNA 4HUXA 2YK1H 4PGBB 5AYUL 4E41E 3BUTA 4F7TA 3X3GH 3QFDB 2A1WL 5C0RL 1XGUB 5C0CB 3S3PA 4KH2A 4GW4A 2W92A 4JZOB 4LF3B 1S7UA 1OSZB 7FABL 4J1UB 4YHKL 4JRWA 5HHMB 3D25B 4WIQA 2W65A 4RGMC 1U2HA 1J86A 2IJ0C 2XZCL 5BOPA 5D2NC 3QBTB 3NBNA 2ADIA 3WMSA 3T1FB 2EDEA 5FM8A 4G6JH 5EZLB 4X8JB 3PWNA 4Z8FL 3BP4B 5EPMB 1YQVH 2X89A 1UCBL 1NC2A 2D0GA 1T5XA 2DM3A 3C9NA 1OTTD 3HN3A 1GGBH 1N8ZB 1S3KH 4H25B 1RV6X 4E0RB 3PXJA 3IT8D 3R8BB 3DIFB 2PO6B 1ITCA 4OFDA 3C08H 4NC2B 4PJIE 4GKZB 1DBMH 2W91A 1FNGB 4YWGL 4HV8A 3MRQA 5IB4A 4DEPB 4XH2B 5F9JB 1M6OA 3VFMA 4RFOL 5TDOB 1P5UA 4HC1A 5KSBF 1TXKA 1FHGA 5KVGL 5C0BE 5ILTL 2YZ1A 1XGRA 1CQKA 2A6KB 2VLMD 4U31A 5HY9A 5L9DL 3W9EB 4OUUA 1FN4B 5IVXE 1XGPA 4ZUWB 2CD0A 2IG2L 3TT3L 3TA3A 2CDFA 3FRPA 3PG2A 2R2BB 3QG6A 1KTDA 4WWKD 4Z77A 2R23B 2AK4B 3BPNC 1U8OB 4EQ2A 1A6AB 1FNSL 2VSDA 3M8OL 1JWMB 4OCLC 4J2XA 4H1LG 3L3DB 2JJUA 1KIRB 4M48L 4KKCC 4NM4H 1CXHA 1ZT4B 2BHYA 3IETA 1MCPH 4M00A 1G9MC 3LIZL 2IALB 4XAKE 5D9SB 1T66D 1G6RL 4CVXB 3TV3L 3BRGC 1IC7L 1Q9WB 1RU9L 2LAGB 3MBED 3X13A 2FX9L 3WLWC 1IGJB 1U0QA 3SKMB 3EYQD 1MY5A 5T5FH 2WBJA 4POZC 5DQJA 1TZIB 3IGAA 2IGFL 3DUSA 3DXAA 3GI9L 5KSUB 4NC1E 5C0AB 5IBLC 5L8JB 1EBPA 4JPIA 3WJJA 1SJHB 2UZYB 5IIEA 1TCMA 2H6PB 3C60D 4Y1AE 5IHLB 4LBEA 4ETYA 4CUCA 1CWVA 3QUYA 3MJ6A 3UTTA 4K7PL 1FYTB 4X6BA 1V3LA 1DQJB 3LVEA 2YN3A 4FQPA 3EDEA 2FJHB 2VXQH 4S1QH 2YK1L 1WZLA 4NQCD 3X3GL 2Q8AH 2APXA 5LKNA 3HZMB 1G7HB 1I1FA 2NNAA 3TNMB 3HAEH 1CFBA 5DEZA 4LARH 3WFEH 1PY4A 2F53D 4GLRI 5FKPA 3MRRB 4PRPE 3VRLE 3C09B 1CVSC 2AW2A 1KOAA 2R1XA 2EIBA 3ULUL 5FECA 5IOPB 2XN9E 4NSKA 4G6JL 1XF3B 5KS9F 2VZTA 4V1DE 1YQVL 4JFYB 4XGZA 1R5VA 1JJUA 1AY1H 5EBLA 4KVCH 4BFIA 2Z8RA 1J8HD 2F9BT 1UCTA 4CU6A 1AXSA 3U2SA 3KPMB 4QRPA 1PLGH 4OI7A 1CK0L 3MLUH 3IJHA 3C08L 1S5HB 3X11B 3NN8A 1DBML 5HI3D 3CMOH 2DLGA 1T1XA 3RX7A 4XNQA 4MA3B 4DFIA 3BKCH 4NQUA 5IMOB 2B1AH 4P2OB 2WBJC 4MXQC 4K7PX 4N8CH 