4N0YH

Structure of the hepatitis c envelope glycoprotein e1 antigenic region 314-324 bound to the cross-neutralizing antibody igh526
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
226
structure length
222
Chain Sequence
b'VQLLEQSGAEVKRPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGWINPGNGNAKYSQRFQGRVIISRDTSATTSYMELSSLTSEDTAVYSCARDRGFDLLTGHYLGLDPWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGH526 Heavy Chain
molecule tags Immune system
source organism Homo sapiens
publication title Structure of Hepatitis C Virus Envelope Glycoprotein E1 Antigenic Site 314-324 in Complex with Antibody IGH526.
pubmed doi rcsb
total genus 44
structure length 222
sequence length 226
ec nomenclature
pdb deposition date 2013-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n0yH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n0yH01
3G5XA 4JFEB 4WU5A 3GMOB 3C6LB 3HZYB 4M8VA 1IKFH 1RZJH 5IHLB 1T1XB 1F11B 4NGHH 2FB4L 3O6FA 3P9LB 5GS1C 1MCBA 1CGSL 43CAB 3NN8A 5DYOB 2YD8A 1I3GH 1FSKC 2VH5L 2VR9A 5C0DA 3S4SG 3EOAA 3C60C 4KKBC 3IXTA 4JO4L 3SCMA 5DJZA 5I1AA 2AQ3A 4Z7QF 2CUHA 3LH2H 5GGQL 3LKRA 3VA2C 3D87B 3IDIA 2QQNH 5DSCB 2GYSA 1WBYB 2R0ZL 2F58L 2WUBH 1FL6A 5GGTA 4GAJL 3O2VH 4ODVL 1KJMA 3HI5H 1MIEH 1P7KA 3FOLB 1T21A 5C0NC 2N1KA 2HFGL 5AG8A 1OCWH 1HDMA 2VDML 2NXZD 4XP9L 3TYGH 4FXLA 3HC4H 1XF5A 4BSVA 5DR5L 3L5IA 2P5WE 4IOFC 4J12A 5CZXD 1YMMA 5D1QB 2D4DA 2CRYA 1KCSL 1U9KA 2MKLC 2PCPA 5IKCA 3K1KC 1PZ5B 1WC7B 3BJ91 5LQBL 1F4WH 2G5BA 12E8H 2GJ6A 3O41B 2DI8A 5D8JL 1S7XA 4X7TB 5GS0C 5D7LA 5EFIA 5I73B 3GSNA 5DFVC 4YHPA 5E2TH 3I2CH 1DBAL 1R3IL 2VN7A 4HUVB 2B2XL 3E3QC 2HH0H 3BH9B 3SKOB 4U1SB 5LBSH 3IS1X 2WWKT 1RIUL 3MRIA 3WDJA 1FFOB 3SE3C 1O5DT 2XZCH 3MROB 2JCCE 1DVFD 4CVZB 1I8KA 4HQQL 3R1GL 1V3KA 4OZFB 2VDOH 3NOIA 4N5UA 5C7XH 1FVCA 4ELKB 1HYSC 4F8QA 3GMLB 4DKDC 4F9LA 2DWDB 3QIWD 5IGXL 2HA1A 2MHAB 2W9EH 3Q3GB 2N56A 3L3DB 2L7JA 2VL4A 2DQEH 3QG7L 1KJ2A 2MQ0A 4U1HA 5FA3B 5T1DH 4PRNA 4QY8A 4YBQC 4PJ7A 1GOHA 1H3VA 3G6JF 1FZMB 3CVIL 1DP0A 3VG0L 4GUPB 3WLWD 3QEUB 3HZVB 3SPVA 2JCCF 3U83A 1FZMA 3WSQH 4P5MB 1UCTA 3D9AL 4RAVB 4HLZG 4QRPE 5DURB 2ICWI 4X4XB 5T5FH 2ESVE 2VZTA 1XR9B 2UV3A 5DA4A 4QOKB 2DBJA 1KJ2B 2CO6B 2H8PA 3D2UD 5IFAH 5I1DA 1AJ7H 1KJ3L 4D9LH 1WFUA 3NZHH 3BMWA 4BZ1H 3OXRA 4PB9L 5JQHC 4B0MM 3S88H 2X05A 4Z76B 1BFVH 4QTIH 4R4FH 3TBWB 1Z3GL 3QEQD 2AJXL 4KPHH 5F6IC 3KYKH 2E7CA 2X6MA 2FIRT 4JY4A 3ZTJG 5C70A 1MSPA 3H3PH 3D0LB 1FG2B 1ZT1A 4HUVA 1MJUH 3BPLC 4H20L 4LPYA 3FB6A 4GRMA 1CGUA 1YEEL 1FG9C 4XXDB 3O8XB 3MRRA 3MXVL 2I60H 3FO0H 3CXHK 3BKML 5HGHA 1ES0B 1CFQA 2DQFB 5EZOH 1R3KA 35C8H 2MOVA 5F9OL 5IHUH 3HFMH 3G9AB 2FHBA 5D7IF 4R90H 4HXAH 4NRZB 1FPTH 4WI6A 4XBPB 1JNLL 2NY5C 2YA0A 4YUEH 3W5NA 1YMMB 5D1QA 3HG1E 2VL5A 3P4OA 4U3HA 2IMMA 1Q72L 4BZYA 1FNSH 4DN3L 4NO5B 3VXSB 3CIQA 3ARED 4X6EB 1Q8MA 4AEHL 2VLME 3L3OA 3DURB 3GUTA 4JFOB 2D9QB 3GB7A 4J3SA 1KB5H 3NFPA 4IRJA 4L8DA 4YHKH 1VB9A 5D1ZA 4L29B 5ERWB 3C6LD 1M7DB 5ADOL 2GFBB 2A0LD 3O2DL 4NSKB 3FT4B 4HUMB 1ERNA 3ROOA 3IXAA 3D18A 5IMOA 3BVNB 1IAKA 1NAMB 3UBXB 1CLZH 2X2YA 4AM0B 5C71A 3NABH 3P73A 1DQJA 3SE8L 2P44B 3UBXI 4OGAC 4WTXA 4HWBH 4QRRE 1BGXL 1V7MH 4WW2C 1NCDH 3KJ6L 1DBML 2X9YA 5EOQL 4OLVH 4CW1B 1H8OA 4MS8D 2IH1B 2DTMH 3PP4H 1RZGB 1TJIL 3VH8A 5HPOA 2AEQH 3TNMA 3HMXA 3U4AA 5GZOD 5L8LB 4KZEH 1WFNA 1YEKH 1HHGB 3AS3A 3F6IA 3L7FA 3CSGA 3MJGX 4U2YA 1J11A 4HV8B 2VUYA 4L1HA 1HKLL 1FGVH 4HGWA 1I1YB 1A6TA 3DUUA 5A2LH 4TQEH 2ADJB 3RWHA 2GTZA 1T7XA 2H9GA 1JGEB 3QHZH 3BQUA 1IAOB 1OP5K 1RFDH 4HGMA 3U46A 2YRLA 3IFOA 3ARFB 3TN0B 3M1BA 3VWKA 5I1GL 1EBAA 3CFBA 4ZODA 4Q6IB 3QJFB 5C0ND 4JLRA 4KROB 1CT8B 4XAKE 4MNQE 4UINH 3ROLA 3FRPG 3T2NL 3UTQB 5D93B 1X5FA 2KL6A 4GSDH 5D2NC 2BK8A 2PYEE 3TC9A 3ARZA 1XAUA 4JKMA 4JFED 3WIHL 1LEKB 5C07D 1R3LA 4LCIH 2DWEB 1RFDL 1J5OH 1WFOA 1DVFB 1AY1H 1OAXH 1HHHB 3QQNA 1IT9H 3EFDH 4I0KA 5DRXA 1HWHB 3P11L 3DECA 3V0VB 3OKEB 3INUH 2NY7L 1IEAA 1TQCB 2EICA 3S35X 3V52H 3RBGA 5AUMB 3BPCB 4CGTA 5DWUH 3HC0B 1G7QA 2HT3C 4AK1A 4QT5A 2NY2B 1R24B 5EBWB 1MRCL 4X5WA 1KIRB 4JPVL 5F7UA 2BY1A 4NYLA 2JJSA 4W6XB 3QDGA 3IDNB 3CH1B 1M6OA 4LHJB 3ARFC 3U46B 3U1SL 5JUEH 2NXZB 2XV6B 4MQSB 4LFHG 4HIXL 4OCYH 3QUZC 2DQDL 4G6JL 4GOSA 4UDTA 3P0YL 3BESR 1MFDL 3U9PL 4PRHD 2VZ3A 3HC3L 1OP9A 4MA7H 4MDJB 4G80A 5MHSE 1RMFL 1KTLB 1INQA 1LP9B 4G8GE 1ZT7B 3D9AH 1HIMH 4F7TB 3I6LD 5SWQA 3QUYB 3ARYA 2ORBH 4PJXB 1YPZA 2AJ3B 4WUKL 5E95B 3S34L 4OGZA 2DQHL 2JJSC 3SE9L 4C56D 3V2AR 4YAQB 1E0OB 4YDLB 5I0ZA 2DQEL 4KXZI 1D5XB 2YD9A 5DLML 2AXFA 4ZTPL 1FPTL 4MB3A 4LSPH 4QHMA 3FFCE 4OLZH 1T4KB 1VESA 4G5ZH 4HAGA 4JJ5A 4WUUD 5C7XL 3ZKXC 2JJWA 4HQQH 3G6JB 3BOVA 1EVUA 1MJ8L 5EA0L 5D2NE 4QCIA 3GHBH 3KLAA 4Y5YC 1RZKL 4XGZA 5FO8B 1M1SA 3DOSA 3EYFA 1AC6A 3QNXB 1QPPA 3HC0A 3T09A 3MOAL 4NJAL 5E8PB 2NX5A 4PLOB 1OAZL 5MEOA 4JDZA 4H26B 4KUZL 4HMEA 3RY5A 3KYKL 4ODXB 4FRWA 3BN9C 3HE6A 5CJ5A 1U2CA 1A6WH 1P84K 5FOJA 1NDMA 4MX7A 2Y7QB 1MI5D 1CTOA 3HR5B 3BGAA 4Q2ZB 4Y8DC 5FUZH 1N6VA 2VO5A 3QDAA 5CZVH 4OF6A 2OR9H 3ELAT 2HJLB 1X5GA 3QEQB 1A6VL 2PYFA 3KWWA 5IQ7L 5FIEA 4A6YH 3P0GB 4V1DB 3S37X 2C4FT 