4XPBL

X-ray structure of drosophila dopamine transporter with subsiteb mutations (d121g/s426m) bound to cocaine
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
214
structure length
214
Chain Sequence
ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Tranport protein/inhibitor
molecule keywords Transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 44
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpbL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpbL01
4M03A 3IDGA 4PJEA 1BHGA 1A1OA 1AFVH 1N6VA 1UM5H 4G9FA 4GAYB 4KKAC 2QSVA 5CJOL 3BWAB 3Q3GB 3V2AR 1WUNT 3HZMA 5IW1B 2XRAH 4U6HA 3PL6B 5JPMA 1FL5A 1JMXA 1CXLA 3GIVB 4BSVA 3UTTA 4AK1A 3T0EA 3U7WH 4HV8A 5IMOA 5FCUH 2EDTA 4WV1B 2XWJB 2FO4B 2YEZB 2B39A 5AZ2H 4FN0A 5FK9A 1EAJA 4NWTL 3SDXB 2DLFL 2J12B 1S3KL 2UY6A 4F7MB 2EC9U 3DYPA 2JCCF 1JTTA 5GRUL 3GJEB 5JHDE 1S9WB 4RGND 4M62H 1OL0A 3CDGA 2XY2A 3V79C 2FL5B 3PWVA 1G6VK 3KYNB 2OSLB 1LO4H 3CLFL 3B3IA 1HHJB 5DHVB 3MCG1 4HPYH 3IDJA 5IGXH 3G5ZB 1CD1B 5C0CE 1IC4L 4MS8D 1NEZG 1A2YA 5IK3A 1OPGL 2CLZB 1UCBH 1LE9A 5KW9H 1QO3B 1CLOL 5DMIH 4ZAKC 3SY0A 2XTJB 4M93C 4OT1L 1ZVYA 4IMKC 3VFRA 4MYWB 3RDTD 3ARBD 5JA9A 1WSST 5CLWA 3TEUA 1MVUB 5MHSE 4OGXH 3GMLA 1MCDA 3VGAB 4E5XB 2H6PA 5F9WB 3LH2L 4KPHL 1RJZA 3F12B 2JK5B 4PRPD 5F88A 3CDYA 3I50H 4F2MA 1IAII 2GK0A 3B5TA 4M7JL 3VMNA 2HLFD 1C16B 2OP4L 1VDGA 5IFJA 4FTVE 3TC9A 1XCTB 4CJ0A 1SQ2N 4M7LT 3QXUA 1WT5C 4K7PL 1CFVH 4CNIB 2W65A 4JM2C 3FHAA 3EO9H 5FYLL 3CFJB 5CBEA 1U8IA 2NY0D 4OD2A 3GSRB 3MUZ1 5B8CC 3ARUA 1AY1H 2BOBA 1PKQE 1NH6A 3BT2H 2OMNA 5K9JL 4Y19E 4LARL 2ZJSL 4ZFOL 4I2XA 5BVPL 4X5WB 4URTB 4KK6D 1YQ2A 3B43A 5IMKA 4Z0XA 5ITBL 4HMDA 5D9SA 3K4DA 3C2SA 5ALBH 3SQBA 1LHZA 4L4TB 4WW2B 4GKNB 3V6FA 5I76A 2IPTH 2X1QA 3L7EA 3CX2A 3EIFA 4MJIA 3SO3B 1I1AC 3O3EB 3B9KB 4U1KB 4EIGB 5HYSA 4DZ8B 3IJSA 1NAMB 3EOBA 3B5HA 4TTDC 5D2NC 1IEHA 3WDJA 1BOYA 1MHEA 1OP5H 5HHNB 4PJAF 4LKCB 1O7VA 1FNLA 1EMTL 4HPOH 2MFNA 3F7VA 3GNMH 4J4PD 1CGWA 2HRPH 1NCUA 5F96L 1C8PA 1S7SA 3UCRA 3TBSB 4FQ1L 1AD0B 4LGSB 3HNSH 5J6GB 1YECL 2QSTA 3O2VL 3PWPD 4WIQA 2E8YA 1RSFA 4UT9H 3CC5A 4JFEB 4KMLB 3QZWG 1VFUA 5FO7B 3ZDZE 3GK8L 4M6ML 4NO3A 1AC0A 2DQDH 2NY2B 1DEDA 2UY7A 4CN1A 3OAUL 5BZWA 4OZFH 4NM8H 4G8FB 1YNLL 4X5XB 5DHYB 1GZPB 5ALCL 3S96B 2XG4A 3MTRA 1FDLL 1Z5LA 1A6PA 3RPKA 1CLYL 3L3GA 3WO3B 3E6FA 1SJXA 4JY4B 1X5XA 2X40A 4G80A 5DD3L 2VIRA 4L8CB 4M5YH 5KTEL 5I1KL 2E7LC 5ICYA 2V17H 4M7KL 2C3WA 1KJVB 2IPKA 3RVUD 2H32H 4O51B 3TBVB 4C56E 4OLUL 4DAGL 3C60D 1J1XL 2FSEB 3W82A 1YEEL 1TNMA 1OCWH 4H1LH 2WIIA 4HK0A 3RU8L 1QFUL 2ZOKA 1UEMA 4C83A 4OQTH 5F7DB 4XNZB 3MROA 2C3VA 4XXCA 4O9HL 5FHAL 1R5WB 3TWCL 3P4OA 4KQ3L 35C8H 4MD4B 4ZPTB 1BQHA 2Q86A 4LKXB 1JNHB 3ROOB 2XQBH 5D6CA 3ARZA 3UC0H 1AGBB 2R1YA 3GI9H 4Q58C 3I75A 4HC1A 4NQCD 4QNPF 3VFPA 3N9GL 5C0EB 4W6YB 2DDQL 4UBDC 5D7KD 3CAFA 4F33A 3EGSA 3WFHA 1D9KA 3TFKD 4MA1B 3MV9A 5TFSL 1KSRA 3VH8G 4OSUH 5E8PB 3GMNA 4CU8A 4JO3H 1UQSB 3RBSA 4EVNB 1XF2B 4L4JA 5BO1H 5TF0A 4XPFH 3KJ6L 1A6UH 3FAXA 3GMMB 2D03H 3T3PE 3IU4L 3ARDD 3HPLA 1T03H 5DSCB 1V7MH 3DUHA 2Y06L 4HBQA 2MKLC 4HIEB 3L3IA 1SJVA 4XPGL 1SJHB 5I1HH 2BX5A 3QDJD 4OGZA 2C4FU 1E4KA 1S78C 5DJDA 3QDHA 3C6SA 5KSVB 1QRNE 3IU3B 1J8HD 4LSSL 4PS4H 5GS0L 4D9QE 3I6LD 4G6JL 4PJGB 5H94B 1FORL 3UZVB 4PBVC 4EDWL 4AQOA 3VFOA 1BBDH 1OAQH 3QEHB 3MLTA 5E99H 4TUKL 3VXOA 1RHHB 4KDWA 5H8DA 1MFCH 4UB0H 3D3VE 2PKDA 2C1PA 3VFVA 4Y16B 3IKCA 3IS0X 3K8LA 4IS6B 4CMHB 2VC2L 5EU6E 1FFOB 4XPAH 3H3KA 3DGGB 4KI5C 5DJCA 2BCKA 3TN0C 3TP4A 2AGJH 4YBLB 1S7UB 2P46B 3OXSB 1N5YL 3ULVL 3QB7C 5KBNC 3L3KA 3VWJD 5IIEA 2BC4A 3QDME 4MJ6A 5CIPB 3PP4L 4K3EH 1MHCB 2P7TB 4LCYA 5ADPL 1WICA 3MZTA 3MOBL 2A6DB 1DDHA 2Z8RA 3RNQA 1MCOH 2JJWA 3QEGH 4NJ9L 5J4MA 2F19L 1J0KA 5GGUA 1KELL 5HI5C 1TZIA 4HD9A 3AREB 4NKQB 1NBYA 32C2B 1MY5A 5ETUB 3VXME 5JIIA 1DVFD 1INQB 1OSPH 5D1QC 1FV1A 1M05B 1TVHA 5CWSB 2YPLD 1ZGLB 3C87A 3NABL 2E6QA 1TTUA 43CAB 5I6XC 3INUL 3MJ7A 4H25B 1HH9B 1YY9C 2AJYL 4XVSL 4LHUG 3NCJH 4IEFB 4JQIH 4RISH 5E6ID 5IB3A 1RK1A 1KIRB 3MRGA 2BK8A 5DMKB 1G7JB 4LL9A 5LWYL 2NYYC 2AJZA 5DLML 5BRZA 5SWZD 1AGDB 5EO9B 1JF1A 1JPGA 12E8H 3CCHA 3BOVA 3F5WA 4LVNC 5DJYA 1GPOH 4P59L 4D9LL 2EKJA 5EU4B 5I19H 3QQ9D 5L2KE 3FZUD 4X7EC 4JO4H 2X4OB 4J12A 2VR9A 1RIUL 2ZCLL 3TZVA 4BQ8A 1YY8B 2HFTA 3QO1B 4RGNB 3CIQA 5I8EB 2W9LA 3SKNB 4LSQL 1JPST 2IWGA 2P24B 2VLLB 5BMFL 2W07A 1GGIL 5H35B 5HYEA 4HGMA 1AE6L 4HW6A 3C5ZA 3QAZC 4PP1D 5E6YA 5F21B 4Y5VB 3WDIA 1XGYH 4M1DL 1SEQL 3TYGL 1UT9A 2DOCA 2XZAH 5LAXB 1P1ZA 1FFQA 2ICWB 4U1NB 2VH5H 4X8XA 1XGPA 2F8XC 4NO2B 5KZCB 1GZQB 1KLUA 1RURH 5IJKC 2YR3A 1WZ1L 3OV6A 2P48B 4ODSH 4TTGA 3PHSA 4XNQB 3FO9A 4P9ML 3RIAF 1BJMA 4JFPA 1PFCA 3HPJA 4N9OB 5IESL 3QRGH 2V9QA 3S3JA 1J7VR 2IANE 4OTXL 4E42B 3O2DH 2EZ0D 2MJWA 2VDLH 5JW5A 4K3JH 1BGXL 4ERSL 1TTGA 1YYML 2B1HL 1MRFL 3ZT5A 3BD5A 2AI0H 4TOYH 1CVSC 2GY5A 2J6EH 4X4ZA 1FL3B 5ERWA 5GS1A 2YZ8A 1YNKH 1DQQA 4Z7VA 2F74A 3RWIA 3SDCC 2ZUXA 2BSRB 2IADA 2NY0B 4NQEB 5KSBA 1WZKA 1QFPA 3ULSB 2L4OA 1RJLA 2QADD 4RSVA 1X5ZA 1HINL 2RAMA 3E2HB 2XN9E 1NGPL 4TSBH 