4OCMC

Crystal structure of the rpn8-rpn11 mpn domain heterodimer, crystal form ib
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
VQLQESGGGLVPAGGSLRLSCVDSGRTFSSTVMAWFRQAPGKEREFVATIRWSGGNTYYADSVKGRFTISRDNARNTVYLQMNSLKPEDTAVYYCAGGTYYGTLSYKYDFWGRGTQVTVSSHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the proteasomal deubiquitylation module Rpn8-Rpn11.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase, protein binding
molecule keywords 26S proteasome regulatory subunit RPN8
total genus 29
structure length 125
sequence length 125
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ocmC00
4UQ2B 4GRMB 2CLVA 3O81A 3OV6A 4KJWC 3MV01 5HYQB 4LLMA 1RJCA 3F7YA 3F7RA 4JM2C 3HMWH 2A1WH 4NSKB 3X14B 1BECA 3VFTB 1JIBA 2LU4A 2YPLD 5IHLB 5BQ7B 5TE6L 1SEBB 3IB4A 1GZPA 3VXMD 5FDWB 1ADQA 1FGNL 3P9MA 1G9MH 4LCWE 4PS4H 3NFNA 1VDGA 5K93A 2X1OA 4NIKB 3DECA 3DHMA 2YD1A 1HHHB 2IJ0C 4HKBB 5TJWK 4HC1A 4A6YH 3SDXF 2ICEB 2IH3A 2VITB 3SDDB 1LDPL 5SWSA 3DI2B 2FIKA 2VZTA 2ATKA 4U6HB 1LE9A 5C8JB 3LEVL 2AEIT 4HH9A 2EZ0C 1JGVH 4EIZC 2AW2A 4U1NA 5C0FA 1LO0H 2B4CL 1RIHH 5DJ0B 4B0MM 3DUHA 1A7QH 3QQ3B 4U1NB 4LHJB 4XB7A 2R0WL 3C60C 3QT2A 4WI7A 3P4NB 1BFOA 4N90E 5J13C 5CILL 5TPWL 3S96A 2FIKB 3W0WE 5D7IA 2W9DL 2BNRA 1PDKA 2D0HA 4P2OC 5DQDH 3OQ3B 3O3EB 3CSBA 5GGTA 1CWVA 2GJ6D 4U05A 3HS0A 4Y2DD 1R24B 3NFNB 1NCDL 4WV1C 3OJ2C 2GJ6A 2DD8H 2I27N 2R0LH 2CIKB 2H32H 3LRGA 1SEBA 4LF3B 4CN6A 1NGPL 1I9RH 1IQDA 3WXVL 3SDXE 3BEWA 4H0HB 2EC9T 1WBZB 3VD4A 4OQTA 1D9KC 3W2DL 4LLMB 5A16A 5HYQA 4KJQD 1KTRL 4UQ2A 3KPPA 3CSGA 5D2LE 1ZVHA 4JFZH 1A9BA 2ADFH 1B0WA 2QHRH 1M7DB 1FV1B 1TLKA 3S36H 1UYWL 4NDMA 5D93B 2B1AH 1IGCH 3CH1B 3VXRE 2R4SL 4U7SA 2VDKL 3U6RB 3MV9B 2EDBA 4LSTH 3X13A 4ONGL 5DRWA 1JPSL 1CT8A 1LP9F 4N0YL 3F65A 3IS1X 3RWGB 3GMQA 3VRIB 5F6HI 5ABDE 5C0DB 4IRJB 4MDJB 1FNAA 4N68A 4YIQA 3P77A 4JO3L 1C08A 1S9YA 4LSRH 2MQ0A 1E0OB 2FBJL 2X1QA 1UM6L 5E7FA 5TE7L 2O61A 3L3KA 3LQMA 4DJMA 4YXLL 1FORL 3BPNB 3Q0HA 4JKMA 5GRYA 2DQDL 4XAKE 3ZKQD 5J8OA 3KYOA 4WHDA 5GIRB 3Q3GB 4X98B 1EXUB 3L3HB 5JQHC 4HAGA 2P7TB 4LSSL 2BRRH 4KTDL 1N5AB 3S35H 3O2WL 3O3AB 4G42B 2QADD 4ZNEA 3OXRA 3HUJA 2SEBB 1B88A 3BSZH 3UBXB 1P5VA 2JCCB 3NH7H 2ORBL 1BVLA 4KI5D 3QAZB 2DQIL 3OAUL 3GKZA 4CNIB 2H41A 5EUOE 3UROR 4V1DB 2ATPB 5F97E 3QNYA 4NRYB 1NBYA 4XVJL 5HHME 1BQHB 3FB7B 2IAND 2YZ8A 3W82A 5F9AC 1CBVL 1JWSA 2WIIB 4PRHE 2YD5A 1F6AB 5BCAA 3IDYB 4WFED 5AG8A 3ARGD 4M93C 3D3VD 3DXAA 3LQAH 1F11B 1UWXH 2PF6A 3SY0B 5MEPB 2VLJB 2H2PD 4YHOH 4F3FB 5IMMB 2AVGA 1R3IH 3Q6FA 2YEZB 2B1HH 3VWKD 5FO7B 1AKJA 4HT1L 4LCCC 3KLAA 3QEQE 3PABB 3BKCH 1T5XB 3FFDB 3LN4A 2Y23A 1NCUA 1EV2E 5E99H 4HMCA 3QQNA 1KCVH 5T5NF 5BW7C 4S2SB 4M9PA 3QHFH 4XP1H 4ZYKA 2WWKT 1XT5A 5EPMB 1I1AC 2CGRL 3FMGL 4QRPE 1I3VA 5D2LB 5AZ2H 2IGFH 3CFBB 4FFVD 2GJ6E 3BX7C 5IIEB 2CMRH 2E9JA 4Y5YA 1U8OA 2VQTA 3CX2A 4JRXD 4JZNA 2AV1B 2KDGA 4N8CH 4YHYB 1X5HA 1OLZA 4MAYA 1D5XB 1P6FA 3VXUE 3RGVD 4NO0D 3FFCA 4K23H 3FT4A 1FRGH 1G9NL 1EX0A 3K2UH 3T4YA 1CFTB 1F97A 5EB9A 3BRDA 3BIKA 5FM4A 3D48R 3MPCA 3S5LA 4Y16C 1C7SA 4HKXA 4TUJB 1OPGL 5GISL 5DJ2A 5DZNA 5DRXB 3L7EA 4NQCD 3VXSD 1URLA 5L2KD 4EI5D 4LSTL 2B4CC 2X4SA 4L9LC 1Q0XL 1XH3B 3QNXB 2D7OA 5EFIA 1NEZB 4K8RH 3WFHA 1Z5LB 4Y4KB 2ADGA 4FQXA 1MRDL 1G7QA 3HCVA 2R1XA 3IFLL 3MRNA 3VFNA 3C5ZB 1QACA 1QLFA 5FECA 2G5RA 4XP4L 3QUYA 2OTWA 2R9HC 4XC3H 1EFQA 3IFNL 4JB9L 4LCWB 4NN7B 1NMBH 2KUTA 1QQDB 4M1GL 5GRXG 2VXSH 1F4WH 2FGZA 3X3FL 3UPRB 3IAQA 5KVEH 4XVTL 4P59H 5EIVA 3CPLB 5F72S 1XGRA 1NFIB 4M03A 3FO9B 3FONB 4RA0C 2I60H 1E4WH 4HWNA 4M43L 4N8PA 3WS3A 4PGCB 3T04D 4E5XB 4H1LG 4P4RA 3T1FA 1NDGA 4KU1A 4KQ4H 1DE4B 3MRGA 4KRLB 2WMPA 4KQ3L 1CLOH 1OTUD 3IJYA 5JORB 5GS0L 5DURB 2I25N 4ZOAA 3G04A 3MUGB 5FYKE 3TGXA 4CJ0A 5KVFL 1C5BH 4LAQH 4QXUL 4CMHC 1EAJA 3HI1B 2JJUA 2H45A 5IHZB 4R0LB 1NLBH 4LCIL 3LZFH 3SE4C 5CWSA 5KTEL 4KK8D 1UFUA 4FZEL 3EYVA 4G9FA 4JGUA 3TM6A 4H26A 2BHUA 2DQHH 2EDFA 4BELD 1RZ7H 3PWNB 1QA9A 3SDDD 4YQXH 1FDLH 5DZOA 1AJ7H 3H42L 1DVFA 2W0PA 5GRUH 4M6OH 4WEBH 4J8RA 4YQXL 1CDUA 4Z7QE 3MA7A 4JN2A 4OKDA 4X4ME 5FKPB 1F3JB 4U1GC 4L4TB 2GTWB 4Q74A 5TE7H 1S5HA 1TJGL 1G0XA 4I5BA 4XPGH 1ZLSH 4HJGA 5E8PA 3AUVA 3H9YA 3QNZB 3DMMB 4YDVB 4JRYD 3TJEH 3LKQB 1EMTH 1UQSB 4NQDB 1G6RL 2BX5A 4K8RD 1CFNA 1R5VA 5DXWA 4WI8A 4OD2A 1X5KA 1QSEE 4XCNB 1AGFA 4KQ4L 1ZA3B 4M61B 3ULUD 1YEEH 2UY7A 1UGNA 3JVGC 2ZSWB 4JZOB 4Y5VC 1MELA 5D72L 3KR3H 4GRWE 2GK0A 2R4RL 3L5HA 2KQNA 1I7TA 4H1LB 3HAEA 4GBXD 4NM4L 3LHPH 2V7NB 3FHQA 3WKNA 3RTQC 2MFNA 12E8H 3THML 1UXWB 3QHZL 1KB9J 3I3BA 1FFQA 1AXSA 4G9FD 4P46B 3PXJA 4LVHC 1YMMB 3VMOA 1F4AA 2ZKHL 4I4WA 3GNML 1KB5A 3DBXA 2HRLA 4YXKL 5T33L 1XF2B 1WWAX 4PJ9A 1MJ8H 3GSWB 3DV4A 3I9GH 1FAKT 4MNGA 4J3SA 4LLQB 3T65A 2VDOL 3SN6N 1FNSL 1HHIB 2DQGL 3MR9A 5BJTA 4F37F 2UVFA 2GY5A 5M7QA 4QRQA 1TVBA 3WLBB 5LGJB 2PTVA 2Z9TA 1NGWA 4HX1A 2YUWA 3V5HA 5GGQL 4HGKC 1A3QA 1D6EB 1Z6JT 1KT2A 1T04A 1AI1H 2P8PA 5D9SA 3H7BB 4YO0A 4W70A 2GEEA 4KI5C 3K2UL 4Z7NE 4OSUH 2V2XA 4G8IB 2FR4B 1J0HA 4Y2OA 3GBLA 2NY7L 5J1AB 2IPKA 4MZ2A 1YY8A 3DO7A 3SGJA 1GIGH 2XZQH 3GSXA 4PJXA 