5C0JB 5IHBA 2FGWH 1E4KA 3EIFA 1A1NA 3H9YA 4LSPH 1I3RB 5E94A 1NJ9B 1Y0LB 2CIIA 3WJJC 2OMNA 4PGZA 4PG2C 5CIPH 5CZXC 2K1MA 5C1MB 2DKSA 2DQDH 1EDQA 5I8CB 1YEIH 4I5BA 5JIIA 1MWAA 1NCCH 1NGQH 1WT5A 2Q1EA 3TN0B 1B0RA 3QI9A 3EDFA 3OB0H 2D3VA 1JNHB 4RX4D 1YN6B 3N0PB 4R4NC 3NFNA 4N8VG 4YDKH 5DJAB 5HGBA 3CFBA 5E4EB 2FO4A 4GRLB 5EOQH 4E5XA 1FP5A 1YJDH 2ITDB 4Z5RB 4KI1A 4NRZA 2PKDA 3MRBB 4NM4L 1BQHB 2R39A 2XZQL 4JVWA 1OGTA 3VH8G 3O0RH 4G7VH 4OLEA 2HFTA 3CX5J 4RAVA 3DGGA 4L4TB 5J3HD 4PJCE 3ES6B 3EW3B 5FIEA 2YUXA 4MX7B 4P4RA 3DPBA 1L0YA 3QXTA 4RGOL 4NBYB 5T5FL 3TM6A 4PJ7B 3ILQC 4HGWB 3QYCA 3FFCB 4UMGA 4WDIB 4WFHE 1UH3A 3MMEA 1CD9B 4KHTH 3STZB 1CFQB 1S9WA 4Y5YC 4YR6B 2GTZA 4CU8A 3VWJB 3AU1B 4KXZH 4OV5B 1HYSD 2Z31B 1KPUA 1MJUL 2E9WA 5M94B 5L8LB 4AYFA 1XCQA 4N5ED 1CDBA 1JP5A 5CP3H 4F8TA 4P5KB 1SYVA 2VXQL 3HE6D 4S1QL 1E4KC 1YPZE 4XP5H 3GSVA 2Q8AL 2X5PA 1AC6A 5TE4H 1OLLA 4BZ1H 1MCBA 2B20A 1F42A 1L0QA 4LSDA 1IFHH 1I9IH 5EN2B 5JXEC 3BGFC 4HUUA 3MV11 4JZNB 4UU9B 3G9VA 1WT5C 4LARL 3VDAA 3DYMA 3VRJA 2WIMA 1LHZA 4MJID 4Y5VA 2GJJA 1T7ZA 5ADPH 4A6YB 1RK1A 1MRDH 4HUWA 4Q9QL 5ACZB 1YYLL 2Z92B 4P0DA 5IW6B 5J13B 3FO2B 1JNNL 3PWLA 1BBJB 4MHHG 4PJ5B 2FO1A 1IGIH 1PLGL 1CD8A 1QRNE 4LHUG 4HZLA 1QSEE 3MLUL 3ZKXB 4PGEA 4YHLL 4JFXA 3ARSA 3CMOL 3LRGA 2IBBA 2DKMA 3ZE2E 3BKCL 3QXDA 2B1AL 1HSAB 4FQ1H 4N8CL 3DVGB 1A9BB 2X09A 3G6JE 2BNRB 4LSPL 3OJDA 1BREA 4PJFB 2XTJD 4UV4H 1GC1H 4MB4A 3RWHB 3V9FA 2VIRA 5F7FA 3S36H 2MTPA 2DQDL 1YEIL 3UTQB 1NGQL 3WHXB 5E6ID 4LPYA 1BJ1H 4LKXB 5C2UB 4UTBH 4XRCB 1F13A 3I84A 3I75B 1TZHB 1PVHA 1UXSA 1N6QH 4YDKL 2C1PA 3RWDA 1FZMA 4PJ8B 1FQ9C 4KRNA 5EOQL 3BXNB 1YJDL 1MRFL 4I0PB 3WS6A 4IRJC 4TNWF 3TBTB 3TBWA 5DC4B 5HYIA 4G42A 2H41A 4LLAA 2X4PA 5J6HA 3CX5K 5I1DA 3CCHB 5JPMA 3O0RL 5ISZA 3S5LA 4G7VL 4UIMB 1J0KA 2Q8BH 2GW5A 5MERB 5IEKB 1J12A 1H8NA 4NKDB 1AH1A 4P4KC 5E8PB 3RIAK 1MHPH 3HC3H 4ELMA 1RSFA 1ROWA 4P2RA 3HZKB 