4N0YH

Structure of the hepatitis c envelope glycoprotein e1 antigenic region 314-324 bound to the cross-neutralizing antibody igh526
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
226
structure length
222
Chain Sequence
VQLLEQSGAEVKRPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGWINPGNGNAKYSQRFQGRVIISRDTSATTSYMELSSLTSEDTAVYSCARDRGFDLLTGHYLGLDPWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGH526 Heavy Chain
publication title Structure of Hepatitis C Virus Envelope Glycoprotein E1 Antigenic Site 314-324 in Complex with Antibody IGH526.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 222
sequence length 226
ec nomenclature
pdb deposition date 2013-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n0yH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n0yH01
1VCAA 1YZZA 3FL7A 4F58H 1INEH 1IGFH 3LIZH 1RULL 4CW1B 1A7BA 4QXGL 1H8SA 3WIHL 2VXTL 5A3ID 4TUOA 3LEVH 4RMQA 1TVHA 1RSFA 5TDOB 1S7WB 2VH5L 4V1DB 3JSSA 3BIKB 4PJGA 4KROB 4PR5A 4K3DH 3V4UL 3ARDA 5D7IF 4GXUM 5TE6L 3MOAH 1FIGH 2DMKA 5GRUL 5AAMA 5F93C 4NQXA 4MA1B 2D03H 3T1WA 3V5DB 4FQ2H 3S5LB 2GITA 2JJTC 4E5XB 4AG4L 1MCQA 3SGKC 5JLZB 2DQHH 3V0VA 1H3GA 3QFJD 5IBLC 4JREC 4QRPD 1R5IA 1REIA 3IU3A 4DKEL 1SJVA 4KRMB 4U05A 5FV2A 3D5OF 4NP4L 3EO0A 1CE1H 3ZTNH 1KIRA 5EOQH 4MXQC 3IFNH 1YY9C 2NW3A 4BQ9A 3NCJL 3TJEH 5JUEL 2OR9L 2HT2D 7FABL 5E8OB 3DUSA 3LS5L 2P5WE 1XF4B 4EQ2A 5E08L 5DJ0A 1KN4H 4YO0A 3EBAA 1KPRA 1ZHBA 3FT4A 4OQTL 4OLYH 1O7VA 2A9MH 4UMGA 4IMKA 1FG9C 3PG2A 4P59H 4Q9RL 1FVEA 1KENH 5T3ZH 2OCFD 5EZIH 5I1LA 4OZHB 4YDIH 3D87B 3QEGL 4PFEA 3QXAA 1WBXB 2Y06H 1WBYA 3RWFB 1YEGL 4JFQA 4MD0A 5C3LD 1SM3L 4ISVB 4HFUH 4V1DE 4B5EA 3LOWA 1ZHLA 4TTGA 2YRLA 3GGWA 3HI1A 5I8EB 1AO7A 4MA8L 4Z7OE 3MBEC 3TNMA 3UC0H 4I2XA 5EUKB 4NRXA 3NN8A 5DJXB 2NZ9D 3REVB 3ULUD 3AB0B 3I2CL 5J06A 3OAZK 1DBKL 4MLSA 4HGMA 4NQVB 3PHQB 4U1IA 2JJUA 4XCYB 4QRRE 3WFBL 1PW3A 1KPVA 1NANH 1FL3B 3KPOB 3MLZL 3T0BA 4QTHB 4G6JL 4XP6H 1DLHA 2YK1L 4OKVB 1K5NB 1M05A 4MNHB 4GKOA 3D0LB 3U0PB 3D85B 2Y5TA 1VKXA 4NKIH 2FBJL 5HYSG 4Q9QL 3GRWL 5EOCL 5I2IA 3SE4C 3DXAE 4KJYA 1D6EB 3F7QA 1AQDA 3L5WA 4HMEA 5KJRH 2JB6A 4IDLA 4XB8A 3HTLX 4PJAE 1C5BL 1G7JA 4RCAA 4ZOAA 1K8IA 4X4YB 3T3PF 5C7XL 3KYNA 2R56H 3LEYL 4IEFB 1TJGL 2DM3A 1UB5A 1D5XB 4XX1E 3FOLB 12E8H 3C2SA 4ZYKA 3S34H 3KPPB 1NGPL 5A16A 4RSVA 1G6RB 3WEXA 1I1RA 1AIFA 1YEJH 5BRZD 4PJDF 1QA9B 4R4BB 1BQSA 1NANI 3UO1L 3DX8A 4FTVB 5IJVA 3KS0H 1BJ1J 2OYPA 3UTTB 5BVPH 4N1EA 3O9WA 4YHNB 5JHDA 3L3KA 1SJEA 4ORZC 3MRDB 3HC4H 1D9KC 3HFML 4L3EB 1RZGB 4PJ9B 4OLUH 5C70A 2NXYC 5IB1A 3WFDH 5LWYH 1YQVH 1MFEH 5IV2A 3WNLA 4BELD 2FR4A 4DK3A 3ARFD 4K9EL 4I48B 3SE3A 2FEEI 1GCFA 4J3UA 5IMLB 1RU9H 3VFMB 3QXDA 1QBLH 1HK6A 4DUVA 3D39B 1L6XA 1YPZB 4NZJA 1JJUA 2DLGA 1JGUL 3EYOB 5HHOA 3VFSA 2FYYA 3VGAC 3V2AR 8FABB 4CN4A 3IJYB 2VXUL 1ZT4A 3KLHD 4BYHA 3GSNH 3MPCA 5DJZA 2J12B 4MNQD 4XBGA 3OTTA 1TZHB 1J1PL 5CIPA 4IDJL 3ARED 1YMMA 1KIQB 1H0DA 1NBQA 3LY6A 3QIUA 4PJ5D 1Z0MA 2OJZH 1NEUA 4TVPL 4R8WH 4LCWB 4XVSL 1CXEA 4EIGB 5C2BH 3V8CA 2C3HA 1UA6H 3TBWB 4NJAH 3UTTE 1QYGL 1HE7A 3UYRL 5D6CA 3RDTA 4X99B 1S7UB 1D5ZB 1MH5A 6FABH 5E2TH 5FUCC 5JOFA 3TGXA 3DYPA 3MNWA 2V7HB 3LN4B 2PYFA 4IOIA 5JXEC 2BVQA 3MRFA 4GUPB 3RHWK 1XAUA 1C5DA 1CZ8H 2NTFB 5ID0A 3H9HB 2M1KA 2AV1B 1PD6A 3P11H 4CDHA 4DOHE 3OR6B 4MDIA 1F4WL 2V2XB 1S78D 4MQXD 3CVHL 2CD0A 4NUGL 1UZ8A 1FO0H 1YPZE 1SVCP 3B9KA 4I5BA 4M5YH 4DCQB 1NMCC 5GGSY 1CD1B 4ERSL 1NKOA 4KUCD 2Y25A 4DZBA 4HEPG 1S5HB 2V2TA 1HDMB 1ONQB 4JANA 1B88A 2KQMA 4IRJA 4PJIB 3OMZA 2Z9TA 5ECJE 2R2BB 1JZ5A 4XWGL 3RTQD 3TYGL 3X13B 3B3IA 3U2SA 4ZO6A 2A6JB 1AI1L 4JE4B 3DARA 4JB9L 3OXRA 3MLYL 4O4YH 1DBBL 4NRZB 5HI3C 4W70A 4ZDHA 3MXWH 2R2HA 3C9NA 3NIDF 1WGOA 3KPRD 1I3GL 5IB5B 5CBAA 5CEXB 1OGTA 1IQDB 4W68A 2X4RA 4NO0A 4J3SA 1S9WA 3TVMB 3MRPB 1EEUA 2PTTA 4KVCL 2BFVH 4L9LA 4EDXA 4TSAH 1BREA 1KFAH 4AL8H 3EGSA 1KN2L 3PNWB 1WCBB 4LHUA 2HH0H 1MREL 1KJ3H 1XF3B 4YE4H 3BGAA 5F88B 4HWEL 1AHWA 4AZ8A 3RZWA 4OM1L 1SJXA 4CGTA 3M45A 3P0YL 4LSQL 5D2LA 4UTBL 4ZAKA 5CBEA 1X7QB 3JV0A 1UFUA 4JZOA 4NC0B 1DSFL 2VKXA 1EMTL 4PJHF 2E9BA 1MJ8L 3MA9H 3SKJL 4QEGA 4WU5B 2CKBH 2N4IA 3CVIL 4LLMA 1WAAE 4Q6IA 4KTEH 1VGKA 2UWEF 4K94L 2FJHA 3JV5A 2W60A 3UAJD 4K71B 1TQBC 5IOPB 2VXVH 2UZIL 3MBEB 4LEXL 2CDFA 5DQJB 1FFQA 1ED3A 2A77L 3GRWA 5L0QC 3ARUA 5SV3A 4C83A 5CD3A 3NA9H 3OKYA 4PJGE 5EIIA 1R6VA 4XNZC 2WP3O 1NC2A 2WW8A 5DJ6A 5A1AA 4OLXL 1ROWA 2I07B 1J1OL 2VZTA 1T4KA 2AKRA 1H5BC 3O6FA 1C12A 4PLKD 4G42B 1B6UA 4JO4H 2L7JA 4IOFC 4OF5A 3VXRB 4F7CB 5E2VL 3L5JA 5D93B 3UBXB 3T65A 1TETL 2LU7A 4TPRH 2V9TA 2Z4QB 1V8HA 4WTXA 2VLRD 4DFHA 1T7XA 4XMKL 3MV9A 1C8PA 1OB1B 3EYUH 3X3FH 1HEZA 2FSEB 3VG9C 2EIZA 2VITB 2D7TH 5ERWB 4YHMH 2G9HA 3DROA 3HG1B 2CGRH 4JO3L 4WI4A 4M03A 3QCTH 1KCKA 3PP4H 1IGYB 2HLFD 4I77L 3FQWA 4DVRL 2ICCA 5CSZB 4XNMB 3V6ZB 3MV7D 3QUMH 4DGVH 3TA3C 1T7WA 5E94B 3SQOL 2FJGA 5I15L 1R3HB 5F7YC 2EC9T 5IK3B 2W91A 4XWOD 5E56A 2DBJA 4K9EC 1ERNA 4LSTH 2GJZA 3U1SL 4MXVF 3FQRA 2E7HA 3DRQB 2APXA 3BZ4A 1AO7E 1WICA 3NH7L 3RPIB 2ICEA 5L7XH 4Y2DC 1YJDC 1QFHA 3T4AA 3HMXA 1MCJA 4NWTH 