4AENB 1MCQA 4N0CD 4OB5L 3TH3T 1JZ8A 3GSUB 1KGCD 2A73B 2Z8VC 3ARGC 4LVEA 1RPQA 1MFAH 4BYHA 5BS0E 3AGVA 2GJZB 2XWBA 3MV8D 1A6UH 3QEQB 32C2A 3QUXD 2BFVH 3F6IA 2CRMA 5JOFB 4MXQD 4F57H 3QDMA 4JJ5B 3T0WA 1P5UA 2IANE 2VLKE 3ULUH 3INUH 3OHXA 1BVZA 5E95B 1HHGA 2R4SH 1FFOA 3ARSA 1ONQB 3P73B 4X7TB 4R2GB 3BRGC 3JV0A 3MV7B 4JFED 2BSRA 3LRSB 4M7LT 4QRTA 4MA1B 2VMFA 1P4BH 5I1JH 4LLAA 4FQXC 1K4CB 1T0NA 4DGIL 1N4XH 5E1AB 1CG9A 3PP3H 4C56B 1U8QA 4X5XA 2VXTH 2XWJA 4WTWA 4EN3D 4R4BB 4NJ9H 4Q2ZA 4J4PD 3HC0B 3C6LC 3DROA 3QDGB 4P3CH 4H0GA 1J0ZA 2F53D 4LRNL 5F7UA 1NCDH 4MXWH 3MQIA 3SJVB 5JW3H 4KVNH 3TBTB 4F58L 4G43A 4QF1A 5JW4R 4XVUD 4OM1H 5D7LB 5FB8A 3U7WH 3CFCH 5KVGL 3LV3B 4N0RA 3RUGA 5EU4A 4NQUA 4M8VA 4JQXC 4QCIA 5DFWH 4L8BB 1MWAA 1ZHBB 2HJFB 2R0KH 4TNWK 1FN4B 2EEDA 3HC3H 2DQJL 4I18C 1AGEB 3BJ91 4NO2A 3MACH 4PRNB 2NY3B 3ZKSD 4KDVA 2BHYA 4R4FL 3CFIC 2OQJA 3OAYK 3BH9B 2VUYA 1UWGL 5IK3B 1RZGA 4PJBB 1K2DB 1EHAA 4HBQA 1CD9B 4OV6F 4OCSH 1Y0LA 3H42H 1AJ7L 3IS0X 4ZNCD 1Q38A 2ICCA 3IFPB 1K4DA 4NQXA 3VXMA 2GT9A 5EBWA 4RGNB 3WHXB 4KJYA 5GGRA 3OKYA 3P0GB 4PLOB 4G6ML 1WICA 1T89A 2ITDB 2PYEA 2O5YL 3BT2L 4Y7MA 4RX4D 4Y4FD 3SGEI 4TRPH 4IM8A 4AK1A 2Z93A 3GIVB 5IBUG 3V6ZB 5BVPH 3ZDZE 4X4ZA 4HK0B 1Q9KB 3CFJB 3HRZA 4HJJL 4P5TA 1YPZA 3FB6A 4EZMA 1DUZB 2VSCA 3CH8A 1R0AL 1EHLL 4YBHA 3F7PC 1VPOH 5CGTA 1JI2A 5DUPL 1RFDL 3WIHH 3AY4A 4X9FA 3T0XA 4DUXA 3KNBA 3THMH 4HK3J 5F7LB 5HJ3A 3BUTA 3BMVA 3IDXL 1FVDB 2MNUA 4W68A 2XTJB 3MGOB 1A5FH 1FAIL 5DD1H 3MLPA 4GXVH 5CZXD 3NGBB 1DCLA 3PJSB 5DYOA 5HHNA 2R1YA 3GK8H 4Z0XA 2VL5A 5DJ8A 4GG8B 4JFFD 4XMLH 3VFMB 3LDBB 4FFZH 3SDDC 4XBGB 5IOPB 3C5ZD 3BD3A 5B3NA 2H6PB 2PO6D 4G6AD 4L3ED 3JUYA 2R23B 4AEEA 4M62H 4KVCH 2C3WA 4N5EC 1DANU 1FG9C 1JN6A 2BVPB 4S0TD 3TVMA 4L4VB 4X9BA 5IUSA 3HMXL 4RGMB 2DLHA 2HLAA 1Q0XH 1LNUA 4Z78A 35C8H 1XGQB 3LAFA 4JY6B 3RRQA 2M26A 2PO6B 2Q76B 5CKGA 3QEHA 1CLZL 3C9NB 2I9LA 5J13B 4JM2F 1NGXB 2QJDA 4RIRA 5CKAA 5DEFA 4YDKH 4DKAA 3EO1B 3ZHKA 5E5MA 1BHGA 3LPFA 3TJHC 2ZZUT 3VJ6A 1CE6B 1GGUA 2R15A 4QLRA 2WNGA 4PRDA 4YJZL 1Q9OA 1IT9L 1I1AB 4OLWH 5C09A 5T1LB 4YZFF 3O3BB 4JFOA 5ID1B 1J8HA 5C08D 1FZOA 1WAAF 3V2AR 5FKAB 1NC2B 5IWLC 4ZDHA 2BNRD 2RHEA 4QRUB 1J1XH 5L9DH 1NMCB 1OSPL 1MQKL 3DX8B 1MFDH 4KKLC 4M48L 4GXUM 3SPVB 2JJTC 4AIZB 3RTQD 1EAPA 1IEBA 1DBBH 5EUOB 3E6FA 2X2YA 5E8NB 3U0PA 5EOQL 2EDDA 4NN5C 3IFOB 3RWDA 1FGNH 5EBMB 5FYJL 4W6XB 4POZD 3BMWA 4KXZI 1OAYH 2XICA 1H3GA 4FABL 5JHLH 2I9TB 2ZP0T 4U3XA 5JHDB 1U8HB 5ENWB 1A21A 4XPFL 2A9NH 1V7NL 4P5KA 3RX5A 1OTTD 4DZBA 1I7ZA 1XF5B 4JG1H 5DQJA 3UDWC 3P4OA 4LKCA 1S78D 1VCAA 1RU9L 3EO9L 3SKUD 1KN2L 2ZCHH 3VD7A 3AY4C 2VLRB 1GC1C 3RQ3A 3G5YB 1ACYH 1GAFH 3HPJA 4TULH 5F7DB 3OKMA 4IRZH 3EDKA 4L8SB 4KKNA 5I1EL 3NFSH 3K8MA 5EULV 5F21B 2M2DA 3NIFF 2CRIA 4ISVB 3OKOB 4CMMA 2O93L 3CU1A 1R0AH 1CDGA 4KHTH 1FLRH 3WL9B 4GRLC 4P57A 4TSBH 4DUWA 2V2TA 3PQYA 5E2UL 4MYWB 1HXYA 1WF5A 3SHSA 5FK9B 4HPYH 4WRLA 4WUUB 2E6PA 3PQYD 2IALA 1D5IL 4HMDA 1MIMH 1GGTA 3DETD 4WV1B 3PWVA 1DBAH 4ZSOB 1EO8L 2IALB 4M5ZH 4MA8H 4WUUA 1SJVA 1G9NH 1KTKE 2IG2H 2A9NL 3FQRB 3PQYB 1MI5B 4P57B 3LIZH 4FP8L 5B8CA 4ODWB 4DUVA 3GMPA 3U9UB 4KVCL 4OZGF 2BVYA 5CSZB 3TZVB 5D70L 4JREB 1J1OL 2HFGL 4H5SA 4OGXL 1RMFL 3OBAA 4LARH 1K5NA 4P2YA 4CU7A 2QBWA 2ZOLB 3O6FB 4WFHE 5H94A 4XXCC 4P23C 2E9BA 1HDMB 1MHPH 1A6AA 3PWPD 3QFJB 1CE1H 1Z3GL 2XT1B 1V3JA 5F7DA 3HPJB 5ALCL 2Y7QA 3W9EA 4BSVA 1QSED 1QRND 3BP7B 2VLRA 3EYSL 4J4PC 3KYNA 1F58H 1WZ1L 1WTLA 4WDIB 2YPKB 3D2UB 4PJEF 1RZJL 2E8ZA 1AGCA 4NFDA 4YWGH 5HVGB 1XF5A 4OZIF 4DZBB 3ISWA 1FH5H 1NUGA 4JKPH 3GMNA 3TN0B 4HIHB 1U8HA 5ENWA 3ILQC 1RUKH 1I7UA 2BNUB 2A0LD 1PAMA 5HHOB 4XPTH 3GBNH 4TUOB 5K9OA 5DR5H 5JIHA 3GJFA 3WNLA 5DC0A 3E6FB 4V1DE 3U0PB 5EUOA 4Z7UE 3I6LE 4AIZA 3C8HA 2XTLA 4JM4L 2CQVA 3DX8A 1E6JH 4Y5YC 4QRUA 3RIFF 1NAKH 1GHFL 3MRFA 5FKAA 1FZOB 1J8HB 1ZHLB 4PRPE 2AKRA 3Q48A 5C09B 5T1LA 1R3JA 1SJEA 1I1AA 1Q9OB 4ZD3L 3KHQA 5JPMA 4DZ8B 3EO9H 3REWB 3K4AA 3VJ6B 1YYLL 3QEUA 3RUGE 2VLJE 4MMZC 3VDCA 1N7MH 3EO1A 5CBAB 1AO7D 3M8OL 5DEFB 4F7MA 1CS6A 5MEQA 3PP3K 3EDFA 3VG9C 5HYSG 4XNXL 2JJVA 5EOTB 2PO6A 2APBA 1Z9LA 2W9DH 2PXYA 4U1IB 4Z78B 3DVGA 1LNUB 5EZIH 3DLQR 3NCYP 4RDQF 1J88A 3SDYL 5AD0B 3HB3D 4UT6H 3MLXL 4HJ0D 1XAUA 4RAUB 4DKEH 2RBLA 2BVPA 3TVMB 5F7NC 3SCMD 1K85A 4CBPA 4K3JH 4IRSB 3U2SB 3TO4B 1A6WL 5DD3L 3QHFL 4XBGA 4YHLL 1A14L 2AK4A 4MLIA 1YYMH 5FA4B 2D4FA 2X4UB 3GRWA 2CO6B 3D87B 2ESVB 5GS2H 3MGOA 2EO9A 4R4FH 3RNQA 2VDLL 1BAFL 3JXAA 4Y4HD 5FFLA 3HE7D 3KNBB 5I1AA 1ORQA 1S3KL 3MLVH 4NQSB 1DEEA 4C58B 3MO1A 4PJ7B 1KEML 5IB1A 1TTFA 3D69B 5L0QC 3QIBA 3RBGA 3MREB 1U3HB 1DUZA 5JW4M 1G6VK 3FB6B 1FL3B 4JO1L 4MNQD 2VDMH 3V6OE 1AGDB 4WENB 2GUOA 1FL5B 2R0KL 4U1KB 1LWRA 2Z93B 3C87A 4WNQA 4PUBH 1AO7E 1CL7H 4ODTL 1R6VA 1FIEA 3MXWL 5JIIA 5C0CB 4ZUTB 4AT6B 2C3HA 1LD9A 1UACH 3GMRB 5EU6B 4OZFA 3BGMA 4NYLA 1J05A 3C60B 4HWBA 2YA1A 4I3GA 4KJYB 5FGRA 4TYUA 3VFOB 3CSYB 2R8SH 1QFWI 3UPCA 5EBWB 5SX4H 5SX5H 3MUHL 2QR0B 3VXMB 5ANMB 4NQXB 1NUFA 1Q94B 4ZXBA 2J88H 1DBML 4ZFZA 3OXSA 2Q7NA 2V2WA 4JFFE 2F58H 2J6EA 5DEGA 1OT2A 4MWFA 1RZGB 4FFVC 5CMAA 