2X9WA 3GSWB 1JUFB 2ZG3A 1M7IA 5H37H 5EO0A 3DRTB 5FYLD 5D7KE 3LKRA 1OTUC 3ARBD 1NBYB 5TE7H 2NXYC 4KHTL 3X17A 4J3XA 3QEQB 5ERWA 1H5BC 3L7FB 3MJ8A 3H9HB 5FB8B 4R4FH 4P5TA 1IC4H 1MCJA 5TDNA 4XTRD 2FEDD 1ZVHA 4GRMA 4HJ0D 1CBVH 1N2RB 5I1CH 5F9OH 4XP5L 2MJWA 2NZ9C 4J3SA 5F88A 1RHHB 5TE4L 4ZNCD 1C5CH 4Z7VF 1YY8A 1BF2A 1IFHL 1I9IL 1ZK9A 2M26A 2XQYK 4GUPA 5IB5B 1Y6MR 1KCUH 1RK0B 3BN3B 5BXFA 3CC5A 1QLFA 3JSSA 1NFIA 3MRNB 3QZWA 2LU7A 5J9PB 1SYSA 3QDAA 3B8SA 1CDJA 1EFXB 5E8DH 5ADPL 1DUYB 1MRDL 1BZ9A 1G7IB 5BRZB 4LRIC 25C8H 4EUPA 4P5MA 2ESVA 4G8IA 4TVPD 5CUSH 3EKCA 4WGVB 1JGVH 1AI1H 4HF5H 4QRQA 5DVOA 3MV8A 3N1QC 1JPFA 4ZODA 1AKJB 2UV3A 1ULVA 1IGIL 4B5EA 3WDHA 2XPGA 3S4SG 4UAOB 2DI8A 2I07A 1G1CA 2P4AB 3DXAE 5J06A 3S3JA 1I8KB 2X1XR 3BT2H 1X5HA 1I8LA 1KC5L 3RY6C 1VPOH 2P8LA 1Q9OB 4N9GA 3UTTE 4YHYC 3VW3H 4ZTOH 5AZEH 1RQ5A 3ARXA 3O4OC 2BJML 4UV4L 1GC1L 5HHOD 2QKIA 4EDWH 4LKCB 1MY7A 5C0FA 2AJVL 4P5TC 2I60L 3CXDH 3D2UD 2HKHH 2PYEB 4IOFC 4XVJH 5B3NA 4RWYL 1MFCH 1JBJA 2EYTA 1DP0A 4GBXB 4EXPX 3RWEB 3DOSA 4X0KA 2Y06H 5F3BA 1QO3A 3VXPB 1IRAY 1N6QL 4PJ9B 4D8PB 4YC2C 5E00A 2BXYA 1IL1A 3O6ML 4KKBD 1QZ1A 3O9WD 3N1MC 1ADQH 3LRHA 1I3UA 2Q8BL 5HHXH 1AGEA 2VR5A 2X4OA 4QRPE 2JB6A 5GRZA 4G5ZH 4J4PC 2MFNA 1MHPL 1VKXB 1XT5A 3HC3L 3P4MB 4L8SB 5SWSD 3UZQA 2UWEA 3EFFB 3LPFA 3QULA 2EXWC 5TE7L 2EDLA 1YA5A 4YHPB 3ULVC 4R4FL 1IC4L 3QIBD 1I8LC 3S36X 3UTSD 4ZS6C 5EBMB 1CBVL 5I1CL 3MUGB 4PRHB 5L6YH 1QHPA 5F9OL 4U6YB 5ETUA 2R56H 5C8JB 1F45A 4GLRH 5DO2D 1Q0XH 4WGWB 1LO5A 4AJ0A 4LVEA 1E4XI 3MJGX 5GS1B 5JNYB 2H2SC 3SQOH 1FZJB 1KCUL 4F37F 3G5YA 3BUYB 5IB1A 1NANI 3Q3GB 1S9YA 1ZE3C 1WBYB 2R1WA 4EDXA 3QNYB 5C0IA 3JWDH 1C08B 5E8DL 1EXUA 1EVUA 1QFPA 4Q58C 4WTZG 5FA4B 2EDBA 3FKUS 4PJCF 1AGBB 5DK0A 1FNAA 2APBA 3MR9A 1ND0B 25C8L 3JV6A 3OJ2C 3PQYA 3GMNB 5CUSL 1J05A 3SDDC 1JGVL 3QDGD 2XZAH 2V5RA 4HF5L 1C8PA 1FNEA 4HUNB 1J0JA 2A6DA 3V4VH 5DJ2A 1LK2A 3Q5OA 