5MP6L 3RTQC 3U36A 1LK3L 4NIKB 4QRUA 5FXCH 2YUXA 3HN3A 3O4OC 2ZPKH 4G7YH 4L1HA 1MI5E 3FQWB 1AJ7L 5FECA 4MMZC 3JTSB 4NKOA 3MLVL 3L3OA 4FZEH 1RZGB 4NUGH 1CLZH 3ZT7A 1T1XA 2X44D 3BGAA 5EO0B 5LGJA 1KPRB 2DTML 2LVEA 1D5ZB 4LLMA 4MA3B 5BXFB 5F8QC 4XP1L 3LD8B 1WIOA 3RA7H 3VH8A 2VDPH 2Y07H 1PSKH 2KBGA 3VXRD 1R3LB 3RI5K 3RWCA 1BVZA 3WUWB 3P0VL 2A83B 3RWHB 4WNQB 3FHQA 3M45A 3N85H 1ZWIB 1IGML 1CICB 4FQIH 3PL6A 1KG0B 4DFIA 4ZYKB 1K4CB 1NSNH 1BVLB 1P84J 2EDOA 4GLRI 3T4YB 1UADC 1KF9B 4NBXB 2XWJA 4GG6E 3PHQB 2FO4A 4AG4H 3SQOL 3AU1A 2YEZA 3LY6A 1W0WB 1DBKH 2H26A 4LCWE 3SDXA 2Z31C 1WBZA 4YHYB 3W2DH 2XKUA 5EG6C 4L9LC 4NPYB 4YXKL 3FOLB 4OCWH 3ZTJG 3O8XA 3OX8A 2R0KL 2VERN 4NO0B 4CU6A 4GG6F 4H5SB 5JOEA 3J7HA 1GGCH 3HAEG 2RCSL 2VZ1A 3GSQB 4OF3A 4OV5A 2NNAB 2FL5A 5SV4A 4DOHE 1C5CH 4E0RB 5DHVA 3S37X 1JWSB 2VLJA 4X98B 1OF2A 5IROC 1JV5B 1J0IA 1A7OL 2J4WH 3EYQD 1RULH 2IBGA 3S36L 1G9ML 1U8KB 1YJDL 5D7LD 2AV1B 5AEAA 2CLZA 1JZ3A 5I1CH 2RGSA 4YXHL 3GUTB 1I8MA 5D7JA 5FYLE 4N5EC 4CAGA 2HT3D 3WNLA 5I17A 1FE8H 5GGSY 5E24E 5E2UL 1CU4H 1P53A 1EBAA 2MPAH 4POUB 1G7LA 3VXTA 1I9IH 3PJSA 5K9KB 2JK5A 4S10A 3UJJL 3BDYH 5IEHB 4L3ED 3RWDB 2CMRL 3C60B 3HA0A 1F3DJ 5E8EA 1C16A 1FLTX 4QLRA 1T1WB 3T0EE 3QUMB 3UTTE 3W11C 1U0QA 1T66D 1DLFH 4FFVD 3TV3H 2IAMC 2Y36H 3WEXA 3K8KA 4ODUB 3U7YL 3VXNB 4DKFL 4FMFA 3H3PH 2YBRB 3CFJA 5FUOH 4JFYA 1F3RB 3GSRA 1P69B 3WJJC 4Z95H 3H9SE 3SKJL 1MAJA 2ZUVA 4IIQA 1E4JA 4LRIC 4X5WA 1C12A 1O7SA 4AEHL 2PYEB 2NXYB 2RJMA 4MA8L 1IAIM 1Q1JL 3BN3B 4N8VG 6CGTA 5F9AC 5ANMA 4K7PY 5KOVC 3VD5A 4LFHG 3TVMD 4L4TA 4FP8H 3X3GL 4YC2B 1K3IA 2H2SD 1XGRB 5BVJA 5C0IA 1MAML 5FV2A 1AXSB 3B9KA 4U1KA 4XWOC 4JG1H 1AP2A 1KTLB 4DZ8A 2ZG1A 3ARDB 3MRFB 2FX8H 3AMLA 4P99A 1KC5L 3QNYA 3PNWB 4KTEH 4D0BB 3RL1A 4KQ4H 5I74B 4HLJA 1LEKA 2BDNL 1CGXA 3QDJB 3PWLA 2R0LL 1RJCA 3KLAB 5L7XH 5DUMH 4RFEB 4OZHB 1I8IB 1UB6B 2EDFA 2BHYA 3TBSA 2RFXB 5DWUL 1AD0A 4EN3B 1EVTC 1YA5A 4HZAA 1F58L 2VXTL 2X42A 5D1ZD 4G42B 3LB6D 2LU3A 4JFEA 1OTTD 3AXLB 2P5ED 5FO7A 4P5TB 3MJ6A 4JHAL 2GCYB 1A47A 2JJTA 3PUCA 3VFMB 4WI3A 3V4VL 2JELH 4PJ8B 1R6VA 4NP4L 5DFVC 5F6HJ 3DV6A 3IDIA 4PTUB 4UTAH 4I2XE 3FT2A 2V2WA 4PY8J 4Y4FA 4DGYL 3PQYB 3T8XA 3TH3T 5JPNB 4JVWA 3NIFF 4XP6H 3Q1SL 4X5XA 1GZPA 3BIKA 1N0XL 3EO0B 4UU9B 4HT1H 4IRSC 4M7LH 4WFEE 4JY5H 1JHTB 2HH0L 4OD1L 4BUGA 4D8PB 1KTRL 5HHMD 3C09C 4XPTL 1IEBB 4KMTH 4KHXL 4MJIE 4L8CA 3AGVA 2VN7A 3ABZA 4LSRH 3ECBB 5ACZB 3SGKA 5K59E 1KJVA 5JOFB 4HIIB 1CDBA 2BY0A 4HS6A 4PGJA 3L7FA 1OD9A 1HILA 5I75C 5KSUA 5I66B 5M95B 1IE5A 2O5ZL 5K59F 1ZGLP 1SYSB 5HI3C 3GBMH 5GSRB 2Y9RT 4M48H 3OKMA 3MBXL 3U9UA 4PRAB 3RGHA 5IVXA 3GSOA 4G43A 5F7DA 4PB9H 5CILH 3S98A 3C5JB 2DMCA 2CO6B 1R5WA 1SYVA 1J1PH 2ZG3A 3BSZH 4ZPTA 4QGTA 4LKXA 1JNHA 3IFOB 3ROOA 3BQUD 4KDVA 3NCEB 3MUJA 3ESUF 4M5ZL 4FNLL 2GJZA 3IFPB 4U1JB 3H0TB 4X6FB 4LQ1A 5C0EA 3MO1A 4A6YH 4GRWE 4G8GB 1NGYB 1Q9WA 1MCNA 1UENA 4ZS7L 5HD8C 4EVNA 4G6MH 1O5DT 1QG3A 5DRNB 5FGRA 1T7VA 4GRWF 5JXED 1XF2A 1JGLL 1ZOXA 2I07B 1EERB 1DBJH 2ERJC 5I8CB 3HAEA 3GMMA 3O6KH 4NQXA 4I18C 1T7WA 2NY4B 1BFTA 5DSCA 1M6OB 3ES6B 2BNRB 3GSWA 1DBMH 3DO3A 4P5KB 1BECA 5HHQB 1IGYB 1SJHA 1FCCA 3ULVE 3ALPA 5EOTA 2V2XB 4PJ9A 5CSZB 2VXVL 3IU3A 3VFGL 2P8PB 3RX5A 3TH2T 3B8SA 4GMTL 5H94A 3VXSE 4GKOA 1OD7A 4IHOB 3ULVF 1WEJH 5MEPB 4B7IA 4IOIB 2NQCA 3LOWA 3QCTH 4LCIL 3TJEL 3DIFB 4RFOL 3GIZH 1VFMA 5C0AD 4WEBH 3EOTL 2FWOB 4IS6A 4IRZL 4H8WC 4X80H 3L3JB 1UM6L 1FFOA 1WGOA 1NMAH 1MY7A 1S7UA 3I3EA 4PV8A 1GHFL 1INDH 2UWEA 4K2UL 4ODWB 1QVOB 4YPGB 1XIWB 2WUBL 2HRLA 3QDAA 1XZ0A 1U8JB 5CZXD 1A6AB 1FAIH 4H8WH 2P7TA 3QUXD 1FNGA 5A2KH 3MV9E 2EDLA 2KPNA 2A6DA 4H0IA 2G75A 4HWBL 4J3SA 5JHLH 2BRRH 2P1YA 3QDGA 1FYHB 1T2XA 2ZSVB 1LWRA 2OI9C 3LQAL 4QXGH 3CFKB 3TNMB 1QSEE 3BHBB 1IGIH 2YRLA 4KKAD 5A16B 3IDXH 1A14L 4MX7B 5F1NB 5C09A 3MA9H 3OR6B 4K3GA 3FB6B 1MCKA 1C5DB 1FVCA 4P2OA 4QRQA 4AZ8A 1INQA 2A6JA 5I0DA 3SJVD 1BIHA 4L3CB 5CWSA 5GGTL 5CJOH 3UO1L 1MCFA 2B5IB 3BP6B 1UZ8B 3UTZB 43CAA 4KZDH 4IJ3C 3WCYA 2DM7A 4XWGL 5LBSL 1T1YB 1KIRA 5DMKA 2Z35B 5F71A 4MCZA 5GZNC 4P5MA 1AGDA 5IBUG 5DVOA 5EO9A 5DMGC 1WFNA 4NWTH 4N90D 2Q1EA 2GTZB 1JTPA 1S3KH 3OKEB 5EFIB 3ZMRA 2X1XR 1EEUA 5EU4A 3PV6B 4MDIA 5GRUH 4U2ZA 4J8RB 1KCSL 2H1PL 4GQ9L 4R3SA 3CLFH 3ZKMC 1FJ1B 4JRYB 1YY8A 5C6WH 4GRLC 4ZAKD 1T5XB 5GRJL 3SKNA 2X4UA 2HJLB 4CJ1A 3FQUA 2P24A 2QKIA 5DD0L 1OPGH 2DBLL 3JUZA 2X1OA 3GSNL 2KQNA 3HMXL 4BQCA 2ED7A 1CLOH 1KULA 3QCVL 5GJTL 4XTRC 1VESA 5DJ8B 4X0KB 4OT1H 1GCFA 3MRKB 4PJHF 1F2QA 3B9AA 3R1GL 1KV3A 1IM3A 2ICWA 3NH7L 4U1NA 4N68A 1GZQA 3MJ8A 1JHKL 1G0XA 3LH2H 4KPHH 1AO7B 1HHKA 4XNQA 3HE6D 1HI6A 4M7JH 1TMCB 4YDLB 3GO1L 2CDEB 5ACMA 4WCYL 2OP4H 4E42A 1NEUA 1XGTA 5I1DB 4RMQA 3ALXA 3KWWB 4JM2D 4ONHB 3D18A 4HFUL 1ETZB 4K7PH 5BRZE 2VB5A 5FYLH 4XBEL 5F6IC 1MCHA 4UIMA 3KPOB 5TE4H 1J18A 4TUOB 2DMKA 3V6OE 1SM3L 3DUSB 2FRGP 2BSRA 5A2LH 4HMEA 2XNAB 2ICWJ 5K9JH 3LAFA 4NQEA 3T0EC 1W72B 1UC6A 2ZJSH 1K6QH 1IGJA 5BVPH 3FFCD 2FECL 3ULSA 3UTSD 1G1YA 2BOCB 1QKZL 5FUZH 1FZOB 4ELKB 3BX7C 2E9JA 5E4EB 5ITBH 5IUSA 3BPOC 1KXTB 3S8WA 1I1AD 4QKXB 5DC4B 5ENWB 