2PXYA 4XCNB 5JORB 4LVHC 4Z18A 4RFNB 3MLSH 1HHIA 1AQDA 1CICD 2ZUUA 1DQDL 4TUKL 1B88A 2YOCA 3IDMB 1T6WA 5L8JB 3IFOB 3OGCA 5GGQH 4I1NB 3S3PA 1LMKA 4GAYB 4YWGL 1DCLA 3NPSC 5F1KC 4EI5B 2VKWA 4K7PL 5I8OH 3IU3A 3CVHA 2Y4SA 4AIOA 4Z7WB 4DAGL 5HI4D 4QOKA 1RZIA 1DSFL 4HS8L 5IEKB 1RJLB 1NC4A 3HMXH 5F8RC 3VXNB 3KPNA 2VLRB 5LJYH 5FUCE 4O2FA 1NCWH 3SDAB 3TM6A 1R0AH 3GSNL 3O4LE 2YEZB 4JFFE 2B2XH 2JF1A 1U42A 3UYOD 3NFNA 5KANI 5I30L 3RGVB 1JZ7A 2XG5A 4P9HL 1FNFA 3QI9A 4YWGH 3P77A 3T0EE 2HKHH 1LK3L 2WQRA 5IEHB 4I0PA 4MAUH 3TJHC 1K6QH 1G7IB 5SWSB 12E8L 4ELMA 2BY2A 3ARUA 2QQLL 4R3SB 1T03L 4IMLA 1U58B 1DQJB 3WFCH 4LP4A 1DDHB 5ICZA 1P9MA 5L7XH 4A6YL 2Q3AA 2FATH 4DOHB 5ICXA 4APQB 1GOGA 5IB1A 3RIFK 2NY2C 4IDJH 1TMCB 5IBTH 2AJYL 4FQCH 1EHLH 5KSVB 1ORSB 4XBEL 5K93A 4X6DF 4P2QE 4M7JL 4NQEE 2G9HB 2GTWA 1LP9A 2AXJA 3D6GA 1FQ9C 5HGBB 1A6WL 5DQ9A 2DF3A 4X8JB 3MUHL 4TSBL 2IBGA 1YMHA 3E0GA 1MFCL 5CD5C 4UQ2A 3B43A 5A43C 2J8OA 5ENWB 3GMRA 4IRSA 4JO4H 3D39A 4KWUA 5CCKH 2UWEE 2HTLD 2HRPH 4HS3B 3KLHD 2X89A 4I3SH 3TBTB 1EZVX 5B8CB 4OQTH 3WNKA 3GMNA 3LCYA 3WFDH 3W5MA 3JWOH 2BNQB 4MD5B 3DX7B 2R2EA 2AEIT 4P3DA 4D0CB 1FO0L 5BO1H 5DC0A 4E9LA 3KYMB 3ULSB 1T20B 5KSUB 1NGQH 4WFED 5JTWA 4HJGA 1UM5H 2AV7B 3M17A 3Q6GH 2D31B 5LGHH 4B5EA 5I1AB 1NFDF 3TVMC 1AI1H 4C56B 3MLUH 4XP6L 3Q0HA 1OQXA 4M7KL 2VLLB 5HVHC 3TO4B 4FFYH 1S7VB 1GL4B 4ZFGH 1UJ3C 4N8VA 3MRNA 1JNJA 4OLUH 5F3HB 5EU4B 5MEPA 5HDQH 3U0WH 1CTNA 5HD8C 3ZE0E 3L3GA 3HZYA 5INCA 1JTTA 1KF9B 4Q58C 2MFNA 4JFXB 4N5EC 4NN7C 3MREA 1N5AB 1S3KL 3SE3A 3GI9H 1E4KA 3U36B 4KFZC 1IL1B 2EO9A 4DZBB 3UP1A 3IFLL 1CR9H 2NY2D 4NHUB 4PRNB 4QY8B 3U0PA 4XVJL 1LO3H 4U1HB 3TO4C 5EOCH 2F74B 5DJYA 4XZUB 3UTTB 4G42B 2ZKHL 5I2IA 2H9GB 1S7SB 3RRQA 2P5WB 2IFFH 2XTJC 3VFNA 4HBQA 4GJTB 2IAMD 1G7LA 3NPSB 3SQBA 4ZFOB 1EV2E 2XI9A 3VE0B 1KEML 2GK0A 3UPAA 3RZCB 3EJZD 1FLRL 1CG9B 4HKBA 4DVBB 5I8CB 3BAEH 4V1DD 5CP7A 3K80A 3QUYD 5T1MA 2CIKA 4I13B 1VENA 2AI0L 3CCHB 4M1GL 5EO0B 5AZEL 4Z0BL 2A6IA 4KJQD 4EIZC 5KS9A 4AJ0A 1A9BB 3CZFB 3MYJA 2Y36L 1PG7L 3CSYA 1N6QH 4GKNB 4HG4J 4TTGA 1CDHA 4EI5D 4HIHA 2WBJA 3QFDA 5DXWA 1D5MB 2CJUL 5IBLC 2AGJH 4IRJB 5K9QI 5CILL 1XF5B 3TCXA 4Y16C 2UYLB 2P24B 5D2LB 1BOYA 3RAJH 3NH7H 1VFAA 4H1LG 4JFDE 2V2WA 2IALA 1WT5C 5K9JL 3FO9B 4S1QL 4RFEB 4P5KA 2ZCHL 5FM4A 3GMNB 3VXRA 2RAMA 1GC1C 1ZTXL 3ARGC 4XWGL 3OKYA 5IBUG 5GRWA 5CEYB 1N5YL 3WUZA 3IRPX 3ZKMD 4OZIA 5GS2H 4NQSB 4MQ7A 4WY7L 4J1UB 2FO4B 2E7HA 4U0RC 2FSEB 3UTOA 1T80A 2ED9A 2H3NB 5IQ9A 2JB6B 4WW1A 1TZIA 4ONFL 5KS9F 2DKUA 5HYSB 2OTUB 4FG6C 3MRRB 2DTSA 2XOTA 4KDWA 5JZ7D 3CNKA 4Z7VA 1QFUL 3GSOB 3RWGA 5I16A 4QO1A 4JANB 4K3EH 5E94B 2V7NA 1QRNA 3D85D 1DEEA 3OR6A 1KCRL 3LIZL 2YUXA 5AYUL 1EFXD 1JF1B 3E6HB 3PL6B 4Q0XH 1CK0H 1QVOA 4LAQL 1IGJB 1SEBA 1CICB 5C0CB 3RNQB 4OZ4A 1YY9D 3GIVA 1YEJH 3R0NA 2IG2H 1WBXA 3EGSA 3V6FA 3OZ9H 4GMTH 4Y2DD 3OF6A 1OP3H 1RV6X 3C9NB 3CSBA 1MCLA 2VDPH 3QH3B 3OKDB 4I3GA 4G6KH 3MV7A 3NACH 1LEGA 1FFPB 4GW1B 3BGFC 3VXSE 3KXFD 3MPCA 1P4BH 3DVNB 4YBHA 5I1LA 5ESQA 2NY4C 4I18C 1P5VA 5GHWH 5HHOD 5L2KA 4LVOC 3UC0L 4KQ3L 1DANU 3BT2L 5FYJE 2BNRD 5INDA 2ADGB 2VYRE 4CUCA 4PRHB 1T22A 3VXPB 25C8L 3MJ9L 4N0UE 1EGJA 1QNZH 1MHPH 5ELIA 3ET9F 5DEGA 3STLB 3ULUL 4N0FA 5CJXA 3M17B 2NTFB 1IC5L 3FRUB 2CLVB 4V1DA 2NCMA 5T3XE 3UDWA 4R4FL 2JELL 4Y19E 1YEIH 1OM3H 5L6YL 4YHNB 4BH8A 3G6JE 5DD3L 5EU7E 2A6KB 2X4NA 3N0PB 1GGIH 1XCTA 4L3EA 4Q7DA 5L2JB 1NQBA 3CSPA 3VD4A 2HYMA 3QRGL 4OZGB 2DOCA 5IFAL 5E2UL 4OB5L 3C5ZB 4JM4H 3RY4A 3WXVH 4F7PA 1CXLA 2XIDA 1ZGLP 4KVNL 3TPUA 3HE7B 3RVUD 1KPVA 3QXAA 1JN6A 3MODH 2YUWA 5TE6H 2V9RA 3HB3D 4TOYL 4M3KB 1TFHA 4ENEC 4MXVF 4LFHD 4B7LA 3QUZD 4HBCH 1QBAA 1CGVA 1TVHB 3UTSD 3QDMB 1JI1A 1XF1A 5ADPL 2P7TB 4JN2A 5CSZA 1ZWIA 3T0EA 4JPWH 1MCFA 3BSZL 4EDWL 5KSAA 3BD5A 1O7SA 3DVIA 1Z5LB 2VABB 2DLGA 4JB9H 4QGTA 5ISZD 2R1YB 5J6GA 4YHIB 3MNZB 4BSJA 2V2TA 4X4ME 2PYEB 3D3VA 1KCRH 3LIZH 3ZDZE 1GOFA 1S9VB 5D7KD 5DMIL 1Y6MR 3ARGB 2VXSH 3NIGE 1KELH 3WFZA 5GZNC 3L7EB 3DNKA 4D9RE 4PYGA 3KJ4C 3MBXH 4FFWD 1OWWA 4LEXL 4KRLB 2L0DA 4GRLC 4F7MA 1WSST 4FFVC 1MCSA 5F89B 3ULUE 3B9AA 3PDOA 1BF8A 1JCKA 1IM3B 5LQBH 3GSUA 1UEMA 4FFVD 3T77B 2Y25A 4CDHA 3TZVA 2W60B 1CDUA 2FX8L 1MJJA 2ZUTA 2V9QA 2VLRA 4XH2B 3VXNA 4PRIE 1VGKA 3SO3C 3JV0A 4POYA 1CF8H 4LCUA 4ALAL 5EO9B 1U8NB 3TYGL 1FGNH 1ZVSA 5HHNA 3X13B 3FQWA 3HE7A 1C5CH 2X70A 3PIQB 4GQPH 1KCVH 2VLRD 1NGYA 3FO2A 3TT3H 3QIUA 4GAJH 2ZUVA 4ZSOE 4KJPD 1R24A 5EBWA 2IADB 1JK8B 3WXWH 1N6QL 1FZJB 3BH8B 4PRPA 3ARVA 4G7YH 5FAAA 4J2XA 3CJJA 1A2YB 4NQEB 3AY4A 1MFEL 5AEAA 1HK6A 4YC2C 5E2WH 5JPMA 3QHFH 5JDSB 1A6PA 4L9DA 4OSUH 2HN7B 2E27L 3KG5A 5FV1L 2O5YH 5GXBB 1K6QL 5CSBA 5M95B 1A7OL 1A4JB 3ZZ1A 1LK3H 1M05B 3QDGD 2W65A 3B8YA 4NFBA 3PL6C 5DGRA 3BH8A 4ZPVB 3F7YB 4HF5H 2A0LC 4G6FB 3IKKA 4ZXBD 4YH6A 3RJQB 4ZS7L 4IRJD 2IBZX 4BM7A 4D0DA 2AJSL 2Q1EA 4UIMB 1BPVA 1FAIL 3IETB 5KZCD 4OM1H 3B8SA 3L3HB 3HMWL 3WJLC 15C8H 4JN1L 3O9WD 1PJ9A 5BOPA 4NNPL 5L9DH 4Y1AB 2BVTA 2R0LL 4GW4A 1T0MB 3FN0L 1VACA 3BP4A 5HYQB 4IHOA 1QSFA 5D1QD 1JYXA 4HX1B 4BA8A 1H3UA 1VA9A 1UH3A 2Z92B 3SDXB 5D5ME 1D9KC 1D6EA 8CGTA 4P5TC 4KH2A 4H5SB 2YRPA 2QL1A 