3FQWB 1T1ZB 3SCMD 4J8RA 3WBDA 3QEUA 2QSVA 5LGJB 3MACL 4HH9B 4W6YB 5F9WC 1HQRB 5DD6A 2VDLH 4MAYA 1T5WA 2NY1C 4N1EA 3WUWB 1UFUA 5I8EA 2DQJH 2I27N 3DRQA 2X9YA 2IPKB 3VW3L 2LTQB 4ZTOL 5AZEL 1U91B 3RVVD 2FCBA 3T0DA 4C56D 2DQFA 4D3CH 3L3OA 4JHWH 4K8RL 4R4BA 4EDWL 5ACLA 4XMKH 4WHDA 1LEKA 1UVQB 2J7LA 3CXDL 1I8IA 4YXHL 4X7EC 2HKHL 4J7RA 3RAJH 3QUMA 4X5WB 4XVJL 3MV7A 1MFCL 2Q3AA 1OM3L 1DN2A 2CLRA 3SGJC 4KMLB 4KJPD 3TJHC 5DMKA 2Y06L 3RA7H 4MD0A 32C2A 2DYPD 1SJXA 1VACA 3KPOB 4PV8A 5I71B 1A1OB 3P0YH 3OX8B 4FXGB 4PJBA 1U8PB 3SDAD 3OWEA 5CKAA 4U1JA 2FJFA 3VGGA 5JHDA 2A9MH 1CDCA 1LILA 2AV1A 3WFCH 4OCSH 5DC9B 2AQ3A 5LCVH 2NTFA 4KGLA 2APWA 4XCYA 1ADQL 4GRWB 5SWZA 4UILL 3WKNA 4XHJC 1UJTA 3ZE2F 5CBAA 1SEBA 2DKUA 5I66B 3RTQA 3DARA 1UWEH 5D7JC 4NN5C 2CRZA 2XWTB 1KPRA 3QJHB 3MRGB 5EBWA 5GGSA 3BZFB 5HYSB 1F11A 1FSKC 5HYJD 4WV1A 5BMFL 1D9KB 3IJYB 3OHXA 1QD0A 5MHSE 1KIUA 3MLZL 3QDJB 1UJ3A 2HLFC 3VI4E 1S7XA 1ZANH 2VXSH 3GFUA 1BQSA 5I75C 2VUYA 5L6YL 2MNUA 1G0XA 1U8NA 3ROOA 3EGSA 2R56L 1WIUA 5FCUH 3FRUA 1KB5H 1MHCB 2EE3A 3BAEH 4MXVE 2GFBA 1DUZB 1QR1B 3SQOL 3FAXA 1WJ3A 4K3HA 3L5WA 2NY2D 4PV9A 5DMIH 2YRLA 4LFHD 1JPTL 4LFHG 4HUKB 3D39D 2OTUB 1G1YA 4HFWA 4KQ4H 4WFGE 3QHZH 5C86A 2Z9TA 1DBKH 2PXYD 1V05A 4FFYH 1FO0B 3UPAA 4NNXA 5FUOH 5D5MB 4M6OH 4OBRA 5ISZE 2VITB 3QUXB 2XZAL 5HHQB 3VI3E 4M1CC 4NPYB 1T1WB 4OD2B 5I1KH 4ELME 3EO9H 5DDHA 5IJKA 3V4VL 4P2RE 1DE4A 2G75B 4PJGB 1MCOH 4WTWA 3M1BA 1KPVB 3LKOA 5BS0D 4JFHE 4F33A 2VDLL 5C0DA 1H3UA 4KGJA 5JW5B 5K9QI 3Q2CA 5CINH 5K9KB 1KCLA 4RNRB 3WLBA 5IFHH 3SJVB 5EUOA 2DIBA 1QLEH 2BVTA 2BVPB 1UKQA 4HK3N 4WV1C 1YDPA 4BSJA 4CVUA 3EOTH 4JHWL 4IMKA 4XMKL 1HCVA 1S7RB 1ZTXH 1U6AL 1AO7D 4I48A 4OCNC 1OGAD 1LQSR 3SPVB 3RAJL 3ARDC 4HS6A 4G9DB 4D0CB 2AXFB 4OJFH 5IHUL 5EOTB 4MA1B 4OZIB 4M1GH 3H3KA 4HIXH 5DA4A 3IAPA 4LRNH 3RA7L 3W0WA 2VDKH 3NZ8B 1HHHA 2V6HA 3S34H 4OGXL 3WS3A 3P0YL 1C7TA 4PRID 1NGYB 4BSWB 