1NDMB 5DK2B 2VLKD 3MLSL 5JQ6H 1G7QB 4WFGD 3QFDA 4RAUA 3MLZL 4NO5B 2AXHA 1VEPA 2VITB 3BVNB 1PZ5A 1RZGA 5E56A 3O2WL 1DANT 5SX4H 3V8OA 3WV0A 4HXBL 1KPRA 2PTUA 3QUYD 4MA3A 5BXFA 5I1EH 3IGAB 2CRIA 3LPFA 4P2QD 3WUWA 1GOHA 1LP9B 1EMTH 2A83A 3RWHA 4WNQA 1FVEB 3SE3C 3SDDB 2R0WL 3QSKB 5F96H 2ZCHH 5LJYH 1KG0A 1K4CA 1PQZB 3SKUD 1MIEL 4FQ1H 1NCNA 3T4YA 1YECH 3O2VH 3D39D 1RAMA 1CGSL 1TJHL 3PHQA 4JDZB 1EVUA 4JZNA 1W0WA 2R69L 3HNVL 1F02I 4Z78B 2N4IA 2F5BL 3IF1A 3REVB 2HN7A 3DROA 3PWPA 2CLRB 3S35X 3GK8H 4M6MH 2CH8A 1NMBL 3WMSA 5KG9B 2ESVB 4H5SA 1KJ2L 1FSKB 3ILQC 1QACA 5L0QC 4QOKD 4N0YL 1BF2A 2DQHL 3OAUH 3EJJX 3BEVA 3NFPA 2G5RA 1U6AL 2LAGB 5D93B 4E0RA 1T0NA 3ZKXC 1JWSA 3CFDB 1S7WA 3U4EB 5KSBE 1JV5A 2ATKB 1DQDL 5EO1B 1YNLH 4TQEL 2HT4C 5M7QA 1OAZL 5BS0B 3ARVA 1U8KA 5ALCH 1ZLSH 1JGVL 5E1AA 2ICEB 4QYOB 1N8ZB 1FDLH 2WMPA 4Q7DA 5IHUL 5KSBF 1CLYH 4I0PC 4NN7C 3GUTA 3D1MC 2X4SA 2R1XA 3VJ6B 3UTOA 1AHWC 2V6HA 5KTEH 5I1KH 4P3DA 5HHMB 3I85A 4OGYL 4M7KH 2EDDA 1NFIA 4OLUH 1QQDB 3OGCB 5K9KA 1YEEH 3QI9B 5IB2B 2DS4A 2R4SL 3LS4L 3FB5A 2W9EL 2WIMA 1HQRA 3RWDA 3C60A 4PJ5E 4HUWA 4QRTB 3RU8H 1QFUH 4ELME 3RZWA 3CH1A 1T1WA 4XMKL 3QUMA 3ARFD 2YA1A 5J12C 4BH7A 2DQCH 4O9HH 3IAGC 5FHAH 3VXNA 4ELMF 3TWCH 4WI5A 4KQ3H 4V1DD 2BY3A 4GG8B 3P3YA 3WFEL 4UBDD 1QBBA 2R2CA 2P5WD 2V7NB 1BD2E 4PJDE 1JWUB 3N9GH 2DDQH 3UYRL 3QIUD 5TFSH 1T6WA 3EJYD 1CGYA 1UKTA 4B50A 5J3HC 4NQCA 1XMWA 3PDOA 4LHQB 2VLJE 4PJDF 5C9KA 4P46B 5HVFB 2YD3A 2PN5A 2HKFH 2XT1B 3RUGB 2YC1B 5DRWB 4ETQB 3KJ6H 5M94B 3D2UB 3IU4H 1AXSA 5GS0C 1CQYA 1U3HB 1NGWB 3VFTB 1S78D 3MRHB 2C4XA 2Y06H 4Q74A 3QUZB 1KTLA 5H37G 4BM7A 3ARDA 4XPGH 3IAQA 2DF3A 4ENEC 1L0XA 3W39B 4OZGE 1H3PL 4Y4KC 1LEIB 3PNWA 4D0BA 1VEMA 4LSSH 4GRWH 5GS0H 1KIUA 4G6JH 3QDJA 1FORH 4EDWH 3TYFA 4OKVB 1I8IA 3EDFA 3PG2A 1J8HA 3O11A 4OZGF 5CJ5A 4TUKH 1T89A 4KI5D 3ULVC 2YSSA 4CGTA 3OWEA 3NBNA 3KPLB 4G6FD 3GMRB 4PBWD 2DQJH 2VC2H 4WW1B 5GGRA 4F3FB 1PY4A 1Q38A 4G42A 3DVIA 4JO1L 5DJZA 2DYPD 4P5TA 1XF4B 1JE6A 3EHBD 2GCYA 1UB5B 2XPGB 3AMKA 3ULVH 1OM3L 2Y7QB 3P0GB 1Q0XL 5LCVL 4F7TA 1TFHA 3PP4H 4YH6A 1FG9C 1DUYB 4PTUA 4Y4HB 1ZT4A 4L8SB 4MDJB 1JFQL 4MAYB 5ID1B 5ADPH 3EDKA 5HI5D 3MOBH 3AS0A 1E4XL 1WF5A 3EOAB 5JPNA 5EZIL 3LS5L 3JSSA 4LP5A 3VWJA 2OQJB 2YK1L 4ZOBA 4NJ9H 3EO0A 4UU9A 5JZ7C 5DJ0B 3ARGB 5ANME 1JHTA 2F19H 2O5YL 1HDMB 1A64A 1KELH 5D1QD 1YMHA 3LHPL 3FRPA 2W0KA 3CSYB 1J05A 1YY9D 1I4FB 1A7PL 1W0VB 3QG6B 1SMAA 4RIRB 3S5LG 1I8LA 4EXPX 3NABH 1BWWA 1I3GL 5HYJD 2NYYD 1X5KA 1AC6A 3INUH 2QBWA 1DVFA 1QFWI 2AJYH 1PAMA 4HC1H 4XVSH 1ZA6A 5I66A 3VGBA 5I16B 4XCNB 3Q48A 5B38A 2YPLA 1SYSA 3K2MC 5LWYH 5GSRA 5DLMH 3A6OA 4PJCB 4OJFL 5E6IA 4PRAA 3FONB 1P9MA 3C5JA 3DX7B 3QEQB 3KGRA 1ORSA 5SWZA 1CDYA 5KS9A 2R2EB 4D9LH 4O2EB 3BPNC 4ZSOA 2CIIB 5C08E 3MBED 1NGQL 1CFQB 4XNXL 5I18L 5EIVA 3IFOA 1XR8B 4HSQA 4ZDHB 3T65B 5DURD 4RRPG 3K46A 4HUNB 3IFPA 4CBPA 4U1JA 3FMGL 1RIUH 3H0TA 1I1FB 2LU7A 2ZCLH 1S7TB 3EFFB 4FXLA 4X6FA 4ZOEA 3MRPB 1KCVL 3TNNB 5HI4D 1NGYA 4M02A 4N9GA 1PX3A 4LSQH 4QT5B 3MGOA 5BMFH 1ZSDB 4RMTA 1AE6H 2AJVH 5K9OA 3B2VL 5DRNA 5EBGA 4UQ3B 4M93B 1WAAA 2I07A 4M1DH 2MQCA 2Q8BL 1SEQH 3TYGH 2UV3A 1T22B 2E9WA 4G8IA 1FRGL 2HTKC 5D7IA 1M6OA 2BNRA 3CVIH 3PABB 2EC8A 2X70B 4P5KA 1REIA 1WZ1H 2Y6SC 4N8CL 1PKOA 1HNFA 2OBGA 2V2XA 1JTOA 2KDGA 1UJ3A 4LOUC 5CSZA 5IESH 1FVDA 4OTXH 4Z7WB 5IB1B 3RX7A 2R2BA 3GM8A 3FO0L 4ERSH 1YYMH 2O5XL 3H42H 5MEPA 2B1HH 1MRFH 3W0WD 4JDTL 4KUCF 1OB1A 3BPLC 3H9HA 2DQGL 3SDCD 3DIFA 4FTVD 4JM2B 1VENA 1BPVA 2Q8AL 5IVXE 5B8CB 2SEBA 5IEKB 4R7DB 3IETB 5F1KC 4CDHA 3QJFB 1DL7H 2B20A 4RFNC 3NFNB 4Q9CA 2OTWB 4ODWA 1P7KB 5LG1A 3DMMB 1QVOA 3B2UC 3LN4B 1HINH 3QG7L 3VRIB 1NGPH 2Y5TB 5EU7E 5IW6B 1LK3H 4X6CE 3VFUB 2GFBB 1J12A 4I0CC 1T7YA 3L95B 3V6OC 3CLEL 1NPUA 2FECI 1H5BC 4Q97A 4RMVA 4X6CF 4HGKC 2ZSVA 3VXUD 1IT9H 3MLVH 4ODBD 1I3UA 4HJ0D 4U0QB 4W4OC 2NY7H 3K1DA 3BHBA 5EIQA 5D2NB 2FATL 3TZVC 5F1NA 4JQXA 3OR6A 3ZE0F 3EYOB 5F70A 3RWFB 4X6EB 3QWOB 4XP1H 4ZO7A 3PHOA 1KBGL 1MCIA 1B0GB 1ZHBB 1OAUL 3P0VH 3QNXB 4L3CA 2QR0A 4YHML 3ZE1E 3A0OA 3BP6A 3UTZA 1IGMH 1OP5K 2ED8A 1I1CA 3VXRA 4R9HA 5C8JA 1IZJA 1WC7A 3CXDL 1EFQA 5DT1L 4JFZL 3RBGA 4BELD 1BX2B 1MFBL 5ESAA 3Q5TA 4OZFB 4OZIB 5ECJE 4U1HB 2OXGA 5HPMB 1U3ZA 3D39B 2ITDA 2CIKB 3OKEA 4JB9L 2CKBB 3BPCB 4ODTL 5EFIA 4YXKH 1G9MC 2VL4A 1YJDC 4KKBD 5KVDL 2PYFB 1M7IA 3PV6A 4K07A 2PF6A 5C0GA 2RCSH 2VZ3A 1CS6A 5IJVA 4J8RA 1FH5H 4M7ZB 1A7OH 1B0WA 4CVXA 4QOKB 2UWEE 3S36H 1KOAA 1G9MH 1YJDH 2HJLA 2WWMC 3U79A 3ZZ1A 1LNUB 1G84A 1EEYA 5E8NA 4L8DB 2H32B 2ICWI 3FT3B 4CVWA 4EXKA 3IRPX 3KNBA 4YXHH 1X9QA 2UWEF 3HI6L 3ISWA 5DJ8A 2FB4L 3D25B 3MRKA 3FCTB 4H1LB 3S3SA 2DWDB 1QUNA 3QDGE 1VGKB 3MGTB 4FZ8L 3MOAH 5EB9A 2A6KA 4C4KT 4KJPD 4JREC 3UBXB 4HKZB 1JGDB 3MRJB 5E2UH 5JR1L 5C09E 3U30C 4MJ4A 5IQ9A 3LRSB 1H3WM 2Q6WA 4ALAL 3M17B 3W11D 3UJJH 3EDJA 2IAMD 2CMRH 2CDEA 1R3HA 5IVZA 2VQTA 4LLWB 1CE1L 4ONHA 4NUJA 4NJAL 4L3EA 1Y18B 3DJ9A 1OQOA 1ETZA 2DLEA 3U7YH 4DKFH 1EUTA 3S5LA 4LLVB 2B4CL 5IFHL 2YRZA 2DQIL 3DUSA 5ESVA 5JORB 5E9DB 3VWKB 5E8OB 4K94L 3SKJH 7FABL 1W72A 4OIBA 4LNVA 3GSUA 