4F15B 4I2XB 5GZND 2FB4L 5I1CL 1R5IB 3TA3A 4XCYB 5DK2B 3ZE0E 4KUZL 4S1RH 3N9GL 2F74B 2F8VA 3EOAA 4LOUD 5I19L 2F8OA 2C5DC 1AGEA 2BY0A 4O2CB 1O7SA 1EJOL 1FN4A 2PR4H 5KJRH 5GS1C 4PP2B 5IB2B 3QI9D 4HG4K 5EU4B 1KPRA 3T3PE 3LV3A 3IGAB 4FXKB 1UXSB 4LCUB 4FS0A 2CR3A 3O9WB 3PNWA 3TBTA 1YZZA 1NCWL 5E5UB 3SJVA 1MQKH 5E94B 4X6EA 3S3PA 1JF1B 1RY7B 3O6KH 4OBRA 4F9LA 4BFBD 4KK5C 2QSCH 3RZCB 3DROB 1YYLH 1FHGA 3DARA 2IAMB 1IC5H 4Q2ZB 1G7MA 3PGFH 4FZEH 4YFEA 3BKJL 2P48B 3BDYH 4GMTH 2VDQL 2EEBA 4XNYL 2FX8L 1CG9B 5E1AA 4YXKH 5T33H 1WIPA 5CZVH 5EZLA 4G5ZH 2G60L 2L7UA 1OP9A 1BF2A 2QHRL 4P2RB 1C16B 3MRCB 2XOTA 4HAFA 3ARZA 4B50A 3MV7A 4FXGB 4ZS6D 3TWCL 4U1MA 4FQHB 4Y19E 1U92B 2GW5A 4RMQA 1TJIL 3EYUH 1GGIL 2VLME 4J1UB 2ADIB 1XFPA 4P3WA 4WWKA 1H15B 4U7KA 3M17A 4X4XB 3ULVE 2VKXA 1QYGH 3WUWA 32C2B 2AI0L 3C8KB 2GJZA 1KCUL 1NQBA 3VXTA 4BUHA 3JV6B 4HGWA 2CDFB 3DSNA 4MNHA 2Q3AA 4WW2C 5FCUH 3ARFD 1H5BC 3PHQA 2DQDH 2HT2D 3TYGH 1IQWL 3GSXB 4PJXB 1E6JL 3CDCA 3BRFA 2XKNB 2Y36H 3QEGH 2IQ9L 3U0WL 3UO1H 4NFBA 4AMKH 2HLFC 4PRIA 2V2XB 2F5BH 4G8IA 4E42A 3MUZ1 2APXA 3MNWB 4DEPC 4AEIL 4FXLA 1TVHA 4M6NH 3H7BA 1BQHG 3BN3B 2WW8A 3A67L 4NNPL 3MMEB 4IMLA 4OLZH 1AD9A 1D6EA 5FYLH 5EIIA 4MJ4A 2VQ1A 2NZ9C 4L29A 4LLWB 1IC7L 2FYYB 2YOCA 3CX5K 3PP4L 2ZPKH 4ODSL 5D93C 5SWZE 1JNLH 5T5FL 4QRQB 1IC4L 3SKMA 3SE9L 5KVMC 3L3IA 1F3DJ 1UCBH 2XN9E 1LGVA 5B4MC 4Z6AT 4JQIH 4Z0BH 3RWIA 4F8QA 1ZHNA 4F7CB 4EI5B 4OI7A 4G8GE 2YRLA 5L2KA 1MREL 1RIUH 4MNGB 4LGRB 5HPMA 3GSWA 3X17A 4F9PA 2P8MA 4G6MH 4JGMA 3LKNA 5CEYB 3ILQD 2P49B 1A2YB 2EYTB 4XAWH 1S7SB 4FTVE 3C5JA 1AFVL 3TCLA 1AXSB 4P46A 1UXWA 4ORZC 2FJFB 3HMWL 1LE5A 5C09E 4OFIA 3QXVA 4X6DE 4DN3H 1CGWA 1D5BA 4X6FA 4R8WL 2W9EH 4H1LA 2I5YH 2J6EL 2GK0B 3O6FD 3GHEH 1TZGH 5HSFA 4OIIL 1BJ1J 2ZSWA 4JZOA 4JY4A 4L3EE 4ZOEA 5LGKA 3S34L 5IW6B 1HHKA 5J1SC 4QRRE 4X4YB 1AGFB 4XCNA 2NW3A 2V6HA 2Z92B 4MSWB 5IB4B 4GW5A 3IKKA 4DAGL 4PGEB 1CFNB 4YHKL 4A6YB 3HI6H 3CCHA 4NQDA 4BK5A 3JWDH 1ZLVH 4XNYH 3TCXA 3NAAL 3DMMA 4YDVA 1JWUA 3FCTB 2VLRD 4OD3L 4QXWA 5E8PB 4J6RL 4NZUH 3DVNB 1U8KB 3BFOA 1A6VL 1LK3H 3HB3C 1II4E 4JRYB 4D9LL 3V52H 1XZ0B 5E2WH 1OL0A 4XPHL 4MJ2A 1HK6A 4LLUB 1VADA 3WIFB 5FKPA 2VZSA 1RZKL 3MA7B 1HKLL 1RU9H 5CEZE 4QOKB 3OF6D 1JV5B 5C0BB 2EYSA 1E4XL 3PWNA 1N4XL 3U36B 1TJHL 4H26B 4GT7A 3MCKB 1S7QA 4LPVA 3LOWA 5CILH 4NO5B 5E6ID 1FIGH 4Z8FL 2EDKA 5JOPD 3MUJA 4PGJA 5MHSE 1FNGB 3MCG1 3JV4A 4G80A 2X42A 5I1GL 2I07A 2X4OA 2GIYA 2R2HA 1XGUA 5E70A 3WHE0 5IHZA 3HI1A 1A4KA 3MUGA 3G04B 1KCRL 1T7VA 5IB5B 1MHHB 2NNAA 1KENH 1U8NA 5GGQH 4M48H 5DJXB 2QSCL 4ZFOA 2DTMH 4WWKC 3EDEA 1I8KB 4KUCD 4Y1AD 1X5GA 3HHRB 5JHDE 3EO0A 4EQ2A 5CD5D 5ICYA 3QG7H 1MH5A 3UJJL 3OL2A 4IIQA 3QIWB 1I7RA 4GAYA 5C0IA 3CDFA 2B20A 3ARVA 1UKTA 3UPRA 4Y5VA 1LEIB 1X5AA 1PYWA 3CK0L 5IVZA 3T0EA 4D9LH 2C7UA 2PN5A 4KTEL 3BP6A 5SWSD 1JGDB 5FUOH 3ZZ1A 2ZUXA 2D3VA 4YEFA 1QRKA 1MY7A 4RFEB 1T20A 3VXUD 4PR5A 5CJQH 3UYRL 2CRZA 1AHWA 4M7LH 4FQXD 2R1XB 1OWWA 4I48A 1G7QB 4GH7B 2ICES 1IM9D 2ARJB 2FIRT 1XIWD 2DM2A 5KSUB 4L4JA 4LGSB 5EFIB 2OM5A 1A7PH 1XH3A 5B38G 2X4SB 1MCWM 2BZDA 3KPSE 3O8XC 1PQZA 1K8DA 5T3XH 4GS7C 1A7OL 3MA9H 3OWEA 1QP1A 5DRXA 4R8WH 2AXFB 3S88H 3RIFK 2X4QA 4TUJA 1QVOA 4RDQG 2YPLA 4NZTH 4TQEL 2P24B 2GCYB 4IRSC 3U0TA 5KVEL 2QSVA 1CFTA 4AL8H 3NFPB 3T4YB 5DRZA 4YC2B 2XZZA 1AR2A 2D9QB 4QTIH 1UJ3A 2YWYA 2FGWL 1HOCB 3QQ9C 4BJLA 3G6DL 4F7TA 4MAYB 3V8CA 5FYJH 1QTYT 4QNPE 2O5XH 2YUXA 3FQTB 3HZKA 4LLDB 5DR5L 5IEKA 1GPOL 8FABA 2G75A 3RTQB 3JTSB 4XI5D 5IIEA 4NP4H 3UX9B 3PWPE 1B3JA 3CFBA 2MKLC 3NIGE 2OI9B 5D1QC 5D2LA 5DRNA 5BVJA 3LIZL 4M1CD 5EPMA 1A6PA 3U7YH 4ZYKB 2UV3A 4NCC2 4OGYL 2BRQA 3CXDH 5CGYD 1XGPB 1Q1JL 4FG6D 4OI9A 2Q6WA 1OGTB 1L6ZA 4NOBA 5FO7A 4IIQC 2P4AB 4V2CB 2R69H 2WUBL 3PXHA 5CJOH 4IOFD 4F3FA 3IYLW 3EKCA 5IMMA 4M6OL 1QEWA 5TH2B 3V95A 1OGAD 2A77H 1F8TL 4PV8A 4X80L 1UCBL 2XIDA 3ARRA 1YEGL 1X44A 1JTTA 3U4BL 2VLJD 4HHAA 3V6FA 5I15H 5JPNB 5D2LF 4WO4A 1QFHA 3MZTA 1T83A 2PNDA 4TSBL 3W39B 1I8MA 1BQHA 4WCYL 3QNYB 4U1HA 1ES0A 3O45A 4YFLI 4ZO6A 1DQLL 2FATL 4PJIB 1IGTA 1JPGB 2NR6D 1QBML 1DDHB 1EGJH 1BVLB 2YMXH 3QO1A 1BZQK 1RSFA 2EDRA 3UBXA 4HXAH 1M71B 4RWYL 3PWJB 1GH7A 4G42A 4LIQE 3U48A 2WUCH 3L9RA 3QCUH 3WJLC 3VXRD 4GQ9L 5EZJB 1BJMA 4K94L 2WWMD 4CN4A 3QXDA 3B9AA 3Q3GA 3CFKA 4LNRA 2BNQA 4RWHA 5JO5B 3BGFC 4UOJA 5B4MD 4S1DD 3SDAC 4UDTB 3VXOA 4I0PC 1HXMA 1YMHB 3LKRB 1KEGH 1SMAA 5T1KB 4HKJB 4JGJA 2EIEA 3BW9B 4DVBA 4UIMB 3KG5A 3VI4E 3BYYA 4HQQL 3HG1E 4ORGA 4OT1H 3D3VA 3D39D 5DJAA 4WI3A 3VFRA 1ACYL 1GAFL 1T7ZA 4QHNA 2WIMA 5C0DA 3WDJA 2HJKA 2JE8A 4XP4H 4HUKB 2BC4B 1CT8B 4S11A 3NZ8A 5FGBA 1Z9SA 4KHXH 3VXNA 3RVUD 2AJZB 3IDIA 1NCBH 4D8PA 2RFXA 3MOBH 3HNSL 5IEHA 1ZKAA 4FFWD 1G7PA 1JYVA 5C71A 4IMKC 4NC1C 5FF6B 3VXRB 1E4XH 4M6ML 1N64L 5GPRA 2X4NB 3MLZL 2BNRE 3VGGA 2C4FT 5D5ME 3CVHH 2RB8A 3B6SB 3ARBD 1ORSB 4MZ3A 1CN4A 2W92A 2XRAH 2Y4SA 5LCVH 4AEFA 1ZMYA 4NWUH 4RGOL 3O4OC 2NY7H 5HI4C 1GL4B 3BEWB 3QQ4A 3VXPB 4NWUL 1IQDB 1S9XA 5DTFB 2ZJSL 2NX5B 4IOIA 3U7WL 1CXIA 1AGBB 3BISA 3OX8A 4F7PB 4ZG1A 5AYUL 1FG2A 3KPOB 5J9PB 4Z77A 1KBGL 4R3SB 1KJVA 5GRVL 3TIEA 3S4SB 