2ADJB 4M7KH 5CSGA 2Z8WC 3RVTC 1C08B 4OZ4B 1UM5H 1NCDH 1J12A 2CDEA 4Z0XA 2P5EA 2DJSA 2RBLA 2H1PL 3VXTB 2OL3H 1YNLL 2VZ3A 3BUTA 4XZUB 5EBGA 3QNYB 3FFDB 3B9AA 2FZ3B 2GTZA 2XXCB 2PCPB 2R1YB 2V5MA 3CFIC 3ZYIA 5ALBH 3OXSA 4X7TA 4P4KA 5JW4N 3VGAB 3ISWA 1QBAA 2IANA 3T0XA 1S9VB 3LSOB 4JFYB 5L6YH 1KB9K 1P84K 3GMNB 2BHUA 5EFIB 2ED8A 4Q9BA 1WK0A 4U7MA 3TCLA 1F8TL 1DVFA 2NQCA 4GG6A 1PFCA 2XRAH 1HSAA 3FOMA 2A73B 3K7UA 3GIVA 4CAGA 2AABH 3BH8A 3GKWH 3BJ91 2BY3A 4YR6A 2K1MA 4P46D 3IDNB 3M1BB 4HULB 4XVTL 3FB7A 5T1KB 4D0BA 2VUOA 3D0VA 5DD6A 2G2RA 4QT5A 3RKPA 3WJJA 3SJVB 4P57B 3TPUB 4PJFB 3DO3A 4ZOBA 1EUUA 4G8GA 4OGZA 4GXVH 4M43L 4TSCH 4LDEB 4FQIL 3FO9A 4KJQD 1OTSD 3O0RH 1WCQA 1NC4B 3L7EB 4OF7A 2YMXL 1MJ7H 2DLEA 3V52L 1ORQA 4R90L 2X4NA 2JJSA 4K7PH 4O58L 4JG0H 4OZFA 4HJJL 1RURL 3QNZB 4M02A 5DUPL 3KYAA 5JHDE 3JWNC 4NKDB 5C0AA 3TH2T 1MELA 4QOKD 5T1LD 4JFDE 1U8PB 5DRWB 2IPKA 5IROA 2FIKA 4FFYH 3ZT6A 3WLWC 1U8QB 1W0VB 1R5WA 1NMCB 3GMLB 4S1SH 4N8CL 2CRIA 5IVNA 3TBVA 4AK1A 2HAZA 4HSQA 2DQFA 5GIRA 3V7MA 1TVDA 5ICYB 3IJSA 4MX7A 5JQHC 1INEL 1IGFL 1EV2E 3LIZL 3BISA 1K8DA 1FGNH 5HHOE 1FL5B 1LK2B 5I74B 3LEVL 1FRGH 4A6YH 3EFFB 5C08D 3DX6B 4O02L 4AENA 4I3RH 4Z7VB 2VZVA 4RWYH 1R24B 5HDBF 1TVBA 5H94A 2O93L 1HHJA 3QUYC 4FQLL 3I84A 4Y4KA 3RIAK 5BW7A 3RAJH 5HHPA 1MLBB 5EU3B 2DWEB 2ZSWB 5IVZB 2WP3T 5DRNA 1YMME 5F89B 1OW0C 2H6PA 2WZPD 2FO1A 3RL1A 4KKBC 1T89A 5EN2A 1CFBA 5EZOL 5FUCE 1JRHH 4DN4H 4EUPH 3VRLF 2EDHA 1CE1L 1RUKH 2V7NB 2F74B 4U1KA 2BC4B 1G9ML 1U93A 4O2EB 5FGBA 1Q94A 5LCVH 4GBXD 5IUSA 2XNAB 3I02B 4K94C 3C8DA 1UM4H 1VACB 2NY5H 2BSSA 3QIWD 4KRPB 2XWTB 4U1JA 1BX2A 3ULVC 4HC1H 2AJXH 4MCZB 5GGTH 4OLYL 2A9ML 3H3BC 1T5XA 5KG9B 4C56D 5ACLA 5I0ZA 4RZCB 1I8MA 4P59L 1EO8H 1KENL 1HHIB 5T3ZL 4F7TA 1QSEB 1EUTA 3RGVD 3SDXB 2ZCKH 4YDIL 2Y06L 1TQBB 3QWRA 3VFTA 4A2MA 2NPLX 4LKCA 4P5TC 3LKNA 3EJYC 1S7SA 5J4MA 3SKMB 4JFOA 1KUMA 1A4KA 2J1KA 1OF2B 1JRHI 3MUY1 4UDTB 4XNZB 4AEIH 1D6VL 2MNUA 1PZ5B 5HYQA 1LO4L 4F2MB 1H5BB 1Q9OA 4LLVB 1JK8B 4JRYE 1EGJA 1IM3A 1AC6A 5CJBA 3TZVC 3VI3E 1KB9J 1JV5A 4OUUA 5MEPA 4JFFD 3RP1A 3VJ6B 4XXDB 1MPAH 2ZZUT 3MXVH 4XP6L 3KAAA 4FRWA 1KTLA 3QEQA 3BO8A 4OQ1A 1KG0B 4GW5B 4XT1C 2ZOKA 3LN9A 3X3GH 2Q20A 2D3VA 4L5FL 3U0TB 3MR9B 4Y4FD 5A2IH 3BZEA 3C2AH 4PV8B 1U8NA 3WNPA 3AS1A 5F6HJ 3KYOB 4WHCA 4WI6A 1I1AC 4DJMA 2OK0H 5D2LE 5KJRL 1QSEE 1MVFA 5B38A 5JXAH 1A9EA 5B39B 2WWKO 1Q9KA 2BVTA 1FG2A 4NO3B 1TCRA 2R56L 1EVUA 4MD5B 1AGBB 4DKDC 5CZKA 4OT1L 2DQDH 3QH3A 3S34L 3ZT7A 4NBXB 3A0OA 5MI0C 3BEWA 4WO4D 2ZNWA 3ZYOA 1YMHA 4APQD 4NQUA 4MCYA 4EN3A 3PL6A 4PB0H 4JEGB 1TJIL 1A7RH 4OZIA 4FZEH 1KT2A 2AXGB 1LP9B 2VN7A 4Y2DB 3I3BA 5BVPL 5F9JB 4NZRH 2H32H 1CFNB 4WFHE 1LO0H 3HC4L 43CAA 2PYEA 4OLUL 4PRHB 3WFDL 3WLBB 1EEZB 1IC7L 3O8XA 3QFDA 2Q8AH 5C0IA 1MFEL 4QTIH 2GQHA 1ADQH 3HE7D 2FO4B 2CRMA 4HHAB 4MJIA 3F6IA 4XPGH 4X8XA 3GI8H 4MMZC 3ZDXE 2VL5B 5DVLA 4DUXA 2Y23A 5C0DA 3BOVA 4PYHA 5I1IL 3MMEA 2VDMH 3GSNL 3AGVA 1EO5A 3MGOA 5DJDB 1ZLWK 3QYCA 1LO2H 4PRIA 5EH1A 5DI8A 4QHMB 2WIMA 4ZO9A 2OMNA 1CXIA 2LV4A 4MAYA 4XCNB 5D7KE 4ALAL 1LE9B 4OLVL 4XGZA 3FQTA 1I75A 1Q8MA 2OJZL 1DDHB 3HR5B 3HA0A 1RJYA 1RJLA 1Z9OA 3CVHB 4R4NC 5C2BL 1BD2D 4XTRC 1D5MA 4MHHI 3G5VA 4RFNC 4LIQH 2NY3D 1LP9E 2OQJA 5C0BB 5TQ2H 3HB3C 1JL8A 3P3YA 4PP2B 5E2TL 4HS6A 2MKLC 5CINH 3TO4A 3RWJB 3RZCC 2GJJA 2UZYB 2HVKA 4KK8D 3IJHB 3F7YA 1S9KC 1CZ8L 1S7WA 3P9WB 4HWBH 1U3HD 3P11L 5BZWA 5D2NC 5J11B 5EU4B 3VXPB 2HN7B 3TESA 3JUYA 4YGAB 2HP4A 2ICWA 1EO7A 4N0CD 4TVPE 1FO0L 3QDMD 4B50A 4M5YL 4ODUB 3V5DA 4N0UB 4HKZB 3GJFH 3ZDZE 1WF5A 1RMFH 1VFMA 4PGBB 1WWBX 1G9NH 2AK4D 4PG9B 5KVDH 1FYHB 4ZUVA 2Z92A 3QQNA 2QEJA 4J6RH 4CVWA 4ETQB 4AM0B 4K3EL 3QUYB 2YXMA 2Q7YB 1N7MH 3EDJA 4GG6E 1W8OA 2ATPB 5E8OA 4OIBA 4LCUB 4EZMA 3ZYZA 4OCWH 1UADC 5A3IC 5DC0A 4U1NB 1FLTX 1NJ9A 1XGRA 5K9KB 4TN9A 3KYMA 5F96H 2BFVL 3EYVA 4RNRB 1JWMB 3UTSB 3BP4B 4OZHA 5E6IA 4K3HA 5IB4A 4AL8L 1MAML 4LPTA 1KJ3L 4ACPA 3RWFA 1RZ8A 5GHWL 4HUNB 4ISVA 1NCNA 4TUKH 4YE4L 2IPUK 1OD9A 5IBUG 4WWKB 3LKQA 5E2UH 2W92A 2NY4C 3O3EB 1QR1A 4U6YA 1EJOH 3O45B 4YUEH 1ZT1B 5EUKA 2Y7QB 5C0AE 4OB5L 2BVOB 3WS3A 3PWPB 1SEQH 4ODXB 4F7EA 3MA9L 4TYUA 3PHQA 4O9HL 4XCYA 3DRTA 3V5KB 2N7BA 4YHIB 2DIJA 4KTEL 3UPCA 1FC2D 2VTFA 3D69B 1EPFA 4P5TB 4HJ0D 5C0JA 5DSCB 4QTHA 3AS0A 1FNGA 5DWUL 3C6LD 3MCKB 5I6XB 4MNHA 5CKGA 1BMGA 5SX5K 1LVEA 1HYSD 2WINB 3BP5B 3CZJA 3D0LA 4LFHG 5FO7B 1X5HA 2ZG2A 4KGJA 1TZIA 3K8LA 2E27H 4N8VB 4F7PA 4HH9A 1PG7W 2DQEH 4Z78B 5KSAC 3FRUB 3G5ZA 5BXFB 4RA3A 2L7UA 2WQ8A 4YFDB 1CFQB 3DV4B 3AUVA 5IQ7H 1QFWI 2X4PB 1UJ3B 3E3QE 1QLEL 2PTVA 1AKJB 1CTOA 5D1ZD 2OP4H 1T6VN 4NRYA 4KKLC 3GIZL 3VW3H 3CLFL 5IQ9A 1D5XA 1HKLH 5FYLD 5E7BA 5GS0D 2NYYD 4PJEA 5I75C 1CI5A 3UJTH 3KVQA 1URLA 1X9QA 1CYGA 3EYUL 3VXUD 2NXZC 3U30C 4OI8A 2ADGB 4DEPB 3CSGA 4BSWA 2DQIL 1I1AB 3W11D 2EXWC 4NN5C 4NOBA 4FTVA 2CGRL 2NY6D 1NH6A 1A7NL 3PP4L 5BVJB 3KPSA 1CL7L 4HCRH 3CFCH 1YEHL 1T1WB 4D2NA 1A4JB 3A6OA 3MRDA 4ONOA 5HYJD 1GZPB 1P7QD 4OFYA 5B4MD 4S2SA 2YD7A 4JHZA 4DGVL 2FB4H 1BFOB 5MI0B 3TCXA 1I85C 5IEHB 4LSTL 1FPTH 4O00A 4R7NB 3SDYL 1H15B 3D39A 1H8OA 3IU4H 4DVBA 4X6DA 3RKDD 