5FHBL 4FQ2H 1QD0A 3I9GL 4AEHH 3GJFH 1FZOA 4JPVL 5FM8A 3RGVD 4MA8H 2IQAA 1Q1JH 2D7TL 4N0FB 5CD3B 2I5YL 4JCMA 4FABL 4XWOD 5ENWA 5DK2A 2AK4D 5FGCE 1QBAA 3X3GH 3REWA 3KPRE 1OLZA 1MAMH 3CX5K 2VITA 3TVMA 1KB5L 1RQ5A 3BVNA 3KPSD 4ZFZB 5T5FL 1SHMA 4WDIA 2J5LC 4AT6B 1FC1A 3QT2A 3VG0L 1ED3B 3IGAA 4G3YL 1OP3H 1JZ6A 3UPAA 1E6OL 1LP9A 2BDNH 1FVEA 2X10A 2R0LH 2NW2B 4U1GB 2MMXA 4NNYB 4D0CB 2DBJA 3VA6A 1PQZA 5D7JC 5FA3B 1I9RH 5DWUH 4D9QD 1UKSA 2LTQB 1BOGB 1YPZB 4PRPE 3DOSA 1G7HB 1CGTA 2ADFH 4JDZA 4JANB 1W2KT 2G60L 1F58H 2VXTH 4LCUA 1JK8B 4Z78A 1KLGB 5DFVD 2C3GA 3REVA 2GITA 1E28B 4NC2B 3TN0B 3OAZH 4JHAH 2EYTA 5EZLB 3QXDA 4LSDA 5KSAC 5D1ZA 3A6CL 4YDVB 3V4VH 2DYPB 2P5EA 2Q3AA 1X4XA 2OL3L 1OARL 3CFDA 3U4EA 4DGYH 2ATKA 25C8L 1PX4A 4XP4L 5EO1A 2FJGA 4ZQKB 1N0XH 3TPKA 2AQ3A 2ICEA 1N8ZA 2GHWB 2HH0H 4OD1H 2VXUL 3MRQB 4XGZA 4O5LL 3VJ6A 4XPTH 1WBXA 4IIQC 4KHXH 5IP4A 5BOPA 5D1QB 5HHOB 3MRLB 4ZUSB 2IBBA 4GS7C 2VN4A 5I6XB 5HI3D 4GBXD 1QQDA 4C59B 2BSED 3OGCA 3I02A 3UDWA 5IB2A 2O5ZH 1PD6A 1WZMA 5JNYB 3QHZL 1WCQA 3MBXH 3KG5A 5EBLA 4CW1B 2BNUB 3DETC 2ITCB 4LVNB 3LMJL 4NQDE 2HLAB 3OHXB 1GGYA 2EIEA 4GG8A 1G7PB 3SPVA 5FFLA 5CSBA 2GI7A 4M5ZH 4FNLH 1ZVSA 3PWPE 2I60L 5F9JA 1UWXH 1FZMB 1JWUA 4G5ZL 3BQUA 4XXDA 2VDQL 5T3ZL 5DQ9A 2X1PA 3IFNL 3RJQB 3G5VA 1JIBA 2IH3A 3VDAA 4MXVF 3QAZB 4ZNEA 4P46A 4ZS7H 5JHDB 3LKQA 3K0WA 1BQLL 4PIRF 2YC1A 5DRWA 5FDWB 1DN0B 2XZZA 4UZGA 3DX8B 5C0CB 5JXEA 3D2UA 1FIGL 4JN1L 5DFWH 5INDB 4R8WL 4YHIB 3MRHA 5J9PA 5ADOL 3NPSC 4WEMB 1ZMYA 4XHJD 4Y2DC 4P3CL 3VE0A 1T4KB 3GMPA 4GAFB 1LEIA 4U1IB 3ZKSD 5FO9B 1AIFA 2P49B 2VXVH 3VFGH 3SDAC 3MACL 2CGRL 3TGXA 2VABA 4GMTH 5AYUL 3T08A 2K7QA 3H6JA 4MD0B 1VGEL 4OKVA 3VI4E 2X4RB 3MV01 2IFGA 3WL9A 2JJSC 4R4NC 5FA4B 2IAND 4LCIH 3TJEH 4RFOH 2XA3A 3QPXL 4IOFD 4YQXL 3EOTH 3KPLA 2F5AL 4IRZH 3GMRA 1I7ZB 4PJFF 1KIQA 4WW1A 4F3FA 4FTVB 1UM6H 4PR5B 4AEIL 2DM3A 1XF4A 1BBJB 2GJ6E 4JLRA 4O2FB 4XB8A 5C0AA 4Y89A 5EIIA 1GHFH 4JHZA 4K2UH 2Z4QA 4JVUA 5B3JE 1FPTL 3LQAC 3RTQB 4KMQA 1U95A 1DUYA 4BKLA 4L8SA 1HXMA 4PRNB 1ADQL 4KUZL 4XHQA 1PKQB 3EOAA 2OQJA 3D0LB 4NQCE 4Y19B 5B3JF 2CXKA 3QUXA 1DLHB 2YUWA 3SEPA 3CXHK 1I1YB 5A43C 3X3FH 1HDMA 3LQAH 4APQC 5DQDH 4X6DF 1MI5D 1A14H 3KR3L 3ORJA 5EU7C 4R0LC 5SV3A 1Z0NA 2XQYK 3HE7D 1I4FA 4S0TD 5D8JL 3FQNA 3QG6A 4NSKB 4Y5XA 2AP2A 3HG1E 3HZVB 2BSSB 5GGTH 2MCG1 4JY6B 3UO1H 5GZND 3RWJB 4YGVA 1K5NB 5HVWA 4OB5L 3KDMB 3SJVA 3SGEI 1J1OL 5DRZA 5T3XD 2HYMA 2CUMA 4GQPH 1NL0L 5INCA 3A67L 5L8LB 1J8HE 2V2TB 2Z31B 3I6LE 4JFQA 3FONA 4L9LB 3QEQA 3ZTJH 3O6FC 5KOMC 3JV4B 3SE9L 2R2EA 4O2EA 3HAEH 4PJ9C 3MUY1 1CFQA 2FX9L 1LO0L 4BSJA 1HIMH 2CXGA 5DRXB 4ZDHA 3T65A 4Z77A 2BVYA 1KCSH 1HHGB 2H1PH 4GQ9H 1OAKL 1S9YB 2X4QB 3T1FB 3QFJD 2Q7YB 3MRPA 3T3ME 3TNNA 5L6YL 1U36A 5GRJH 1QFWM 4QT5A 4WHDA 1NC2B 5DD0H 3SE8L 1D5MB 2DBLH 3T4AB 1IQWL 3GSNH 1UXWA 3HMXH 4ZAKA 3T3MF 2AXGB 2K7PA 3QCVH 1OAYH 2J8UA 2VL5A 5GJTH 4IMKA 2FBJH 1DQLH 1IGCL 1NUGA 1AI1L 3R1GH 1T22A 2HFFA 1GXEA 3NH7H 3PGDB 1B2WL 2R2HA 3PABA 4JAMA 1K3ZA 1I75A 2X70A 5FYLD 1F00I 3VXQA 1JHKH 3D48R 1IMHC 1Q94B 1IKNC 4YE4L 4TSCL 4WCYH 4CUCA 5BOZG 1N64L 4JEGB 3HE6A 3MV7D 4OFVA 1JN6A 1NAML 3LN5A 3QNZB 2YPLE 1WT5A 1D3CA 1E4WL 2IAMB 4HFUH 3BDXA 4RGOL 2EXYD 4MA7L 1MHHB 4JM2A 4P2OC 2HFEB 1N5AB 2VAAA 4JFXB 3IXTB 4XBEH 4HWEL 4R7DA 3ROLB 3IETA 3MRDB 1SM3H 3OSKA 4PGBA 5SWZE 3UP1A 1G1CA 5FB8A 5KS9E 4HBCL 3LPWA 3QJFA 3STZA 1SY6L 4FXGA 4ZSOE 5HGAB 2PTTB 4PGZA 3NFNA 3P9LB 4QHMB 4BK4A 2AXJA 1CFNB 4OM1L 1QKZH 4HIHB 3FTGB 2IBZY 4XVUC 3VRIA 1TLKA 3FFCA 3VFUA 2VDNL 1FYTD 3UTSA 2GFBA 3A6BL 4TRPL 3RHWF 5D6DC 3B5GA 3MLZH 2IC2A 1I1AA 1WITA 1KNOB 2VLKA 4IDJH 1S7RA 1DEEB 3O2WH 4WUUD 3P9MA 3WKML 5D2NA 4HXBH 1NFDF 4NNXB 3EYOA 2NZ9D 3E6HB 5K9QI 3RWFA 4L8BA 2BERA 5D7IE 1ZS8A 3QWOA 5D2LA 2FIKB 1B0GA 3N1QC 1ZHBA 3STBA 4UT7L 2PO6C 3QUYA 1ZVHA 5D7IF 1KUMA 1YDPB 2IMNA 5E08L 4DTGH 5F3HB 4XVTL 1MIEH 5JUEL 1RI8A 1AD9B 3MMEA 1CGSH 1ZTXL 1QRNB 2GSIA 2DTSA 4OZIA 3ILQD 2R69H 3RDTC 3ARBC 3HNVH 5HPMA 4FQXB 1NBVL 3D39A 1SEBB 2CIKA 2F5BH 1K8IB 5KVEL 1ZGLM 4U1MB 3QIBD 1NMBH 1KJ2H 1RK0A 4NQVA 3OJVC 2OLDA 3JWNC 4N0YH 1MCQA 2A0LC 2DQHH 1FLRL 3OF6D 2G9HB 3D3VB 2WV3A 3OKDB 4R97B 1U6AH 2CQVA 2QLVB 4I0PD 1ZHKA 2HLFC 1DQDH 4QOKA 4TQEH 5EU6B 1OAZH 3AAZB 1TVDA 4PGDB 1LNUA 1EJOL 4IRSB 5EOQL 5TQ0L 3OTTA 4OLXL 4Z5RB 2H32A 5IHUH 2MTPA 4XCEB 4WHTA 4MJ2A 4LLUA 1VCAA 3CVHL 2DICA 3QDMB 2BHUA 3C09B 5EU3B 3MRIB 5DMYA 3FCTA 2E7LA 4H1LA 1A9BB 1RJYB 3MGTA 5F89B 4ZTOL 4RNRB 4OGYH 3UBXA 4HKZA 3MRJA 4OQTA 2DI8A 4FXKA 5L8JB 3MRNA 4RAHA 5I75B 4QRPD 5DQJB 4WO4C 3DGCR 4F15C 2W9EH 1KYOK 3VXMB 4X6BA 5FYKL 2GJJA 3LPGA 1H8OA 1MRDL 2XG5A 4LLWA 1T20A 3VXRE 4XMKH 4WHYG 1H3GA 4M43L 4K7PX 1MEXL 5A40E 1P4BL 3WDHA 3N50A 4A6YB 1B4RA 4J7RA 2VQ1A 2VXSL 3WFEH 3ARFA 3RP1A 3MRRA 1UFUA 3QH3B 5J3HD 3Q6GL 1LE5B 1QR1B 5JORA 5E9DA 4V1DA 1HHHA 3HZKA 2NTFB 3UYRH 2GSGB 4J4PC 3X17A 5BV7L 5L2KB 5CS7A 4F7PB 5I1LB 5GS0D 1IAOA 2EXWC 3BRDA 2KKQA 3IDMA 4I18B 1AXTL 2AEQL 3NTCL 4Q9QL 5D7LE 4WFHE 4Y4KD 3KHQA 2H45A 1CGVA 4AT6A 2RR3A 1WJ3A 2D7MA 3EW3B 3HC4H 5IMMA 1H3PH 4G6AC 3LKRB 4U6XB 