3GM8A 4NKDB 3O3EA 2KQMA 3LQAL 3STLA 4UV4H 1BOGA 4HH8A 5L0QB 4KY1L 2NXZB 4ODTH 5KW9H 4LSQH 3DURB 2N4IA 2XQYK 5DMGD 5DLML 1BFOB 1MJ8L 5IROA 4JKLA 2OP4L 2R8SL 5DJ0A 5FGSA 5F9OL 4J3XA 1J87A 4YUEH 3TVMC 2GAZB 4RFOL 1BGXL 5HHMB 3F5WB 4B5EA 5C0CD 5C8JA 1YDPB 3VGHA 2EDWA 4JFHE 1X5JA 5A40E 1U2HA 2FEDD 4GRLB 1FYTD 3TEUA 2DQUL 3R8QA 4HKBA 4KK9D 4JPKL 4L1HA 1P6AB 4MJ6A 3WJJA 1I8IA 1CICC 1GRWA 1FYTA 1P7HL 4J7RA 3DX6A 1HINH 3P9MB 5FDWA 2BY3A 4KAQL 3GFUA 4FQIH 1DQJB 3TBSA 4XVJH 1T0PB 4M1DH 3VFTA 5F9WB 1HHJA 4G7YH 4NSKA 2X4RB 4MJIB 1IJ9A 4NQCA 3C60D 2CLVB 4HSQA 5EIQA 5T3ZL 4ELKA 5HGBB 4H88H 4LEOA 4WI9A 2ZUWA 4MQXC 4PY7A 4HDIB 3T0ED 1SVZA 3LB6D 3HFML 3P4MA 2WUBH 1OAKL 1A3RL 4L3EA 3CFDA 1P7KB 4HLZH 4LASL 1FSKC 4JEGB 3L3OA 1HSAB 4XNZB 4K7PH 2RR3A 2FHCA 1GZQA 4ZUVA 1JCKA 1Q1JH 1ZANH 5KANG 4U6YB 4HUXA 5D5MB 1JE6A 3B8SA 4NNYB 5LXGL 1MJUH 3QUMA 1TQCC 2FD6L 3UXFA 3FFCE 1N2RA 2D03H 1WWBX 3VFWA 3KPMB 4P48A 3KLHC 4KROB 3QUZB 1RZ7L 1FYTE 5AZEH 3F7VA 1NC4A 3GKWL 3L3GA 1AD0B 5DUBB 4RAHA 1KXQE 3QSKB 1OSZA 2V17L 3VCLA 1JFQL 3HZYB 4OLUH 5J11C 2FX9L 4I77H 5D1XB 1A7RL 4R96B 4G8EA 4FZ8H 1C1EL 1JRHL 5C0JB 3T4AB 1B4RA 3BN9D 3AB0C 3MJ8A 4XPAH 2B5IB 4LIQL 4ZAKC 2Y5TA 5DHXB 1VHPA 3D3VE 5IQ9A 3QDJB 3PV7A 4M1CC 2Z31D 3WDIA 3QH3A 4HV8A 1KBGH 4OV5A 5HVHB 2BY1A 3FHAA 4UIKH 1CYGA 3C6LA 3MRKA 1AO7B 4OLYH 1B6UA 3HFMH 3IU4L 1MFAL 3KJ6L 3QPXL 1TZIB 4XCCL 5SWZB 1Y18A 3VMNA 3K8KA 3B9DA 4FABH 2OL3A 5EBLA 2R0ZL 4MA3B 5C07E 3IF1B 2J4WH 2OSLB 3KXFD 1LDPH 3NCBB 3OTTA 5FYJE 4LCWD 5HYFA 2BNQD 4A2LA 2EKJA 5K9KA 1CU4L 4KV5E 1MJUL 3D6GA 1RZJC 2DQEL 5I8EA 3BH8A 3JUZA 4W4NA 1RIVL 3L3JB 1DQQA 5C0AA 4NNXB 4F33B 5KN5A 1XIWB 2EC8A 2PW1A 3MFFA 3ZDXE 4CU6A 2F58L 4MGXA 1A0QH 5DVNA 2I24N 2W59A 3P30H 4FRWA 4ONHB 5K9JH 4WFEE 4N1CA 2VERN 5C09D 2ZJSH 4HIIB 3X12B 3BPLB 4PB9L 2VDOH 4NP4L 2OYPA 4F15C 25C8L 4JPWL 2VN4A 5GHWL 4WHTB 4KK6C 5IFAH 1KIRB 3CZFA 1N3NB 5CSGA 5BRZA 2DTML 2BSSA 1KJ2B 5GS0C 3HC3L 4LGPB 1KSRA 1D5IH 4EUPG 5HHPA 5F7KC 4YDIL 5F88A 4OZIE 3FZUC 3RDTC 5EU7C 2OX5A 3LDBC 1AKJD 1OM3H 4OQ1A 4HPYL 1WBXA 5HHOD 3DGGA 1KB5H 1VGEL 3IU4H 3V5DA 3LS5L 5EUKB 2VXVH 1KB5L 1VGEH 3ARUA 2FJGA 4XPFH 4XBEH 1S7WA 4WI5A 3QWOA 4YDLC 5HI3C 3TZVD 5HXMA 2YC1B 2VH5H 3QUXA 1U8IA 2QADB 2XV6B 3D39A 5F7MC 1MEXH 2VE6B 1KCKA 5BV7H 2NZIA 1NFDF 5ISZE 5JA8B 4WFHD 1H3TA 4PB0L 5HYSB 1S7XA 5E9DA 3H2WA 4YUEL 2IANA 4XZUA 1P7QB 1WK0A 2B8OT 4JFYB 3I2CH 1T7YA 1GGBL 4KRPC 4MDIB 1R3IL 4Y88A 3GHBL 4F57L 3ARDB 1S7UB 1F2XK 4QY8A 1HH9B 4XMKL 4ZTOL 5BS0A 5DS8B 5CCKL 1XGTB 4RMRA 5IVXA 4WFGD 4PRAB 3KXFB 4X7EC 3DRQB 4YXLH 3QI9C 3OGOE 4XC1H 4JRWA 2VABB 3WEXB 4DKDC 3NCJL 4ODBD 4YPGA 5HDQH 3QRGH 3H9ZA 1NEZG 1FNFA 3GSQA 3RL2B 3TT3H 2D7NA 1ETZA 3GSRA 1NDMA 4PTUB 4Y16B 5I16B 2FO1A 3GMMB 3GSNB 3GMOA 1MVUA 4QYOB 3RU8H 2R2EB 4D0BB 2Y6SC 4PJ7F 4R90L 3C2SA 4KGJA 2ID5A 4GO6B 4PREB 4U1LA 1IL1B 2X7LB 1ZSDB 1F42A 4Y89A 2IAMC 4DN4H 3K3QA 1G6RB 3U46B 4NKMA 1X5LA 1JNNH 1XGYH 2ZUYA 3RY5A 5KVFH 4JM4H 5I8KL 4APQC 4Z0BL 2ERJC 4YHIA 1W8OA 5C08B 4PLNC 3O3DB 1KJ3H 4CU8A 5L88H 3ETBF 1NAML 4X99B 5FHBH 3V5KB 3L5WB 1MCFA 5K33A 4GAJL 3PWLA 5DZLA 4HKZB 1JP5A 1MCOH 2HWZL 1C1EH 3SGJC 4ZO7A 1NCCL 1CK0H 1MLBA 2C3VB 3QDME 1JFQH 1NCCH 2CKNA 2EYRA 4IRJD 3O4LB 2FZ3B 1SYVA 5E2VH 2F5AL 5GGSB 2V5MA 4LPCA 1D5MB 2GSIA 3ARDC 5HHXL 3B3IB 2ENSA 4Y2DB 4E41A 3ARXA 1JWMA 4L4TE 2NY0D 3QIUD 1NL0H 1MAMH 5BV7C 4JFXA 4C57C 5DD0L 2XNAA 4RWYH 1TETH 1INQB 4KROD 1IGJB 3UTQA 2AS5M 2EDEA 3SO5A 2HMID 3MRLA 1A02N 5D7IE 5F1IA 3MLYL 1BQLL 1R5WB 1QUNA 3BO8B 5D71H 4JDZB 5D2NB 2M8XA 3C6SA 4JRYE 3QP3A 4Z95L 3OKNB 3VWJB 1OB1B 2DYPB 3T3PF 5DMJB 5I1LB 3VRJA 2ZSVA 3M1BB 1IEAB 3TNMA 3WJJC 1YEIH 2FJHB 3QFDA 1RK0A 5EU6D 1P69B 4P2OA 1G9NC 4PYHA 1WFTA 1UJ3C 1K6QL 3LEVH 3ULUC 3H3KA 4PRBA 1U95A 1N0XH 2QQNH 3WLWC 2JF1A 1RIHL 1TNMA 1XMWA 3HNSH 4X7FC 4JKKA 3NFSL 2GFBA 1C5DB 5D7SL 1QSFB 4PJHE 3PHSA 3RVXD 4R2GD 4JR9H 3FB5A 2EDHA 3LKOB 3O0RH 2H2SC 5E00A 2MHAB 3MODL 5T3ZE 2Q3ZA 4BQ6A 3W5NA 3SGDH 3WN5A 5E24E 4UTBH 1UG9A 1T3FB 1NAMB 1MCKA 1E4KA 1X7QA 2EDLA 4UI2A 1WC7A 3RY4A 2DM7A 2FJHA 3VGBA 3TNMB 1AY1L 4GKNA 1FQ9C 2PR4L 5KJRL 2VH5L 4NGHH 4EI6A 3BZFA 2DYPA 2JJWA 3EJYD 4K94C 2F53B 3G08B 3OKNA 3VU2A 4LQFL 1FVCB 5J6HA 1UM5L 1HI6A 4MB4A 4W6WB 3FT3B 1G84A 12E8L 4PGBA 3ULVL 5F1IB 3RWJA 3MRLB 2A6KA 4H25A 5F6IB 2BCKB 4HWEH 3PL6D 4PP1C 4UUJA 3UYRH 5E08L 2CUHA 2XNAB 4KY1H 3ZTNH 4JFXB 2VDRL 1CGYA 4JFEB 5E7BA 1Q9WA 1ZTXH 4UQ3B 2VXUL 1QFOA 4E41B 2R1WB 3T77A 1D5MA 2GSIB 3I6LD 3RL1A 3GSOB 3K80A 3L1OL 3S36X 4OLVH 1XEDA 3NZHL 2Z8SA 1S7TA 1DN0B 1P4IH 3MYJA 3TF7C 1KG0A 2G2RA 1IFHL 3DYPA 2FNBA 2YD6A 2D7TH 4HKZA 3PWLB 3IETA 3FZUD 4WO4D 1FORH 5EA0H 4QHUB 3B5GA 1AP2A 4HG4J 5I17A 3ARFA 3UTZA 1U91B 3CVHB 2Y5EA 5C92A 4Q0XH 3O6ML 4LQ1A 2IADB 3NH7L 4PJFB 4RGOH 4X5WB 2C9AA 4I3RH 5GGTH 2YK1L 2XXMB 2R29L 3SDCB 2WV3A 1PEZA 3GJFK 4FFZL 4LQFH 4NZUL 2APWA 4NKOA 5DQ9B 4M62L 2YUZA 1V5JA 1FPTL 3U46A 4UT7L 4ZTPH 1YECH 1HH6A 4NNPH 1FFPB 3S3SA 4F2MA 4JHAH 5F1OB 3DRTB 1IL1A 4PREA 2AJYH 4KRPD 1AIFA 4U1SA 3S5LG 4M7ZB 1RZKC 5ACZB 4RQQA 3FO1A 1IAOA 2BSTB 2X9XA 4ONFH 5IG7B 2W65B 4Y16A 