3KWWB 3FTGB 3HE7D 4YHZH 4G9FA 2ZUVA 5LVEA 4K3JL 5DRXA 3BDXA 2ESVE 3I3DA 4OCSL 4PGDA 5LCVL 5H2BB 2BDNH 2GK0B 3GIVB 5DHYB 4HGKC 3V5DB 5E1AA 4ORGA 2OTWB 1WITA 3I02B 3VXQB 4IIQB 3LKQB 5ESAA 3FN9A 2XWJA 5KANI 1WFUA 1UWEL 3PV6A 1YMMD 2VXUH 4BFBD 3O2VH 5KG9A 2WP3T 1FV1B 1U3HD 3O6FA 4RRPA 1NCUA 4HFUH 2DICA 4JKMA 3LV3A 4OGYH 2FATH 1NCTA 1TCRB 5GXBB 1T3FB 3LAFA 4FQHB 4XNZC 5CSGA 5DZLA 4Y4KD 2WINB 2CDEB 3VWKD 4J6RH 1A9EA 3KLSA 3F12A 2ZNWA 4OCRH 1TVBB 5GGUB 3O4LA 5FCUL 4D9LH 2YUWA 2X4RB 1KB5L 3E6HA 1T21A 4GG6E 4WO4A 4GXVH 3TYGH 4OM0H 3P9MB 4XVUD 2IANA 1KJ2H 4DN3H 2GJ6E 3H7BB 5ANMB 4NQXB 1M05A 2GSIB 5DMIL 4CADA 5GSVB 3TWCH 5T1KA 3DUUA 4AZ8A 1NGZA 1N6VA 4PS4H 1P7QD 1N4XL 5LQBH 4AL8L 4Y5XB 5DJXA 3VCLA 2GT9B 4KQ4L 3QHZL 1N64H 4D9QD 1CG9B 1DBKL 3F7RA 4FFYL 5FUOL 4C54A 2E8ZA 4M6OL 1E27B 3TIDB 4EI6A 4QRRD 3TIEB 3B83A 3MRMB 4R8WH 5I1KL 4PJHE 1OTTC 3QISA 1MCOL 1JGEA 2UWEE 1WCBB 3BMVA 3S96A 3HZYA 1WICA 4ZPVA 3DO3A 1AHWC 3DMMB 5CINL 4UOW1 3L3HB 5J1AA 4JFDA 1PKQB 4DUWA 3NCBB 1QFWM 4GT7A 1A4JA 2Y1VA 3ARFB 5IFHL 4DUVA 4ZOAA 1I85A 1ZOXA 1P53A 2VLRB 4Y2DB 2R8SH 4M5ZH 5DUBB 5A2FA 2NY6B 3EOTL 3B6SA 3TO2A 4NYLA 2A6IB 1IM9B 5CSZB 1WISA 3IFPA 1ONQB 2X4UB 4HC1H 4GG8B 4PJFF 3ROLB 2VLLB 4KRPD 2LQRA 4HIXL 3V5HA 4LRNL 3T65A 2VDKL 3S34L 2MOVA 3TBYA 2CO7B 3TEUA 2F74A 3V6ZA 4WWKC 1JYNA 1MUJA 3BZDA 1T7VA 4OCWH 2OL3B 2EKJA 4U0RC 1C5DA 2KL6A 5BJTB 4FQXD 5H94A 4YHZL 4NQDD 3F7VB 2X7LB 5FO9B 5K59E 2VLJD 5C07A 4ZFOA 4EI5A 5IM7A 2UYLA 3PQYE 4GAYB 2YD1A 5EBGA 5DSCA 2Z91B 1EUTA 3FOLB 2VDRH 3T0BA 4KK6D 1T66C 3ULSB 1JHKH 3DBXB 2H9GA 1K9TA 5KVMC 2VXUL 2YPVH 1F6FB 3MBEC 2F8OA 5D7LD 3EYQC 2WUCH 5F1IB 1JZ5A 4N1CA 5B8CA 4MB5A 2O5ZH 4QGYA 1NMBH 1JHTB 1RIUL 5IUSA 2YD9A 4ERSH 3RKPA 4ISVA 4OGYL 2FATL 3DV4A 5IT2H 1E4XH 2W38A 3NA9H 3C60C 1LE5A 1ERNA 2VR9A 4J6RL 4JM2A 5JTWA 3H7LA 2X40A 1NANH 4OCRL 4NZDA 1A2YA 3MV7E 4LLMA 1CFTB 3CXHJ 4GXVL 3TYGL 4OM0L 3UXFA 