2YPLA 3LQMA 2QKIA 4LP4A 5FYLH 2GY7B 3VXME 3W0WE 4DW2H 5GS0H 4PRPA 5L7XL 2BVPB 1AGFB 2MQCA 8FABA 2Z35A 5MEND 3FFCD 3IXAA 5A40E 5IIEB 5HYEA 5KSUB 1UM5L 4X6BA 1QO3B 1NCDL 1Z9MA 3O3UN 3S4SB 1TZHA 3CFJB 5HJ3A 5DJ8B 4NQCE 3T0EA 3UPAA 4W6YB 1LEKA 1BM3H 3QG7L 4OGAD 5E6YA 4XNUH 3GEWB 3WN5C 2C3VA 2ENSA 5KZCD 1T0MB 4LCWA 5EOTA 2DICA 3QA3A 4Y5XC 1I7UB 3MUZ1 1KELH 1T7VA 3UTOA 2B1HH 2IH1A 1MWAL 1EBAA 3DMMC 2ZUUA 4JAMB 3V5HB 3MGAA 3ARFC 4MA3A 3ARBD 3SQBA 1KLFA 1S7UA 1D5ZA 4EI5D 3QUKA 4KWUA 1CFVH 1NDGB 4S1QH 5FO8B 3LN4A 3QG6B 1VGEH 2AABL 3SDCD 3GKWL 3RRQA 5C07A 3ARXA 1KC5H 3H9HA 3S88H 1J05B 4PJAF 5CFHA 1IAIH 4R96A 5HDQH 3KLHC 1A6AB 1BVKB 4RFNB 1AR1C 1RVFH 2AGJH 2W65B 3ILPB 4J8RB 4YAQB 4GXVL 4DCQA 5JW3H 3AU1A 5EG6C 5GRJL 1T22A 3AREC 4WUKH 3O0RL 3HI5L 4M1GL 1Q9WB 4YIQB 5IFJB 4CADB 5KVGH 1IQWH 1Q38A 3QWOA 4PJIA 1BQUA 4XNQA 4K7PL 4JG0L 3O6ML 2A83B 1TTUA 3GSRB 5D2NB 3H3PH 1RIUL 3GO1H 2BHZA 1N26A 1A6ZB 4JN2B 4KXZH 2PYEE 4FFYL 4OGXH 3G08A 3PWVA 2EDYA 3WL9B 2FATH 4JDZB 4BFGA 4RQQB 5IB5A 4OTXL 4LKXA 4S1SL 3MRKA 3VH8B 3HAEB 5CWSB 1IQDA 5C09D 4MJIE 3BESR 4YH6A 5C0FA 5J8OA 5EO9B 3S3JA 5F70A 4WI9A 4WGVB 3TVMA 3MRPA 4LASH 1MHHB 1T0NB 1DEEA 4HXBH 2YEZA 1FGNL 5A2LH 3S37L 5AZEH 5DTFB 1IAII 4BK4A 3GSOB 4NM8L 1S78C 4MQXC 5I1HH 3EFDH 4A6YL 2XG4A 2B8OT 4I3RL 3CIQA 2VLMD 3VRIB 3P4MB 4A2LA 1R0AH 2P46B 3BPOC 1F6AA 3EOBB 4H1LA 4ZUTA 4PRIE 3RAJL 1KNOB 3BDBA 3BZDA 1UKSA 3PGFH 1I4FB 3MJ6A 1HNFA 4LSSL 4JPKH 2DL2A 1MLCB 2N56A 1X7QA 3NMEA 4HS3B 1YEFH 5DQDL 1XZ0A 2E6JA 4PY8I 4PGDB 1JRHL 3M17A 4WU5A 4DN4L 1T0PB 1MCDA 4UOJA 3PQYE 2KBGA 4WV1A 4X4XB 1UM4L 1HHHA 5ADOH 2NY5L 3QFJB 3B2VH 5C0RH 3S37X 3C08H 1VEMA 4QRPB 4PJCA 4N1HB 1MAJA 2K7QA 2VC2H 2F8OA 4P2QB 1X5FA 2Z8VC 3FB5A 2AJXL 2YWYA 5EU6D 4FFVD 3W5MA 2HMID 3QPXH 3VFUA 3S98A 4UDUA 2OM5A 5C6TH 1QLFA 4ODWA 1RUMH 1E27B 5ENWB 3C5ZD 4I0KA 2ZCKL 4YHPB 3HNTL 4FXLA 4G42A 4RDQF 2CUMA 4LSUH 5B8CA 2OSLA 1E4XL 4Y16D 5MEOB 3NZHH 3P40A 2FHCA 4TSBH 4JFXA 4Y5VA 1FP5A 1V3JA 5F44A 3TN0A 5F1IA 3IETB 5TF1H 1QD0A 3WNOA 3ARGC 1VADB 4JQXC 4Y19E 2YUVA 3FZUD 4ELKA 1YN6B 3UAJC 5GZNC 1BZ9B 3OWEA 5DZNA 1F4YL 5BOPA 5T3ZE 1EFQA 5GQBA 2Z31D 3RWEA 4W4OC 3O41B 5EPMA 1MPAL 2EC9U 3MXVL 1JPFB 4QHKI 1JZ7A 4I0PC 4XNMA 5I75B 2MPAH 4GKZB 3PWJB 2NXZB 5F1OB 2YUWA 1HSBB 5IK3A 3U30B 2ICES 4P2QE 1MCHA 4C58B 2IALB 1FZMB 4GW4A 5CLTA 1FLRH 4NN5B 1OQOA 1E4WL 1SBSH 3ZE0E 5IESL 1HXYB 3VFGH 2Q3AA 4D9LH 2OK0L 3NFSH 5EA0H 4OF0A 4ELMF 3C87A 1IL1B 2XZQH 5CGYD 1A8JH 3MRMB 1CU4H 1WFTA 4LPCA 1T1XA 4ZFZA 3ZHDA 1DQMH 5EU5B 2HTLC 3IVKA 5EDXA 2DQDL 3VXTA 4JM2A 2AEPL 2MHAB 3OKNB 3Q6GH 1IGTB 4KAQL 1CQKA 1HH9A 1WAAF 1MY7A 1MWAA 4HLJA 4L8DB 4M3KB 2HLFC 4PB0L 1A7RL 3E6FB 5IVXE 4FZEL 1A2YB 3BYTA 3LZFH 4GRWE 4G6KL 3C60A 3FN0L 3QIBA 5KS9B 1LO0L 4PJGF 4XWOC 3GMNA 5EFIA 3AM8C 5BRZB 4KVNL 4QTIL 1TFHA 1OAZL 1ADQL 1NAMH 4ZFOB 5IW1A 3OAUH 3WN5B 4ZXBC 1ZVYA 2VQ1B 4HKBB 3C5SB 5DURD 5T1DL 4Y5XB 1RIHH 2XWBB 3PV6B 1E4KC 1XCTA 4PJEE 1YDPA 5IB3A 3ARFB 2WBJC 3BE1H 3EO1A 2VDML 3IKKA 4NZUH 4G5ZH 1RZKH 1B2WH 1BOYA 4P3CH 4M6OH 5MERA 4E41D 5IHZB 1CLCA 4LHJB 3CLEH 3LRHA 4XP1L 3KPSE 3TNNB 3VRJB 2Z0BA 1G7QB 4NKDA 5HYSA 4LAJH 3OZ9H 1S7TA 1A21A 1NLDH 3MV11 4M6ML 1U8QA 1W0VA 1FO0B 5DMIL 1NBZA 3JWOC 4JPVH 4WFEE 4JFEE 3AREB 4LMQI 2K3TA 5TQ2L 3IDXH 3O2WH 1I8KB 4PRDB 1CR9L 4PJ5B 3CH1A 4HZLB 4FMKA 3LCYA 3Q0HA 4X6DE 4GXUN 2YPLE 1IT9H 3SGJA 4TOYH 4FFWD 1P69B 2X4UA 2CMRH 4O5LH 3U9PH 1FL5A 4PRPE 1AE6H 5D6DA 5K9QI 1WFNA 3RY4A 3EFFA 4QRQB 3CSBA 4HWBL 1CE6B 1NFDB 3G6AA 3N85H 4B0MM 1T1ZB 3DVNA 4X4ME 1JVKA 4I9WD 4U3XA 4U1MB 5EB9A 5EU3A 1IC5H 3LQAL 2EDQA 5IVZA 4ZUUB 2NY7L 5F89A 5BMFH 3QDJD 1MRCH 3G6JB 3FB8A 4G3YH 3EAKA 1F2QA 1JPSL 1IGIH 1G9NL 4QXUL 1VFUA 3MO1B 1RFDH 5LBSH 5DEGA 4DTGH 2NY2C 1A6PA 4ODTL 5FK9A 3BPOB 2R9HC 4AIZA 3O4LA 1MEXH 2BC4A 1BOGA 4WUUA 4K7FB 2APTA 2NY5C 2XWTA 3H9SB 5SWZB 1X5JA 5ITFB 3RTQB 1MVUB 3MROB 1OAQH 5F1SA 5L2KB 4MCZA 1HZHH 5C1MB 3RVXC 2XV6B 2APFA 1KXTB 2CK0L 5KG9A 4MNGB 2AJUH 1HHIA 1IAOA 1D5BB 1T7YA 4Y5YA 2CKBB 3KPRB 1BGXH 1CN4A 1S7RB 3SDXA 5FHAL 3ESUF 3IFPB 4UQ2A 2O61B 3K0WA 4NKMB 4WU7B 4NGHH 1SVZA 5HHVH 1NMAH 1QRND 4YBHA 2Y6SC 1XGQB 2YC1B 3OJ2C 4CU7A 3O3DB 1F58H 1PKQA 4Z76B 3WO4C 2JIXA 3BQUA 5C9KA 3NBNA 4MVBD 4Y4HA 5FYJH 3FQXB 2YPVH 1ZV5A 5K93A 4D8PA 3I75B 1I9RH 2RCSH 4N0YH 1W0WA 4XAWL 4JRXA 5I66B 4HWZB 4PJXB 5IFAL 3QB7C 4IOSD 1FSKC 2XACC 2AAVA 4YHYC 5JIKA 5D71H 1GIGH 1UQSB 4XP5H 1K2DB 3O3BA 1GHFH 5HGAA 3UTZB 4I18C 1WC7B 1AGCA 3WJLC 2BNRD 1NGXA 1RV6X 2ZJSH 5HHMD 3DHMA 1JGDA 1KG0A 5D7JA 4EXKA 4UOW1 4KZEH 3H9SE 2L0DA 5SWZE 3BKJH 3RGVC 3U0TA 3BRFA 3QUXD 3TV3H 5DJAA 5L2KE 4U6XA 2WQRA 2WUBL 4BQCA 4MSWA 1DQQA 2F54D 1IKFL 1KF9B 3PDDA 3KDMA 4HIHA 2IG2L 5IQ7L 1CG9B 1YN7A 1IEBB 4LBEB 4N68A 2XN9E 4I0PB 1JHTA 4CU6A 1FBIL 2P8MB 4BSJA 4M8QB 3QUMB 4QHKJ 2C3GA 2HLAB 1AGBA 5L2JB 1HKLL 1TDQA 3N9GH 3O2VH 4K8RD 1F5WA 3UJTL 2XTJD 3MNVA 5I18H 3MA7A 1KULA 4HUUA 1MFDL 4OKDA 1HXMA 2VDNL 5GGRB 2YA1A 5I1JH 2AXGA 4PJCE 3MJ9H 2NX5D 2VLRB 4PJXE 1CFNA 3CFCL 2ITDA 1IEAB 4PPTA 1W2KT 3SKNA 2YD1A 2J4WH 3WLBA 4Y4FC 1DE4A 3RY6A 2FB4L 1QBML 3W9DB 3P4NA 2OL3B 4HX1B 4L4VA 