4ODHH 2YD1A 4OD1H 3W39B 2JB5L 5H94A 3FAWA 4Y16B 4ZOBA 4WI2A 5IMLB 4PJEF 2VQ1A 4YIQA 3WUWB 5DRWA 3RHWK 4JPKL 3P73B 2XZAL 2DQTH 4NHCL 1FVEB 1MAKA 2DLHA 3ETBF 4GRWF 5EO1B 3PL6D 4OCXH 4DVRH 3GSWA 4HWEL 1BX2A 4JY6A 3TYFA 2YD3A 4AH2A 4O5LH 3PABB 5C0CD 1F4YH 1T1YA 3H3KA 4OM1L 2NX5D 4JY6B 4GW4B 4X6BA 3WO4C 2D7TL 5EIIA 1AC0A 3QQ4A 4K3GA 1OPGH 3BGMA 3L3KB 4LRNH 4UT9L 2ZCKH 3HA0A 3LKSA 4HIIB 5GSVA 5GS0D 4Y0GA 5CIPH 3U30C 2BSRB 3I02B 1A4KB 3BO8A 3EDFA 1WQVT 4P23A 1EGJH 4ODWA 4HK3J 2B1HH 4N0YH 5DFTA 2EIZB 2P5WD 1KCUL 2K7QA 4N0RA 3ARSA 5HPMB 1TENA 5EZJB 3ARGD 4Y4HB 4OZGA 5CINL 1IFHL 2DWEA 3VFMB 1UH2A 4XXDA 3B2UC 3LHPL 1CG9A 1TJGH 5I19H 3VFSA 4BK4A 1W8OA 1HXYA 4WW2A 2D7PA 4KKLC 1SJHA 1RUMH 1P4IL 1T5WB 3BKJL 3D69B 2XT1B 4GBXC 1INEL 1TIUA 1BBDL 4GXVL 2ATKB 4X7SH 3OXRB 2AKRB 2E5EA 2EDQA 5JNYA 5I17A 1CXFA 3MX0A 3AB0C 3F7VA 3VFTA 4LHUG 4I8DA 4NNPH 3VXQA 2J3SA 2V5YA 4ZAKB 4PTTB 2D7OA 3K8LA 5EUKA 1BJ1H 3CAFA 4HV8A 1TZGL 1BBJB 2PR4H 1P1ZA 1MJJB 4AMKL 2WNGA 4BQ9A 4UOW1 1GYAA 3UTSB 1IL1A 3FOMA 2ZOKA 2IANE 1QRKA 3G6AB 3B9KD 2FX7H 3HLAB 3AAZA 1JHTB 1G0DA 3MRBA 2IF7A 3NA9H 1F3JB 2VXSL 1QG3A 3QUKA 2ZUYA 3QISA 3RY6C 3T0VA 5T1LA 2A83B 4JCMA 3VGDA 5EU4A 5MEPB 1OT1A 2YMXH 4JHAH 4CN4A 4YFLF 3QUXA 3V6OA 1J86A 3ARQA 3MSPA 4ISVB 4O9HL 1T1ZB 5D70L 5IIEA 3BVNA 4NUGH 5GGRB 2PW1A 2LV4A 3WLBA 5IFHL 5HHXH 4M7LT 4JPWL 1ED3B 2DM2A 5GGUB 4JVUA 1RPQA 2LVCA 2XRAL 5JMRA 4JANA 5IROA 2F8OA 5IWLA 3BP6A 3TIEB 4EN3D 2XWJA 4JG0H 5GS2D 1WZ1H 1N4XL 1FV1B 4PY8J 5E8OB 2GQHA 4WUUB 1S7QB 5F88B 2P5EA 2XQBH 4KZDL 2Y06L 4LCWA 4XXCA 2XXCB 1XF2A 4GKZB 4Z95L 3A6CL 2NY0D 1HNGA 4UOW0 5F89A 1J0KA 3HI1B 1KT2A 2DQGL 3OJDA 3E6FA 4LIQH 1JRHI 3R0MA 5IVXA 5DVOA 4H0HB 1Y6NR 3MRKB 4EDXA 3W2DH 5HGHB 3PGCA 3TWCH 2PYEA 5LKNA 4MHHG 2V2WB 2G60H 1ETZA 4PGBA 1YUHB 4OLZL 4U6VH 1X5IA 1LD9B 2VLMD 4PJFF 1BVZA 2OCFD 4YDLC 2YRZA 2F15A 5IMKA 1MJ7L 1HH6B 5J0BA 3BHBB 4TPRL 3NABL 1ED3A 2W0FA 3GBNL 1JWSA 5E6ZA 3G9VA 2DQHH 1E6OL 3S34H 1TVHA 3R06A 3G5ZB 3V5DA 3V6OC 3VG9C 2EDEA 2GSGA 1IARB 2PO6C 1F90H 5D1XC 5TF1L 4MCYB 4Q6YA 4YDJB 4RZCA 1YY8A 2CIKB 5EULV 3QJHB 4JO2L 4ZDHB 4ZFOL 1J0JA 3DVNA 4D9RD 2W9DH 1AR1D 1L0YA 3P77B 3IAGC 4Y4HC 4E42A 1JUFA 3NCYP 4UNVA 1SBBA 1KC5H 4G6FD 2H1PH 1U3YA 2DMBA 4OBSA 3WNMA 1I8LA 1P2CA 1GRWA 4RA0C 3WFBL 4CU8A 2R1WB 3CLFL 3LQZB 3HE7D 5EUKB 4K3DH 4P59H 4GG6F 1Q0XH 4NQCB 1CL7L 4N0FB 2X4RB 1WBXB 3GK8H 2P47B 3L3DA 3WS3B 3U30B 4U6HB 1YYMH 1F8TL 1NLBH 2R1XA 4K71C 4M62L 4N1CA 2WWMC 1TNNA 4LHUB 3MRMB 5A16B 1ITCA 2QHRL 2DN7A 4H20H 4FXKB 2GJZB 5EPMA 4O51B 3W0WD 2KPNA 1MF2L 1U3HA 1TQBB 4GKSB 2RFXB 3IT8D 2OTUA 4TUJA 5C2BH 2PYED 4Y16D 4PGCB 1JGLH 2BRRH 3SKMB 5HYJD 2PXYC 3STBA 1SM3H 2F54A 3OGOE 3JTSB 4PRPD 3V4PL 2FO1A 5GQBA 2Y7QA 3LV3A 4PRIB 2HKFH 3SGJC 4OLXL 3VWJA 4DKFL 2KBGA 2EDRA 2RCSL 1IKNC 5K9JH 4LRIA 4ODWB 1JV5A 2HFEA 1CD8A 4JDTH 3GFUA 1G9EA 1IGJA 3VXRB 1AFVH 1BQLL 2NX5B 5E8PA 3RDTA 4K3DL 1E28A 3SO5A 4XC1H 3I02A 3CLFH 4WFGE 1FFNB 5FYLL 4NN5B 3RUGE 4PPTA 2MMXA 3NCJL 3PWNA 3MLXL 4HH9A 4M93B 4UTAL 5MENA 2EDLA 4LMQE 4Q97A 2JIXA 3IAPA 5JR1L 3QA3A 5CP3H 2VXTH 4I2XA 4LSTH 5F7EH 2ICES 2VITA 5D5MF 3MOBL 5HHXL 3D39B 1UG9A 5MERA 2UZXB 4Y89A 4M6NL 2R0KH 2MCPH 1I7ZA 1WBZB 3VRLE 5IW1B 3KJ6H 4LRIC 2J6EA 2HRLA 3FQNB 4HZLB 1J1XH 5HGBA 4PRHE 3DHMA 3IDGB 3MUZ1 3CU7A 4I2XB 4KK8D 2C1OA 4X80L 5J12C 3BZEB 3MBEB 4DWHA 4PV8B 3FO1A 1BZ9A 5E5RB 4CU7A 2EYTA 4PJGE 1Z2KA 2EEDA 1OGTA 4WV1C 5C08A 1E28B 4X6DA 1NCAL 3K81A 5AZ2H 2RQ8A 1NUDA 2GT9B 4NFCA 3QWQB 1A0QL 4IRZH 3QFDB 2WBJB 1N5YH 1YDPA 3K4ZA 4Y1AA 3FL7A 32C2A 4ZXBB 3BPLB 5LWYL 2MWCA 1CLYL 3BIKA 1YEFH 4UV7H 3GJFH 4FNLH 4HW6A 1JNLH 4DK3A 4X5WB 4KZDH 4NO0A 3GNMH 1TJGL 5I19L 2Q76A 4FQPA 3P4MA 1G1YA 5IEKA 1IC4H 1MFAH 3V6ZB 4JQIL 5E7BA 3NBNA 1PX4A 1F2XK 5A16A 1UADC 3BEWA 3OKNB 3LKNA 4U1NB 1KENL 2DQCH 2C5DC 1SMOA 2VLLA 3MGOA 4K7FA 3VGFA 1G7PA 1VHPA 5CP3A 5C0EB 4U6HA 2BHUA 3IDUA 3H3PL 1GPOH 1F00I 5B4MC 2YMXL 4XCNA 4C59B 4DGYH 1VKXB 4C4KO 4IEFB 1QO3A 3SOBH 4NM4H 3WHE1 3UDWC 3V0WH 4NM8H 2PO6B 1IQDB 3B2VH 3VRIB 3ZDXF 2FX7L 1AJ7L 1KJ3H 2C7UB 2H41A 1VADB 4D9LL 3O9WA 3RWFB 5KVEL 1IGIL 1HILA 3J7HA 1PX3A 3JVGA 4O5LL 3ARDB 3VXME 1HINL 1MCJA 1S7TA 2YPVH 4Y8AA 4ZUVA 2Y06H 3OSKA 2QJDA 3QPQD 3KPPA 4M4PA 3RTQA 3HAEG 1TITA 1EX0A 4XI5C 4M6MH 4QRRA 1OAUL 5IF0A 4Q9RH 3V5HB 1LDPL 1TCMA 1XGRA 3CLEL 4JZOB 4DUWA 3FT2B 5D7JA 3BQUC 1L0QA 3TZVB 2HLFD 4I0CC 4HPOL 2D31A 1R6VA 1RUML 4GAFB 4LARH 1MNUL 4ZSOB 2ITCB 5GISL 2D9CA 3QCTL 4OUUB 4RX4D 1ADQH 4KXZH 1PY4A 3BKYL 5EU3B 1U8MB 1WUNT 4APQA 2E3VA 4M7KH 1BVKB 1GZPA 1UXSA 4X5XB 5B39A 4M1DH 1IFHH 3QBTB 5FEBA 4QHUB 3WE6B 1L4IA 3D18B 1EFXB 1BAFH 4X4YA 1KB5B 1A8JH 3RWEB 4NBXB 4OUUA 2VUOA 3DXAB 1VFBB 3HMWH 4XNUH 3QUYA 5F97E 1NGZA 4LCCB 4N8VG 1IAIM 3NFNB 3O3UN 5FM5M 1JNNL 4P2QD 5I1CL 3WFDL 5IFJB 4MZ3A 4PJCE 3P30L 2OM5A 4OQTL 1KCSH 1Z0NA 5E6IB 4JR9L 1XZ0B 2XA8H 3PWPA 3PUCA 2CQVA 4GRLA 5GGUA 3MZTA 4K55A 2VDRH 5ICXB 5DURD 3IVKB 3MRQA 1YEGL 4PG2C 4PJBE 5ICZB 5HI5C 5HYSG 3EO9L 4OTXH 1R5VA 2ZG1A 3QDJB 4H8WC 2BVQB 2F8VA 2RR3A 1T89C 2EDXA 1WITA 1W72A 3B9KB 5D7JC 4YEEA 1JPFA 3FB6B 4DGVL 5J1TC 4BSWA 1KYOK 1HQ4A 4K23H 3STZA 