1ETZB 3GSRB 5I16A 4OCLC 1R3KB 4EXPX 1JHKH 4JQXA 1OARH 2CUIA 2UZIH 4G8GD 2VABA 35C8L 4L9DA 1S7VA 3DRQA 1DLFL 3EYUL 4M7KH 3BPOB 1CGVA 3HG1D 3RFZC 4MD5A 4K3DH 1XGTA 3JV5A 4D0DB 4JDTL 1MNUL 2DWEA 5TPWH 1HH9A 3NCCB 4IJ3C 3QCVH 2E9IA 2JLLA 5ERWB 2QSQA 2DAVA 1NCAH 4MDIA 4WY7H 1NGZB 4OF3A 5BW7A 3I6KB 4XPBH 5KG9A 1F6FB 3WFEL 5FYKL 2HVJB 5HYSA 3BPLC 5D72H 3U4EA 4RBPH 3RWEB 4EN3A 4Z95H 4WHYH 4FQQB 1F4YH 1G7LA 2BRRL 5J89A 4DKFL 4Y8DC 3OAYH 5D71L 1TCMA 1WAAE 3GUTB 4C4KO 5DA0B 3QWOB 4O4YL 4WGWB 1EZVX 4ONGH 4UINH 5E9DD 4PG2A 1ZLVK 2NY1C 4XP6L 1S5IL 4MQTB 2AAVA 2FEEL 4JVPA 5TE4L 1JTOA 1WUNT 4LSRL 1CD1A 4JFZL 5DJZB 5HHPB 4K7PL 3QUYC 1YEDA 3O4LE 2HT3C 1XR8B 1YQ2A 3MUY1 2H9GB 4ZSOE 5FCSH 3IXAB 3ILPA 4ETQB 2Q20A 5FYKU 1YJDH 4ZS7L 1NLDH 2ZG1A 3CMGA 3CUPB 1X5XA 5TDPB 1YNLL 4G9DA 3EAKA 2X4PA 4P59L 2EIZB 4KHTL 2DIBA 4J3VA 3ARDD 5D8JL 1QLRA 1JUFA 4DGIH 4LVOC 1MJ7H 2CIIB 2PW1B 5BO1H 3C5ZC 1XIWA 4NNXA 1W2KT 4F33A 5IW1B 4DK3A 5I30H 5DC4B 4JFDB 1CLCA 3BH8B 4YGVA 4M5ZL 2DQCH 4PJIF 5K9KB 5L6YH 1PJ9A 1NC2D 3KPRD 2EH7L 4AG4L 2X4TA 2J8HA 4DGVH 2OSLA 3IF1A 4Y1AB 4JO1H 2OL3B 5EBLB 4MAYD 4S1DC 1QNZL 4UT7H 1D6VH 3BKJH 1TZIA 3QCTH 4DTGL 1AO7A 3MRKB 4HIEA 1W72H 3E3QE 5HYEA 4FQLL 1YNTA 1QSFE 1XF3A 1RD6A 3W5MA 4HV8B 1IILE 3OB0K 4Z7UA 3F58H 2E7HA 1H5BA 4ZUWB 2KH2B 4KPHH 1WV7T 3ESUF 4CADA 2AXGB 1JNHA 1JHKL 3T8XA 3IAGC 3BKMH 1GXEA 3QDJA 5IQ9B 5CJQL 2Y5TB 2AGJL 2P44B 3MJ8B 1L4IA 1ZVYA 1IE5A 4FFWC 1IFHH 3LH2H 1JK8B 5MENE 2CRYA 3D0VA 2IGFL 3RAJH 5ADOL 4LSDA 2OTPA 3VCLB 3WKML 1P4IL 1OW0A 4AIXA 5EORL 4YAQA 1RZIA 1DQDH 3GI8L 3QIUA 1MPAL 4YXHH 1AD0A 2E8YA 4N8CL 1AQKL 3SQOH 1OOAA 1CL7I 1OQOA 2AJXL 1H3XA 3MJ7A 1MPAH 3NMEA 5F9JB 4R26L 3O41B 1HILB 3BI9X 4LMQI 3BDXA 4HS6B 4JM2D 2XY2A 3VFWB 2CXKA 4WI2A 3TA3D 3KPRA 3QUMB 5FO9A 4PJDA 4JQVA 4Y5XA 2XZQL 3EYFB 1A64A 1MHCA 5GGTL 3TT3L 5E8EB 1NCWH 1DFBL 2GK2A 1BD2D 1RJLB 3MBXH 4ZUVB 2YPLE 3KYAA 1T0MA 2P47B 1G9ML 3MRMB 4RCAA 2P5EE 4X7DC 2DF3A 8CGTA 1JHTA 3CFDB 2IFFH 4L3EB 4G6JL 4Q9QL 2VAAA 2WLYA 4QRRB 3HI6L 5HPOA 1BZ9A 3PL6C 4JHWL 4NJAL 1B0GB 3KDMA 4NO0B 5I1DA 1PG7L 4LEOB 1CBVH 4GG6E 1CQKA 4LEXL 5HGBA 1UENA 1OAUL 4NPYA 2EE3A 4PRPD 4HIJB 4NQCB 1FNSH 2DQGH 3PL6A 4PRPA 3FRUB 1PZ5A 2E7BA 4MD4B 1RK1B 2HRPH 2XKSA 3G6AB 4Z76A 3A6BL 5DSCA 2FL5B 1N59A 4XNMA 2XACC 2W9LA 4D9QD 4PJAF 5HHQB 4MA7H 3DX6B 5JIKA 5CEZL 2GSGA 3VH8A 3FT2A 3LEXB 1FYTB 4FQJH 4KH2A 2HN7A 3W11C 3WO3B 1DLFH 1EFXA 4M7KL 2VB5A 2EDNA 5IF0B 4MJ6B 4Y4KC 4F8TA 4TUKH 4X80H 2OCFD 4A2MA 2DIAA 3MBED 2WBJC 2UYLB 1BX2A 5CJOL 1FZKA 1FBIH 4DN3L 5JDSA 4RGNC 5F3HA 1YDPA 5SWSE 4KKAD 1JGEB 3GO1L 4N0UB 3R06B 4XVUC 4XBPA 1JVKA 2VDLH 5I76A 5BMFH 2IPUG 1ZT1A 1OAQL 3W9DA 5IFAL 1T1XB 4JR9L 4FQ1H 4NZRL 4LFHD 5ICXB 1TZGL 3L5XL 4KMQA 1JL8A 3LN5B 3WJLA 4K3EL 3DURA 4WUKH 5A3IC 5EO0B 3D9AH 1FCCA 1MFCH 2DQHL 3TIDA 4ODVL 2UZYB 1BOGB 2FO4A 3STLB 3AMKA 2R29H 5HGHB 5GS0H 2DBLH 3ZTJG 2PCPA 3KPOA 2NX5D 1WLHA 4AM0B 1IC4H 3VFGH 3O9WD 1PBYA 3WSQL 5EBGA 2NX5A 3IDGA 4OM0H 3UAJD 3QQ4B 5I74B 1H3UA 3UYPA 2NY6C 1OVZA 1CFQA 1MFBL 1J8HE 2Y9RT 4U0RC 3P0YL 3B6SA 3HN3A 4P2QA 4UILH 3WCYA 4NQVA 4LSVL 4BA8A 2C4XA 4XNXH 3IKCA 3MRDB 4P3CL 2BMKB 3IRZA 5DMKA 4MXVE 4WU7A 1IM3B 3EIFA 4DQOH 1FLRL 5KVDL 5T3XL 5FF6A 1G7PB 4K9EH 2J88L 2DD8L 2OMNA 4NHUA 1LO3H 5CIPH 3SE4A 4KZEH 3MYZA 2A6DB 4UBDC 3QWRD 2Q8BH 2KKQA 3IDMA 5BMFL 3VXNB 3RA7L 3SBWA 4I8DA 5JA9A 2DWDB 4XC3L 3UTSB 4MB5A 1J1PH 1IBGH 4J4PA 1B0RB 1SJHA 2V5TA 2CKBB 1BIIB 5I9QC 5KVGH 2YBRB 1B2WH 3VFRB 1B6DA 5FM8A 1U42A 3T0BA 3LS5H 1UZ6E 2PYFA 4UIMA 3ZKMC 1M05A 3MLWH 5IHUL 3BW9A 43CAB 4DVBB 1J8KA 4J3UA 3IVKB 4ENED 2WK2A 1TDQA 5FGCE 4MNQB 1CR9H 4U4BA 1AY1H 1UADC 5JO5A 2BNQB 2NX5E 4LNRB 3CFKB 4BKLA 2NY2D 5LKNA 4Z7VA 3QXDB 3H6JA 1IKFH 4LHQB 4RFNB 3QDHA 2A6JA 3AS3A 4G8GA 1UWEH 4I0PB 4QRPA 1YECL 1T2XA 3L9RB 5DMYA 2V5SA 3WFBH 1FC1A 3MNZB 2AJYL 3TH4T 1IC5L 1OAZH 4KKBD 5LJYH 1EBAA 1JPGA 4FHBD 5KW9L 3GMLA 1KYOJ 5D7JC 3SKOA 4HPOH 1P9MA 5B22A 1LEKA 4U1HB 5I6XC 1G7HA 2B0SH 1I8MB 3HC4L 1MJJB 2JB6A 5DUML 2E6JA 2XFXA 4CDHA 4LHUG 1MAJA 4RNRB 4WO4B 3V6FB 5JPNA 5E8DL 1VFMA 5TDNB 2OS7A 3SGDI 2DJ4A 4E0RB 5MENA 1CTNA 2NLJB 5CUSH 4N9OB 4G6KH 2F54A 4PV8B 5TH2A 1GOFA 3ARBA 4R26H 1YPZF 2VXQH 5D6CA 2V9RA 3GGWB 5JXED 3OSKA 4Q6IB 3ZLQC 4P5TC 3QPQD 4JM2A 5A2IH 3A6CH 3N1QC 5DWUH 3DPBA 4OLXL 4CUCA 4I2XE 5HYJA 2F19H 5HI3D 1CF8L 4HWZB 5EU3B 1TNNA 3T2PA 4OCYH 4WHCA 1GHFH 1FZMA 1UWEL 1DZBA 5JOEA 5IFHL 3N06B 1U8LA 3IDNB 2YXMA 2ZUSA 3B83A 1Q0YH 8FABB 2ADJB 2EKSB 3FOMB 3FQTA 3HZKB 5E08H 5JNYA 3C6LD 4KXZH 3P0YH 3G5ZB 4UILL 1P2CA 3TO2A 1TQCB 3MRBB 3UTSE 5DRZB 3NFPA 2ICWA 3CVIL 3INUL 4GBXA 2B0SL 3BPCA 3ES6A 3PWUA 1A1MB 4X6CA 4LSPL 2P24A 1DQMH 2YPLB 2FD6H 1MCOL 3X11B 3F8UB 4O2FB 2X4QB 3GB7B 3LCYA 3UZQA 3BPNC 5TGBB 3SEPA 4PJDE 1FNHA 2N56A 4GLRH 1NC4D 3RA7H 3DTXA 1OGAB 4QGTA 3VGAC 1WJ3A 3KYMA 5D8JH 1OY3B 5KSUA 4GG6B 2XQYG 3L3DA 3OZ9H 3AMLA 3VXUB 3O2DA 2P5WD 4I0KA 3STZB 3VD5A 5F7YC 4S1SH 1PGRB 3GI9H 1IARB 1VGKA 4EUPB 4ZPVA 4M00A 1NSNH 4F9LC 1JGDA 5D2NE 3BP6B 1M4KA 3KGRA 5JUEL 1KF9B 2A83A 4PJ8B 2UWEF 4JO2H 3GM0A 5IVZB 3UO1L 3U0WH 4FFYH 1LEIA 3KPSA 