4P2CG 2YWZA 1HQ4A 4GRMA 4PS4H 5EWIH 1BVZA 4PTUB 4KDVA 3VMOA 4J12A 1AXSA 3QCUL 4D0CA 5I0DA 4PV9A 3WE6B 1IC4H 1NEZG 4LOUD 4ZSOE 4DW2L 4HUMB 1U41A 3RVWD 4K8RH 5SWSA 5TE7L 1RK0A 3RPKA 1P9MC 2XWJA 2AI0L 3KPNA 4WO4C 2GJ6A 1GGUA 2R1XB 4EIZC 2VKWA 4QHMA 4APQC 5D7SL 5H35A 5GISH 4XCFL 4NOFA 1ITBB 4J1UA 3V7AG 3VI3F 4PTTB 3WDIA 1LE9A 2EKSB 1BM3L 3GHEH 2W9EL 4XNUL 5GRYA 2HRPH 5ETUB 3SO3C 5ILTL 3D9AH 5I76A 1AJ7H 4LSPH 1KELL 2B1HL 3OKEA 43C9B 2VABA 5C0BA 1I1FB 1FFPB 3HE7C 1S7QB 1QSZA 4YBQD 1N59A 3WXWH 2CLZB 3LS4H 5I1DB 4HV8A 5ITBH 5M95B 4MWFB 4QHNB 1CFVL 4S1QL 3RWJA 1G7LB 1BWWA 3QUZA 4P23A 1WWWX 2ED7A 5D2LF 3RU8L 1M4KA 3TC9A 4HFWA 3S88L 1RZJH 1YYLH 1MFAH 4WJ5B 3O11B 2FJFB 4HDIA 1XH3A 3HZYA 2WWMD 3RWDB 1HWGB 4M1DL 5DMKA 3HLAA 4F9LC 1T7ZA 2AGJL 1X5KA 4IRSC 4Y1AA 4L3AA 4ODUA 4M62H 3G9VA 1MQKH 3A6BL 4UIMB 5HDLA 1A6TB 2P5WD 4WUKL 4P46B 5AAWA 2EIBA 3WXVH 4PG9A 1M6OB 2DLIA 1IQWL 1G9NC 3STZB 5GS1B 5KVGL 1MRDH 4ODBD 3JTTB 3CZFA 1P2CB 4AM0A 1F6FB 3FONB 3AAZB 3KXFE 3MJ7B 2D7NA 2GFBB 2M8XA 3LN5A 2FATL 4GRLA 4LAQL 2ZWLT 4V1DD 4MB4A 4X8JA 4C59B 3DHJA 4KROD 3GMQA 5TDNA 4RIRA 1QNZL 4DKAA 5SX4H 3OKLB 2GK0A 4QOKB 1QP1A 1J86A 5K9KA 3GFUA 5HXMA 1AD9B 3ZDXF 3UZEA 3FJTA 4HXBL 4POYA 3GUTB 1DUYA 1JWMA 2FEDC 5AZEL 2NY2B 5FF6B 2XY1A 4UILH 4EUPB 4KK9C 1WISA 3WS6C 3EFDL 4N0CC 4FQHA 4QRRD 4GKNA 2X41A 2J8UA 3SO5A 3BEVA 5J57B 3NCBB 3VFNA 3VFPA 2HFGL 4WWKA 1IZJA 3PGFL 4M7JH 2L4OA 4XCEB 4XXCA 5C08B 5KSVA 2FX7H 1KJVB 1TNMA 4FXGB 1PYWA 1YEFL 3PWPA 4ODXA 2MCPH 4ONGH 4G9DA 4BZ2H 2JK5A 1OARH 3ET9F 3SGDI 3V5KA 5DT1H 4U7KA 3DXAD 1NCAL 1T04A 3IXTA 3EHBD 5EBMB 4X5XB 3IKCA 3VG0H 3KR3H 3B2VL 3MCKA 3WO4B 3MUGA 1KPUB 4H26A 1EVTC 2VC2L 2VIRB 4OZGB 2I5YH 3BXNB 1K4CA 3STLA 1FFOB 5CP7B 4PIRF 1SEBB 4GBXB 4N8VA 3QPXL 4QYOA 5T33H 3MLPA 2I9TB 1FSKB 4YHYB 3ABZA 5E4EC 1RUML 3KPLB 3QIWB 1PG7H 1FYTE 1CDHA 3MRCB 1K6QH 3T2OA 3S96B 2E7MA 2X4PA 1UJ3A 4LSUL 4ZO8A 1AKJA 3P9LB 4I18B 1KJMB 3ZDZF 3B8SA 4QCIA 4X9IA 3RUGB 3D2UD 5T5FH 3T0AA 4C56B 2EEBA 4TSBL 2JELL 2EDRA 2ENYA 2Q7NA 1HWHB 4KI5F 4C4KO 3RGVB 1E6JH 5EUOA 5I1GH 5DQ9B 2X89D 2E7BA 3O4LE 1CBVH 3GJEB 3LKOA 2Q76A 4KU1A 5TF1L 3G5YA 3UP1A 2HJKB 4WUUE 4FZ8H 1KB5H 4HJ0C 2ERJC 4OCYH 4GG6F 3C6LC 2VLLB 1Z3GH 4BA8A 2X4TB 5GGQH 1C1EH 3DI3B 1T1WA 4HGWA 2G75A 1OAUH 1OT1A 1UWXK 2VDOH 3GSXA 1D5IL 4U1SB 2NY1D 4KKNA 4LCCC 2MPAL 4FP8H 3O3AB 1L7TH 4D3CL 3QO1A 4JFFB 1WFOA 1G7PB 3UYPA 4F37F 4R7NA 3DVGA 1H15A 2ADIB 1SBSL 3QO0A 5F9AC 4PJ8C 3VFGL 5D1ZC 5FGRA 1H3PL 4D9LL 5D7IB 2FX9H 1X4ZA 3ALXA 2R1WB 2PN5A 1TTFA 5EA0L 2BVPA 1AGFA 2H32B 5FOJA 5GS0C 1CCZA 1I1YB 2EYSA 3HNSH 1CU4L 1NCWL 4OCXH 1N4XH 4ONFH 3DIFA 2AK1L 4Y4FB 3SDAD 3UTTD 4GJTB 4JQIH 3GMRB 4JRXE 1QO3A 2A9NH 3LB6D 4S11A 4TUJB 5FKPB 3SEPA 2ITCA 2FL5A 3W11C 3E8UL 2W0KA 3T1FB 2NY6C 2EICA 1UH2A 1ORSB 1R3KA 4NC1C 4OLZH 2AV7B 1GOHA 1XIWC 1V05A 3N1MC 3WSQH 3FT2B 5B4MC 1B4JL 2Y07H 3B9EA 1YNKH 3WD5H 1MF2H 4WO4B 5E2WL 1T83A 1NCBL 4APQB 1DUZA 1LMKA 1JZ6A 4KV5E 1CDIA 1Z5LA 2IADA 3QULB 4KH2A 2DLFL 1P6AB 3OAUL 3RKDC 2QHLA 2R0ZH 3HI6H 5JQ6H 2BHYA 2DWDA 2HKFH 3PABB 3SO3B 4M5ZH 1G7IB 1BF8A 3HPLA 1BVKA 1RIHL 4NCC1 2DB8A 5D1QD 4HAGA 2OTUA 3HE7B 5D7IE 1CGTA 4QRTB 1A14H 4G5ZL 3A6CH 4XBEH 4M6OL 2B39A 2JCCA 2H26B 1Q9WA 4CKVX 5D7LA 4MZ2A 4CADA 5HY9B 1U92B 1SBBA 3QRGH 5ADPH 2BMKA 4MJ6B 5H2BA 1G7MA 3OB8A 5AZ2H 4MXWH 5C0GB 1O7SA 1NLDL 4IRSB 4X4ZA 4JDZA 5T1MB 5D9SB 4JPVL 4L4VE 1LEGB 3HAEA 1WBZB 3LQZA 5CWSA 3IDXL 1FGVH 3O2WL 4X7DC 4KQ3L 3U6RA 4TNVK 2K7PA 5SWQB 2FH8A 2VE6B 1NL0H 3TIEB 3V4VH 3V6OA 1NGYB 2KZ1B 4TOYL 3ULSA 5DTFA 3ALPA 3BPNC 3GSOA 1BD2B 2C7UB 1AE6L 2R23B 5SWSE 1MCIA 2NY3B 1VEPA 1Y6NR 3VRIA 3P4MA 3N85L 1A1MB 3EOBA 1FH5H 3H8NA 1W72L 2GJ6E 4ZMAT 1JTPA 4M9PA 2FIRT 3DPBA 2R8SL 3CFDB 1IC5L 4B7IA 1MRCL 1CS6A 4Z7UA 4I3SL 4LVOC 3EOAB 1KOAA 2QADC 1U3HB 3E1F1 3O6LH 5CHNA 1VFOA 2A74A 3W2DL 4G8FB 4PJDB 3UROR 5K9OB 3QDMB 1ETZA 3ARDD 1N0LA 4HPYL 3U0WL 1VHPA 4DTGL 1Z9LA 2ZG1A 4Q6YA 4ZODA 3IDMB 2VXQL 5FM5O 1AY1H 5KN5B 2VLKB 3UJJH 5DJCB 5GRVK 4MMXC 3KHQA 2AK4B 1RJZA 2PO6C 4YGVB 1FZOB 2BCKB 4MXQD 2BY1A 1YY9D 2XQYK 4QRPA 5CSBA 4OBRA 1ND0B 2Q6WA 5EBLB 2R4SH 1EJ6A 2YA2A 1UZ6E 2HG5B 4XBPA 3WUWB 3H42L 4JKWA 3SE8H 3ZTJH 1NKRA 3HC0B 1BGXL 1E27A 1OWWA 5ENWA 4JGJA 4G9FB 3OKMA 5LJYH 1P5UA 4WW2A 1II4E 1VFBA 3ETBF 5SV4A 5IEKB 2X09A 3KNBB 4HS8H 4IMLB 4YXKH 3BN9C 3LD8C 4BKLA 3MRGA 1F58L 5F9OH 8CGTA 3BGMB 4OD2A 4MYWB 5DD0H 2HVJA 5FYJL 3MRQB 4U1GC 4E0RB 2YPVL 3RJQB 3IETA 5F8QC 2RCSL 2GI7A 1HH6A 3GSUA 5E4EB 1CFTB 2DQGH 1YN6A 4LRIA 3TEUA 1YEDB 4PJDE 5KOMC 4X9FA 3CFEB 1UCTA 1AO7D 3MGTA 4ONHA 4J3TA 5IKCB 4G80B 3BUYA 2VLKE 1ZE3C 1JPFA 5AWNL 3WFHA 2A6IB 1KJ2B 4RGNC 4DQOL 4PRNB 4J4PC 2ZJSL 4GKZA 3PWJA 2HMIC 3L7FB 2AQ2A 1T2XA 2B7DT 4UU9A 5KSBA 1QFWM 4YQXH 4FQJH 4KZEL 3THMH 3TV3L 2ERJB 1H3XA 1CVSC 3C6LB 5GRZA 4HIJA 4Y16C 1U58A 4ZTOH 1G1YA 1DL7L 5I16B 2D31B 3WKNA 3N1FC 3CCHA 5EC2A 2QR0B 5JNYB 1FZJA 1OSPH 4G9FE 3MRMA 2CSPA 2ZKHH 4H25B 4N90E 1RI8A 2VISB 5E00A 4ZUSB 1BJ8A 4HH8A 1QBBA 3QDGB 4TRPH 3ZT5A 1JGLH 2MHAA 3N9GL 3O2VL 3OKNA 3DVFA 4IHOB 3RWHA 2X4OA 2BK8A 3BKMH 4PJ8B 5I18L 5D1ZB 1C5CH 2EECA 4UQ3A 4YHZH 4XVJL 