2AXHA 3VW3L 4P2RB 3F6LA 4XPGH 3ZE1E 4QHNA 4KDTC 4LPTA 4MA1B 1RK1A 3MV8A 4PUBH 1BMGA 4JY5H 5DRXB 3TBWA 3B4NA 4HULB 2EC8A 3WDIA 4MAUL 4U0QB 3F7RA 4Z7WA 2VDNL 4MA1C 1X7QB 4PJHF 2B0SH 3FHQA 3SJVA 3PXHA 2ATKA 3P4MB 2XTLA 1Q9OB 2ZUWA 1W0WB 3RU8H 3SPVB 3LAFA 2O5XH 2HLFC 4XC3L 4MXWL 1OP5H 1X3DA 4HS8H 4TUOA 1I3UA 1NLDH 3K2MC 4Z7NF 1NGWB 3MV9A 1WEJL 3DX6B 5CD3B 3V4UL 2XN9A 3BDYL 2N4IA 4ZG1A 5I1IL 3UYRL 3VFMA 5I1HH 3Q3GA 5DD0L 2EXYC 1DQDH 4YDKL 2ADFL 4K3JH 3FCTA 5TFSL 3KYAA 4L5FH 4CMHC 3U0TA 1QRNE 3DRTA 2OLDA 1ACYL 5GS0L 5GRZA 1R5WB 3MO1A 3MRCA 1NL0H 4GMSH 4EI6A 3HZKB 1KG0B 3MNWA 3W0WE 2UUDH 5FM8A 4QRSA 4MD4B 4LAJH 1EJOL 1JZ5A 5I1JH 2YN3A 1I1AC 3ARDD 5SX5K 4HJ0D 4XNXH 1BOGA 4N90E 3QA3B 1A3LL 4QXWA 1D9KA 5F1IB 3C08H 3IYLW 4EBQL 4OKDA 3TN0C 3FFDB 5SWZE 2UWEB 1RZKH 2DLIA 3BZDA 4H88H 5EB9A 3L3OB 1J10A 5DD3H 4KTEH 4Z7UA 2HT2D 4JM2F 2IQAB 4X6EA 2J88H 1NDGA 1P7KB 4TSAH 1UWEL 5C9JA 4NT6B 4AEIL 2BNQE 4AQ1B 5IP4A 4DGYL 3JTTB 5H37G 1LNUB 4IOSD 2E27H 3UTSE 1NFDA 4RGOL 1MI5B 3BN3B 3E2HC 3D0VB 5HVGB 4LSPL 4LLVB 4Z7NE 4Y5VB 4O2CA 3S96B 2D03H 4JHBA 5HHOB 1JE6A 3EOAB 4BKLB 1KGCE 4Q9BA 4NQDB 4QXGH 2QEJA 4MJIE 3D48R 1VPOH 4KK5C 5C07B 4PGCA 3REVA 2AEWA 3JV4A 4P3CH 4WNQB 1HHKB 1IQWH 2XNAA 4Y4KB 5HHVL 5KVFH 1ZHKA 3G5VB 5I1GH 5LVEA 2MCG1 4HUUB 2VAAA 1FG2A 1I85C 3OKMB 4G3YH 2EZ0C 3QDGB 4NC1E 4R2GB 1CU4L 1T89A 2JKXA 5F7EL 3VWJC 3MFGB 3HE6D 4M5ZH 5GJSL 1OTTC 4R26L 2LTQB 2A9NL 3OZ9L 5GGSY 1DUZA 3X17A 1D5IH 1F4XH 1K4DB 4ODTH 1IGML 1JGEA 3ZYIA 3OJ2C 2X89D 2W65B 1SY6H 4YDVA 3V4VL 1AFVL 1BQLH 4LAQH 4YLQT 2R69H 2ERJC 3QXVA 5H35A 1VSCA 4OIIH 2VMFA 5FECB 2VRAA 5E1AA 5CSGA 3GM0A 4NBYB 1A2YA 2HKFL 4NQEA 5T3XL 4OLWH 3A67L 5C8JA 3MBXL 1MHCB 4FABH 3MV11 3NCEB 5MEQB 3X14A 4KUCD 1INDL 3BIBX 5ETUB 3PWLB 4OD2A 2HFTA 4KAQH 4BUHA 3TLRA 2MCPL 5DD1L 1GZQA 2DWDA 5C0JB 5D1ZC 3S7GA 3TN0A 1N64L 3VWKB 3O6FD 3HCVA 2X70B 3PIQA 5FYJL 4XVSH 3OG4B 1DE4A 2Q6WB 4E41A 4YHZH 5J1SC 2Q8AL 3TVMA 5JW4R 4R4BB 2BVPA 2GITB 1F6AB 2JTDA 3B3IA 4GSDL 5ADPH 1I1AA 2FX9L 2R0WL 3K4AA 4GRLB 5IMKB 1I1YA 1U3JA 4KJWD 3MRJA 1T3FA 4NIKB 2GJ6E 1FNSL 1IC4L 1MFAL 4LQFH 3ZE1F 1EO8H 5T3XD 1L7TH 4NKMA 1Q0XL 3H9SB 5FO9B 4OZHE 2AGJL 1RZGA 3JUYA 4HT1H 4P2QB 4PP1D 4YR6B 5I76B 4QHLA 4EUPB 4UV7L 5F9OH 4EVNA 4JEGB 5IHBA 3GGWB 3KPQA 4LHQB 4XAWL 5BZDA 4HS3A 1EK3A 1U8QB 4X9IA 1UCBL 9CGTA 1MY5A 4OIBA 4D3CH 3L7EA 3I85A 5IK3B 3F12B 2E7MA 2BRRL 3MGTB 4M48L 1TVBA 5F9DC 1JPTL 1UB6A 3T3PF 3MGAA 1LQSR 4N8CH 4CAGA 4M7LH 2J5LC 5E8DH 4WO4D 2AK4A 3IXAB 3ARPA 5F70A 5ID0A 5HGGS 2H32B 4RMVA 5J6GB 2DYPA 1M7DA 2NY3B 2AJXH 4KPHL 1N0XH 3CDCA 4QTIL 4Y4HD 1C08A 5E8EA 3DUHA 2IH3A 3ALPA 4WWID 4X80H 4JFOA 3V8CA 4PB9H 2ZNXA 4PR5A 1LO2L 4FABL 5CEZD 4G8GD 4ERSL 4B53A 4BFEA 5CZKA 3BW9B 3OX8B 4U6VL 5I6XB 1NCCL 3K3QA 1A14H 4R3SA 1MFBL 1AXIB 3LN5B 3WFHA 3TWCL 4FQQA 1DBJL 1QBMH 3LDBC 5E08H 1F3JA 4AG4H 1DVFC 1F4XL 1MPAL 1B0RA 4PV9B 3VDBA 3RPIB 2N7BA 3MQIA 3QZWA 5DJ8B 1QBLH 1UCBH 3MLXH 4Z7OF 3ULUD 4OV5B 3RI5K 3UTZB 4EOWL 4JO2H 4OFPA 3OG6B 3RAJL 4CDGC 4JDVA 3REWA 2AXGA 3KLDA 2FYYB 4HXAL 3DO7B 2XQBL 3VXQB 4MB4A 3R1GH 8FABA 3ME0A 5I17B 3WMSA 5I8KH 4NZUH 1WAAA 5BVJA 1SY6A 3ILPA 1KIPB 5DJCA 1FIGH 1KLUB 5FYKD 2CDEB 1RD6A 4K94L 3B9VA 4LLWB 1GC1H 2NTSP 1JGUL 3F65A 3MLRL 1DQQA 4ZAKC 4GS7C 3SE4C 4J23A 2XYCA 2XKNA 3QNYA 3MFFB 3HZVA 3CD4A 3QIBA 1ZHBB 2EKSB 1ZHNB 3KPSD 5C07A 4Y4KC 4MSWB 3AFLA 4NKQB 2KQNA 2FZ3A 1DBBL 3MA9H 3BWAA 4MDIB 2NW3A 5DJ0A 5KVDL 3O3AB 5CJQL 4P4KB 3RWDB 4OIIL 2MHAA 4OCSH 4H26A 3RGVC 4Z7VF 2ATPB 4H25B 4NT6A 3FAXA 3Q5YA 4MLIA 3T65B 4XCCL 3B6SB 1NKOA 3MRHA 4NRXB 1UVQA 5CAYB 1NMBH 4W6YB 2BOBA 3L3KA 1DEEB 3OR6B 5T3ZH 3C60A 5E6ID 1KJMB 2AQ1A 4WEBL 2AVGA 4F8TA 3QDME 4PJAA 5JHDA 4X6BB 4P0DA 2HG5B 4UT6H 2IPTL 1H0DA 1YEDB 1LO4L 1T5XA 5EUOF 4HZLA 3TYFB 2LABA 3OBAA 3GSWB 4KRPD 3BMVA 5C0DB 3GJFA 3O6MH 3O6FB 3P9LA 4TTDC 5FDWA 2FO4A 4NOFA 4QRSB 4KHXH 1OTTD 1QD0A 3HE6C 4QXTA 4WEMB 3IF1B 2RIKA 4PJ8C 2ZCLH 1MI5A 3TO4D 4NKIL 1KN4L 4LCYB 1A5FH 4Y4KD 1A7NH 3FONA 1WWBX 4P2QA 5I76A 1OAKL 4HK3N 4RFEA 1NLDL 3MZGB 1FRGL 1OGAE 4G8IA 3QIWB 5DJXB 3B6SA 4AEIH 1KYOJ 3C8DA 4XHQA 2CIIA 3RU8L 4H25A 2OL3L 5JXAH 3W2DL 3RWDA 1BOGB 4NC2B 5F7YC 2HMIC 3OHXB 3LKOB 3FB8A 5DR5H 2VZUA 4GW5A 3C08L 4LPUA 1PAMA 4N9GA 2Z31C 3UTTD 4WI9A 1PKQB 2PETA 2UZIL 2V7HA 4S2SB 4S1SH 1X5LA 3KXFB 4QGYA 4M5YH 3MUGA 5E1HB 3U0WL 3GSRB 2R0ZH 5HGDA 3PWLA 2OZ4L 3O2WL 4U7SA 1A6VH 5E5MB 2NY3D 4HKBB 1NJ9B 3DSFL 1QLRA 4MQXD 2Z35B 1N4XH 2BNRB 2IAMB 2PTTA 3BP7B 4ZFZB 4Z7OE 1ND0B 4NOBA 5EIQA 4YEFA 1R5WA 3MO1B 1N0LA 2EH8L 1X7QA 3CK0L 3D5OF 3OAUL 4JGMA 2P8LB 3QB7C 3BRDA 5C0RH 3RZCD 4KHTH 4HXBL 1KFAH 4M93C 4S0SD 4L8SB 3MJ8A 1G7HA 5BO1L 2X4SB 3WNOA 4F7EB 1AXTH 2AJVL 4LPXA 3O8XD 2P5EE 4Z5RB 4PRPB 1T04A 3HNTH 3LOWA 3MV9B 1JPSH 5ACZB 1MREL 1EMTL 4PLJD 3TFKC 1MOEA 1XMWA 2AV1B 1CN4A 1UKTA 2XA8L 2ARJB 1QA9A 4GRWE 4S10A 4DZBA 1FC1A 1FNHA 2DKMA 5IB2A 4M8QB 3S35L 5I1CH 5I8EA 4PV9A 4PJEE 3IVKA 1D9KD 4ONGH 4K3HA 2FIKA 4WWKB 5EORH 4XC3H 4K8RL 1UM4L 1CE6B 3K8KA 1BD2A 3QUZB 4TVSa 2VN4A 3SKUD 3RWHB 4YDJA 3DETC 4MCYA 2R2BB 2XZAH 5CMAA 3IJYA 1NFIA 4X7SL 4B50A 1ZA6B 4I48B 3D39D 4OT1L 