4Y5VB 5C2BL 4OCMC 1CFVH 2PW2B 3G5XB 3ECBA 4OAWB 4WW1B 1MH5B 5ICYB 3MLTA 3EO0B 4PJCA 2CKBL 1I1FB 5CINH 3K1KC 2H32A 2BVTA 4J6RH 1KFAH 3CX5J 2FBJH 3ARFC 4NUGH 5DK3A 4BH8B 3ZKXC 1U3JA 2AEQH 2CPCA 5HYJE 2H8PA 1N6QL 2UZIL 5C0EA 4GKZB 4LP5A 3MA9L 1A4KB 1J0IA 2L7JA 4JQVC 4Y5XC 3ARPA 4PG9A 2A9MH 3X3FH 3MRRB 3U7AA 2UWEA 5DK0B 5D7JA 5EU5A 3UTTB 5CJ5A 3JV4B 4G80B 1FNGA 1P4BL 5L88L 5B38A 5INCA 4UV7H 4X7SL 3VGEA 2V9QA 3V0VB 2NY0C 3QIUC 3VD3A 3TNNB 2EYSB 2YKLL 1MFEH 5C0BA 4XNQA 3RP1A 3GK8L 3N0PB 5ISZA 2X09A 1TZHA 5F9WC 3ALPA 1OAXL 4MS8D 2R0LL 3WIFA 1VADB 1EHLH 4LLUA 1G7IA 4LIQH 2CDEA 1YN7A 3SQBA 2DMCA 5C0GA 2NCMA 1A6ZB 2VLRE 4MJ5B 3AS2A 2VDPL 3CLEH 4DCQB 1L7IH 4M8QB 2BK8A 1NGPH 3FCTA 1KENL 2IEPA 4X6DB 1HN1A 1VB9A 4XNUL 3VWJC 4OGXH 4Q58C 1A6UL 2DIJA 3L95B 5CP3H 1JGLH 2HFTA 1KPUB 1LO2H 4GW5B 4ODXB 1L0YA 3TN0D 3EYSH 1T21A 2DN7A 2NW3B 4X4YA 2AJ3A 2AEPL 3RJQB 3PP4H 4JJHA 1WCBA 2FX8H 1YN7B 2DLFH 2CDEB 1ZANL 5F6IC 4LVNB 2XA3A 5FHAL 3RI5K 4EVNB 2BDNL 1D5BB 5ISZB 3BP4B 3RAJL 1DBMH 5ADOH 5CHNA 2XI9A 3FMGH 4R2GC 2FJFA 3NZHH 1LE5B 4HXBH 3V0VA 5KOVC 2DS4A 4OCRL 1S7SA 5C6TL 5IHBA 4PJEA 2EYTA 1A2YA 5FGCB 3UTTA 5ISZD 3PQYE 5DK0A 1DN2A 3VW3L 1FBIL 4JDVB 4HFUL 2YPVH 2HYMA 1CFSA 4JANA 3CU7A 4PG9B 5HPMB 5E8DH 4GKOA 5L2KB 1X5FA 1QRNB 1ZHNB 4F7CA 3KJ4B 2H8PB 5SWZD 1TENA 4PGDB 3L3IB 1KXTB 3SKMB 4JG1L 4NQEB 2C1OA 4OBSA 5FV1L 1CF8H 2HKHH 1PVHA 1I1FA 4BFIA 3SGKA 3GSVB 1FJ1B 5E6IA 4EEEA 2YS4A 4TPRH 3DUSB 2J5LB 1OAYL 3ET9F 1OAUH 1F4XL 2N7AA 1TVHB 3MNWA 4E42B 1FVEA 3BE1L 4NJAH 1V7NH 4ONOA 1RUQL 5GRZA 1T7WA 4F7EB 1G1YA 2XKNA 1UZ6F 4X0KA 3EYOB 2K3TA 2P5WB 5EDXA 3U79A 5FUOL 1NJ9B 3GEWB 1A6WH 3DX7B 5DJCB 2IH1B 4P5MA 3STZA 2VISB 3DIFB 3VWKB 3OPZL 1KJMA 5MP6H 2XQBL 1RUAH 1TJHH 5CD5C 1O5DT 1CDCA 1UM6H 1RULH 1QLEH 2J8OA 4WWKB 5ALBH 1EGJL 2ADIA 2QKIB 3MJGX 1U92A 3J7HA 4KRNA 4U1MB 4LCYB 1X5YA 4X6CB 4G3YL 2G5BB 3BPCB 1HCVA 3HA0A 3MRCA 1C16A 2AABH 4P2RA 2W9EL 5I1KL 4RA3A 1FE8L 1SM3L 3MRBA 1I1YA 3G5ZA 5GQBA 2ICWI 3LZFL 1BLNA 1E28A 4YHPB 5T3ZH 5F7EH 3Q1SH 1H8OA 1YEJH 3FOMA 2ADJA 2YUVA 3IDNA 2NY3C 1RUMH 4PJXF 1G7MB 1BQLH 4LHUD 2J8UF 2NY4C 2IAMA 4MX7B 3RZCA 1X5IA 2E3VA 2J4WL 1FZMB 4POYA 2VLKB 1JF1A 1WFNA 1T7XA 5EU3A 3MRHA 3CLFH 4Y19A 5E94A 2VOTA 4G7VL 1U93B 1SEQH 1CIDA 1JZ7A 1K9TA 2BOCA 1DBKL 4XRCB 1INEL 5HY9B 4G8FA 2H26A 2Z8WC 5FUCC 5IB2A 2P46B 2EXYC 1SMOA 1MFBH 3GGWA 1ZA6B 4WFFD 1U0QA 1F90H 1ZGLA 3ARBB 3EYQD 5ID0B 3EOAB 2F74A 2MSPA 2YKLH 1KC5H 4OTXL 4XCYA 5DK2A 2NLJA 2EIBA 3G6JB 5CMAB 1MY5A 2L4OA 4L4VD 1KC5L 4MWFB 3RHWK 7FABL 4HFWA 4HUVA 2C4FU 4RNRA 2ZOKA 4KJPC 2Z35A 5IJVB 1M1SA 2Q7YA 3NCFB 1MJJA 2JB6B 4OF7A 1SBBA 1VPOL 1T83C 4P9MH 4EDWL 2QR0A 4TSAL 4HWBL 1G7HB 1BBDH 4O9HL 4N8VG 1S7RB 1LEKB 4UV7L 4X7SH 3SKOB 2ZWLT 3WMSA 2Y07L 2HKFH 1RUKL 3LD8B 4NYLB 3BGMB 3MJ6A 2XPGA 4PRIE 5EC1B 3BOVA 1LD9B 5AG9A 2XKUA 5EO9A 4PFEA 4NT6B 1MRCL 4X6CF 5J7CC 3RIAK 5F1NA 2NY1D 1QOKA 3E1F1 3FL7A 5TFSH 3U83A 2YRPA 4WNQB 3G6JF 4HBCL 4UU9A 4URTB 3HZMA 3L6FB 4I0PA 3B9KA 1GC1L 4G8GB 4CRPA 4OCSL 3WFEH 3VXME 2X1PA 5E2TH 4Z5RA 3NABL 4YHZH 1FL3A 1U3HA 5EZIL 4JFFB 4YX2L 4MNQA 3VFGL 3NABH 5CGMA 1MCBA 3IVKA 1DEEB 4NQSA 1ORQB 1M05B 1I9IL 1CFVL 5KSBA 4R7DA 3GJEB 5FGBC 4YR6B 3ALWA 3ZYZA 1T66C 3RNKB 2YBRA 2WANA 5SWQA 2X4UA 3I2CL 5FAAA 1B0RA 1SJHB 4HS8H 3LKSA 2MCPL 2YZ1A 2DWDA 1EUUA 4D9QE 4HT1H 2VDNH 5FM5O 5IVXE 3GI9L 4NHUB 3TO4A 4IRSA 4L8DA 4KI5E 3SDAA 3S3JA 3MJ9H 4XTRD 1IGIL 2BMKA 5DMKB 3TO4C 5AD0A 3IKCB 3MRDA 3I02B 3DVGB 2IFFL 4P2QB 4U1IA 4Q9QH 3HPLB 5MERA 2VUOA 1CFQB 5IBLD 1FO0H 1BPVA 1OM3L 4RMTA 1J0JA 1NH6A 3V7AG 5CBAA 4P3DA 4DFHA 4L3CB 3IDGB 1IAIL 5D6DC 4GQPH 3V8OA 4RSVA 3REWA 3I85A 1FSKB 4LNVA 5LAXB 4DZ8A 4I3RL 2V5YA 1CZ8H 2BVOB 3RKDC 1KYOK 2PCPB 3N85L 4FQ2H 4XWOC 5HGHA 4L4VE 4PJ8C 2FO4B 4QWWD 3MRFB 4FA8A 3HTLX 3TIDB 3VMPA 3QFJE 4PLJC 2ERJB 4X8JB 3SDXA 1PKQB 1IAII 4JPIA 2R0WH 3LN5A 1LP9A 4YHNA 1EPFA 4LOUC 4LSQL 3MV8B 4NM8H 2CJUL 3LMJL 1MCDA 2VDQH 4U2YA 1MF2H 4YE4H 3SE8L 5IMLA 4G6FB 2L0DA 5F96L 1FL6A 4GAGL 4HPOL 1R3LB 4YDKL 4ALAL 3MV7D 3U9PH 4NRXA 5I76B 5FYLD 3R06A 4N0UE 5D1XC 1IGFL 2BOBA 1I3RB 3DUUA 1QO3B 1IGFH 4QEGA 3GZKA 5GHWH 1FZKB 1LO4L 4XX1G 2UYLA 2YPKA 1Q8MA 3KYNB 5D1QA 4ODUB 1QKZH 1R3HA 1RHFA 3DETC 2HN7B 1QNZH 3LEXA 2Y7QB 1KCLA 4O5LH 2GSGB 5INDB 2CMRL 3R8BB 1NFDE 2VIRB 4U6XB 3HNVH 2WQRA 2EZ0D 1N59B 3QCTL 4DTGH 5DSCB 4XCEB 3G6AA 5IHUH 1RK1A 2AP2A 4PRPB 1K5NB 3KJ6H 3QPXH 3SDCC 5GS1B 4QHLB 3UEZA 4H5SB 1OP5K 3PL6B 2OTUA 2IBGA 3TZVA 9CGTA 2B1AL 3SGEH 4NPYB 1J0KA 3GMPB 3U9UA 5I1IL 5B8CB 1FGVH 3PV6A 4XH2B 1KIUA 3H9SA 1WT5C 5GGRY 3KDMB 5I1DB 1BZ9B 2PTUA 2Z91B 4P23D 2AV7B 2LU7A 3V52L 4NUJA 4TVPE 1GCFA 1KN2H 1BD2B 2DM4A 5IGXL 4OTXH 2DJSA 1XIWC 3BKYL 4OZIB 1P1ZA 4GUPB 4HS8L 1RJLA 1L0QA 3BKYH 3BHBA 2HWZH 1YJDL 4ZS7H 4NQDD 1MHCB 5J6GB 4B53A 3EYFA 4Y5XB 3V0AC 3QRFM 4PJDB 3FTGA 3U4BH 3WD5L 5BRZE 3WL9A 1BBJB 1RZJH 5HI5D 4MAUH 1N6QH 2HG5B 3BYTA 1D9KD 3MX0A 2WINA 4EBQH 4KZDL 5EWIH 1KACB 1H9VA 1ZT4B 2D03L 3O41A 4D3CH 2F5AH 3IU3B 1LO3L 3FQNA 1BZ7A 4JPWH 2IQAA 2NY0B 3QIUB 4YAQB 5T1MA 3SCMA 4OCRH 1X9QA 4L8SA 4LPUA 2EDJA 3WXVH 3VG0H 1JK8A 