4R97B 1KJ2L 4DN3L 5FFLA 3D3VB 3BH8A 3PGDB 5FYJE 1K3ZA 2ICWB 4DZBB 3CJJA 2V7NB 3PNWB 4OLXH 3TWCL 1G7LA 3CZFB 5L7XH 2OQJB 4PJBE 3WDIA 1NCBH 5LQBL 2F5AL 5IVZB 1U58A 2BRRH 4HHAA 4UNUA 1SJVA 5CSBA 4AT6A 5GRXG 3WIFB 2RJMA 1P4LA 1NGXA 4Q6IC 3DVNA 3VFTA 3QUKA 1A7OH 1V7MH 4L3EB 4OLZH 4IEFB 2YWZA 5SWZE 1I9EA 4ZMAT 3LDBB 1CXEA 3O8XB 4F7CB 1W72A 5E70A 5DRWA 4R8WL 3VMOA 1UWGH 3KYNA 3EYOA 3W2DL 5BZDB 1IEAA 3CMGA 4CDHA 4M61A 3VI4F 2IF7A 1VFBA 3BGMA 4OM1L 2AGJH 4Y19B 1TQBC 3B2UC 5HI3C 4UNVA 1YPZB 3LN5A 3T8XB 4L8CA 1UWXH 3VJ6A 3QXAB 3CDFA 4DVBA 5B38B 2JIXA 3Q5TA 2R8SL 5DEGB 4RGMB 4MXVF 5A2KH 3GSQB 3QAZC 5D2NB 1BF8A 2OMBA 4BUGA 3Q1SH 2HLAA 3LEYH 3BH9B 4OKVB 1EAJA 3PDOA 4CVZA 3NTCH 4HC1L 4JM2C 1KLUB 1I7UA 3DURA 3L95B 3GMPA 4LGRB 4UIKH 5GRYA 1FJ1B 1KELH 1BD2A 3FB6B 3F5WB 3VFPB 3A67L 2A74A 5E4IA 1BX2A 1MI5A 4OCWL 1PG7L 1NEZB 1MWAH 1VEPA 3WL9B 1U3YA 4JFQA 2P5EB 2VDNH 1FLTX 4ELMF 2CKBA 1VERA 2G5BB 4PB9H 3O3BB 3TBSA 5T3XE 4JFPB 1QRNB 2QTEA 1KIPB 3KPRD 4HMCA 1ZT7A 2NX5D 4HIEA 4P2QB 3ZDZE 4MD4A 3U0PB 4LCCA 2P24A 2VDRL 2Y7QA 4DOHB 4DGVH 3SDCA 5BQ7B 2BVQB 2W60A 5MP6H 1JHKL 4NRXA 5J3HC 3FT4B 5HPMB 2W9LA 2YPVL 3BD5A 5T1DL 3FCTB 2HFFB 4G6FD 2E3VA 3ZDXF 2WUCL 3I6GB 2DJUA 5I17B 3VXUA 2O5ZL 3AXLB 1NMBL 2P8MB 3VFVB 5EUOE 5JOFA 4MCZA 1EBAA 4WW2A 1DL7H 2F54A 3BPNB 5IT2L 4NDMB 1E4XL 3NA9L 1VGEH 1WC7B 4NQED 1HYSC 4QF1A 3U36A 4N5EC 4U2ZA 2FL5A 2VKXA 3FB5A 3HE6C 3KYKH 1AR1D 1GZQA 4OAWB 3BPOC 1D7FA 1RZ8B 3W0WE 5E24E 1F4WH 4J12A 1KXQE 1K2DB 2VH5H 4RFNC 4I9WD 1PG7X 4OLXL 4FQQB 3MJ9L 5L7XL 4R0LB 1CDHA 2ZUXA 1NCBL 3RPIA 3EUUA 2MPAH 3UX9B 2HG5B 4KJYA 2BRRL 4EVNB 4G9FE 1QEWA 4ZYKA 1D5ZB 4DTGH 3C5SA 4DKEL 4OQTA 5GS3A 3KNBA 1QA9A 1V7ML 3QQ4B 4OLZL 2BNQB 4IHOB 1IC5H 4HV8B 1MIEH 4Y4HB 1M4KA 3GMRB 3MV9D 3GDBA 1M6OB 2B2XL 3QWRD 1UWGL 5T1LD 5CHNA 2I5YH 3U6RA 4UDTA 4RGND 1V3JA 4WTXA 3WEXA 3TP4A 4LCCC 1JPGB 1MNUH 3B43A 4FA8A 1JZ3A 4BKLB 1R5WA 1CGVA 