4U6XA 2A1WL 5D71H 3EOTL 3ULVH 3GSUB 1CIUA 3O6ML 5DUMH 4OZHF 3L95A 1XGYL 1LNUA 3PQYD 5D96C 4P4RA 3U82B 1CFSA 3PGFL 4ZXBC 3MJ7B 4WDIB 3F7QA 4NQXA 4JFFA 4D0CA 3LRHA 4MGXA 3P4NB 5HHPA 3KLSA 2XY1A 5JW4N 5FHBH 4LARL 3C5SA 4QHUA 1E6JH 3MRDB 2QADC 3BUYB 4QRTB 5CZVL 3L3IB 2P48B 1NAMA 4PREB 5FUZL 3D3VB 3I3DA 4GQ9L 3ROOB 3M45A 1A7RL 3CPLA 5EU3A 1CDYA 1XIWA 5BZDB 1U8HA 4YPJA 3C2SA 4RMTA 5IESL 3DSNA 3KPTA 3HPJA 1CICC 5DHVB 1ZWIB 2WAHA 4CVWA 3MV7E 4LOUD 3W11D 4P5TB 4FA8A 1BP3B 5IM7A 3HRZA 2IQ9H 2GTWB 1CFBA 2YWZA 4JREB 3ESVF 1OPGL 3O11A 1U8LB 2I24N 3B3IB 4XWOD 5DQDL 4X7CC 2NQCA 3H9HA 1MFEH 3AUVA 2NXYC 2DDQL 3PDDA 5I1EH 4MNQD 4WCYH 1A1NB 1XF4A 3F5WA 3TA3B 2XQYG 1DN2A 3BDXA 3C2AH 3X14B 4DN4L 3FMGL 2M8XA 2WM0A 4FHBD 3UEZA 3DUSB 1I8MB 2E7LA 3RP1A 4XNMA 4RX4A 1A6UH 3O2WH 4JY4B 3RIAF 1MH5A 3U7WH 1WTLA 3DPBA 4OV6F 4GT7A 3RGHA 5GZND 1XGRB 3U48A 5HYJB 1DEDA 2BJMH 1OAZH 4OZHB 1MY7A 2DLTA 4RFOH 5CEZE 2UVFA 2MQ3A 3TV3H 3IU3B 4JM2D 3BRFA 5BW7A 5C09A 4XRCA 1UZ8A 5EU5B 3C5ZD 1JHKL 2FIKB 4WWKA 3GHBL 4UU9B 1I7UA 1A0QH 1V05A 1N2RA 1OARL 2FH8A 1J18A 2AEQL 3O9WB 5EC2A 3RWFA 1IRAY 4GUPA 4XPTH 3H9SD 1YEHH 2GHWB 4QF1B 1DBMH 1NC2D 1W72H 2VE6B 3K74B 32C2B 5E2UH 5D93C 4ZTPH 3OKOA 4I4WA 3P9MB 1UYWH 3WIIH 4HMDA 4ZUTA 1KPUB 3ARBC 3REVB 1FNEA 1R5VB 3SE9H 2JJTC 3FTGB 3MA7B 3SOBL 2J8HA 1E4XH 1V7NH 1MLCA 1J88A 3E6HA 1RURL 3C8HA 3KR3L 2DIBA 4LLVA 1F02I 4PRAA 1AQKL 5FGBC 1KXQE 3C09C 1J05A 3W81A 5MEOB 4YHPB 1BLNB 1P53A 5B3JF 4Z7VB 1A4KA 3BO8B 2BNUA 5JR1H 5C0IB 3QUMB 1MCRA 5IOPA 1EO7A 5EBLA 4O02H 3O41A 1Q72H 1MCDA 1MEXH 3DXAD 4HIJA 2NMSA 3BPOC 4OCYL 1JRHH 1UEYA 3T4AB 3KNBB 1I4FA 1D9KB 4TOYH 5FGRA 1NAMH 1C5CL 2CDGA 2CLRA 4FTVD 5DEZA 5E9DA 2WBJD 1T7VA 1WV7T 2XZZA 1GAFL 3MLTB 5MENB 4KGLA 1HKLH 4U1GC 3FQUB 4U49A 5CHNB 4X7EC 4RIRA 1JGLL 4JHZA 4DKAA 4U33A 5ABDE 3M8OH 1AY1L 1JV5B 1CVSC 5IT2L 3IDIB 1S8DA 2ED7A 2APFA 4P46B 1QEWA 4P9ML 4Z8FL 4G8GA 1KNOA 2BMKA 4H0IA 1NEZA 3U0TB 3EIFA 3LV3B 3MYJB 1D6EB 2I9LB 3RUGF 4OFKA 3U4BH 4C58B 4HFWB 3VFOB 1OL0A 3UJTH 3SE8H 3UC0H 3V5HA 4QRRB 4XMKL 2W91A 3V95A 1BQHG 3SKNA 4HX1A 5T3XH 3HS0B 4JRXA 4NUJA 3I9GH 1CE6A 4HLJA 3WEXA 2VIRA 5ESVA 4PG9A 1RULH 1X5YA 3VA6A 5I8CA 2BCKA 1Z9SA 2OR7A 3NACL 1AIFB 3UJJH 1TETH 2VDLL 2GW5A 1PBYA 1IGMH 4FQIH 5DRNA 5H8DA 4D0DB 3FT3B 2AW2A 4IBLT 3T65A 5TE4L 5D2NA 2DJUA 4UTAH 5AUMA 3PF2A 4ZNEE 2XPGB 3T0DA 1Q9KA 3KYNB 3ZL4L 4Z5RA 1ZXQA 4G3YL 4WWKD 2N7AA 5C0EA 2OXHA 2QR0A 1C5DB 4M02A 4XMPH 4XVUD 2F19H 1HHHA 1A64A 3NTCH 2CUIA 1NCDL 4MA8H 1MRFL 2VJXA 5KOMC 2EKSA 1RK1B 3QIBB 3TZVC 5GGTL 1JFQH 3MXVH 5D7IE 2DS4A 4Z77A 2X1PA 1YEIL 1OM3L 3UPRA 1WICA 1OD7A 4R97C 4TNWF 4ZPTB 3QCVL 4LOUC 4KRPB 2CLZA 5FYJU 5IMMA 2EECA 3WN5B 5EZIH 5GS1B 2G75B 4L3AA 4S2SA 2E7LC 1S7VA 1RHHB 2APVA 3TO4A 5ISZA 4N8CL 3PWVA 1RUKL 1KB5L 4M61B 4YHOH 4DUVA 4H88L 4JPIB 2ZUSA 4BZ1L 3ZSTA 5GSRB 1PDKA 1T0NB 2VLKE 5E7FA 4HG4K 1X5ZA 1LEIB 4XNYH 3BUTA 1NLBL 3QUYC 43C9A 3CFDA 4J8RA 1YUHA 4LDLB 1H3WM 4ZQKB 2NY0B 5JW3H 1FHGA 5IR1B 5F9WC 1YA5A 5DJAA 4M1CC 3DX7A 2DQIL 4XVJH 2ZG3A 4IS6A 2QSCH 4Y5XB 2OX5A 4AENA 3K1DA 3O3EB 4AEFA 3QXDA 4P2YA 4U1KA 2RJMA 3AREA 2VOTA 1U92A 2R8SL 4Z0BH 5IJVA 4UIKH 3MRGB 3O6KL 3OXSA 2BVEA 2BHYA 3L5WB 3EHBD 5IHZB 3H42L 1NEZB 4PRDA 1KEGL 1KCLA 1S5IL 4MJ6A 2HJFA 2J2ZA 3T3MF 1Z5LA 2VABA 3QDJD 4PY7A 4NQDD 4G9FE 1K8IB 4PJAB 2DBLH 1CZ8L 3GB7B 5E2VH 1G7JA 4JRXE 1KJVB 1M71A 4I2XE 1JYWA 1QFUH 3V4UH 1ZMYA 2E9IA 1AKJD 4P99A 5E24E 4YBQD 3VXSA 1NMCB 5F1OB 5HJ3B 2NYYD 3SGEH 5M7QA 1XR8A 5GRJH 3CX5J 1YJDC 4CBPA 3O0RH 1U93B 1NGXB 1FL3A 3CVIH 4ZTOH 3QULB 2HRPL 5DT1L 3OV6A 5DMGC 3FOMB 2ZCHH 3C6SB 3SDDA 5E00B 1IZKA 1BJ8A 5A1AA 2I07B 4HJJH 5C6PB 4FMFA 4J3OC 3TPKA 1SJXA 4XCEA 1FH5H 3LQAC 5HYEA 3VFPA 1AGCA 3ULVF 1X6NA 5GSRA 5JA8B 2VLJA 4RAUB 2V5TA 4TTDD 4LLWA 3U2SA 2CGRH 5IIEB 2FL5A 1E4JA 4G8FB 1JF5A 4DCQA 1LE5B 2Y07H 4FQCL 4QLRA 2Y9RT 3QEQE 2CLZB 5IMMB 1KCKA 1HZHH 3SDYL 1KPUA 5IVXF 3HAEA 1EUUA 4WJ5B 5D70H 3PQYB 1YEGH 2UWEF 3UROR 2J8UE 3H9YA 2F5BL 5MEQA 4F9PC 4O58H 5I66B 1FC2D 1NSNH 2ZPKH 3AS0A 3OKDA 5HXMA 3SY0A 2CPCA 3QCUL 2FCBA 4PGZA 5J3HC 4KK8C 5H35B 4UT9H 4NC0B 3QJHA 4ONOA 3WFHB 2DQJH 5C09B 3LN5A 5I1KL 3EGSB 3V6FB 1CLOL 1KV3A 3IS0X 3UCRA 5SX4I 2ZKHH 3CXDH 2R29H 4PGDA 4NQUA 2E9WA 1IJ9A 4K7PH 5I8OL 5HYIA 4QYOB 3IFLH 1RQ5A 2EYTB 4H1LB 5F7HA 2VNCA 1S7UA 3FJTA 5DTFA 3RL2A 5C6TH 1JYVA 2XFXA 2MJWA 3GSOA 4GG6E 2HJFB 4LU5H 5J6HB 3HS0A 2X40A 1T1WA 3N1GC 4BZ2H 2ZJSH 2QSQA 4CJ1A 5IV2A 3BGFB 3PGCB 1YN7B 4XB8A 2OTWB 4MMXC 3GM8A 1PZ5A 4BKLA 2IGFH 4NRYB 3WUWA 4YFDB 3KPRA 4DZ8A 3AM8C 4G8GB 4M43L 2O5ZL 3BJLA 5TE7H 3PJSB 4NO3B 4GKOA 3RDTC 4Y4FA 5I30H 3O11B 1OAUH 4GH7B 1S78D 3N1PC 2GK2A 4PJXE 5H94B 3PWNB 1NDGB 1OLZA 4U1GB 3GO1H 3FO9A 3VGHA 1AHWB 1NCWL 2VWEE 3LY6A 2P5EB 1S7QA 3KJ4B 4K8RH 1T21B 3QEHB 2ENYA 2FBJL 3FOLA 4R2GD 4S1DC 2A2QT 4GBXB 3HPJB 5CBAB 4AL8L 4G43B 5GGSB 1LEIA 5DQJA 5ANMB 2BFVL 3RTQD 4JM2B 2QQKL 5F72S 1RUAL 4MLSA 3GI8H 2WLZA 5EA0H 4Y88A 5GGVL 3VXTA 4UB0L 4XP4L 4S11A 2BVOA 3SDCB 2J7LA 5A2JH 1KTDB 3JWDC 1T83A 5GRVL 4QRPD 5HHPB 3TJEH 3QIBD 3WD5H 1VFMA 1KFAL 5KG9A 4WIQA 2Z0BA 1FZKB 3OPZH 1ODAA 3TBYA 3ZTNH 1XCQB 4Z7VE 