4QHNB 1A5FL 1LDPL 4GW1A 3VRLE 3MREA 3OKNB 2NW2A 2BZDA 3ULVD 4P9HL 4NNYA 4D0CA 1CFTB 3B4NA 2EYRB 1BOGA 1YPZA 2EDKA 3VRLF 3TCLB 3DX6B 3P4MB 3N1MC 1CGUA 4HIXL 1X5HA 4L3EE 4AM0B 1I8KA 2IANB 3D87B 3P4NB 4HKJA 4ZUUB 4YWGL 4JO1H 3HLAB 4PREB 1E28A 4RA0C 4Z8FL 4LAQL 4LSUL 5HYFA 4KKLC 3BP4A 3RIAK 3NACL 1OM3H 2DYPA 4CRPA 2M26A 3HC3L 4FFZL 1Q0XH 3Q6FA 3GGWB 5FYJU 5HGDA 5LCVH 4N1EA 4R7NA 3H2WA 1JFQH 4HWNA 1E4XH 5EZIH 3LS5H 4ZQKA 4FG6C 2YK1H 5FGSA 3LKPB 1RZ8B 1M7DB 1BZ7A 2OI9B 2O5YH 3KPMB 3MGAA 2EDYA 3L5XL 3X11A 1YEIL 3O4LD 4F8TA 2XN9B 3MOQA 1KFAL 2W1NA 1U8QA 1KEML 3LHPH 4JFDE 4NFDA 1C08B 1P6AB 3MA7B 5D1QA 1A7PH 4GKSB 3MRLA 1MI5B 3H7BB 4ESKA 1QSED 4ZUSA 4E41D 2BP3A 1I3GH 4IJ3B 2FJHB 1A7BA 3D69B 3V7AG 1BIIB 4NQTA 4FQLH 4TULL 4HH8A 2D7QA 2EIBA 4KKNA 5D96B 2J88L 5JLZB 4HKXB 3MNWB 1KN4L 2CDGA 5JNYA 1U2HA 4MQXC 1F4AA 5GGSB 4OJFH 4CW1A 2BNUA 2ITCA 2DIBA 4NHCL 4YX2L 5IVNA 2BVTA 3OHXA 2HLAA 2FHBA 5CP3H 2QSCL 1Q9OB 5KJRL 4EI5D 3DO7A 4XNXH 1JL8A 5I18H 1YYLL 4HKBB 5EBMB 2PR4L 2JCCA 3EZ8A 4GG6B 1YC7A 1CIDA 4LCWB 4GRLB 2R39A 1FZMA 1KCVH 3ZSTA 4BQBA 4HJGB 4NZDA 4AIOA 1JPTL 1WWBX 1NUDA 5TE6L 2P5EE 4Q0XL 1CFSA 3OR7A 4K3DL 1Z0MA 1EA9C 5JHDA 4DOHB 4ZFFA 4QY8A 4RWHA 2Q8BH 5FDWA 2EEDA 1PGRB 1ZLWH 3DX8A 5INDA 4NKDB 2KH2B 4OUUA 3IVKB 1FRGH 1FGNL 4P49A 5CJ8A 4LEOB 2VISA 2BMKB 2J6EA 4N8CH 3VWJC 1T4KA 2NY3C 4U1IA 1DANU 3B83A 5DJAB 1VERA 5JW4R 3FO0H 4MD0A 2Q76A 2GKIA 2O5XH 4QWWC 3OB8A 3Q0HA 4JDTH 2X4RA 4WTWA 2Y23A 4Q9RL 1TJGL 2DQGH 3IDGB 2WUCL 3U0WH 1A1OB 4YLQT 3C8DA 3W0WA 3S4SB 1TIUA 2Q8AH 1I8LC 4RMUA 2FZ3B 3SDCA 3B2UD 4FTVA 3B9EA 1DVFC 4J3XA 4PR5A 5JPMB 3T0EB 1BBJA 4MNHB 2EO9A 2UZXB 1YQVL 3UTTB 1QBML 4BSVB 2E7HA 4EDXA 4HV8B 5IMOB 4JKPL 3WJLC 1CDIA 5F3BA 2WZPD 1S9VA 5JIHA 5CZVL 3BPOB 5FK9B 3QG7H 5E6IC 4PRNA 5TJWK 4S1SH 1PKQA 1RZJL 3CLEH 3H9SB 3D0LA 4TNWF 2OM5A 4ZNEE 1DLHA 4AENB 2IGFL 2ED9A 1I1YA 1FIEA 4XB7A 1ZK9A 3IDJB 3QQ9C 2FATH 3SOBL 3WUZA 5IFAL 3VXUA 1A2YB 4R26L 5EWIH 1KBGH 4NC1C 5IK3B 3EOYG 1IC1A 4NSKA 2EEAA 3CXHJ 1OAUH 2NLJA 1MRCL 4OKDA 4OBRA 3RWJA 3SY0B 4NRXB 4FQCH 3VCLB 1KCRL 2B1AL 4PJAA 5ID0A 3VFRB 3MXWL 4U3HA 3FQTB 3CXDH 4PP1C 5DT1H 4JFZH 1MFBH 2COQA 4C4KO 5T1DL 2Z31A 2W59A 4X5LA 5AAMA 1EZVY 1RJZB 1OT2A 4P23C 3RL2B 5F88B 3JV4A 4ODTH 1KB9K 2A73B 5FOJA 3E3QE 5DEZA 4F2MB 3FQRB 4DK6A 5KVDH 1UJ3C 5FOBB 1JVKA 2WWMD 2IQ9H 3ZKXB 3H9ZA 5C0AE 1ZE3C 5IROA 2X4QA 3T1FA 2Q7YA 2YS4A 2P44B 4OLWL 5C2UB 1CL7L 1KCLA 2HFGL 3AFLA 2EZ0C 4YFLI 3EAKA 1D5MA 4OD2B 5AYQA 4I0PB 1INEL 1YEHL 4NN7B 4X7DC 1NLBL 2BOBB 2AXGA 1A3QA 1E6JL 2D7NA 3HI6H 5DDHA 1UWGL 1AHWB 1MCBA 2FB4H 1VFBB 3HZYB 1VPOL 4LPXA 1D5IL 4FZ8H 2DLHA 5IOPB 2DN7A 4Z0XB 1FG2A 3PGDA 3OKYA 5JR1H 2EDWA 4H88L 3V6ZA 2OX5A 5TPWL 5D4QA 4PRDB 1A7RL 3TESA 4DN4L 1Q94A 4ALAH 3VFWA 2V9RA 3WO4B 1JI1A 4GAGL 4YHOH 3SGDI 4MJIB 4Z6AT 1UH4A 2B4CC 1EHNA 1I7TB 4U0RC 2C1OA 2YHGA 1CE1H 3SJVE 2R8SL 3QNZA 4NJAH 3ME0A 3EOBB 5SWSD 4Y1AE 2IAMA 4K94C 5BJTA 4PJ5D 2BJML 1MHHA 4MJ5A 1EV2E 1N5AA 4KI1A 4JG0L 4JFXA 2B4CH 3C2AL 1BJ1H 3C6LD 3ROLA 2DQIH 3WJJA 3MRDA 4FQQA 1S7SB 3IDNB 4K94H 7FABH 4YHPB 1FL6A 4LSTL 3P9LA 1T5WA 5FHBH 1NC4D 2GK2A 3I9GH 3VFSA 5B4MC 4HIHA 3OL2A 3FTGA 4XX1G 3LQMA 4LIQL 1MJ7L 2D7TH 1HZHL 2VWEE 2I5YH 3CC5B 2P45B 4FABH 1YMME 2BVOB 4NO3B 4PP2B 3RGVA 4JR9L 4PJBA 1S5IL 3H3BC 4GRWB 2J8UE 4OBSA 2AK4A 1KNOA 2X09A 5H37H 5T5FH 1DEEA 3GKZA 5GRZA 1QLRA 3VG0H 3E6HA 3KPSA 4M1GH 4OIIL 4G3YH 4TYUA 4NNPL 5I71C 1Z5LB 1E6OH 4GSDH 4HUMB 1LQSR 3L3GB 4NC0B 3VXPB 2VDOL 1YDPA 3MR9B 2QV2A 4JO2L 3DVFA 3VDCA 5HY9A 2R15A 2XFXA 3SCMC 5ICYB 1AD9A 2G60H 2ZUUA 2OCFD 3VXSB 1K8IA 2HT3C 5I9QC 4JM4L 4U1MA 4F58L 3L5JA 1BMGA 5DTFA 2WIIB 4HK0B 1IM9D 1NJ9B 3A6CH 2ZOKB 4C83B 3OKDA 3D3VA 2OL3H 1DQTA 3WLWC 1OARH 3O9WD 2DKUA 3MROB 1EHXA 2C3VB 4P48A 25C8H 2BVEA 4HX1A 3AAZA 4JDVA 4LHUD 1BQHB 3FB8A 2VDML 4QCIA 4Z5RA 5HXMA 3FFCE 3UBXI 3UTSE 4XCEA 2VXUH 5IWLC 2W60B 3JTTB 4R90L 1F11B 4UINL 3SE4A 3QDMA 4O5LH 5JW3L 3MRIA 5IVOA 4F33B 3P2TA 3GSXB 3MV9B 5F89A 2RBLA 2VLKE 3T0BA 1HSBA 4WFGE 3DXAE 4U7SA 3BZDA 1MCSA 3NZHH 3QP3A 1P7QD 1P4LA 5D2LE 1QSEB 5DQJA 3DETD 3O0RL 4GBXA 2ORBL 4KWUA 3TVMC 3QHZH 1MCRA 4P2QE 4JCLA 5KANI 1RUPL 3BD4A 3LMJH 4IMLA 4TSAL 5C2BL 4A6YA 3TPUB 4KJWD 5DJDB 1KYOJ 3BPNB 1TCMA 3C6SB 1WIUA 1MCEA 1DQJB 1EX0A 4M6NL 1T2QL 2BNQD 1YNTA 3QH3A 4LCCC 3BKCL 1QR1A 1LE5A 3MLTB 5C08D 2HT2D 1QLFB 4G5ZH 3VXOB 2VDQH 1U8MB 4Y5YC 2GSGA 1N2RA 3IFNH 1J9CT 2JB6B 3WXVH 2HWZL 1PG7X 1TTFA 3VFVB 1FNEB 4FRWA 4GAJL 5L2KA 5GSVA 3G5YB 1BQLH 5DJCB 4XBGB 3BD3A 3MLWL 4J3TA 4YDKL 4I18A 1FIGH 4JN1H 5D1ZC 3LB6C 5E2TL 4Y2DD 3BGMB 4MJ6B 4GOSA 4PJHB 5ADOH 3BJ91 5GRVK 3UEZA 1H3VA 4OFIA 2D0FA 2G5BA 3VD7A 1DDHB 2D31B 3RNQB 4C54A 4P3CH 4U6XA 1U8LA 1M71B 5TQ2H 2VE6A 4OD3L 4R4ND 1F6LL 1KN2L 3MACH 4OIAA 5GGUB 3OKNA 5AYUH 3KLHC 2B0SL 1VGEH 4JGJA 4LDEB 1JI2A 2NY1C 1CDJA 4KUCD 3BPLB 5CMAB 3EO1B 2EYRA 2FGZA 1CXKA 3NZ8A 3TCLA 3P4MA 1FV1B 3QPXH 4YQXH 1IAKB 1MIMH 2XOTA 4AM0A 1CE6A 5B39A 2IANA 5CJXC 4ZUUA 5J6HA 3HLAA 4AEIH 4KTDL 4RFNB 1DQML 4Q9BA 2AJZB 1JF1B 4GJTB 1ZA3A 3GGWA 3OPZL 4V1DE 1Y0LB 1FPTH 3CCHB 4HS8L 