2AGJL 5E8NA 3UBXG 4UINH 3SDCC 2D7OA 3AC0A 2VLME 2CH8A 3EO0B 1ZA3B 2CIKA 2A6JA 4S1DD 1FG2A 4G8GA 3QJFB 4LSSH 3DO7A 3NIFF 1KTDB 5DJYB 2D4FA 2XTJC 2L7UA 2GSGB 4LDOB 3O4LE 3Q1SL 3U4BL 1CF8H 3LEYL 3S98A 2GQHA 2Z8SA 3NTCL 3OPZH 1F3JA 2BSRA 1KTLB 2OI9C 2IANE 3EZ8A 2ARJA 2CK2A 1JGLH 2PETA 5E6IC 5HDOA 1KELL 3JUYA 4B41A 1MF2H 2XKNA 4GKOA 3UEZA 5JIPA 2FHFA 5F7KC 2R2CA 1MQKH 2XKSA 3X3FH 1MWAL 3L1OH 2FHCA 2VDNL 1AQKL 2XICA 1NLDH 1G9NC 1PQZA 4PB9L 4LCIH 4JB9H 2WBJB 5DURB 3I6KA 3ARGA 4LCUB 1CGTA 4AQOA 3P0VH 4CW1A 3T4YB 1U8MA 1CFNA 4DGVL 4KDTC 3K2UH 4UQ3B 5MP6L 1ED3B 1YNLH 4AENB 3P2TA 5EFIA 1JNLH 2VZ1A 4Q9RL 3MRJB 3T04D 4JFDE 3B9KA 4ZFFA 1KCVH 3GM0A 4JRYA 3WE6B 1CCZA 4AEEA 1K8DB 2PF6A 2FYYA 3ARBC 1DL7L 3MLSH 4ZTPH 3KXFA 3SKNA 5TPWL 2HH0H 4U1IB 2X2YA 3TJEH 3HPJA 5JQHC 1ZHBA 4XTRC 2FEDC 3A0OA 4HJ0C 3QIWD 3KYKL 1FVEB 2DS4A 3DUHA 3CDCA 4FOMA 4L3CA 5GRJH 5EC2A 5KSVB 1UT9A 1ZGLM 1XF5B 2F5BL 2JCCB 4NNYA 1F4WL 4WNQB 1LDSA 1T2XA 5K59F 3MXWH 3GB7B 1XIWD 3L6FA 4X7DC 1JF1A 2D7PA 2VH5L 3OKNB 4JAMB 3T0ED 4N8PA 2X4SA 3L3JB 4I18C 2VDPH 2G9HA 5IVNA 3P9WB 1S7VA 4FTVA 4WRLA 2JJTC 2AKRB 3SE3A 4DTGL 5I1LA 5C07E 5EZJB 1AQDB 4OZ4A 4QRPB 4BQ9A 5CP7B 1MJ7H 4C83A 1EVTC 4Y5YB 1KTRL 5IVOA 1WZMA 4UV7H 4JRXD 5CJXC 5TFSH 1HIMH 1IC5L 2DQGH 1MIEL 5LAXA 3U1SH 1FL5B 5FGBC 4QHMB 2LU4A 5SWSA 2Y5TB 2QSCL 3RZCB 5H37G 2I5YL 3RGVA 4PREA 3U7AA 3P4NB 5D5MF 2YD2A 1MNUL 5J11C 1XZ0B 4EUPH 1H15A 1KNOB 1FZOA 2DMKA 5T3ZE 4UINL 3P4LA 5DRNA 1DQDH 2HFEB 2W0FA 4PJGF 4JQVA 4UB0H 2P5WD 1MWAB 1D5IH 4MNQA 4Z7UA 4BFEA 2YPLA 3B9KC 1Z5LB 2GY7B 1W0WA 4LSSL 3REWB 2AXJA 1MCDA 3IVKB 3VU2A 1UYWL 2XQYG 2CUMA 2W1NA 1OD9A 2ID5A 4C59B 5EO9B 4ZUUA 5DJZA 1CF8L 2VLKB 1E4WL 4MJ6A 4PJBF 1I1CA 5C0GB 4B50A 4P99A 2MHAA 1JGLL 1HH6B 2FSEB 1TJIL 4MNHA 1MF2L 1HEZB 3VXNB 4X6DB 4L8DB 3QRGH 3ZSTA 4CJ0A 3LOWA 4GQPH 4HULB 1MQKL 1NMCC 1U42A 1Z3GH 1B2WH 3L1OL 1NLDL 5EUKA 5E6YA 3CFKA 4LCIL 1ZHKA 