1AKJB 1ORQB 1H5BB 3DSFH 1AR1C 4PJAF 1IC7L 1OAYH 2YD7A 2HN7A 5F21B 2OZ4H 3AVEA 1Q0YL 5E70A 4ZAKA 5HHQA 3OTTA 4AT6B 1AHWC 3LD8B 5EZIL 3QXWA 3CU1A 1LEKA 4S1SL 1ZLWH 1HSAB 2BSED 5K9KB 5EBGA 3HRPA 5DI8B 3RHWF 4ZO8A 4NJ9L 3L3HA 5MENE 5GGTH 1CD1A 3OAYK 4ZOEA 3LDBB 1S5HA 5JUEL 3U1SH 1VGEL 1HXYB 1KEGH 1CQYA 1UACH 1I7TB 5EN2B 3UTPE 1CXEA 1S78C 4BELD 3PHQA 1G6VK 5AYQA 3VI4F 5EOTB 4Z7WE 3MLVL 5TPWH 4OGYL 3B83A 5C0AB 3MJ8B 4NQDA 4HCRL 5F3BA 1M4KA 5CFHA 1NC2A 3O9WC 3QZWG 1KNOB 2BMKB 2DIAA 4OCRL 2BRQA 3MNVA 5J1AA 1BQSA 4ZFZA 1FZJA 2Z35A 3PWPE 4G7YL 3WUWG 4A6YA 1WT5A 5GSVB 4BK5A 3AB0B 2BVOB 1UZ6F 3B9EA 5EUOB 4KJWC 1NGYB 3FO2B 4QRRD 3LB6D 5T3ZL 3VXOB 1PG7X 2CRZA 2V2TB 3AMKA 1WF5A 2Y6SC 3WHXA 1T1YB 5FO7B 1Q9LA 3SGEI 2IEPA 5TE6L 1RZ7L 4LCUB 1I4FB 3KNBA 1CQKA 4WI5A 5KVDH 1WJ3A 3K46A 4EN3A 1BM3L 2PNDA 5E8NA 4PD4J 4XCFL 4NO5A 1JHLL 3KDMA 4FQLL 5F1SA 4MA8L 5TGBB 3DLQR 3TT1L 3KYOB 4WFGD 2EDBA 3IF1A 4XMPL 4QXTB 2EO1A 5DZLA 3DRTB 1AO7B 1F45A 4G5ZL 4NRYA 5GGRA 1MLCB 4XNQB 4PG2A 5FM5O 1WIOA 1FO0A 1NBYB 3ORJA 1U58A 3NCCB 3NCYS 2A83A 4LKCA 1G7IA 1T1WB 5SWSA 2XZQL 1KELL 5C86A 5C07E 4WDIA 1XGTB 1Q94A 4L9LC 3U6RB 2HWZL 4FP8L 1N7ML 3B5HA 4N1EA 1JF6A 4DFIA 4TN9A 2ZOKB 4JQXC 2EZ0D 1X5AA 4UIMA 3W9EB 4FFWC 2EIEA 3L3JB 4PJGA 3EJYD 2X4QA 2EYSA 5JO5B 2X10A 4LVNB 2AAVA 3QRFM 4PB0L 2VDPL 3QDGE 3DV4A 4H1LH 5KS9E 1J9CT 1UZ8B 3VFTB 3KPPB 3RTQB 5L2KB 5BRZA 2VXUH 3W9DA 1KTKE 1TPXC 3NCBB 1UJTA 2DQDH 2UZYB 1I7TA 1T2QL 3UJIH 2IG2L 4HD9A 1CE1H 2A6DB 4WI8A 3MLVH 1FSKB 4P5MA 1PSKH 3W9EA 4APQC 2DMKA 4JFDA 1TTFA 3SBWC 2A38A 2XKNB 3LRGA 3CVHH 2ARJQ 5FA3A 3A6OA 3VFSB 1V7ML 3MACH 3C9NA 4M6OH 3KWWB 3V79C 3EKCA 4ODSH 1KJ2L 1S9XA 2IADA 4F7EA 5L6YH 1CLZL 3HB3C 3VRJB 4ZD3L 1AE6L 3TV3L 2EXYD 3MGOB 1KLUA 5HPMA 5MHSD 1QVOB 3OWEA 3Q6FA 4U1NA 4FQ1H 3MRIB 3NFSL 1ZKAA 4IOIA 3EDJA 4J4PA 3MJ9H 5GRUL 3SKOA 4XCEB 3DV4B 3KS0J 4P23B 4BFGA 1U91B 1G6RH 5E5MA 4PJIE 4X6CB 4CNIA 3ZE2E 3IDYC 3L3JA 1BHGA 1ZTXH 1IM9D 4EIGB 2BOCA 4XGZB 3IAQA 3VXUA 1KTDA 2GJ6B 1AQKH 4XPFH 3C5ZC 2Q7YA 2W9LA 3UMTA 4GW5B 4R90L 5FF6B 4HCRA 1NGPH 4P5TD 4HC1L 5HTSA 4RISL 2ZSVB 4FS0A 4XP4H 2P1YA 3FZUC 3VXOA 4KKNA 2NW2B 3TT1H 4KRMB 2J4WH 4LLQB 5C0FB 3GI8L 3QEHA 1RIHL 4LSVH 5AG9A 2QQKH 3DX9A 5FKPA 3A6BL 1KIQA 2NPLX 4HZAA 4FMKA 1HNFA 2V17L 4PTUB 5DHVH 5I71C 5C0BB 4WFHD 1SYSB 4QRPB 3P0VL 2XZCL 4NNXB 4KV5F 3EO0B 4WFEE 1HCVA 3MV8E 5GGVY 4DEPB 2YA2A 4MJ6B 5D7IB 5DHYA 5IW1A 4R7DB 4JKPH 2AEPH 4JG1H 3MGTA 2FSEA 1F11A 4PB0H 4ZYKA 3DX8B 4KI1A 2FH6A 4OF3A 1Q0YH 4Z0XA 1KOAA 3C6LA 4L4VB 1WTGT 4IS6B 4QHLB 1NMAL 4LNVA 1QPXA 5DFVD 3MV9D 5JZ7C 2EDOA 3WHE0 4R0LB 1YJDL 2AV1A 2P24A 4NO2A 4WCYL 2WINA 5CS7A 3CFDB 4J8RB 2EXWC 4L3ED 4GLRI 1B0WA 1HSAA 5C09D 1OCWL 2NNAA 4P2OA 4WHYG 4ZS6D 5FGBA 5FCUH 3L5XH 5IW6B 3TA3C 3CXDL 2XTJB 5HI5D 4E41B 4JFHD 1NC2B 2CK0L 3DI2B 4U1JB 5J56B 1A9BA 1RIUH 5JHDD 2JJTA 4X4ZA 2DQJL 1VGEH 2IBBA 4FQLH 3MFFA 4HFUL 2C3XA 3H9ZA 2QKIB 3BKCL 4PGEA 5KAQF 3GKWL 4Z77B 3UPRB 2BNRA 3BP7A 2E6JA 5B38G 4YBLC 5BS0E 2AJZB 3BISA 2R2CA 1KSRA 1MELA 1ZLSH 4PJ7F 4O58L 4JLRB 3NCFB 3KXFA 2EEBA 4PJIA 1KEMH 2FL5B 4KDVA 5DJCB 3ILPB 4N0UB 4B7IA 4KJQC 2ZCKL 1AGFB 3D3VD 1OW0A 1U8NA 3EYQD 3GIVB 4NP4H 1VFOA 3MRLA 3LEXB 2GT9A 2VB5A 3ZHLA 4WO4A 3RWIA 5FOBB 1KN2L 3LZFL 4JO1L 4Z78A 4PBVC 1JWUB 3VMOA 4G8EA 3FT3A 1URLA 2W60A 1FH5L 3ZYOA 3X3FH 3U36A 2PKDA 3O2VL 5J9PA 1Q1JL 3RPIA 4OCRH 2H2PD 3EOTH 2XKSA 2Z91A 1NFDE 2PUQT 5MEND 1IVLA 1UGNA 3HI6H 3OKKA 4JZNA 4AIZB 2FDBP 4X98B 2AJYH 1R3HB 5FDWB 3GRWL 4IDJL 2B39A 3RZCC 3MCKA 1I7ZB 1LO0L 3QNZB 5C92A 1UM4H 4KKCC 2DLEA 1JWSB 1OOAA 1MWAA 4OZIB 3CC5B 1QP1A 1J0YA 4MNQB 4PJCF 2JIXB 1OAKH 2J12B 4XP5L 5C9JB 1EMTH 1MREH 2ESVB 3EJJX 4IMKC 1RUQH 4J3UA 1MIML 1U8KB 5LGHL 4EXKA 3PQYE 5FB8B 2IALB 4PRDB 2Z31D 2X4PA 2HJKA 4JRYA 2GY5A 3RJDA 4NCC1 5F1NA 4FQXD 4PJ7E 4U3CA 2W0PA 3MBEC 1T7WA 2DICA 2YXFA 5T5NG 3PHOB 1HZHL 3JWOL 4U1KB 4UV4H 5KSBF 4LCWE 3BRGC 3VFWB 1KPVB 3QXAB 2IBZY 5J13B 4Y2OA 1P6AB 3I50H 3TPUB 1U8OB 2Z8RA 1F58L 3HI1A 1S9YB 4P23C 3T4AA 5TDPA 4WGVB 5DJAB 1A02N 1MUJA 3EJYC 4XP9H 5IOPB 4G6AD 3RWJB 1QACA 2XWJB 4KMQA 1NMAH 4MJ2A 2GK0B 4PJCA 4JPIA 2NLJB 2BNRE 4GG6B 1WWAX 5B3NA 3HG1B 3O0RL 5IBTL 2OL3H 2XN9D 4IMLB 1BJMA 2FB4H 3ES6A 3FB7A 1QKZH 4G42A 1CDGA 4XP1L 3VWKD 1FN4A 1U41A 5E6IC 2D7QA 3KPSB 4EQ2A 2E8ZA 4YXLH 2WBKA 3ARXA 5I18L 1L9NA 2R4RL 3C6SA 4PRPE 4NKIH 2IPUK 4IIQB 5JXEC 4WHTA 5CGYD 3C8KA 3KPNB 4G6ML 4XHJD 3TBSB 3W9DB 3HAEB 4FG6D 4WJ5A 3E8UH 1K4DA 4WV1B 1LO4H 5IB3B 3LVEA 3N1MC 4LSUH 1DLFL 2GSGB 3IDXL 1NGPL 4DCQB 5D2NB 1AO7E 1GGYA 3IDMA 3ILQC 1ZGLM 3LB6C 5DLMH 4B41A 4NHCH 5D6CA 1BAFL 2IFGA 3DV6A 4WEBH 1J87A 3CGTA 4OI9A 1HKFA 2FEEL 4L4TE 5IVNA 1C08B 4TUKH 5DT1H 1PQZA 4HHAA 1F3DJ 2PYFB 3X3FL 3O4LA 2VDLH 1LK2B 1S7XB 4X7TA 4R96A 2FECI 1GVIA 2HFFB 4ODHL 4F15C 4XBGA 3QCTH 1JIBA 5IQ7H 4JZJA 1FO0B 1WFTA 4XNYL 3QULA 5IBLD 1GGBH 3TCLA 4FFZH 5SV3A 1U3ZA 1CFNB 1GGUA 1U0QA 3HC3H 3KPMB 4KK6C 4LLUB 4PJIF 3EW3B 4F7CB 1QUNA 4OM0L 3DETD 1YPZB 1T7YA 1TZHB 4A2LA 4NKOB 4M6ML 2EE9A 1NUNB 5ACMA 1TJHL 1B9ZA 3OB8A 1P69B 2VLKD 1JGUH 3BGMB 3KLAB 1OTSD 5HY9A 4S1RL 43C9B 5DK2A 4HUKB 2B20A 5E9DB 1L7IL 