2Z31C 1HI6A 4KK6D 2ZP0T 5GZOC 1A2YA 5I1JL 3HRZA 4HMDA 2EYTB 3U9UB 1ITCA 3VXUB 5GS2D 4WEBH 3TIDB 5KS9A 5IHUH 5BRZA 1FAKT 1D9KD 1XMWA 4R7DB 1I3RB 4G8IB 3EOTH 2NXYD 2J3SA 2NY6B 5CILH 2I9LB 1NDMB 4WEUD 3AFLA 2EH7L 3LRSA 2CLVB 2VQ1A 5CEYA 1FVDA 3S3PA 3C5SA 2H9GB 3GSVA 4EQ3A 5EWIL 5J1AA 5JHDD 5HYJB 2Z91A 1P7QB 5CGYC 5DR5H 4JFDD 4FS0A 1EEYB 1PSKH 2BSTA 3U46B 3MRRB 3MLXH 3MLUH 1JBJA 3PWNB 5EUOE 5C0CE 5HI5D 3MNZA 1IFHH 3BKYH 1UM6L 1C16A 4JGMA 1GAFH 1M71A 4NZTH 1RZKC 1FV1A 1MIEH 5F7DB 2OXGA 4PJHB 5GISL 1A3RL 4XP9H 2PF6A 3QDGE 2FGWH 5HHOD 3G6DL 3GHEL 1IKNC 2VAAB 4X7FC 1AFVL 4M7ZC 1NUDA 3SBWA 2LABA 2UWEB 4JJHA 3D9AL 4MNQA 1AJ7L 4LSPL 3P30H 3BP7B 3NIFE 4YZFF 4TULH 4HUVA 4OSUL 5E1AB 4NO5B 3D25B 4UB0H 3CDGB 1CD8A 1FDLL 4P0DA 1YMMD 2ZOLB 2Z93A 4PJ5A 3K4DA 3QIUD 3WXWL 3OBAA 5KZCB 2UYLA 3ZE0F 1QVOA 5ITBL 5ESVB 5LG1A 1W72A 2AXFB 1NMBH 1NC4D 4XPHH 2WM0A 4QRQA 1UXWB 4JCMA 1UWGH 3KPQB 5JXED 5EZJA 1RZJL 3T77A 4ZG1A 3ARBB 3VCLB 1MFAL 2AEIT 5L9DL 4EI5B 1LDPH 3H7BA 1LK3L 4ZUUA 1XCQB 4YDJB 2CUIA 1MQKL 3EDEA 4YEFA 4O51B 3SY0B 5K9JH 4PLJC 2H3NA 3BPNB 5MEQB 2YR3A 3LV3B 5F6IC 1BHGA 5E8EA 5IVXF 1AGDA 1G0DA 4X6FB 1MRDL 5HYFA 3B9KD 5CIPH 4GRWF 1QEWB 4JDTL 4JKLA 3LRGA 3DX9B 2RGSA 4JVUA 4J3OC 4YPGB 4X9BA 1IAIM 2JB5L 1IC1A 2NNAB 5HI3D 1A7OL 4P2YA 4LVOB 1I1CA 3RTQA 2QADB 3MROA 2FECL 5B3JE 4PLOB 2VDRH 4YNYB 1V7NH 4GW1A 3T3ME 1CICC 3E2HC 4HLZH 2VH5H 4NO2A 4UILL 1DANT 2GKIA 4PJEF 1YEEH 5E5MA 3REWB 3GBNH 4JRYD 3V4UH 3IFPA 5C09B 5TE6H 1GJIA 2PO6B 4WU7A 4NO0D 5GRUH 3OAYH 1S9XB 5D7LE 5GGVY 2PTUA 1EH9A 2UUDH 4RAHA 4M7JL 4PY7B 3O3DA 4AG4H 1F13A 3L95B 4Z76A 2FX7L 1ZKAA 2CH8A 3MRNB 3T2NL 3FQXA 2GSIA 1KLGA 1BIIB 4LHUD 1YA5A 3I75A 5F7KC 2MCPL 3PJSB 4KRLB 4U1LB 1LO5A 2V5TA 1OARL 4WEMB 3VXQB 4XB7A 1U8KA 3QJFA 5JUEH 2OR9H 1QSED 4LVEA 3QXUA 7FABH 3LD8B 3VG0L 3KR3L 3E6HB 4N9GB 2P4AB 4X6DF 5IMKB 5EU7E 1FCGA 1JNNH 4P2OC 1ZLSH 3ZKXB 3NABL 3LDBC 4U1GB 2LE9A 1OQXA 1PAMA 4I13B 2I5YL 3ELAT 4P9HL 3NCFB 5D1XC 3QEGH 2W59A 2GSGB 5T33L 4LLUB 4NQDE 1WUNT 1SM3H 1PG7L 2RAMA 5DHYB 4QXTB 1LILA 1K6QL 3FHAA 1UXSA 3CC5A 1IEBA 4RGNB 5EU6B 3VFOB 4LGPB 3PGCB 3QWQB 4WFHD 2NR6D 2P8MA 1MCRA 5T5FL 1OM3L 4M8QA 5L2JA 1GOFA 3STBA 3BFOA 3I2CH 3BGFC 1E6JL 5I1GL 1WZ1H 2GCYA 1CBVL 1LNUA 2WANA 1T80A 2B0SL 4XMLL 4NHUB 4Y16B 3QZWG 4FZ8L 1KB5L 4O2FB 5DLML 5GGRY 3VFVB 2JJWA 5GGRA 5I1CL 3PHOA 3MLZH 2VLRA 1Z3GL 4P2RE 4LPWA 3ZL4H 1OAUL 4GKSA 4YPJA 3EZJB 1JN6B 4WHTA 4FP8L 2DQUH 4OLEA 3TA3D 1PG7X 1KIPB 1CXLA 3GRWH 2C4FT 2DQJL 5D7KD 4M4PA 2Z31B 3FQNA 2VUYA 4PTUA 3X14A 3U48A 3MV7A 5ISZA 5TDPA 1YYMH 2H2SD 2FX9L 1ZGLM 2ORBL 5FO9A 2IAMC 4HWNA 1NPUA 3LEYH 1TJGH 4K8RC 4ONFL 1N4XL 4B41A 2QTEA 4Y2DD 4FXKB 5HHNB 3T2PA 1AC0A 1HILB 5LGJB 4JQIL 4RMSA 1NGPH 2A9NL 4RGNE 5AD0B 3MREA 1ZSDA 4RAVA 1NAMB 2IQAB 3VGHA 4PRHD 5JA9A 3UO1H 3BWAB 3GMPB 3L3HB 3FO0L 3K2UH 1FL6B 4OV6F 4EVNA 1AD0B 1B0GB 4U2ZA 4Z5RA 1T21A 4TVPD 2YRPA 4R3SA 3S5LG 43C9A 1YNKL 1I1FA 3W39A 2CO7B 2EXYD 1FFPA 3WFCH 1S7QA 3VGBA 3L9RA 2UUDK 4ORGB 1UVQB 2CLZA 5E0QA 2XA3A 4MWFA 4E42B 2XPGA 1G7LA 4K7PY 1F3JB 1EK3A 2R0ZL 4M7ZB 3HI6L 3ZKSD 5FECA 4N1CA 4I3GA 4NPYB 3IFOA 2HKFL 4M5ZL 4JG1H 2X7LA 2OTPA 2X70A 1J8HE 1U36A 1RZJC 1UH4A 1QSFA 2EE6A 4P5KB 2YSSA 1HOCB 2YZ8A 4GS7B 4WTZG 5TF0A 3RX8A 1QQDA 1DZBA 3CUPB 3MRIB 4OFIA 3HPJB 4P46A 5DURB 3AY4C 3U36A 3HMXH 3H3KA 4IDJH 3DO7A 5FM8A 1M7DA 2PW1A 5GS1A 3KPMB 2APVA 4PJCF 5IFHL 1F42A 4TVPH 4HUWB 3MODL 4HUXA 4Y88A 2HA1A 4DUWA 2RQ8A 1ZHKB 1A6UH 2WIIB 3C8KB 1QYGH 3UYRH 2ESVA 4H5SB 5D72H 1I7RA 3GB7B 3OKLA 3OKOA 3NFPB 4QOKA 3OKDB 5T1LA 4F8TA 5F6IB 5C0AD 4JO2H 3X11A 1L4IA 5J6HB 3GUTA 2DN7A 4Q97A 1FFNA 4YDLC 2WWMC 5D5MA 4LPXA 2M2DA 1ZS8A 2XQYG 2ZSVA 2DYPD 4HKJB 2IWGA 3FMGL 3FT3B 3QP3A 4AIOA 1CWVA 3TBTB 1Q1JL 3SOBL 5IW3A 1XF5B 5H8DA 1OCWL 3E2HB 5TPWH 4F9PC 4X9GA 1FZKA 3C5JB 4XWGH 3F12B 4KKBD 2W0LA 1INQB 1AI1H 2PXYC 4JZNA 5KANG 3MLYH 3MLVL 1DBBH 2HTKC 3QDJB 3TBSB 4OV5B 4OZFH 4LLWA 5F1NA 3UJJL 5GSRB 3QNXA 4X5XA 3HNVH 1ZWIA 3RNQA 3CK0H 5I17A 1XF2A 2VIRA 4LDLB 5DRZA 4AYFA 1G7HA 3NFNB 4RGMC 4JY4A 1FFOA 4ENED 4GBXA 4FMFA 5DK0A 1A6WH 1MREH 2NZIA 3SE8L 3KPLA 3QIWA 4JM2F 2OLDA 4HKXB 3MRCA 4CN1A 4HWEH 2BNUB 5F7MC 5BQ7B 2QLVB 3S96A 3BHBB 2X05A 1SJHA 1SY6A 3FQUB 3HZVA 1S9YB 5C8JA 2D9QB 4LSQH 4HS8L 2X40A 1QKZL 5FGCE 4YXKL 4X98A 1KV3A 5IHBA 5F9OL 4P5TD 4JPIB 3EJYD 3FCTB 5EZLA 1EMTH 1MJ8H 4U6HB 5DD0L 1OWRM 1U42A 5D1XB 5L88H 3K1DA 3SKJH 5AG9A 3AS3A 3CVIH 3QWRD 4CMMB 5TGBB 2FWOB 1B90A 1QRNB 1S3KL 2DQGL 4R0LC 3EHBC 1D3CA 5JZ7C 1P4IH 5E8PA 4J3VA 1EAPB 2E6PA 4S10A 4FQCL 2DTMH 1N2RA 3PGDB 3V79C 2ARJB 1G6VK 3VXMD 3W0WD 3TZVD 5F97E 1OGAB 2A77H 1A0QH 2XQBH 2YUXA 1M7IA 5I8CB 1T2JA 2WLYA 3VI4E 3VGDA 4OF6A 4KTDL 3T8XB 5CUSL 3PHSA 5JDSB 4OLXH 4YQXL 4FQJL 1V3MA 1JNLL 1U8JB 4NQCD 3THML 5FEBA 2ADIA 5FYJE 3UXFA 3HZMB 2XT1B 3X12A 4IRZL 2BNRB 3BMWA 2BNQB 3UZVB 5HHMB 4ZNEA 4WW1A 2R1WA 5E2VH 3X17A 4EI6B 3VWJC 1OSPL 1I1YA 2J8HA 5DK2B 5TFSL 3WMSA 3QSKB 5C92A 5HD8D 4UTAH 5JW5B 1RUPH 3D3VB 3CXDH 1JGLL 3CX5K 2UV3A 2C1OA 1T20A 2H8PA 4HJGA 5HYIA 4LRNH 3TYFB 3P0GB 1L0QA 3FT2A 4I77H 3VD9A 1FVCA 1OSZA 2NTSP 2V17H 1EGJH 1FNEB 4WEBL 