2PXYD 4NFCA 3F5WB 3LKSA 4PRHD 5DJYB 2P5WE 1ADQH 4KUZH 1XCQA 1JCKA 1LGVA 4APQD 2B7DT 5E70A 1JWMA 1ACYL 3LKPA 1H5BB 4P4KD 2Z8WC 4XRCB 1RZ8A 2CK0L 4JPKL 4YHNB 1Y6MR 3KPMA 1DBBL 4ZOCA 5C92A 3P77A 3TZVB 1EO5A 1DP0A 2XN9A 3WIFB 3KR3H 4LPWA 5D8JH 3MA7A 1MI5A 3IDYB 3CUPA 2IMMA 3VGAC 3SGJC 4BSWB 3HE7A 3O3BB 1BIIA 2LABA 4R4FL 4YBHA 5EA0L 4HKXA 3QXVA 1NL0H 4WTZA 4EOWL 3BGFB 3U6RB 3A67H 1XGPB 5GGSA 5GPRA 4I8DA 2B2XL 2R29L 1J0JA 1CBVL 5I1AB 2VZSA 3FO9B 3SE9H 1S7XB 4JFPB 3HPJB 5DHXB 2FX9H 1LO0H 5JW5B 5EBMA 3LKOB 2NXZC 3CDFA 4GG6A 4LEXL 1UWEL 1OAKH 4LCWA 5KVFL 1NCTA 5L6YH 3RI5F 2I9LA 4C57C 2GY7B 4RGMB 4GMSL 5ERWB 1P2CB 3SE8H 4BQ9A 3E3QC 1IQWH 1DQQB 1T83A 4LLQA 4K9EC 5IHLB 3GEWB 2XI9A 1AI1H 5KSBB 4IRJC 3OAYH 4O58L 1EO8L 1JRHL 4HAGA 3SO3C 3IVKA 4L5FL 1YEJL 1B2WH 2D7OA 3CGTA 3U30B 4P2RD 1A4KB 4QRUB 4K9EH 4YR6A 1U93B 2BMKA 2VYRE 4ZFGL 1B0RB 3VI3E 4O02H 4YE4H 4TSCH 4NKOB 5DJAA 1N64H 3L3OB 2C3XA 3MC0A 3PIQB 1T1XB 1NAMH 4EUPG 1PLGL 5LGJB 1E4WH 3VI3F 5HYJE 4RGOH 4LLMB 4ZFOA 2DM4A 4MA7H 4LFHD 5JO5B 1AR1D 3MV7A 3VH8B 1P84K 1M1SA 1G0DA 3GJFB 3RWCB 4Y5XC 3S4SA 4HWEH 4PJ5B 2ZUYA 1WV7T 1P4IH 1U42A 4DVRL 2FZ3A 4ELMB 1IVLA 1TVBA 2H2PD 4HBCH 4KRPC 2CUIA 5GGQL 4XVUD 1SY6H 4MNHA 2NY2C 1J0ZA 3UXFA 2P4AB 4XCFL 2JCCE 4OM1H 4LSVL 3AU1B 2W38A 3JWDL 2H26B 1CG9A 4OZFG 4U6VL 1WBZB 1EXUB 3OKKA 2I9TB 1NC4B 2X4PA 2VDNH 3KXFD 4N1CA 1BD2B 1QP1A 3A6BH 3AM8A 2AS5M 3O8XB 3GJFK 3H9SA 3OX8B 3EUUA 2A38A 4TRPH 1ORQA 4PJDB 3TA3D 4NT6B 4AENA 1N0LA 1FC2D 1FYTA 4OV5B 1CDHA 4PYGA 3EYFA 4GUPA 4MQTB 2J5LB 4ONGL 2VLJB 5T3XL 3WKMH 1OF2B 3ZDXE 2PO6D 3KPRD 2VWEC 1KENL 2M8XA 4KU1A 2APVA 2EDHA 1ZHNB 4OFKA 3KYMA 2HTLC 3ZDXF 4UT7H 3SE3A 2WWKT 4N0RA 3NN8B 1I8MB 1OP3K 4NRXA 3VCLA 5E08H 4LPYA 5D7JB 2LVCA 1FZJB 4XVTH 3I2CL 2GAZA 3FQTA 5JUEH 1KXVC 5EPMB 1A9EA 5I17B 2HKHL 4OCMC 4OZGB 1ZTXH 5GGVH 3IJHA 2PCPB 3MQIA 4PLOB 1OGAE 1OAXL 2HVKA 3RZCD 1G7LB 1NBVH 2A0LD 2Y4SA 3RL2A 3PJSB 3VXTB 5KVEH 2A73A 1U58A 5C6PB 3W0WE 3FQRA 5KSAB 4F9LC 5E8EB 1I7RA 5FOBA 3DTXB 3HRZA 2VR5A 5CGYD 1J8KA 2A74A 3OAZK 4OCLC 4MQ7B 4HUXB 3HE6C 5ICXB 1CN4A 4YAQB 4PYHA 1ZAGA 1QRKA 3WEXB 1IM9B 1KB9J 4NQUA 5JOPD 3UPRB 2LV4A 3OF6A 1EJOH 2Z91B 5TQ0H 4JFYB 2ICCA 1A6TA 4CADB 4I0PA 1N3NB 4ZXBD 4J3OC 4LHUB 1AHWA 3CVHH 1VFBA 3EYUL 3HZYA 4IIQB 1CI5A 5CCKL 4FFWD 5TDOA 5TE7L 1C12B 4ZTOH 3SGDH 5IOPA 2ZUQC 3CFBB 3RVTD 4WO4D 4GS7B 4HUKB 5AZEL 3MRMA 5ANMB 2A6IB 3LIZL 1BEYL 4PRDA 3VXUE 4XMLL 3RY6C 4OZHF 2DQUL 5BVJB 5C0IB 1R3KA 5FYKH 1FFPA 3WD5L 1PY9A 1I7TA 1KPUB 5DJ2B 1AP2B 1MRDH 1CTOA 5AAWA 4PJAE 5DGQA 1RVFL 4M43H 4HWUA 1AQDB 1P4BH 3I6KA 2MKWA 4XC3H 3QNYB 2R0ZL 3T0VA 4LHJB 2VXSH 3RL1B 1LEKB 5BV7C 1MNUL 2YXFA 3PWLB 5GJSL 4NQDD 5JDSB 1X5FA 3QUYC 5EOCL 2VAJA 2CK2A 2LFGA 3Q6GH 5D70L 3IDNA 4LLYA 4DVBA 4YHPA 2BNQB 2EXWD 1EPFA 4TVPL 5BV7H 5E5MA 1UWXK 4N0UE 5C08B 2WANA 2VZVA 4MXWL 1ERNA 3V7MA 3B8YA 2CJUH 1BVKB 5J89A 3LKNA 2BVOA 4PP2A 4NM4L 3PV7A 1MOEA 2DLIA 1AXTH 2AEQH 3NTCH 4L3AA 4DEPB 5HDLA 3M8OL 4Q9QH 2C4FT 3HNTL 4X4ME 3NPSB 4M8VA 1U91A 4G6AD 4NBYB 3DV6B 3IDIB 5HHPB 4RWYL 4P9HC 3AREC 4H20L 4WTXA 3FT2B 1OW0C 2V2WB 4G9FD 4Y4FB 3T2NL 3O6LH 3T8XB 1E0OB 3G6DL 4Y2DB 4C55A 3BKML 4Y4KA 3BIKB 4LVHC 3SDAB 1AFVL 2DIAA 1UM5L 1A5FH 1LDPH 3VXPA 2XRAL 4P9HH 4BFIA 4HWZA 3MR9A 3BIAX 1MAKA 4G8EA 3UAJD 4YFEA 3T1WA 3RRQA 4U31A 5ISZD 1TPXC 1D6VL 4HIXH 2VJXA 4BA8A 4KKLD 2VSCA 2FEEL 4HS6B 3NFSL 3L7FB 5EC2A 4YWGH 3VXSA 1HILB 4OCXL 3BH9A 2E9IA 3PWNA 5KSUB 1MCWW 4Z8FH 4LSUH 1U8OB 2N1KA 3HI5L 4PRIE 3S35L 1NJ9A 1S9KC 3BYTA 3NACH 1MJ8H 3HC3H 3OKMB 3U9UB 3V7AE 4FG6D 4FFZH 1CDCA 2GJ6D 5IVXB 3GSOB 4G43B 5IGXL 2DWEB 4HAFA 1UEYA 4QGYA 1XR9A 1SYVB 3FN9A 2X4NB 4P57A 4QNPE 3ARFC 5KW9L 3BP7A 4LPTA 2NW3B 2W92A 4APQB 2GJZB 2W60A 3JTTA 4Y5VC 5GZOD 1F11A 2E9BA 3L5XH 3OKOA 1YEIH 5CFHA 4CN6A 4R0LB 3MO1B 4PJBE 1KEMH 4X6CB 1Q9WB 3GSXA 3H9YA 3AS2A 2AK4E 2VDRL 4KRNA 3O4LA 1T0MA 1ZEAL 1SMOA 2FLRT 3WHE0 4PJBF 4MQXD 3QIUC 2OZ4L 3KPSE 5DVMA 3EJYC 1QSEA 5F7FA 4NCC1 2WW8A 3HAEB 3HG1D 4TULH 5EZOL 2FD6L 4NQXB 2J88H 1KN4H 4RZCA 3SHSA 2YXMA 4ZO8A 3DI3B 3GSWB 5H2BB 2D9QB 2ZKHL 1EH9A 2VRAA 4DKAA 3O6FB 4NHCH 4ZD3L 4YX2H 1NEZA 2FX7H 5EOTB 3TPUA 2QSCH 2VXQL 4PJ9B 5KJRH 3FJTA 2VLRD 3QXAA 5JIPA 2AV7B 1DQJA 3ARPA 5DEGB 3GSNB 3PXJA 1YYLH 1L4IA 3MSPA 3L9RA 2PR4H 2ARWA 4EI5A 2MNUA 5FF6A 1DSFL 1K2DB 1PEZA 4QHLA 1QLFA 1P6FA 1DZBA 1U8MA 1JPTH 5TE6H 4Q0XH 2JB6A 4K3DH 3V5HB 1Z3GH 1FNEA 2VUYA 4ODHL 4BZ1L 3E2HC 1HH6A 3G5YA 5MEND 1NDGB 1V7NH 1YN6A 4XBGA 4PV8B 3MLYL 1A7NL 5ABDE 2IG2H 5MI0B 1CXIA 2UWEB 1F90H 2E7MA 3KPQB 1MELA 1XZ0B 3BGMA 1FGNH 4F7EB 2NY3D 4PJHA 3EHBC 5I1GL 3J8F7 3BH8A 1BLNB 1WBYB 1FNGB 5E00A 4W6XB 2D31A 2G75B 3LD8C 4QWWD 1M71A 2FH8A 4OFYD 4PGEB 3QDGB 5E0QA 4X99B 4O4YL 1PZUB 2HRPL 1CICC 5C0FA 1VSCA 2X05A 1NGZB 5CMAA 4P4RA 5C09B 5DYOB 3WN5C 3EO1A 3RKDD 2IF7A 1FVCB 1TJGH 4P2OB 3DVNA 2QEJA 4X8JA 5FKPB 2WUCH 4DGIH 4QRQB 2A6JB 3CPLB 4N8VB 1IAKA 3BWUC 2AQ2A 1NBZB 1V05A 3TJHC 3IAPA 1YQVH 1RZJC 1VACB 5FGBC 1QZ1A 1CZ8L 2A1WL 4JKPH 5CP7B 4MCZB 4P5MB 4W6WB 2DIJA 4O2CA 5CZVH 2I26N 1UYWL 4JKLA 1Y0LA 5LXGH 3BUYB 3N1PC 