4PLJC 2Y07L 1F2QA 2EDWA 3E2HB 3TFKD 1OAQH 5LGJB 1K3ZA 5E03A 1UM6H 1F6AA 3WBDA 3GSQA 3CPLB 4MVBD 1JVKA 1NANH 1SBSH 2WWMD 4YHLH 4X5LA 2XTJD 3L5XL 1IT9L 3C87A 3EFDL 3CCHA 2AABH 4HT1L 4MAYB 4RGMB 4A6YB 4RMWA 4XAKD 1KG0A 4G7VH 5D6DA 4XPFL 3BPNC 2B8OT 4WVRA 4NZTL 3F58L 3MRBB 3THML 1JHTA 4JZJC 1G9MH 1ZT7A 2WZPD 3I6GB 2W59A 3UX9B 1G9ML 3L5HA 4RWYH 1B4RA 3WS6A 1N59B 2GUOA 5GRJL 2GI7A 5CUSH 4U6YA 2XWTB 4K2UL 2ICWB 4ZOAA 1MFBH 1I9EA 3DMMB 1PZUB 5GRUH 4MXQD 5GGRY 1EEYB 2Q3ZA 4DOHE 2QR0B 2VR5A 3R8QA 4UDUA 1T0NA 4MAYC 3UPCA 2PO6D 4ZD3H 5TF0A 4CL7A 1IGCH 2YPKB 3PV6A 2LQRA 1IM9B 5IW3A 1TCRA 1OAQL 4P4KD 4KJYB 1YEKL 3A67H 4ZPTA 5DC9B 5ALCH 1BM3H 4H8WL 2Y1VA 4JFXA 3VH8G 5IJKA 5BVPL 3MC0A 5ALCL 3F7YA 5C0BE 4PG9B 4K07A 3DGGA 3N06B 3PP4L 1KLGB 2DTML 2GAZA 2V17H 1BQHA 4XRCB 4OLVL 3OKEA 4LSVL 3UBXG 1X44A 3TH3T 2FEDD 1DLHA 3EYVA 2XWBB 5EC1A 2X44D 4HFWA 5JDSA 1FAKT 4HK0B 3CFEA 1DLHB 2GUOB 4FQJH 4KUCF 3I75A 4O4YH 5ITBH 4KRPC 1ITBB 2GAZB 4GO6B 3TP4A 1L7TL 4JDZB 4BSWB 1EIBA 1QFWL 4WRLA 3T0WA 4OLYH 1BZQK 4CVUA 4LCIL 4HKJB 2IQAA 5D7KE 5I9QB 1L9MA 4NWTL 2G2RA 5J13C 1A22B 2JK5A 4Q6IA 3HNSL 4DN4H 1HN1A 4NZTH 5CWSB 2QSVA 2QSTA 3LN4A 2XZQH 2CDGB 2CLRB 4FQXB 4HBCL 3KR3H 1IBGH 3OHXA 2OSLA 1T66D 4HKXA 1P7QD 2NX5E 2K3TA 4HDIA 4GBXD 5CILH 4JRWA 1MHEA 3FN9A 5CBAA 4PS4H 2Z8VC 4LSQL 5CJ8A 4JKWA 5CIPB 4C83B 4MYWB 5FK9A 1N59A 2EH7H 4PJDF 3CUPA 4M6OL 2OL3B 3X12B 4UNUA 5ESAB 3TF7C 2EH7L 4LCCA 4S1RH 5E4IA 2BERA 5E56A 3B2UD 4CW1A 3BZEA 3HZMB 3FQRB 4BFIA 4XBPA 7CGTA 2D7NA 2P8PA 1KTLA 4DZ8B 4G80B 5HDLA 3KHQA 3DYPA 3UJIL 4QHKJ 5CIPA 4EEEA 1WBZA 3OB0K 1U8PA 1BVKA 1GZPB 2DIJA 2QHRH 1HYRC 3SHSA 5CUSL 1LK2A 4UTBL 1C12B 5J6HA 4P2RD 3O4LB 3BP4B 4JFFB 3NZHL 3QPXL 2MNUA 4FQIL 5ERWA 3AMLA 1NGWA 2FR4A 2Q7YB 3LN4B 4OBRA 3Q5TA 4X83A 1ADQA 3T0EB 3U7WL 4X9FA 3CFKA 2G2RB 3FQTB 4G9FD 3O2DH 3HUJF 1ZS8B 5SX5H 1UWGH 4QWWD 3VG0H 1BD2E 2Y72A 4F37F 1CR9L 3S5LA 1B6DA 4TSCL 4YDKH 4HCRH 1TZHA 4HJ0C 3GSVA 4WV1A 4Q9CA 3EZ8A 3EYSL 4ZO6A 4NRZA 4K9EL 5DD5H 1MCHA 5HI3D 1EA9C 4DN3H 3BDYH 4POUB 1WZLA 4GAYA 2BFVH 1CDIA 3WYRA 1UXWB 3ULVE 2FLRT 3ARTA 4JFZH 2F53B 4DJMA 1S9XB 5IHUL 1ACZA 1ZSDA 4WEUD 2F5AL 5C0AD 1I9JH 3LPGA 1UKQA 3SDCC 5KSAC 3QSKB 3SDAC 1W72B 1PEWA 4YO0B 1MJ7H 3I3BA 4OM0H 3UZQA 2YPKA 1DTUA 1KIPA 4OJFH 1D5BA 2R1XB 3V7AG 2R56L 3GIZH 3EDDA 5JDJA 1JRHL 3WS3A 5JOPE 3IGAA 4U1MA 5F7LB 5EO9A 4M6AA 1BFVL 2IAMA 2PTTB 1CLCA 3VW3H 2ADIA 2VKXA 4RAVA 2JE8A 1DQLH 3HI6L 3A0OA 3HRZB 4IIQA 3SJVE 3TJEL 2P5ED 1K8DB 3G5YA 3VXMB 1ZGLA 2IH1A 2CSPA 1RAMA 1VFBA 5C0CE 3G6JA 1E4XL 1V7NL 3LEYH 1F97A 1ZANL 5DJ2A 5I1IH 4PJDE 1ZOXA 1SEBB 1YQ2A 1L7IH 3HHRB 4CMMA 2VH5H 4YAQA 3RVXD 3UTPD 5CLTA 3N1FC 4FZEL 5ILTL 3QIUD 3RUGB 1AXSB 1AO7D 2BC4B 2P8PB 3GSQB 4U3XA 3SDCD 4RRPA 4DTGH 4YHIA 2YK1L 4LSSL 2ERJB 3ZHKA 3MJ7A 3S35H 4ZSOA 3NFPB 4L8DB 3L95B 3ZKSD 3BE1L 1ETZB 4PGBB 3VFGL 4JN2B 1W8NA 1C1EL 4PJAE 4XP5H 5BS0B 1NFIB 4GQ9H 4P9HH 5IJVB 3T0BA 2YC1A 1OTUD 4HPYH 2X7LB 1T5XB 3W0WA 4YX2L 3WFEL 4X4MA 2E6PA 2ZJSL 4BZ2L 3OJDB 4Y7MA 2D0HA 4F58H 5FGCB 5D72L 1K85A 3GMOA 4NZRH 4DK6A 2YUVA 2Z91B 5CWSA 5HYFA 2BOBB 5L2KD 4XBGB 1SEQL 1H3XA 3VRIA 3O8XA 4ETYA 2UYLA 4LGPB 5D2LA 2VZOA 1Y18B 3OKLA 3VCLB 1H15B 1QQDA 1QO3B 2CLVA 3O3AA 4GAGH 3V0VA 1DLFH 2BVPB 4LVHB 1YECH 3GHEL 4M61A 1G7HB 1KN2H 3LZFH 1Z9OA 4OKVB 5HDQL 1KB9J 2QQNL 4UILL 4IOFD 5CZXC 3VGEA 3H6JA 3LKNB 4Y2DA 2MKWA 2R2BA 4PJ8A 1RUAH 5EO0A 3MXWH 5AWNH 4ORGA 3KPLA 3MLUL 4XP6H 5CEZL 4LLDB 1BQHB 1ND0A 1KLGA 3B2VL 3VDAA 3ROLB 5I15H 1F6FB 1NGQL 2LVEA 1F13A 3QWOA 4CVXB 3MLYL 5FA4B 4D8PA 1QR4A 5J06A 1CYGA 1XF3A 3BIKB 3PV6B 2YK1H 4LSSH 2C3VA 4XI5D 3WO4B 3GKWH 4GRLD 1UFUA 3LEXA 3WNLA 2EC9U 5ILTH 1TQBC 4K94H 3ZT7A 1E6JL 5E9DE 3ES6B 3FB7B 1GHFH 4OLEA 3VFUB 4OZ4B 5C0CA 2CGRL 1J0HA 1H3TA 1CGYA 3HN3A 2YN5A 3LMJL 4PD4K 4R0LA 4LSRL 1HEZB 2VLKB 3R4DA 1NEZG 4EOWH 2VAAB 3VMNA 5J12B 3P3YA 4LKXA 2DQUL 4UBDC 1YJDH 3L3GB 3BIAX 1OWRM 1DUYB 5D1XB 4LLDA 3FKUS 4JFPB 3KPLB 1MUJB 1RJZA 3DVGA 2GCYB 2R29L 3WIFB 4IRZL 2V7HB 5EWIL 3VXTB 2FATL 4P46D 5F44A 4MJ5A 4DQOH 5EDXA 4OD3H 3LKOA 1DQML 2EIZA 1R5IA 4DW2H 3K8MA 3LQAH 3DGCR 1H15A 1QQDB 5I75C 5DK2B 1MFDH 3IJHA 1QLEH 1BZ7A 4E0RA 4HWZA 2H32A 1KBGL 4NQVB 2HJKB 1CGXA 3HNTL 4FN0A 4G8IB 3BKCH 4XTRC 4HIXH 4F33B 3WL9B 3VU2A 4R8WL 4G9FB 4L4VD 3L5JA 2F5AH 5E99L 2I9TB 1W0VA 2OJZL 1D5MA 3HMXL 3PJSA 3BWAB 5T3ZE 4R0LC 2P45B 5DJZB 3RWCA 2VSCA 4M48H 3BYYA 1KT2B 1T2QH 2HVKA 3C5JA 5GJTH 4EVNB 5ANME 3GJFB 2NZ9D 4K9EH 4Y19B 3VFVB 1OD9A 5EBLB 4X8JA 1EAPA 5FHAL 4OF7A 4LLAA 1Q1JH 3QUMA 4FTVE 1X4ZA 1SJEA 4M5YL 2X09A 4U1LB 4R4NC 1FJ1B 4NZDA 2W0KA 3HUJE 5JHDB 5EPMB 3W39A 1NUFA 2YBRA 2H6PA 3UZEA 1AXSA 1BJ1J 2BC4A 4ZFOA 5CEXB 4MJIB 4BYHA 5D7JD 4JO3L 4PJEA 3Q6FB 1WGOA 3T2NH 4ZTOL 3EFFA 4YHOL 4KTDH 3L1OH 2W1NA 4QNPE 5DEFA 3RTQC 5ID1A 1NH6A 4X0KB 1S7SA 1AGFA 4HKZB 3QIWC 4M3JA 4MDIA 5HDBF 3U4EA 1WZMA 3WNNA 5DVKA 1ZLSL 2FZ3B 4MA3A 1J8HA 4S1DD 4X4XA 2C26A 3C8KB 4P2RE 4U7KA 2CO7B 3QCVH 1LO2H 3VXUB 4ODSL 3MLRH 3TBVB 1QLFB 5KVGH 1JUFB 4W4OA 1W0WA 3ESUF 3QWOB 1KIUA 1BBJA 1JHLH 1JFQL 1Q9OA 2OI9B 3RDTD 4XCFH 5INCB 3LPFA 5EU5A 4BQCA 3U4EB 2R0KL 2F19L 2WSKA 3QAZC 