1XF2B 3T77A 4JB9L 3RDTD 4KKBC 1F4XH 1AD9A 3WHE0 4PLNC 5HDQL 3DV6A 4XXDA 3UYPA 4YX2H 2NW2A 4B53A 2VKWA 3C6SA 5GGRA 2DOCA 1JN6B 2VQ1A 3MROB 1YNLL 4YHIB 3TZVD 3QUZA 1MQ8A 2AJZA 4QXTB 2YHGA 4JANB 4QXWA 2HYMA 1YQ2A 5FK9B 4YNYA 1KCVL 1WBZA 3HA0A 3MFFB 4P57B 3VXSD 4XNMB 4NO3A 3MLSL 4GW1B 3BKYH 4ZTPL 3O41B 1BZ7A 5FO7A 1P6AB 2HH0L 4NKOB 2ICCA 3J7HA 3TJEL 1FAIL 3GSNA 3OGOE 5FYKE 3U7YH 3QIBC 2R2HA 4IRJB 3QXVA 4KKAD 1XGTB 2QQNH 4HEPG 1DBAH 1XF4A 3ARUA 3BPLC 5E7FA 1BJ8A 2O93L 3G04B 2V9RA 2AAVA 5DO2C 3V52H 1FFNB 3UPRA 1BD2E 3MXWL 1I1AD 3FMGH 4E41D 4P4KB 1MI5E 4WI3A 3PHSA 5I15H 4POYA 1WZ1L 1LMKA 2E27H 3ETBF 5AD0B 2VDPL 1R3KB 1NAKH 5J0BA 2R4RH 2YPKA 4XP9H 3V5KA 5DJ6B 2NXYB 1NGPL 5DA0B 3A6BH 3WFZA 4UV7L 3U1SL 1MHHA 1Q72L 1H5BB 1L4IA 2B5IC 2DQIH 2DQGL 3D85D 3IS1X 5FV2A 5ID0A 5L8KB 5MEQA 3UC0H 3AM8A 4N0RA 1JTTA 3MPCA 3KLDA 1NDGA 5BVPH 4BH7A 2IFFH 2FD6L 4HWUA 2D2OA 3BW9B 4L9LC 3C5JA 4LLYA 2ORBH 4OLWL 1NUNB 5D1ZA 5C70A 3VXUE 1U8QA 3PABA 5D1XA 2SEBB 4UB0L 2F54E 1QSFA 3CAFA 4R26H 1D5IL 2IBZX 4XMPH 3LKNA 3MNVB 1OP5H 2XNAB 2CLVB 5F1OB 5D1QA 5JDSA 2VWEC 5TDPA 1OP5K 3VXMB 2DL9A 3OXSB 4O2EA 3HFML 1O0VA 1JZ4A 4CVWA 2D7MA 3RVVC 3GMQA 5HVWA 3AY4C 3OKLA 3N1FC 1IZKA 5C0BD 2PW1A 4QNPF 4L4VA 3HC4H 1XR8B 3MNZB 3RVXD 4M93C 1JI2A 3S7GA 3QO0B 3E6FB 4WCYH 4LLWA 5DI8A 4RDQG 1OSPH 4PG9A 1QBMH 1FBIH 2Y4SA 3QRGL 1ZS8A 4KJPC 3O11A 4PLKD 3HNTH 4D2NA 2ZSWB 1AXIB 5KSAD 1I1YB 1Z3GL 2PXYA 3QUMH 1AGFB 2UUDH 3VGBA 4F7MA 3WO4C 5B39B 3SDAC 1ZGLP 4ONGH 3F7PC 1DN0B 5A16A 1F4XL 5FYJH 4N0FB 5B4MC 1K4CA 4YX2L 5CJBA 5J8OA 3C5ZD 4H20H 2CK0H 4B7LA 2UVEA 3SE4A 5C09D 2MQ3A 3HRZA 4U1LA 2IQAB 4PGCA 4GRMB 3IDYC 1PFCA 1I3GL 5GGVH 1OAQH 1JPSH 2E7LC 3STBA 4QOKA 3QFJA 2ADFH 5I16B 3FOMA 1LEIA 3S35L 3BKYL 1N0XL 4G8GE 3G5XA 5DTFB 4OCYH 1R3IH 3BQUD 2X70A 4YC2B 1YEEL 5TF1H 2P44B 3U7YL 1HHGB 1JHLL 4Q6YA 4YEEA 1Q38A 1E6JL 2BMKA 4AH2B 4ZQKB 2QQNL 1T89A 2QV2A 4Y1AD 3IXAB