2CKBL 3V6OA 4RQQA 3HR6A 1RZJH 5E5RB 5C0JB 4MDIB 4HIJB 2GT9A 1H5BA 4XRCA 4YHNA 4XCYA 2IGFH 2FIRT 4W4OA 4R3SB 5TF1L 3CD4A 2GEEA 1CIUA 3WIFA 3MBEC 3SOBH 4M5YL 5IFAH 2X4UB 3FQUB 2V17L 4R26H 5FGCB 2QKIB 2R4RL 2PO6B 1I1RA 3KPRB 2VZUA 3HTLX 3TCXA 5HI4C 2QSQA 3QZWA 4BSWA 3QUKA 2YPVL 2B1AH 3O3BA 3MXWH 2D4FA 1UXSA 4FQJL 4P23D 5C1MB 4PJ7E 1IM3B 2UVEA 4M4RA 3U6RA 2EYSB 3RDTB 3ARBB 2ENSA 3MJ8B 2X6MA 4PPTA 1GSMA 4JJ5A 3GMQA 4PJ7F 5I1AA 1HHKB 3I3DA 5HVHC 1HI6B 1S7XA 3WFBL 3WNMA 1N59A 5BZDB 1I85C 4HUUA 1XGTB 4PRPB 5IT2L 4A2MA 5A3ID 3GI9L 3TBWA 3G6JF 3LKOA 3D18B 1MLBA 1IAMA 4OLWH 5LGHL 1WCBB 4X7SL 5IB5A 1P2CA 4JZJC 1QSFD 4UIMB 1AKJD 1OGTA 1DUZB 1INEH 1YEHH 4YXLL 1XFPA 1GYAA 1XGUB 5BO1L 1UWGH 1VHPA 3K7UA 4OLZL 1VPOH 1D5IH 1HCFX 4DGVL 1IGJB 1T03L 5F7WC 1SVCP 4LGRB 3PP3H 4K7FB 1MCPL 4YUEL 4H88H 1A4KA 3DSFL 5TPWH 3ETBF 1U93A 4DN4H 1NLDH 2EDQA 3K2UL 2NR6C 1JNNH 4WO4B 5ILTH 4XX1E 1B0RA 2JJVA 3QFDB 4RAUB 1QHPA 4V2BA 4GAGH 2Q87A 3FFDB 3P73B 2OTUA 4Q6IA 4WHYH 1PZ5B 5HDOA 2R8SH 3PIQA 2LQRA 2AEIT 1G6RL 3MRBB 1P5VA 5E99L 1F4HA 3KHOA 2BJMH 4EN3C 4QHUA 4UB0L 5JO5A 4HJ0C 4PGCB 5LVEA 3QYCA 3GJFA 1R3IL 5SWSA 4JG0H 5T3XE 3C2AH 5DS8B 4PJ5A 1OT1A 4UTBL 5CEYA 4ELMA 5B4MD 1G9EA 5SX4I 1JZ4A 4RCAA 2AGJL 1E27A 4B53A 5T33L 2W0FB 4LSTH 4NQDB 3D85D 1IC5L 5EUKA 1RUML 4PJ8C 4JZNB 4NKMA 1MJ7H 1T04B 1HZHH 1EXUA 2WBJC 3T0DA 1FO0L 1NC4A 2I9TA 3IF1B 2HN7B 3DROB 1BD2A 3PWPB 2L7JA 3QFJE 4PJDA 2YRPA 5MEOB 4JR9H 1S5IH 4NT6A 4U1LA 3BEVB 3NFPB 5HVGB 3WBDA 2FLBT 4KRMB 2WM0A 1T0NB 1S7WB 4KKBC 3OJDA 1H15A 2Z0BA 4XI5C 4BK5A 1NKRA 4LNRA 4KK5C 4LVOC 5FUCE 4OIIH 4WFHD 2QQLL 3QHTC 1D5XA 1ZHNA 5E1AB 4XMPL 4C58B 2DD8L 4NNPH 5F1IA 1LILA 1J87A 3SCMD 3T0WA 3NN8A 2X4SB 2R1XB 2VDOH 4YIQA 2YUZA 3WXWL 1FZJA 4JO2H 4HUVA 1VADB 15C8L 5EPMA 1HYSD 2A2QT 4P3DB 3TT1L 4I3SL 1NMCB 4OZGA 5C07D 3KVQA 2PCPA 3MNVB 1NFIB 1HXYB 1MFDL 1U8PB 2LAAA 4WU7A 3IYLW 4KK9C 5GXBB 3MV7E 4ODVL 3WLWD 4JM4H 4KJPC 3FB5B 4NN5B 4F58H 5KSAA 1HQRB 1V3MA 3OZ9H 3MLRH 4HUWB 5F1OB 3DTXA 5EU5A 4OI8A 3BI9X 3CH1B 4MQ7A 4HUXA 5ICXA 1KTDB 1F8TL 2Y5EA 4YAQA 4TNVF 4UUJB 4BH7B 5DK0B 4KZEL 1IM9A 3C5ZD 3UPRA 2APBA 3GRWL 1EGJL 1Q0YL 3KYAA 2GJ6B 3O9WA 1QNZL 3RUGF 2Z91A 3BW9A 3D9AL 2VDMH 4CADA 1GH7A 1N3NA 2BRQA 3DYOA 4OM0L 4GO6B 4LHUA 4R90H 4MLIA 4UINH 2WAHA 5JW3H 3JV6B 4QRRD 5IMLB 1FYTE 3F7YB 3Q5OA 3RX8A 3K74B 4HEPG 4XPHL 3CFBA 3PDOB 4NQCB 5ACLA 1RURL 4HXAL 1D5BA 5E7FA 2A6IA 4JFDD 1JZ8A 3GFUA 1HSAB 2FJFB 3K8MA 3WIHL 4TVPE 3LQZB 1WIPA 4WUUE 3RGVC 3QRGL 1RZKL 2E27L 3X12B 1K9TA 3BKYL 3O2DL 3SKOB 5GHWL 5KVMC 4WENB 5T3ZD 1KPUA 5DJ2A 4NN6C 2AI0L 3HG1B 1FZKA 1RUPH 2GTWA 3ZE2E 1AQDA 5C2BH 4M8QB 4B7LA 1OVZA 4XP5L 4M6NH 1EFXD 3ZE2F 1JF5A 1T2QH 5JDSA 3BKCH 2F54D 3TYFB 1NCDL 1Q9LA 1OQXA 1J8HB 3O11B 3HS0B 4R2GC 2BNQA 1S9XB 3ET9F 1JYVA 2YSSB 3RVXC 4X7TA 5C08A 4GXVL 5CUSL 4TSBL 1F45A 4GAJH 5GGRB 3WS3B 3DPBA 5DJZB 1L9MA 3T2QA 4G7YL 4YPJA 1BVKA 1BZ9A 2HAZA 2EIZB 3MLWH 4JFHE 4YDKH 3NIFE 3FL7A 1UZ6E 5E2TH 2FBOJ 4F7TB 1D6EA 4M6OL 1CLZL 3NGBB 1A0QH 1S7VA 5DC0A 5EORL 4LDLB 3C9NB 5HHPA 1ZT4B 1ZLWK 1VEOA 2J3SA 3KLHD 4YDJB 4Y2DA 3VWJB 5KVGL 1K4DA 1UZ6F 3WIIL 3RIFK 2NY1D 2XWBB 1RIHH 1NCCL 2L0DA 3SDAA 4OD3H 4F9PC 1KN2H 1W8OA 1G9NL 4FQIL 5CEZD 2B0SH 4PJCF 1YMHB 3SE4C 2A9ML 5FYJD 2JJSA 4CDGC 3JVGC 5ESQA 1J05B 4QRPE 4QTHA 3FT4B 1OLLA 2AJXL 3BO8A 4PB0H 3MFGB 5IBLC 3MYJB 3PWUB 1LD9A 3FOMA 1DVFB 3LEXA 4W68A 1ZA6B 3U0PB 1A6ZB 1HKLL 4DW2L 1U8OA 5B38B 2YPLB 4HWBA 5A1AA 1DQMH 4GBXC 1R0AH 4ONFL 2YN3A 4JN2A 4DUVA 4RAVB 5E6IB 3OPZH 4DCQA 4RX4A 4HS8H 3U7AA 2DWEA 3CFEB 2WQRA 1EEQA 1ORSB 3N0PB 5SWZB 4B0MM 5I15L 5KS9B 3O3DA 1HWHB 4ZSOB 2X4NA 1BWMA 1ACYH 2CK0H 4JPKH 2XZQL 5FCSH 5GGTA 5AD0A 2NW3A 5DGRA 4APQA 4Y8DC 1DBBH 5CJQL 1BM3L 4AL8L 3SN6N 2IH1A 4P4KA 4R0LA 5F97E 4X6CA 1IAIL 4N9GB 1LEGA 4LPUA 3MGOB 2PNDA 3O45B 1BFOA 3RPIA 1FE8L 1CF8H 2H9GA 5K9OB 4LASL 1U3YA 1WFTA 4Z7WF 2YD9A 3GSVB 1X4YA 2EDRA 2E8ZA 3OBAA 4R4FH 5FKAA 5F44A 4G8IB 2FH6A 2XYCA 5D7IB 4EOWH 3QO0B 3NA4A 2J7LA 4J6RL 5H2BA 2PW1A 5DJXB 4EBQL 2IEPA 2B2XH 2R29H 3G04A 3O6FA 1CBVH 1UACL 4JHBA 4X7FC 2NXZD 1ZLUH 2J2ZA 1UJ3B 1MSPA 2AV7A 1FVDB 3NVQA 5F7NC 5DEGA 3GSNA 3NCFB 3HMXA 2R2BB 4XHJC 4I1NB 3L1OL 4K71C 3VD3A 4Z95L 3LEYL 1F5WA 4LEXH 1UWEH 3HUJA 2ID5A 1K2DA 3U9PL 1OB1B 5KVFH 4HZLB 3H9HB 3UROR 4L4TD 1F4WL 3V5HA 3EBAA 4NDMB 1OSZA 4Y88A 2SEBB 1OHQA 5E4EC 4IRJD 3DUUA 4OFDA 3CMOL 3P30L 3B9KD 4FFYL 1LO5B 1NDGA 4AQ1B 1AKJB 4IOFC 4O58H 1EO8H 1JRHH 4L5FH 3DHJA 1YEJH 3KPQA 4F7EA 3L6FB 4R96A 4ODXB 5C0DB 4EI6B 1BLNA 1WBYA 2JF1A 5B3NA 1IKNA 2QADB 3ZHKA 1KPVB 3O4LE 4KTEL 1CXEA 1LO2L 5IV2A 4P2RA 3GKWL 4PGEA 4QF1A 4U0RB 4X99A 5L7XL 3GDBA 3SDDC 3QQNA 4E41E 1CT8A 1PLGH 1NGZA 2YD8A 4HH9B 1J10A 2UZIH 5DYOA 2IALA 4M3KB 5FKPA 3PHOB 4KRPD 3C5SB 4ZODA 4M61B 5C0RL 2EDNA 3CPLA 1HOCA 2QR0B 4N8VA 2NY2D 1SJEB 4Y1AD 1OWRM 3MJ9L 2WWKO 3JWDC 4MZ3A 3W9DB 4DVRH 2JKXA 4J3UA 4HCRL 3HE7C 3VXRB 1NBZA 5C8JB 3WKNA 5GGQH 1WC7B 1VACA 4UV7L 3ALWA 1FSKC 5CP7A 43C9B 2V5MA 5ESAB 4XCFH 3K4AA 2DRUA 4LSVH 4LP4A 2UUDH 3HCVA 4Q2ZB 3JZ7A 4WI4A 4U6VH 2DLFH 2AAVA 3BUYA 2P8MB 2ITDB 1RU9L 