1P7QB 2RHEA 1H5BC 3O6KH 3BD4A 2IPTH 2PXYD 5H37H 2BSTA 3VJ6A 3DROB 5FYLE 4K8RC 5MI0B 1IBGL 5C09E 4C56A 5E4EB 1LP9F 3HPLA 5TE4H 5JORA 1XFPA 1AGCB 3JV6A 2QSCL 3KYMA 2C9AA 1Q94B 2WINB 4P2OD 3S37L 1JK8A 3F5WB 2R2EB 5ID0B 5CJOL 1RULL 3WCYA 4NKDA 3JWDH 5HDBE 5TF1H 5TDPB 3OJVC 3ZDYF 4HMCA 1K5NB 3OAZH 4X9GA 4XVTH 1HI6A 5IVXB 2DAVA 3WJLA 4EI5C 1XR8B 3GBNH 1T83C 3UJTL 3RVWD 1T66C 2O26U 3U4BL 5C2BL 5J3HD 1W0VB 1A7PL 1N64H 2I9TA 3S5LB 5JOPD 3RIAK 4KK9C 2LAAA 3N9GL 1OB1B 2WLYA 1ZA3B 1W72L 2EDJA 2X4QB 2OQJA 2L7UA 1QFWM 2QLVB 4NKMB 5IM7B 5FB8A 3HR6A 5IT2H 5BVPH 1D6VL 2CKBA 4YJZL 2F53E 3VWKC 5E8DL 2J6EL 3MRJB 3SJVD 2E7BA 3DXAA 4LL9A 5DSCA 1JI2A 1QTYT 4JQVA 3RA7L 1FDLH 5D1XD 3KS0H 1YC7A 3WHXB 1IGCL 5FKPB 4YXKH 3P11H 4CMMB 3OXSB 3L3IA 1TVBB 1NCTA 4E41D 2MPAL 3AS1A 4XNXL 4Z95H 5T1KB 4JFPA 1IEBA 2HT4D 25C8H 2R1YA 1RIVH 3HG1D 4K2UH 1ZVHA 1CFSB 2X5PA 4JFEA 3B9DA 3MRCB 4PJ5B 3CX2A 3MV01 4OAWB 4AG4L 2Z9TA 4Z7UF 3UTSA 3Q5OA 5E08L 2A77H 1VEMA 4N5ED 5DJDB 4RCAA 5KVFL 2ADIB 1OF2B 3ULVC 1RJLA 1QBBA 3MRLB 1MAML 3MUY1 3VFUA 3LD8C 1G7MA 2NYYC 5F6HJ 2F54E 5CD5D 4RGNC 3SGJA 2AKRA 3WDHA 2ZUQB 3MJ9A 1RZFH 1KBGH 5F7DB 2C3VB 4RGNE 1CBVL 3TVMD 3IFNL 1XF3B 4YPGA 1W0YT 4YO0A 5F7WC 4RAHA 1QA9B 1RU9H 3H7BB 5D5MA 1CK0L 4HLZH 3Q1SH 3KAAA 1ZT4A 4PLNC 5JW4Q 1MRDL 4PGJA 3EHBC 3RVWC 5TDNA 2HT4C 5BRZE 1G0YR 1GAFH 1II4E 4LIQL 3ZT5A 4GS7B 3R8BB 5HHQB 4HK0A 4RQQB 2A9NH 4M43H 5HHOA 3KVQA 1PW3A 2BJML 4RFOL 1FNGB 4PJHB 1JZ8A 4YDVB 2EIBA 4F37K 4UQ3B 4YDIH 3RVVD 3DGGB 3OKLB 5ICYB 5I1LB 2ZSWB 5FUCC 1S5HB 3B9KA 5ALBH 3VXUD 3LHPH 4I77H 5BS0D 3ULVL 5FYKL 5C6TL 3OKMA 3OF6D 3I84A 1C16A 5HI4C 3WD5L 4YHZL 5F7DA 3RX8A 4KK9D 1ACYH 1CXHA 3EO9H 5DD1H 5JIPA 4MNHA 4ODVH 4RGOH 1VGKB 5E9DD 3F7PC 2UUDK 2VXVL 4HUWB 2WQ8A 5EOCJ 2EIDA 4OF5A 4IMKA 1NAKL 2ITDB 4JR9H 1FZKA 4M9PA 4LCYA 3DO3A 3HNVL 4EI6B 2ITDA 4P3WA 2PR4L 3KDMB 3CMOL 3RUGA 4H5SA 3GO1L 1LO5A 5DDHA 4Z7UB 5FK9B 3FQNA 2F5BH 1SY6L 3T4YA 4L4TD 4MHHI 5DVNA 4C83A 3SDCA 4XVUC 3MLTA 5J11C 3TA3D 2H3NA 1UWXH 4WWKC 4N8PA 1OAYL 4ZS6C 1Q9LB 1A7BA 2J5LB 2ZUXA 5MERB 3VI3E 2OSLB 4W4NA 2EXWD 2XN9B 5I0DA 3RY6A 4NSKA 1GGBL 2IPKA 4O2EB 3DMMD 1ROWA 5IVOA 4PIRF 1J7VR 2IFFL 2IJ0C 4XHJC 3NIFF 2EDDA 5A40E 3RPKA 3JBG7 1AHWA 4X6CA 1IQWL 4CNIB 2Z31A 1RY7B 2K9UA 4HPOH 3SJVB 3JSSA 3GMPA 4MQTB 5GGVH 4PRAB 3QAZB 3O3BB 5C08E 4F7CA 4RRPG 5AAWA 4Q9RL 3K0WA 5KSBE 2R0LH 5KS9B 5T3ZD 4YHMH 1S9WB 4KI5C 3KPRD 4POZC 5I1KH 1FNEB 4KMTL 5L2JA 1DR9A 2NY5L 4MXWH 4LQ1A 1L6ZA 4WTZG 4WUUE 3LS4H 4OF0A 5CGMA 1KXVC 1IGIH 3CDGA 1ONQB 2XFXB 2VE6A 2R23B 3EYOA 4Z6AT 1A5FL 3MCLL 4TUOB 1MIMH 4AZ8A 4OCWL 5JQ6H 2OK0H 3FFCA 4YXLL 5D6CB 3QJFA 1JPSL 4XPHL 3SCMC 4BQBA 1A7OH 4KHXL 1BREA 4WO4C 2GSIA 4M4RA 4K71B 2O5YL 5FKAA 1XH3A 2LU3A 1F4WL 1QKZL 3RFZC 4AEEA 1QSEB 2X1WL 3U2SB 4P23D 4BFBD 1LILA 4J4PD 1ZLVK 3CFJA 1UQSA 4JPKH 5AD0A 2A73B 1QFHA 1GSMA 1IMHC 3RQ3A 1XR9A 4M1DL 2R8SH 3RKDD 5HYJA 1OF2A 3LEVH 5DMKA 3LKPA 3TESA 4WHTB 4PJGB 1HHGA 1ZS8A 4UMGA 2HT3D 1WCQA 4PP1C 4DKEH 1G1CA 3TBYB 5DJ8A 1Z6JT 1B6UA 1NGZB 3DUSA 1I8MA 4ZXBA 1B0RB 4FTVB 1FN4B 5TFSH 1JPFB 1CD0A 3T3PE 1IEBB 2C1PB 4RWHA 5L88H 4WHCA 4X6FA 5TDOB 3CLEH 3WE6A 1MQ8A 2BXZA 2VZSA 4XBEH 1DBBH 3ECBB 3HG1A 5TQ2H 3ARBD 3O4OC 4P46C 5EG6C 4UV4L 4MJIA 5CEXA 15C8L 3Q1SL 3HZMA 2ZPKL 5T1KD 1NSNL 4HJGB 4BFIB 4L29A 1FRGH 3ARWA 4MB5A 5I75B 4OIAA 4KJPC 4IDLA 2YZ1A 5HY9B 1MLBB 5ITFB 5E8NB 3QQ9D 4NQCE 4MMZC 4MJID 3SDDB 4P5TA 5D7JB 5HYSA 4RSVA 3FT2A 1TZIB 5F6HI 4NM4L 1S9YA 1U2HA 2IGFL 5B8CA 5IJKC 1AXTL 2AJVH 3VFWA 1PVHA 5D7SL 1I75A 4R6UA 3IFPB 4XCYB 3X11B 3BKYH 5DC4B 4RNRB 3GRWH 4F7PB 2EDTA 1UJ3B 3ALWA 3C5ZA 5B39B 5GISH 3OMZA 4K23L 4KGJA 4LCWB 3ZT6A 2X4PB 4LGRB 5JOEA 2VISB 4L3EB 1LWRA 3C09B 3RDTB 4L8BB 1CDBA 1RHFA 1RIVL 2X42A 3TIEA 4P4RB 1K8IA 1IGYA 3DBXA 3NAAH 1H3PH 3X3GL 3LKRB 3QDHA 3BX7C 4XC1L 2YPLD 4HIHB 1RJCA 3I75B 5DEGB 1PYWB 1FGNL 4JDTL 2K1MA 5K59E 1DQTA 3I9GL 5CJQH 5C0JA 1O0VA 1CF8L 1U92B 5HHME 2FGWL 4TUJB 1NAKH 4XMKH 2XTJE 4E41E 1V3MA 3P30H 2D0FA 1S7TB 3ZE0F 3V6ZA 4PJBA 5E2VL 3P4LA 1LE9A 4IJ3B 2DBLL 5KAQG 4PS4L 5JOFB 1U6AH 4P9MH 3SY0B 3FB5B 3PWJA 5FXCH 4FZ8H 5IR1A 1MF2H 3KPSE 5HYJE 1KACB 5ACZA 3LKPB 3RVXC 1FIGL 3F7VB 3RVUC 4OGAD 2GJ6D 4M62H 2X9XA 1DUZB 2QADD 5GHWL 3GMLA 4ZNEA 3PWVB 3JWDL 1ZVYA 2O61A 3V7MA 1LE5A 2R1WA 4G8FA 5MP6H 2ICWA 1CWVA 1OTUC 1JMXA 1MWAL 1CL7H 1JPST 3BEWB 3OKNA 5D7LE 1SJHB 3GNML 4HJJL 3FFCB 1MHHB 4GXUN 4WENB 1E4WH 4JQXA 5JW4M 1JWMA 3GJEA 2ENSA 2RGSA 3WFBH 3BPOB 4FQJL 1QBLL 4R7NB 3D25A 2OS7A 4L8SC 5CKGA 2VLJD 4NCDA 2OMBA 5HGDB 3SBWA 3AREC 4JCLA 5C0BD 1QHPA 2WUCL 4MXVE 4UT7L 3VFVA 2Q8AH 3QIUC 2YZ8A 2JIXD 3WXVL 2NY4D 4YHYB 1QSED 3BHBA 2ESVD 4X6DE 2QTEA 3DBXB 3VCLA 1BFSA 2Z31B 2OMNA 5KSAD 1K4CB 2YUZA 5FYKU 1KTRL 3T2OA 1K3IA 3WL9A 1PY9A 1YPZE 3CXHJ 1HDMB 4RFNC 1EEQA 3OR7B 2ESVA 3FONB 1UJ3A 4PV8A 3VXUE 3WIHA 3TBTA 1KUMA 5F1IA 3PNWB 2IPKB 3QHTC 4O2EA 4TNVF 1GCFA 4UIKL 5HVWA 1YY9C 4JJ5B 3V4VH 1RIHH 2BY3A 3CSYB 3EYUL 2VWEC 5CKAA 1YN7A 4TYUA 2YXMA 3E3QE 1XF2B 1OQOA 1Q9WB 1QFPA 4G7VL 2BSSB 3MLZH 5T1MB 4X9HA 4LPCA 3U9UA 1MLBA 5D1XA 1GGCL 2G9HA 3A6CH 3BEVB 3PNWA 2OP4L 1V8HA 3F8UB 1Z9MA 4WU5B