2XTJB 1N6QH 3SQOH 4OJFH 2DMBA 2GT9B 3WBDA 4JHBA 5I15H 5IHUL 1OGAE 4RA0C 5IR1B 4AQOA 3WO3B 4EN3D 3ARPA 1R3JA 3EOTL 3GMMA 2NX5B 3GK8H 1T1YA 3P9MB 3ARZA 2F5AL 3ZO0A 1G7IA 4JJ5A 1YUHB 4PGZA 2P47B 1HINH 3RGHA 3SDAC 2PYED 1SYVB 1CXHA 3VD4A 3TBYB 3MLXL 3LB6C 3CSYA 3MLUL 4XNXL 3V6FB 2BNQE 3RL2B 1ACYL 5CJXA 4UOW0 1IGCH 1IFHL 3IGAB 1HIMH 4LLQB 2O5ZL 3BKYL 4N5EC 3OJVC 3HS0B 1A9BB 1GAFL 3HCVB 4MJID 3DX7B 4ZQKB 5EOCJ 5L8LB 1F00I 1MIEL 2YZ1A 5EIQA 4XP9L 3D3VE 2LTQC 1PQZA 1JNHB 1DBML 5FIEA 4IIQA 5HGBB 4G6MH 5IMOB 1R5VB 5ICZA 1OAYH 4JGUA 3P30L 3U4EA 3WNKA 4PRID 2QL1A 3DGGB 4R4ND 1EA9C 1JPST 1ZA3B 4MAYD 4UB0L 1F8TH 2ZUWA 3BD5A 3VE0A 3PXHA 3HB3D 2X9WA 3WIFB 5DUBA 1DN0B 1XR9A 2FX8H 5SWQA 2IC2A 1QFUH 1VFAA 2H41A 5ISZE 4H0HB 5DK3A 1AXIB 1BD2A 2C7UA 4XPHL 2R23A 3BT2L 2D7QA 3N50A 3KWWB 4MZ3A 4XVTH 2C4XA 3FTGA 3RZCD 1UWGL 4XI5C 3KHOA 4MD4B 5LQBH 1RHHA 2W0FB 4L1DA 4WHYG 3PXJA 4M43H 3PQYD 2LU4A 4FQQB 3CFDA 4NYLA 4FQIH 5DRXB 2E7LA 5DHVA 1MHCA 2N7AA 3NGBC 4QHLB 1S7VB 4R90H 2RFXA 5CCKL 1U3HA 4DZ8A 4O58H 3BPCB 4HJJH 4FQXA 4JKPH 1EERB 3F65A 3WS6A 1NFIB 5DC9B 3RX7A 2X6MA 2IPTL 3IDMA 3UBXG 5JIPA 7CGTA 1JCKA 3K4ZA 1MCBA 4LLDA 1X5LA 2AK4A 4OI7A 4KV5F 1FZOA 3QDHA 2E8ZA 4ZPTB 3E0GA 2RJMA 1MHPH 1ND0A 2CDGA 2PKDA 2VLJA 4J23A 3U82B 2J8OA 1BIHA 2AERT 2VDRL 2MFNA 1V7NL 4L4TA 2HG5A 1QSFE 2DKSA 4KDTC 4NFCA 5I1AB 2PXYB 3HC3H 4FOMA 4O02H 3QR2A 5A2JH 3L3IB 4D9QE 3L3JB 4UIKL 3HC0A 4Q58C 4Y19D 4YDVA 1YEEL 5E2JA 3IF1B 3GBNL 3OPZH 4FQLH 2EDDA 1UCBH 3TO2A 1U6AL 5T3ZD 2X4QA 3TM6A 2V2WA 3CX5J 5DJ2A 2KDGA 5DVKA 2XKNA 2JJVA 4RGMB 2NY4D 4J3XA 3N1GC 5EZOH 3ARDC 2XXMB 4M93C 2GAZA 5E6ID 5J9PB 1LE5B 4QRRB 3CU1A 4JPWL 4P2QD 1JPTL 1AR2A 4DK6A 1EDQA 4UUJB 2ESVE 3ROLB 1AP2A 3OG4B 1G9MH 3CFEA 4MS8D 3Q3GB 4RMUA 3BZFB 3C09C 1B9ZA 5HHQB 4ZFFB 3MJ8B 5GPRA 4G80A 2FLRT 4Z6AT 1KJ2A 4PRNA 1ZA6A 1JNNL 1ZLSL 5D5ME 5BS0E 4JLRA 2X4SB 5FB8B 5JMRA 5FA3B 4LL9A 3DXAB 4EKXA 2RHEA 3SGEH 4R0LB 5EO1B 3QQ9D 3OJDB 4XHJC 3UCRA 5ID1A 4PJAB 1U3JA 2F53A 3HUJA 2CIIA 3WDJA 1MCSA 5KSAD 3MCLL 5INCB 4IMKC 4H0GA 5HPMA 2ICWI 3RVVD 3AMKA 1AGEB 2D0GA 3SKOB 1XGUB 1NUGA 1D6VH 1WSST 1LO4H 3PWLB 4KKLD 3DTXB 1WZ1L 3MTRA 3QPQC 1PY9A 1RIVL 5D1ZA 6CGTA 2NXZD 1I8LA 1N3NA 1NBYB 4N9OB 1J87A 3NAAL 3T0VA 3D2UB 3MUHL 2NY0D 1J0IA 2VDPH 3VWJB 3PDOB 2EXWD 4JFPA 1Z0NA 3RX5A 4NUJB 4NJ9H 1HQRA 4JDVB 3VXUA 1A5FH 1DBJH 1PVHA 2ED9A 3BN3B 3ZL4L 1I7TA 1FN4B 1UZ6F 5E9DE 3GSWA 3SGEI 4R7DA 4G7VH 2G5BA 4L5FH 1JGEB 3UEZA 2DQUL 1NDMA 4NBZB 3VD3A 1OVZA 3KPSD 4GRWH 3JZ7A 1GGTA 3EYQC 4BSVA 4CVXA 4KZDH 2NY1B 5MHSE 1JF1A 3U46A 1YYML 3MRRA 3F7VB 1X6LA 4G43A 1Z6JT 1X5AA 4WFED 4JFED 2DAVA 3LKRB 4IS6B 4OT1H 4WI3A 1J5OL 1CT8A 2P8PB 1WIUA 5DS8B 5F7DA 1Y0LB 3G5XA 4M1CC 5F9WC 4AH2A 4URTB 1IGJB 4KK6C 3IS0X 3R06B 2YPLD 2WSKA 1TJIH 4PRPD 2QSTA 3QJHB 5MENA 3SDAB 3FFCA 1N8ZB 3KLAA 3K2UL 3CU7A 2BJMH 2HRLA 3A67H 2XZAH 3F8UB 1QFOA 4NNXB 1KTDB 1CIUA 3D25A 3NCMA 1RK1B 1IC7H 1JUFA 2OI9B 3DMMD 4RGOL 5LAXB 3ZHKA 3WFCL 1P1ZB 2ZOLA 2AJZA 2J8UF 4PJ7E 5DJYB 1P4LB 1V7ML 2HJLB 1MCPH 3O9WC 2YD2A 1VEOA 4DOHB 3EYSH 4Z7WA 4D94A 1A6VL 4ZNEE 1HHKA 2AXFA 3MRLB 4M61A 4NZDA 2DJ4A 3NOIA 1GC1L 1YY8A 3ARBA 2BOCA 4JG1L 3VCLA 5HI5C 5BZDA 3SE3C 4EI5A 1Q0XL 4MQ7B 4PRBB 5DVMA 5E5UB 5I1IH 5IM7B 2F5BL 2NLJA 5EO0B 2FRGP 1XCQA 4HPOH 2EDTA 1VA9A 4YDJA 4GAYB 1AR1D 3BJLA 3SDCA 4O51A 3GBLA 1FJ1B 2XZCL 4OAWA 5ESQB 1VPOL 4V2BA 3S35L 4ALAH 5ESAB 3HMXL 3RBSA 5J12C 5MEQA 4TNWF 3L3OB 1IRAY 2CR3A 4OLVH 3JV4B 5D1QB 1UWEL 3IDJA 2UVFA 1QHPA 3G04B 5DDHB 4W6XB 2P8LB 1A6UL 4JZJA 1MI5E 4YPGA 1YNTA 1BZ7A 4LP5A 4CVZA 2XTLA 3QIUC 3GBMH 1I7ZB 5D72L 2W9DH 3RWCB 3MLSH 1XGTA 3DYOA 4HWUA 3ECBB 1DQJA 3DBXB 4JO2L 1JMXA 2CLRB 2WUCL 3GZKA 5FKAA 2EYRB 4MDJA 3RDTC 3REWA 2D0HA 5EUOF 5C09A 2YD9A 4ELMB 3S35X 1ES0A 3BD4A 3RVUD 1JWSB 4N5UA 5GGSA 1QRKA 2MQ0A 3BSZL 4Y2OA 2R2EB 5FA4B 1ZLVH 1NLBH 4G8EB 1F97A 2NW2A 3MRNA 3O6KH 5TPWL 4X6CE 3B9KC 4WHDA 1R3LA 3H9SD 5SWZD 3PJSA 4GAFB 3ZLQC 2A6KA 5L2KD 4K3EH 3NIFF 5T5NG 3VXQA 1U8IA 3QQ3A 5B39G 4MA7H 1NFKA 3BIAX 4TUOB 5FDYA 4IRJC 1TVHB 4PG2A 3HMWH 3HNVL 1F3RB 3CK0L 4PJGB 2XN9D 2HT3D 4PR5B 4RWHA 4NNYB 4X5WB 2IF7A 1YEIH 3ARDB 4M93B 3DLQR 3EUUA 4JREB 3DV6A 2CIKA 4NQEE 4NQXB 2Y72A 3G9AB 1NAKL 5FDWA 1MAMH 4KI1A 4L8CB 5E99L 2GITB 1A6WL 3P4LA 1OP3H 1WIPA 3DURA 5ANMA 4XNYL 5FUOL 5GHWH 4OFDA 4YHKL 4NKOA 5DHYA 5BV7L 4XH2A 3CSPA 3LH2H 4L9LC 1R5IB 3IU3B 4QY8B 3VFOA 1JF5A 1CQYA 3ZDYF 4ELME 3ILQD 1MCCA 4YX2H 4OB5H 4H1LH 1BQLL 2NW3B 5IJKA 5ACMA 1AHWC 3C5ZA 4LVNC 5HHXH 5L88L 1LEIB 4NDMA 5DEFB 1ZHNB 4O9HH 2AEWA 4Y16A 4YO0B 4ZAKC 2WMPA 1ZHBB 3L5HA 1P4IL 3ARGD 1WVZA 2V6HA 3QI9A 5GZND 2DTML 4CL7A 1FVEB 2VLJE 3GI9L 5DWUH 4LNRA 1KSRA 3IDIB 3MRJB 2KZWA 5I8OH 1A0QL 2XQBL 5B3JF 1X3DA 2Y36L 3L3GA 3LKSA 1P4BL 4L4TE 1XGPA 4MD0B 4JFQB 3T3MF 2C4FU 4Q6IC 1JN6A 2B4CH 3V7AE 1ZHLB 4I0PD 1NGZA 3GGWB 3HI1B 1AO7B 3I6LE 3TNMB 1X44A 4I2XB 3WHXA 2M26A 2JCCF 3NN8B 3VXOA 5FOBA 1BP3B 1KCRL 1QLEH 2NR6C 5E8NA 4BUGA 4U1IB 4KK5D 3GIZH 3B9DA 3CLFH 1BAFL 4MGXA 1KPVB 1CGVA 2CXKA 3L5IA 3O6FC 2MQ3A 4UTAL 1RUPL 3CXDL 2IQAA 4ETYA 2HTLD 4Z7QE 1KEMH 2DQIH 3HE6A 4F7MA 3W81A 1BVLA 4OCNC 1A7NH 