4PG2C 5BW7C 2FR4B 5C0JA 3U82B 1WVZA 4LBEA 2NTSP 1M7IB 5D6DA 2OR7A 4HIJA 5C0GB 5LQBL 3KXFA 5IJVB 3RFZC 1YMMD 1EZVX 2HTLD 4ONGH 5T3XH 1JNJA 2XA8L 4CVXB 1IC4H 1KENH 1T6VN 3NCYP 5I71B 4PJHE 1EEYB 5E8NB 5F9OL 1WWWX 2C5DC 2PO6A 3KPRA 4OAWA 4GKZA 3KNBB 2VOTA 1T83C 5D7LB 2VUOA 3P9WB 2I25N 5C0NC 1EHLL 4PLKD 5J7CC 3I2CH 1KJ2A 2A6KB 1F6FB 3PGFL 3SCMB 5HGHA 5HYQA 2HKHH 5FM4A 5FUCC 2EYSA 3O41A 4QO1A 1EHAA 1R5IB 3RDTA 3ARBA 1I9EA 5I9QB 5IQ9B 4GFTB 2Q6WB 1J1PL 1WFUA 3TBTA 1W8NA 5BZDA 1R3HB 5GS2H 5IVZB 2HMIC 4UDUB 4PRPA 3B6SB 4NUJB 5HYSG 3L3DB 1N6QL 4L3EB 8CGTA 1LDSA 5C86A 3KPTA 1WCBA 4UV4L 4PLNC 1L7IL 4ORGB 3VMOA 3S5LB 2ADIA 1KACB 1DUZA 1XGUA 2EXYC 5ESVB 5FYKD 4K3HA 2HG5A 3CNKA 5IB4B 3EYUH 4LARH 3H7LA 3O6KL 5IQ7L 3GSUB 5CCKH 5JW4N 5TE7H 3BKJL 1U3HC 1H3XA 4K7FA 1NANH 3QUZC 2IQAB 4KGLA 3WSQL 3MX0A 3C8HA 5IHZB 3LIZH 4FOMA 5C3LD 1BEYH 4XMLH 1IJ9A 3IFLL 4PLJD 3AM8C 4WO4A 3REWB 2DQUH 3DXAD 4DKEL 3FFDA 3LRHA 4JFDB 3WD5H 1HEZA 1KJ3L 3P73A 3TVMB 1Z6JT 1RVFH 4WDIB 2FYYB 4RBPH 1F13A 5J1AA 1CLCA 4Y16D 3MRBA 4ZUTA 1BP3B 2YD7A 3QCTL 2AK1L 1X5AA 2R0ZH 4PGCA 5DR5L 5DUPL 2I24N 4FS0A 1MNUH 2E3VA 4LCCB 5DS8A 5GJSH 4X80L 2N7AA 3AROA 2NZ9C 5EOCH 1Z2KA 5EUOE 5D70H 3L3HB 3BRGC 4LSPL 1BQUA 4Y5YB 1EFXB 2W0FA 2RQ8A 4NQDA 4J4PA 1INDL 3QXTA 4TVPH 2BY1A 5EUOF 3NMEA 4LCUB 4DKDC 2X7LB 1T04A 1AQKL 4I3RL 4MAYC 4MXWH 2GITB 3AY4A 2EYTB 5DA0B 3ARED 4NM4H 4LLDB 3QXDB 2BRRL 3FN3A 5D1ZB 3LRGA 5MEOA 2XICA 3ARGC 2P5EB 1HNGA 3M8OH 3HNTH 3GMOA 3DYMA 1JNLL 4CU7A 3MFFB 4RWYH 3QIBC 4H20H 5DF0A 3T2NH 3WS6C 1JGEA 3MA9L 3VD4A 3G6DH 2F58L 3BKMH 5C7XL 2FJGB 1BQHG 2EO1A 4I4WB 2YN5A 1FHGA 2XXMB 4OUOA 1B6DA 4KZDL 5DC9B 1J5OL 4XGZB 2NY1B 4QHKI 3TO4C 1WBXB 5DD3H 1VADA 3ZYZA 1IEAB 1ZLVH 1D6VH 2UVFA 2V7HA 5JW4Q 5KAQG 3MNVA 3TIEA 1HXYA 4DAGH 1U8PA 1J1XH 3NFSH 3I02B 2ZUWA 4I13B 4OCXH 5ISZA 4BZYA 2E5EA 3WHXB 5SWSE 3KPPA 3HI5H 4PJFA 1GGUA 3S35H 1PW3A 2K9UA 5F1SA 4UOW1 1KTDA 5EBLB 3KYOA 3V8CA 4UUJA 5DK0A 1RPQA 4P0DA 1ROWA 4KTYA 3O3AA 2GJ6A 2HJFB 1TCRB 3SPVB 2CRMA 1BQSA 5J13B 1ZVSB 1CFBA 5F9JB 4PRBA 4QXUL 5KZCD 5CGMA 3JV6A 3BQUB 4XXDB 5IMLA 5DQ9B 3V5KB 4HQQL 3F7YA 1GC1L 3G5VB 2IH3B 2VDRH 2ZNXA 3CFCL 4X6DA 2MCPL 3VD9A 1RZ7L 1ZEAH 1WFOA 3ZO0A 5D5ME 3LKQB 3BZ4B 5JXAL 2EEBA 2A77L 3AC0A 4WWKC 1G7IB 2OZ4H 2KL6A 5CP3A 1HSAA 2FJFA 3LQZA 3NCMA 1A3RL 5EZOH 1MCJA 2FD6H 3X12A 5D5MF 3F58L 3FN0L 3SKOA 4MLSA 3AB0C 4TNWK 4DWHA 5J9PB 3FO1A 3G08A 4WGWB 2ZKHH 1QOKA 3HG1A 4M8QA 4ZD3H 5I2IA 1EIBA 3WLBA 3VE0B 4XH2A 3GMPB 2VXQH 4GH7B 4AIZA 1AIFB 4DFHA 4XVJL 1N26A 1A6WL 4NQED 2OJZL 5TE4L 3OJMB 4EZMA 4LU5L 5TDNA 2VABB 1H3TA 2NXZB 1DFBL 2G2RB 4Z7UE 2VLRA 3HS0A 3WL9B 1DSFH 1MFEL 3BJLA 1K6QL 1S9XA 4S1QL 4NCDA 5FUZL 3DMMC 1HQ4B 1RUKL 4Z7UF 3U0TB 4ODHH 4BZ1H 4MB5A 1KIQB 3HMWL 4KDTA 3WS3A 5JQ6L 2R1WB 1H0DB 3K81A 4JLRB 4YZFE 5C0AB 4YJZL 3DECA 5EIIB 2EIZA 2XACC 4IRJB 3MLYH 1N5YH 1A7NH 3BP5A 5I1IL 5MENA 2Z4QB 2CDFA 4FQPA 4QRSB 3BXNB 3HFML 2WINA 4YZFF 1U95B 1MCWM 5CSGA 5I1GH 3C9NA 4BKLB 1HXMB 3OAYK 5T5NG 2NX5E 8FABB 4YDJA 5I1EL 1CICD 2VSDA 3BEWA 5HHXL 2XWBA 4I48B 3QUXB 1ZXQA 4O4YH 4AY0A 1JPSL 2ARJA 2CRZA 4EUPH 4I0KA 4L4VE 1NFKA 3UMTA 2ZCHL 4GW4B 5GIRB 2VR4A 4OFYA 2ATPA 2ZWLT 5C3TA 3FT4A 4LLAA 3FQNB 1UCTA 4Y5XB 3RKPA 3TJHD 1NAKL 4NO0D 3MYJA 1ES0A 4NZTL 3CSPA 3IRZA 3PWUA 4HHAA 5DD5L 1JHLL 4YGVB 3KYKL 4Y7MA 4KRPB 5ITFB 3U0PA 3SJVB 1A6ZA 4FMKA 1HCVA 4Y1AB 4PTTB 5DRZB 3WJLA 3VGGA 1CZ8H 2V5SA 2A1WH 5INCB 4I9WD 1OTUD 1AGEB 3IXAB 4RAVA 1UYWH 3ZDZF 1MREL 3MZGB 4JFQB 2BNQE 4M7ZC 4AH2A 2CKBH 3CFEA 2OR9L 1MCLA 1XF3A 4P59H 1ZLSL 4RMWA 5E7BA 4WFFD 3KAAA 4RMSA 4Z77B 2X9XA 1K8DA 5FAAA 3GM0A 5TF1H 4NRYA 4EI5C 1U8NA 4MVBC 9CGTA 3MV8E 1QHOA 3NA9L 4XP9L 3O45A 1YMMB 3FRUB 4OLVL 2R4RH 1GGIH 1NFDA 1UXWB 4ZAKB 2BVPB 2J8UB 1HHIA 3GSVA 2VL5B 5C0BE 4KROC 2YPVH 2BVQA 5T1KD 1A1NA 2DJ4A 4FQJH 2HFFB 3QO0A 4YHKL 2R2HB 4JAMB 4W81A 1LK2B 5DJXA 5DK3A 3VXQB 1JZ2A 2DQCL 4P23A 1OY3B 3U46B 4P9MH 3WFBH 3WNKA 4N0CC 5AUMB 1A6VL 1OGAD 3DLQR 5D1XC 2ARJQ 5JMOC 4OGAD 2W0LA 5IT2H 1PYWA 1BGXH 3HE6B 2PYED 1JN6B 3LN5B 3V0VA 3CVHB 2C7UB 3VWKC 2W91A 2NXYD 2KUTA 4HZLA 2ILLA 3DX9B 4DK3A 5LGHH 4X7SH 1CQKA 5C6TL 2CUHA 2I27N 2VAAB 3WFZA 1EUUA 3DVGA 4NDMA 4MSWB 4YXLH 4PGBB 2HKFL 1YUHB 3I6GB 5BQ7A 5FB8B 5F9DC 4WU5B 1LO5A 2YPKB 3STZB 4FXGB 1QSFA 4JFFD 3IJYB 4OLZH 1AKJA 3G9AB 4M00A 4PRHE 4DGVH 2Z9TA 2ZUQB 2FCBA 5J57B 2NR6D 1MCPH 4YUEH 5MP6H 1B4JL 3L6FA 4ODXA 5C0DA 4EI6A 3FFCB 3DSFH 4HLZG 3T3PF 3UTSB 1FFRA 3TO2A 3MODL 1KPVA 3K2UH 3QXWA 2F53E 1AJ7H 2QQKL 5I1JL 3K1KC 3ZE0E 1I1AB 5GS3A 4B41A 4EN3D 1SBSL 2VLKB 4U1GC 1S7RB 4KK8C 3P9MB 3DXAB 1G6RH 4HH9A 2F15A 4XBPB 2DTMH 4RMRA 4L8BB 1ZS8B 2LTQC 4HGWB 1IGTB 4DZBB 5D2LB 3C5SA 4M61A 4P5TD 2DL9A 4JJHA 1R3IH 3D0VB 5BV7B 2WP3T 3MLXL 1SJEA 2DQJL 3QUYB 4UTBH 3W9DA 1AGCB 4PJ8D 4P2QB 1JMZA 1NUNB 3RVWC 5T33H 2WBJD 1GOGA 4XAKD 1IC5H 2FNBA 3PQYD 4X4XA 43C9A 3MMEB 1RUMH 1KB5A 3SQOH 3HUJE 2GSIB 4Q2ZA 4J1UA 3D85A 2P8MA 5MEQA 1FO0H 1WWCA 2DM2A 2X4TB 1BJ1J 4UT6L 2R0KH 2FR4A 3HUJF 1RK0B 1I3RB 3R4DA 3QWQB 4MNGA 4XI5D 4NQVB 4D0DA 1ODAA 4KK5D 2WBWB 5K93A 2GQHA 4TUJB