3OKMB 5CBEA 4KRMB 1N6UA 1ED3B 4BSJA 4Q9RL 4AQ1B 1E6OH 1F13A 1I9JL 3EJZC 4U2ZA 4DN4L 1LHZA 4OQTL 4TTGA 4XGZB 2COQA 5EZOH 3VFPB 1JNHB 2WQ8A 4FQIL 1H5BB 3UZVB 2HKFL 3UP1A 5JUEH 1JMZA 4H8WC 4PJ9D 4K2UH 3CGTA 4GRWB 4HIEB 1FFNA 2ZUQC 5JHDA 5ELIA 1UVQA 3FN9A 3UAJC 2OBGA 2I9TA 2WBJA 4HF5H 4LARL 2YA2A 1MFCL 5EC2B 1DBJH 4YHZL 1RUAL 1X5ZA 3MLYH 1MF2L 4YE4L 3SE8H 5C3TA 1IEBB 1G7JA 4N0FA 5B8CC 4JO3H 3SPVA 4KJQC 4EOWH 4OZGA 1OHQA 1IZKA 3FN0H 1KJ2H 3WD5H 2VO5A 1FP5A 1FNLA 4D9RE 5ID1A 2OP4H 4U1GB 3QISA 4NZTL 5IW1A 4EBQL 5CJXC 2PUQT 1V8HA 1CIUA 4UBDD 3ROLA 1OTSC 4PRDB 1BEYL 5TQ0L 4PRHB 4OFDA 2E7MA 3ZTJH 3MROB 5JR1H 2ZNWA 1JUFB 3DMMC 3QJFA 3I6GA 4AY0A 1A7PL 1EEQA 4ZXBD 1P84J 2EIZA 1C5CH 1EUTA 1UWXK 4O51B 3PG2A 3LSOB 4G9DB 4P4KB 2Q76A 4XVSL 3OG6B 1XGQA 3MCLL 4GS7B 4JY6A 1KCUH 5GXBB 5JHLL 1NBVH 2HLAB 5GJTH 5I18H 3IDJA 4JB9H 1ADQL 5EN2B 5FCUL 2H9GA 1K8IA 1JN6B 1XR8A 5DFVC 1GSMA 1KEMH 3G5VB 2PTTA 3NIDF 4PYGA 5ILTL 3ORJA 3BWUC 5DJZA 5CP7A 3WS6C 4YC2C 2H6PA 3EOYG 5DJYA 5IOPA 1HQRB 1PG7H 4P46C 3V4PL 3ZYIA 1SJXA 4H8WL 5HHNB 1T66D 5E8OA 4MQSB 1MQ8A 3O2VL 4TOYH 1IZJA 4RMVA 1G7LB 3TFKD 4Q9BA 4RMUA 2V7HB 4ZPTA 4PRID 3NTCL 1JNNL 1XGYL 3U30B 4ZQKB 4POUB 3VG9B 2AJVL 1FLTX 5ERWA 3RGVC 3MTRA 1HCFX 1IAMA 4NM8L 1IGYA 1WCQA 4HK0A 3V0WL 1N64H 2Y25A 3GIVA 1KIPA 1TQBC 1BFVL 4QT5A 3D0LA 4KGLA 3C09B 5IBLC 5L2KE 5CCKH 1DBAL 5TFSL 4OLWL 4PJAA 3MCLH 2HH0L 4LRNH 2CGRH 5GGUA 4XC1L 4TVSa 2FSEA 5CEXB 1X4XA 2JJSA 4NGHL 5EG6C 2HFEB 1KIQB 2CDGB 1EVTC 1KCVL 2GT9B 3HG1A 2W65A 1NANH 5JXAH 2BSTA 3T08A 5ACZA 4RAVA 5LVEA 2XA8H 1K2DA 3GSNL 4PJBA 2F5BL 3LD8C 2GHWB 4L9LB 3WFBL 4X9IA 3TP4A 1T5WB 2OQJB 1FFPA 3O11A 4LPTA 5EOQH 1HYSD 1CXLA 2DMKA 5I73B 1JBJA 4NBYB 4ZO8A 5GZOD 4RRPG 3E3QC 4UTAH 4NKOB 4XCCH 4L8BA 1SQ2N 2XN9B 1Q9LA 1TPXB 4LPXA 3S7GA 4JKWA 4ZS6C 2YD3A 2ZCHL 2APVA 2D2OA 4XXDA 5DI8A 3RWHA 4OFVA 4LFHG 3LS4L 4PJFA 5AUMA 4LLVA 1F45A 1U91A 3CVHA 4Y16D 5D7SH 5E56A 3ARFB 3SKJH 4GLRI 4OM0L 5GRJL 3U1SL 4D2NA 3QDGA 3IETB 2QTEA 1FCGA 1EMTL 1YEIL 3STBA 1OLLA 2NXYD 3HC0A 4R4BA 3VGAB 1KG0B 2LVCA 1H8SA 3RVVD 4C56A 1S7TB 1KCSH 1SBSH 2VC2H 3MV9D 4LDOB 5IB3B 4UT6L 4PG2C 3RPIB 5D1QD 1T5WA 4PJCE 4K55A 2RCSH 1JI1A 3GSOA 5KANI 4QRTB 1AXTL 3LRSA 3SDCD 2BSRB 5CGYC 2I5YL 3H3PL 3FAWA 2VDPH 3CLEL 2QEJA 4UQ3A 2QL1A 3BIAX 1CFBA 4JFEA 1LP9E 3SKNA 3QWRA 1IAIM 4M3KB 5AWNH 4HZLB 3MRIA 3EHBD 2HFEA 4MMXC 1ZT7B 3CFCL 4MQXD 1MAML 2FSEB 5CEXA 5J11B 5GGUB 2BCKA 4K3HA 5JOFA 2A6KB 4H25B 4OD1L 3QHTC 3RWJB 1B9ZA 3LN9A 3QEQA 1A1NB 2B5IC 4ZAKB 3RHWF 4MCZA 2XWBB 4HIXH 1AE6H 3D0LB 5DD6B 4QT5B 4K07A 1WWWX 1YPZE 2IWGA 4OFKA 2LV4A 3VRLE 4NO3B 1IKFL 3HRPA 2HP4A 4DOHB 1IGYB 3BZFB 1CR9L 1ZEAH 1J86A 4EI6B 2EH8L 4AENA 1VFUA 3BAEL 3C5SA 1G9EA 1YN6B 2V9TA 3HE7B 3NCYS 1NAMA 4GXUN 4ZPTB 4OJFL 2V7HA 3T2NL 5AEAA 5DGRA 3RZCD 5E00B 5AAMA 4L8SC 4FMKA 4ERSL 1UA6H 1ODAA 7FABH 1NGWB 1UA6L 1QSFA 5BV7B 1HQRA 1C5DA 3WLBA 5F9DC 1OP3K 2OR8A 2Z31C 3NIGF 4JO2L 1CDHA 3RWCA 4OGAD 3I50L 4OGZA 1HWGB 5EN2A 4P2OB 4YDIH 4I3SH 3IDJB 3GIZL 3FAXA 1OF2A 1UH4A 3QUKA 1HZHH 1I3GH 5HDLA 4P4KA 4LEXH 4O51A 3M1BA 2ZSVB 3VRJB 3S37H 1A7BA 5I1LA 4KAQH 1OB1A 4Q0XL 5D1ZD 2FX7L 2VWEE 3N50A 2QQQA 1A3RH 3QJFB 3ULUL 5HGGS 2MMXA 3BO8A 3RVXC 1WQVT 1R5WA 2XZAH 5I8KH 3ROLB 4JHAL 3WXWL 2XZAL 3P0VL 3UTQB 1IGJA 4MJID 4X6BB 2VZOA 1GGYA 4J23A 4DFIA 5K9QG 5HGDA 4P23B 1FPTH 1ZA3A 2DI9A 4M61A 5MP6L 5DVOA 1MHPL 1T6VN 3O2VH 2BSED 3MGTB 2F53E 4OZGB 5BOZG 3ARBC 4LRIC 1G7JB 4N0FB 1O7VA 1UQSA 5I6XB 5EC2A 1UZ8B 3CIQA 2B1HL 3LKQA 1KCSL 1SYVB 2FZ3A 2VC2L 5FV2A 2EYRB 1DL7H 1S9VA 1KTLB 2JIXB 1QPPA 3OGCB 4HJGB 1MLBB 1FFNB 4KK6D 3QDAA 1F2QA 2GTWA 1GIGL 1F3JA 3AU1A 4P2CG 1QFWL 2MCG1 3L5WA 3VFPA 5JXEA 2CK0L 1IGML 1X6NA 1YEHH 1QBLH 4CVXB 3DX9A 5DMGC 5FOJA 1AI1L 2YPVL 1ED3A 3O3DA 1J8HD 5C08A 2RIKA 5CBEB 5KSAA 3EDJA 4YHIB 5GGVH 1L9MA 1BVKA 5CWSB 5B39A 3O4OB 5F8QC 3TZVC 2W0FA 3SCMB 5GGVL 5T1MB 5FDYA 5KOMC 4DGYH 2Z0BA 2DKSA 3NAAH 3H3BC 3NIFE 4IEFB 1OQXA 3IU3A 1ZT4A 2OI9C 2XG4A 2WINB 2HG5A 2X7LA 3D25A 1I9IH 3K46A 2OMBA 4QOKE 1DE4A 2VDML 3MRGB 3ZSTA 2Q87A 4R97C 4OJFH 3FTGB 4N0CC 1NDGB 4MVBD 3K8LA 5HDOA 3VA2C 4PGCA 3GMOB 3BHBB 1F3DH 4UOW1 4JAMA 4GUPA 2BFVL 3GSQB 1TPXC 3CPLA 1A0QL 3MXVH 2B39A 2VRAA 4BQ8A 1M6OA 3WEXA 4DKEL 3MC0A 3M45A 1QQDA 1TJGH 2BXYA 3FN3A 3KXFA 1YQVL 5DT1H 2Z91A 4PJBE 4XMPL 1MSPA 2DICA 4OF6A 1MREH 1RIUL 4R7NB 1QLFB 5KZCB 1MJ7L 3I3EA 4M4PA 3EJJX 3F12A 4QHLA 2NY5H 1OD7A 3HCVB 4Q9RH 2VSDA 5CD3A 4WUKL 1OAXH 4XCEA 3OJMB 4YH6A 5C9JA 5D4QA 1QPXA 2DQJH 1NEZA 4I9WD 3TYFB 1HYSC 1EZVY 5ETUA 1SY6H 5IKCB 5INDA 3D39B 4FTVD 4ODUA 5DA4A 3V4VH 2BXZA 5D1QB 3L7EB 1BFTA 2FECI 4ZUUB 4FG6C 3BQUD 2HA1A 4JPVH 3S5LB 1MCLA 2LE9A 4AIOA 2NY6B 3DGGB 3T2NH 1W0VA 1WBXB 5HYIA 2IPTH 4NRXB 5F88B 1D5XA 2FEEI 1MLCA 3FB8A 3HE6D 3FJTA 3K7UA 2NXYC 3EYQC 5HDBF 3GNMH 2P5EB 4RRPA 4O02H 2JB5H 5BRZB 1N3NA 5DMIL 4X4MA 3MV8A 2EH8H 4WHTA 3RVVC 1YEGH 4JPIB 1F58L 1PKQA 2X6MA 3SDXB 4X8JA 3X12A 4HIIA 1E4KC 5T1LD 2A9ML 4XPAL 4CL7A 4Y4HA 3OKDB 5JR1L 4G9FE 2W1NA 4YDJB 4NBXB 3FFDA 1OT1A 1B4JL 3KLAB 4JDTH 1I4FA 1AKJB 3GSNH 3MJ9A 2CK0H 5C0AB 2YEZA 3RUGF 3IDXH 