4LRNL 5I1EL 2ZCLH 3L3DA 1CDBA 1WV7T 1CL7H 4ZS7H 1VKXB 1YEHH 3MV8A 4JKMA 3VWKA 5I2IB 2V17L 1ZVSB 1EGJL 1F4XL 2EC8A 2C26A 4KJYB 1N6QL 3L5WB 3KYKL 3OF6D 4OJFL 4D0DA 2JB6B 5F9WB 2F53E 3HUJE 1C7SA 1G7JB 4YBLC 1ZLVK 1K8IB 3KYNB 4JVWA 3SDYH 3GK8L 1UB5B 2R2CA 2H2SC 4Z7UF 2E3VA 1WT5A 3C60D 4ZXBD 5A16B 1HINL 1LQSR 3QIBD 4I2XE 3WEXB 2DS4A 1AIFB 3KXFD 1BQHB 5JHLH 4P5KA 1D9KB 2EE3A 1X6NA 4H88L 2NXYB 2D7PA 1MFBH 3DX8B 5IJVB 1J0KA 1IGCL 1JPGA 1HIML 2WBJD 3CUPA 3O9WB 2IQ9L 3HKFA 4YFEA 2Q3ZA 3D18A 5JHDB 3L3KB 1SJEB 3Q6FA 4JFDB 4GFTB 3KPMA 1LDSA 3QG7H 4GSDH 5IB1B 2HKHL 3Q48A 2GW5A 1CL7I 1MCWW 3SDDA 2FR4B 4JR9L 3SE9H 2HT4D 1TIUA 4G6ML 3BYYA 1BEYL 1MWAH 2EXYC 3P73A 1OAYL 1I9IH 1UG9A 2QQQA 3M8OL 3QXDB 4E41A 3SCMA 2OZ4L 4HGKC 1B0WA 3ZE2E 5HHOB 4P4KC 4HQQH 3VFSB 1GZQA 4WW2F 5CLWA 4GG8A 5J12B 3OKDA 3OGOE 1I8IA 2IMNA 4KI5C 1VB9A 1ZT4B 2PW2A 2FX8L 4ZPVA 1QFUL 2DKUA 4NN7C 3KS0J 3MJGX 5DJZB 4XBGB 5CIPB 3BVNA 4X0KB 5CEZH 1DVFC 1YMMB 1H0DB 5LQBL 4QF1A 5TH2A 3QIUB 3FT3A 5GRJH 5C9JB 3HI5H 2ZUTA 3TBTA 4M1GH 4X9HA 1XF5A 3BP6A 2IMMA 2HFEA 4N8VG 3WJJC 5AYUL 3IDGB 4Y7MA 3ULUF 3MV01 3O6MH 4HK0A 4KPHH 5D6CB 3NCYP 3F12A 4JKPL 3RDTB 1INQA 1MH5B 1RIUH 1Q0YH 3K4AA 2K9UA 5JOFB 4GOSA 5KSBF 2DRUA 2YPKA 3MNWB 1FYTD 4IOIB 2NY2D 2PYFB 3MRFB 4OTXH 2R9HD 3N06B 1C5DB 2JJSC 2VZ1A 5ID0B 4Z7WE 5JOPE 5IROC 1MHPL 3UYOD 4S1DD 2BZDA 4U1HA 3TT1L 3B9KB 4I5BB 4FFZL 4PJBA 3S37H 1QTYT 4NM8H 4QHUB 2AJ3A 3VXSA 4CNIB 2IH3A 4LQ1A 3O4LD 3HC3L 3RVXD 4DZBB 1P53A 4L3CA 1TJHL 2V2TB 4WUUD 4JANB 4HXAH 4IRJB 4ZUWA 5BQ7A 3OPZL 5KOVC 2P24A 5DFVD 4OFPA 1UCBL 1KLUB 3JTSA 4LSSH 4N8PA 1BFSA 5HDOA 4CU8A 5EBWB 2QQKL 3NVQA 4AEEA 1GVIA 4JPIA 2Y6SD 5DQDH 4ZDHB 2R2HB 3C9NB 4U6HA 4JRYB 4Y4KC 5BW7C 2VZOA 1OGTB 2X4RB 4NO0B 1F3DH 5E8DL 2FWOA 1S9WB 3JV6B 3UPRA 2OJEA 1IM9A 2PTTB 3E3QC 5IBTH 4L9LB 4EDXB 1T89C 3PGDA 2ARJA 4Y8AA 3EGSB 5FCUL 3BQUD 4LHUB 3S4SG 4RFEB 4R97C 1CGSL 4Y4HD 5IHLB 4JQVA 4ZS6D 4HZAA 4ENEC 3WUZA 4LVNB 4JRXD 5FGBC 4AEHL 3MLWH 3I9GL 4L8SA 3MLTB 5D2LB 2G5RA 5CBEB 3EYFA 4J2XA 5DHXB 4JZOB 3HNTH 1CXKA 1BF2A 2BNRA 2QBWA 1E4XH 1KEGH 4XPTH 4EI6A 2Q8BH 5L0QB 2ZUQC 5D7JD 3CPLA 4Q6IB 3QUXA 1XGYH 3KPTA 1LD9B 3QHTC 2P43B 35C8L 5IG7B 4TQEH 2FJHB 2W60B 5JW5A 3F5WB 2YD5A 2CDFB 2F54A 1ED3B 2DF3A 1T3FB 2DJUA 1P7KA 2LVEA 3PWUA 4HIEA 3MSPA 4C83B 1F4YH 1KTRL 5CD3B 5EIIB 1P84J 3Q5YA 3QT2A 1V3LA 5DJ6B 2VDPL 4YWGL 2VJXA 1B0RB 1WEJH 4NJ9L 4XVUD 1T4KB 2AKRB 1FNEA 1A5FL 1C12B 3O6FB 1DBJL 1L7IL 2GT9A 2MCG1 3VG9B 1X5GA 4AIZB 2F58L 4G7VL 4U2YA 3T65B 1DQTA 1E4WH 4Q9CA 4BUHA 4NCDA 5IESH 1MUJB 1J18A 1E4XI 1BFTA 3MV9B 5CD5C 4JY5H 4KZDL 1FNSL 1RQ5A 2EIZB 2CJUL 3VH8G 3HAEG 1SYVA 2EKJA 2G9HB 5HD8C 5HVFB 3TA3B 4M4RA 3IGAA 1OAKH 4L4VD 2I24N 3DX7A 1FORL 4YBLB 2AEPH 2GHWB 3CMOH 1X5YA 4HF5L 4KAQH 3FQWB 3EDFA 2J5LC 1W8NA 1NCCH 4YXLL 1TLKA 2FJGB 2OZ4A 1JHKH 5SWSD 4Y0GA 5HGBA 4JM4H 5DMJB 1G6RL 2BJML 4KHTH 1R5VA 4G6KH 3A67L 3FQRB 2XZAL 3FN0H 2GJ6D 3VI4F 3P4OB 5JPNA 4GO6B 3BZ4B 5D70H 4EN3C 3PL6C 4KVNH 2ICEB 1MFCH 4BH7A 4NHCH 1OAZH 3VMNA 5KVFL 4OM0L 3T4AB 1MCPL 4GMTH 4OD1H 3MRHA 4AY0A 3EYSL 5T1DH 3WNMA 4F80A 2CDEB 4Z0XB 3KWWA 3NCCB 3O8XC 2XFXA 3QZWA 2A2QT 2GTZB 2V5SA 2W0FA 5DFWH 3MV9E 4KRNA 5IWLA 3OXSB 4X7TB 2VOTA 4HPOL 3LHPH 1CLYH 4IRSD 1BPVA 1S7VA 4XC3L 4WNQA 4AMKL 4NN7B 4XP1H 2GK2A 3MV8E 1NFIA 4QRSA 3TCLB 3ZHLA 1X5ZA 4GG6B 1JMZA 3GIVB 4M6MH 1X4YA 1IAKA 2P5WA 3BH8B 4MAYC 5DMIH 1GSMA 1HHGA 2APBA 4HIIB 4YR6B 5ACZA 3GDBA 4UZGA 1LHZA 3GBML 2D7OA 4D0BB 2W9DL 1CR9H 3D0VB 5DD6B 2G2RB 3NCYS 4QT5B 3MLSL 4M6NL 2JF1A 4OCMC 4F9PA 4CW1A 3VDBA 4ODVH 1ZK9A 1T66C 1F11B 1JFQH 2PR4L 3QQ4B 5TDOA 2WAHA 4V1DA 1TENA 3BIKA 2DMCA 3L3JA 3EKCA 1I9JH 4GRLD 2D4DA 2FEDD 1E28B 4KK9D 2X4NB 4OZFB 2YN3A 2P5EE 3TO4C 3LQAH 5DD5H 3FN3A 1A7QL 5C0AB 2NY7H 2IPKB 2VLKD 5H37G 3S5LA 2FIKB 1JPSH 5HGDB 3BDYH 1X5XA 4E5XA 5BO1L 5JLZA 1NLBL 1R5WB 3LPGA 4L1HA 4YK4C 3T0WA 3O6KL 4QXUH 4NM4H 4QRRA 2IANE 5CZXC 4KI5E 3MC0A 1KBGH 2DYPB 4PB9L 3TBVB 2DQFB 5GIRB 5T3XH 4E41E 4ODTH 1YECL 2VQUA 1ZGLP 3IJSB 4MX7B 4UUJA 3ROLA 2VWEC 1K8DB 4MA7L 3Q3GA 1BJMA 1G9MC 3I50L 5CAYB 3HMWL 1FNFA 4ZFFA 1RZ7L 1QOKA 4G9FD 1XF4A 1EBPA 1BFVL 4WTZA 2LAAA 4N90D 1TVBB 5H94B 1HHJB 1YEIL 4Y4KB 1J0JA 2X4SA 5HHPB 4LF3B 2CK0H 4GT7A 1MOEA 4JY6B 3DXAA 5DRNB 3OKKB 4G8GE 2H6PB 1CDUA 3WIIL 4XMPH 5FHAH 1WBXA 4OLWH 4K2UL 5EN2B 5ABDE 2IFFL 4KFZC 3LH2L 3FAWA 4R97B 5I8EA 2UY6A 2YXFA 3EJZD 5E6IC 4U1KB 4YX2L 1U93B 1Q94B 5DJXA 3O2DL 4XPFL 3PWLA 3REVA 2BSSB 5HHXL 2BXYA 1DBAH 3D48R 4XAWH 4N0RA 4NQVA 4YJZL 4MS8C 1KXQE 3OR7B 4U1JB 5IFAH 2WWKT 1ZTXL 1NBYA 1TQCC 2WBWB 4UINH 1EFXD 1T5XB 4LLAA 1FL3A 3KPOA 1I8MB 2VERN 2AEQL 3BAEH 4JDVA 4PJBE 3VA2C 4LSRL 1CGUA 3V0WL 5I8OL 5C0CD 4OKVA 1K5NA 3VXSE 2E9IA 2VMFA 4RX4D 5LGHH 2B4CL 3QQ9C 4NKQB 3U0PA 3UDWA 4LKCB 3D85A 3S7GA 1SMOA 4ODHH 3LKNB 1XT5A 3RNKB 2WUBH 4JFOB 4X7CC 3W0WB 2I26N 2RR3A 3FHQA 3TZVB 3QDGD 3VXMB 1D6EA 1IKFH 5HYQB 2OR8A 1IGMH 2IG2H 3RVVC 4PJ8D 3F7VA 1Q9OB 1FBIH 2O5YL 4X4YA 3TFKD 1IM3B 4S1RH 1UB6B 4NQCB 5MEPB 3LKRA 3FOLA 3KPPA 4M9OA 1EXUB 2YOCA 1M1SA 4R26L 1G6RA 1EHLL 3CX2A 1HN1A 1IGJA 1KTLB 1QA9A 4FABL 4R4BA 4XPAH 3OJMB 2NY0C 1KEML 1IILE 1MFDH 4RMTA 4XC1L 4V2CB 5F71A 2VDNH 4TTDC 5ALCH 3QJHA 3UTTA 1N8ZA 2YS4A 5E5RB 2ZCLL 4FA8A 4YHNA 1XIWD 2EO1A 4ZS7L 3BZEB 1I3UA 1J8KA 4U6VH 2EIEA 5FYKL 5D5MF 1KTDA 2GYSA 4L3EA 1RZGA 4PJ9A 4Z77B 4PYGA 1MRFL 5DA0B 1QBMH 1P1ZA 2N1KA 1MQ8A 1P4LA 4I48A 3GMOB 4UV7H 5B38B 1A9EB 3GJFK 1Q9KB 2J5LB 1BLNB 4WIQA 5M7QA 5IMLA 1L0YA 5IT2L 3VFMA 1TCRB 3VXNB 5LGKA 3QCUH 1YPZA 3UTPE 4MQSB 1S5IL 3EYOA 3W82A 3T09A 3BEWB 4KKAD 2P45B 5JHLL 5JPMB 1YMHB 5TE7H 3IJYA 2WK2A 4MCYB 3PIQB 4QWWC 4EN3B 5IM7A 1MFBL 2AI0H 1KCUH 1KT2B 5HVGB 1FJ1A 5ESQA 5D7SH 4KKCC 1ZLUH 4XCFH 1KIQA 3L3OA 1K4DB 43CAB 3IFLL 2PYEB 3JV4A 4GSDL 2W9EH 5D1QA 5C0IB 3OAZH 3QEQE 5ILTH 3SE9L 4MJIB 3TBWA 2YKLH 1I9IL 3DGCR 1U3ZA 3T0EC 2OS7A 5D7LD 5I30L 4OGYH 4X99A 3U7WH 4PGEB 3IRPX 4HQQL 1MY5A 5C0DB 5KW9L 4HIXH 1PGRB 5F72S 5E24E 3MMEB 2V7HA 1B3JA 1BBDL 4GUPA 3RU8H 3MGOB 3S36H 2XIDA 2NTFA 2YBRB 2AV1A 4PRIB 5DI8B 3OR6A 1WITA 4MAYB 2V2XA 1ZAGA 1E6OH 5CEZL 1DLFL 4M1DH 3KGRA 5FGSA 2QHRL 4MJ5B 3FQTB 1MCEA 2EDNA 1T03L 3A6BH 1CD1A 1RJYB 3TP4A 1RJLB 4CDGC 1PEZA 1S5HA 3RZCB 3ARYA 1HDMA 1ONQA 1D5MB 1WZMA 4OZIE 3G5VB 2OQJB 3B43A 3OSKA 2R2BA 4KPHL 3X13A 2QADD 1IE5A 3PQYB 4RMRA 1Q0YL 1GOGA 2A6JA 4H20H 4HS6B 1OHQA 4NQDD 3D1MC 3TO4B 4NRZA 2XY2A 1CDGA 4LAQH 2HVKB 3F7YB 4PJ7F 5CEXA 3DUHA 3K80A 1OY3B 1QNZH 5BZWB 2JJTA 3SGKA 2PO6D 4NNYA 4X5WA 4YK4B 4CJ0A 2ICWB 5F8RC 4Z0BL 5HGHB 2R0LL 3HAEH 1UEMA 1JE6A 3TT3H 2FH6A 4L8CA 3PNWA 3V0AC 1WCBA 3RBGA 1UC6A 2WBKA 5C2UB 4ZUVB 3TVMC 1XF3A 2Z92B 3RVUC 4HXAL 5F88A 4LPVA 1CD9B 3O2DA 2HFGH 2CXGA 4P2RD 4QY8A 4DN3H 4GH7B 4PUBH 4LSVL 4R2GC 4AT6B 1ACZA 1QR4A 4GMSL 3L1OH 4Y19B 3BN9D 1BBJB 4L9DA 3F62A 4G6AC 1LEIA 4KXZI 5DEFA 1ZHNA 1MCNA 1NJ9B 1XGRB 2SEBB 3KYMB 5TQ0L 1NCAH 1IJ9A 5IBTL 3HHRB 3EYVB 2HT3C 2NY4B 3MQIA 1Q72H 5IOPA 2DIBA 3L5XL 3MBEA 1DQDL 5DQJA 3IDIA 5E6IB 5IB4B 3MRJA 1WQVT 2J6EA 1RZ8B 2BSRB 4PBVC 4M00A 4RGND 1GGBH 3LKQB 4KMLB 4K71C 2B4CC 4J4PD 1QR1B 4U6YB 4K23L 4QXWA 3MLWL 4WV1C 2I07A 1ZLUK 4JN1L 1TQCB 1JYWA 3WS3B 3QEHB 4F7EB 4WI5A 1IVLA 2VWEE 3ILQC 3VXRA 4F7CA 3CJJA 1KEGL 4PREB 4XPTL 2Q8BL 1IZKA 1FQ9C 2YD8A 3UBXA 2Z4QA 3DRTB 4NNPH 4X6CF 2JELH 1XGYL 1JTOA 2QSQA 3LPFA 4TQEL 4KHXH 1OB1A 5C0JB 3MBXL 1FNGB 2FSEA 5B8CC 2AJYL 2VITA 4DGYL 5D93C 4KUZH 5IVXB 5ERWA 3SE4A 5KSAB 2XI9A 2AJVH 3LMJH 5HGGS 3EIFA 5IF0B 5F7HA 1WZKA 3BH9B 2KUTA 3HG1A 4GRWB 4Y5VC 1EZVX 4DFIA 1IGYA 3TN0C 1J8HD 1TZIB 4DAGL 4F7PB 1V3KA 5GZOD 4HH9B 1WEJL 5KAQG 1D5IH 1ZVSA 5CSZA 3V6ZA 3V4PL 3G5ZB 4YZFE 5E94A 5F7UA 3ZMRA 2VSCA 3FB6B 5CMAB 4OZHE 1HCVA 1R3HA 1Q9LB 3AROA 3ZKMD 2D7MA 4D3CH 3DSFH 4NRYB 3S8WA 2NY0B 3ULUH 3EOYG 2I27N 1OLZA 3DRQA 3PV7A 5IQ9B 4PJEB 3QXWA 5H37H 1H3PH 3RPIA 3CDFA 4RAUB 4KK5C 4RISL 4JY5L 1U8OB 1BQHA 1D9KA 3K2MC 3WV0A 4BSWB 2ADJA 1NCWH 2AK1H 4WCYL 1C08A 1J10A 4OZ4A 5IVOA 5CKAA 1OAKL 2YD6A 1DTUA 2I25N 2B1AL 3KPSB 4ODSL 4WY7L 3E8UH 4XZUA 3CMOL 4OCSH 4EUPG 3QNYA 3FFDA 4JFDA 2FZ3A 2PCPA 2R1YA 1NCCL 4S2SB 2B2XL 4BQ8A 1JHKL 1FFRA 2F19H 4JFEB 4JM4L 1K3ZA 4JM2C 4KHTL 1B4JH 1S9VA 1UACH 3LSOA 4KJPD 4JFYA 3OV6A 3ME0A 2A6DB 3GSNB 5E2WH 4DVBB 5D70L 4NFDA 4X6DB 1NCBH 2YPLB 2J88L 2QKIB 1MFCL 1YJDL 1EHNA 4PRPB 4R6UA 4LFHD 4NHCL 4M48H 2A73A 2Q87A 2DLFH 2Z35B 4GMTL 4OD1L 3IXAB 2EDJA 3C60C 2FHFA 2E9WA 2QQNH 3QIBC 3OL2A 1UYWL 4X6BB 3IDNA 4X6EB 3M1BA 5DO2C 5T1KA 4X0KA 5HJ3B 3DMMB 3SJVA 4P57A 3T0EB 3TPUA 4PJFA 3INUL 1LEKB 3KJ4C 3C6SB 4AQ1B 2C3VB 5EOTB 3QA3B 5C9JA 3DSNA 3ESVF 3LHPL 1FE8H 1NC4A 3QISA 3L7EA 1CLYL 2DDQH 4Z7QF 2IH1B 4FTVE 5JXEA 3WIHA 3MFGB 3IDGA 4MA3B 2HT4C 1PDKA 3KLDA 1KCSL 3QNZA 4PLJD 1U8PA 3QUKB 5DRWA 2ZPKH 4L3EE 4J7RA 1GXEA 4K3GA 5EORH 5FYJU 3GMLA 5C07B 3HUJF 4R96B 4KQ3H 3D39E 5ICYA 1CLZH 32C2B 15C8L 4ODVL 4M7LL 3AU1B 1LK2A 4QHUA 4CNIA 1JFQL 5ICXB 1T22B 1BZQK 2BOBB 3DX6A 1JF6A 1CICD 2XA8L 4OFKA 3WKMH 3CAFA 4Z7VA 1I9JL 1R24A 3QWOB 2CPCA 1W72H 4XNQB 4OFVA 1MLBA 1KLUA 3SGJC 2R8SH 3NTCH 2DWEA 5DD5L 2ZSWA 5I74C 3H7LA 5D6DC 3PP3H 3T0EE 5EBWA 4U0QB 4NIKB 4I3SH 3G08B 3BDYL 3PWVB 1GGIH 3HRPA 4LCWE 2J7LA 4OQTA 3W2DH 4JRYA 3ALWA 4LKXB 3MRKB 4NM4L 2IPUG 2Q1EA 4HPYH 1KBGL 3U0WH 5E4IA 4P4RB 4WI8A 5C0FB 1PLGL 5JOEA 5T3XL 3JV6A 2VXQH 5FYJD 1DEEB 2V7NA 2F74A 2YEZB 4O2EA 2ATKB 2XNAA 3I02A 3ZE2F 4AEFA 1RUQL 2O5XH 1VACA 4R2GB 4MHHG 4S1DC 4PGJA 4RFEA 5DUML 1N5YL 5C07E 5JMOC 1F6AB 4H1LB 4ZUTB 4KMTH 3V8OA 2RB8A 4P2OD 3H42H 1MJUL 3MLTA 4RZCA 2EO9A 4PY8J 1QSEA 2DQCL 3OB0H 5DFVC 4KRPC 4XMPL 1JIBA 5ELIA 1NGWB 5D1XD 2XN9B 4OLWL 1XZ0B 5FM5M 2YUZA 3MZGB 1H3WM 3M17B 2YA0A 4PJIE 3SKMA 4Y5YC 1LD9A 4ZTPL 5IG7A 1OF2A 4UDTA 2I60H 1OGAD 5KTEL 1PZ5A 3ARQA 3F5WA 4WV1B 5GGVH 1HHHB 1T3FA 4F2MA 2VAJA 2EEAA 1DBAL 1H5BA 4PJCB 3ULVL 4LLVA 1JK8A 3DWTA 4OIAA 3FB5B 4WI2A 3CNKA 5GJSH 3VJ6A 3BQUC 4UINL 4GLRH 4XAKE 4Y4HC 4XXDA 4Z7WF 4QGTA 1B0RA 4ZS6C 3VFUB 4UDUB 5AWNH 3BDXA 3BAEL 3UJIL 1QLFB 4ODWB 4DQOH 4X7SL 2BNQD 5LGHL 4GW5A 5FHBH 5B8CB 2OSLB 3TWCL 3MR9A 4I4WB 5D8JL 3ARGB 4ODHL 1B6DA 1CFSB 4PV8A 4JFXB 4Y5VB 5DC4B 4ZSOB 2WNGA 1MUJA 3KYOA 2X9YA 3D3VD 3TN0B 1DL7H 2E7CA 5F1IB 5K59E 5D7JC 1IGML 2OTWB 5F6HI 5B39A 3AXLB 4NO3A 4ELKB 3BKCH 3TA3A 1GPOL 4S1RL 4MD5A 5GS3A 1F2X