4J3OC 5DWUL 3DVFA 2IC2A 4G6AC 4L3CA 1QSFD 3E0GA 4HUMB 5I8EB 2YK1H 3MBEB 2NTFB 5MEPA 4A6YL 3SY0A 3T0AA 5CS7A 5GRVK 5DUPH 1I8LC 2ZUVA 4Y8AA 3CXHJ 5MERB 1QRNE 3DXAB 3MBXL 3GJFH 3I02A 5FOBB 4UAOB 4OB5H 1I85C 5DO2D 2NPLX 2PXYD 1Y18B 5E03A 1PG7X 2XA8L 3B9EA 4JN1H 1BJ8A 2IBBA 4NRYA 3CXDL 4IOSD 5ESAA 5J3HC 2J1KA 2C3XA 4WUUD 4XP6H 4PJDF 4ZTPL 4EUPH 1MRDH 2R56L 3LKSB 3QH3B 3B8YA 3S8WA 4PJ5D 1WEJH 4Y1AE 3HUJB 1I1AD 1PLGL 3B2VH 4OZ4B 1UYWH 3O3AA 3F58L 4DVRL 5C0CE 1P84K 5IR1B 1N5AA 3GJEA 4TSCL 5TF1H 5C0JA 4D9RD 4UNUA 5EOCL 4R96A 4X98A 4NHCH 2BP3A 3KYOB 1OSZB 4POZC 4JFFA 4FQCL 4HD9A 3L3KB 2O61B 1VKXA 3ZKNC 3C09C 3KPTA 4JFQA 4Z5RB 4Y4FB 4JPKH 1CXKA 3OJVC 3KPMA 3QIBD 3K1DA 3B9KB 3P77B 2VLKD 4IRJA 4MDJA 5F1NB 1MHEA 4NNYA 4NT6A 5D5MA 5EO9B 3QDJD 4HUXB 4DGYL 5I18L 3EJYC 5DRWB 4OUUA 3X13B 1PX3A 1B90A 1QSZA 3T09A 1HSAA 3H0TA 4OCYL 1KOAA 3L3OB 3CH1A 2H1PH 1S7RA 4N90D 4NDMB 5T1DL 1FV1A 3ALXA 1M7DA 1ZWIA 1NBZA 3L7FA 4HCRH 3V6OA 2Q7YB 3P4MB 3WN5C 2Z35B 5IJVA 2ZOKB 3ZMRA 3DGCR 4ZFGH 2BVEA 1H8NA 5E0QA 3IFLH 2FLRT 4PUBL 4LVNC 2X4RA 4MJIA 1WBZA 5IMOA 3TBSB 2LTQB 3HC4H 1ZA6A 4TSCH 5TF1L 1KNOB 4O58H 3A6OA 2D31B 1CU4H 4MD0A 1I8IB 4OFYA 1ZV5A 2Y6SD 1HKLH 1A14H 2NMSA 5HVFB 4D0CB 2Z8RA 4UT9H 4GRLA 3O0RL 2VLKA 3GI8H 4YXHL 1BFVH 5F70A 1UEYA 4MX7A 3S96B 1J5OH 1P9MC 2JELL 2C1PA 3HKFA 3N9GH 3WNOA 3FQUA 1QG3A 4JE4B 5DEZA 5C7XH 5I15L 5I66A 2MJWA 5C0FB 2E7CA 1I1YB 1X3DA 5IVXF 4LDEB 4IJ3B 2RJMA 2FDBP 1JTPA 1D9KB 2G5BA 4MCYA 5ACMA 2R9HD 3QHZH 4LCYA 4L3AA 2IH3B 5DF0A 4Y4KD 5DD0H 5CFHA 2ICEA 1S5IH 3KWWA 4RGMC 3DHJA 3OR6A 3W2DH 4IDJH 3S4SA 3TIEB 4ZO9A 4KFZC 3ZL4L 5J9PA 2IPTL 4RGND 4HBCH 3OX8B 4F7PA 2R0ZH 2AXJA 2ICWJ 1KJMB 4XNZC 3DO3A 3VWKA 3BAEH 2JB5L 3DIFA 4IOIB 4JPVL 5BQ7A 4K94H 1UH3A 5DTFA 3TWCH 1JPSH 4EOWL 2OR9H 2D7MA 2HRPL 1NJ9A 1OTUC 3SJVD 5E2VL 4GRMA 5TQ2L 3RGVB 3FO2B 4F7EA 1GYAA 4OZFG 5BVPL 2P43B 5IROC 1CVRA 5FXCH 1BWWA 1Z0NA 3VXRA 3Q5TA 3QG6B 1YEEL 4S1QL 1FNEB 4YWGL 4CVUA 3DUSA 3PF2A 3IDIB 4U6VL 2AJZA 3S88L 4RMWA 3WO4B 5ICZA 3O9WC 1VFBB 3NZ8B 5B39G 7CGTA 2BC4A 4U6VH 1A47A 4BFIB 3LPWA 5C0BD 4GJTB 4LVOB 1EHNA 4JG0H 4KWUA 4PJ9C 4QHNB 5HVWA 4PGDA 3UDWA 3ULVC 4ORGB 3RPKA 2JKXA 1QRNA 4AMKL 4W6YB 4HKJA 4J3TA 4JDVA 3LKRA 2OL3H 2P5ED 4GRWH 5LQBL 4GW4A 1KN4H 4GRWF 3I75A 5E5RB 3EOBA 5EZJA 4C55A 2VWEC 4EDXA 4K71B 1EJ6A 2DLTA 3CDGA 2NYYD 3PWJA 3BP4A 2YD7A 2AGJH 1M71A 3LS4H 4JRXA 1PKQE 1A4JB 4ELMB 1DDHA 5EU7E 1KB9K 3CAFA 2QQLL 4PJFE 1WCBB 1IGTB 4TULL 3QCVL 1ES0B 3O45B 3MV8E 2AJ3B 4PJ5A 1XR9A 4APQA 4L8CB 1MNUH 1ZE3C 2A74B 4ZXBC 4MB3A 3W39A 4C83A 5I1EH 3GO1H 2CXGA 1KPUA 3ZE1F 4ZOCA 3N1FC 2UUDH 3Q6GH 2NY2C 3KJ4C 1M7IA 5C7XL 4Q9CA 5IJKC 4X6DA 1F6LL 4M8QA 5DD5L 4YHML 4R4NC 1FH5L 2X1WL 5DFVD 4GSDL 4Z7OF 3WFDH 4Z7WA 1A6ZA 4HJ0C 5IQ7H 3WUWG 5JXAL 1J0YA 1ZLWK 2I60L 3BD5A 4RFNC 3NOIA 3S37X 2KBGA 1TZHB 1DBBL 4I1NB 3OB8A 4XNQB 2QSTA 3ZYOA 2ARJQ 2D7PA 3BGFB 2VXVL 5CIPB 1EEZB 2EDYA 2JTDA 4NRZA 2VN7A 4JHZA 1PSKL 4U0QB 4WWID 5I1HH 2OR7A 5B38B 2NTSP 4R6UA 3TFKC 1WZKA 2G9HB 3WNPA 2R2BB 4OD3H 5L8JB 2UWEB 2HKHL 3MRRA 3JTSA 4AZ8A 4TVPD 3E2HC 3HE7C 4PD4J 3PGCA 1NUDA 4LLDA 1NLDL 3WFCL 3H9SD 4YK4C 1TFHA 2DQEH 4F7TB 3HNTL 4NWTH 3ZE1E 1UJ3B 4H8WH 3B5HA 4P5TD 3ZHDA 1ND0A 3EW3B 5EO1A 1EEYB 43C9A 3W0WB 5IV2B 3IJHA 4N1HB 1TIUA 1WIOA 4OZHB 3LY6A 3BKCL 25C8H 4Z7OE 3MRQA 3QA3A 3HZVA 4KC3B 1KELH 4OAWA 4WW1A 3G5XA 3VD9A 2PW2A 3O2DH 4Q6IC 1K8DB 4OLVL 4HC1H 1QFUL 3ZE2F 3QXAB 1CICA 2DQFA 3HUJF 3ME0A 4LSSH 3T3ME 4OIAA 4P9ML 4PJ8A 2A83B 4GKSA 3B2UD 2FCBA 4I48B 4EUPA 1VGKB 1IM9A 1T1YA 5GS2D 1W72L 2O26U 1TETL 4PR5B 1T20B 3N1GC 4LL9A 4XXCA 5CLTA 3RVTC 5L2JB 5E2TL 2BVQB 1AXIB 3VXUA 2AK4D 5ITFA 1W72B 5GZNC 4GKSB 4Z18A 3L3DB 4GG6A 2C7UB 3NACL 4PY8I 3RVWC 1PYWB 1JNLL 1H0DB 5T5FH 3UC0L 3N85H 4FQ2L 2WZPD 1OGAA 2ESVE 3LHPL 4N0YH 5C0IB 1I7RB 4GAYB 4ZD3H 4IIQB 1IEHA 1YMMD 3FQXB 3MRQB 3OAZH 3OJDA 5ECJE 4CJ1A 4UIKL 3X11A 4KI5F 2VTFA 1X4YA 1A1MA 4KUCF 1YEKL 3WHE1 1OWRM 1DJSA 4HF5L 5AZEL 4ZFOB 1K6QH 2WBJD 1U8NB 1LO2L 3TO2B 1P2CB 5IB5A 3ZE2E 4KK5D 2AJUH 4XHJD 3VXSA 3PGCB 1XF4B 2EKSA 3QR2A 4DQOL 2HLFD 4IRJC 1XGUB 4GG6F 3BZ4A 3JTTA 2I07B 2G9HA 3LPGA 4U0RB 3WIIL 1EK3A 2X70B 4LCCA 1K3ZA 5DD3H 3ARTA 4NO5A 2O5YH 3BT2H 1MCPH 3MCKA 4WCYH 4NRZB 1EEZA 4LRIA 2XZCH 3EHBC 1JV5A 3VG0L 4QOKA 5GSRB 5DQDL 5GRWA 1YNKH 1K3IA 2VZVA 2EDXA 3QUYD 4FNLH 2HT3D 1XZ0A 4PJFF 2O5XL 1W8NA 5D6CB 3JWOH 1MCEA 3P40A 4JRYA 1U8KA 4G7YL 3AAZA 3H3PH 3SGKC 1KN4L 4KMTL 1JWUB 1Z0MA 5MENB 2VJXA 3SOBH 4E0RA 5TDNA 2QLVB 1T1WB 1CD0A 1LO0L 1N8ZB 2B4CH 2W91A 3HLAB 4MA7L 2CLRB 2GTZB 3EBAA 4I0CC 1PKOA 2HJLB 2O5ZL 2YHGA 4A6YA 2HT2C 4PGEA 2XFXB 1J7VR 4OLZL 4WW2A 4OFYD 4C83B 2DLEA 4APQB 4L8CA 3BE1H 4PJ5B 1UWGH 1X4ZA 3WYRA 3GMLB 4JY4B 5CJBA 3Q5OA 1WZLA 4MS8C 4JRXB 1QHOA 4O2EB 3QUZC 4X6FB 3MNZA 4WTZG 4QTHA 1J12A 3CDGB 4O58L 5BZDB 2NZ9D 4JFPA 3C5JB 2X44D 3R1GL 2VZUA 2A6JB 2PO6C 3EFDL 2OJZL 4BZ1H 3E8UL 4XP9L 1I9RL 3QUML 4Z7VB 4AL8L 5I8CB 4GW4B 3B9KC 5CEYA 5I1CH 2EXWC 2P8MB 1E4WL 3DJ9A 1YY9C 3VW3H 4JFDD 2AJSL 4P4KC 3K81A 4IDJL 3AM8A 4ENEC 1OPGH 4P99A 3KPNB 1WSST 2IFGA 2CKBA 2H1PL 3TJHD 4LLWA 4L29B