4N0YH

Structure of the hepatitis c envelope glycoprotein e1 antigenic region 314-324 bound to the cross-neutralizing antibody igh526
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
226
structure length
222
Chain Sequence
VQLLEQSGAEVKRPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGWINPGNGNAKYSQRFQGRVIISRDTSATTSYMELSSLTSEDTAVYSCARDRGFDLLTGHYLGLDPWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Hepatitis C Virus Envelope Glycoprotein E1 Antigenic Site 314-324 in Complex with Antibody IGH526.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords IGH526 Heavy Chain
total genus 44
structure length 222
sequence length 226
ec nomenclature
pdb deposition date 2013-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n0yH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n0yH01
1JNNL 1I3UA 1U58A 2KQMA 4LSUH 3HI1B 2YBRB 2GTZA 2RCSH 1YECH 2DDQH 3QEHB 1BD2E 5K9QI 4X9HA 4YHKL 1N5YH 2PXYB 3ET9F 1C8PA 5DEGA 3MJ9L 4F3FB 1KXVC 5E56A 4ZUTB 1Z3GH 4XVJH 2IALA 3LMJL 2G5BA 5T3ZD 2W65A 4HWNA 3X11B 5GIRA 2B7DT 2AGJH 2R56H 5HI5D 1N64H 4P2RB 3WUZA 1WAAE 1ZGLM 2FIRT 3SGJA 4UU9A 1FO0H 1MCWW 5TQ2H 3HI5L 2A6JA 1FDLL 4FMKA 1T7YA 3BPLB 2R2EB 4I0PD 3RZCB 1OW0A 1L0YA 4NC1E 3QFDB 1TJGL 3VDCA 4NZTL 2NXYB 5LAXB 3WLWD 3WLWC 1I3GL 4WUUD 4NKIL 1A7NH 3V5DB 4Y4HD 15C8L 5JXAH 4L1HA 1WICA 4IMLA 1OP3K 4KQ3H 2DF3A 4QNPF 1FNLA 2EYSA 1L9NA 1SVZA 3BX7C 1BEYL 2GW5A 4FS0A 2DBLH 1NCBH 4KVNH 5KBNC 4PLJC 3MCKA 1KPVA 4MAUH 3MRFA 1FGNH 4JO3H 3C6SA 4OFYA 1I8IA 3GHBL 1J87A 2BDNL 3ZDZF 4ZO9A 1IEHA 1B4JL 1RZIB 1PQZA 3VXTB 5H35B 3TP4A 2BXZA 1CGSH 1A5FH 4XPAH 4HG4K 4LCCC 2GITA 2HFGH 1ED3A 2GK0A 5D7SL 1AGDB 2YEZA 4ZQKB 2ATPB 1XGQA 5IP4A 4J4PD 2PYFA 3SJVA 3HMWH 4I9WD 5D7LB 4UIKH 4OM0H 4KMTH 5CD3B 1FVEB 5FGSA 3LRSB 3R0MA 3QCVH 3QIWB 4JQVA 4HWZB 2QKIA 3T0WA 4D9QD 5I1DA 5C0GB 1P1ZB 3TA3C 3BZFA 1S7QA 3TVMD 1N59A 5CKGA 2AJSL 2E7LC 1IRAY 4LP5A 4X6EA 4TSBH 5F1NB 1J1PH 4QRPA 5DJAA 3O3BA 1E6OH 1A5FL 4NRXA 4WI6A 4IRSA 4L4VD 4OSUL 5IMKB 3O41B 2AABH 1P6FA 2NY2D 4JFOB 1YYMH 4UBDD 1H5BB 3PDDA 2F53E 4XBGA 3U30B 2X4SA 5T5NG 4KKNA 1R3KA 3ROOB 1V7MH 5I1HH 5JUEL 4MJ4A 5C07E 1DBJL 1IJ9A 4L9DA 4YBHA 4HC1H 4E5XB 1MY7A 3E6FB 4H26A 4KH2A 4GMTL 5KW9L 3LKQB 1VFBA 1E4JA 4B50A 4L3CB 2W91A 4AT6B 2J8OA 2F8XC 1W0VB 1J10A 1IKNA 3GEWB 4NKDA 5DA4A 4JFZH 1MFBL 5CJ8A 5IGXL 1KTLB 1JGVH 4OGAC 4OGYL 4FZ8H 3BOVA 3KYNB 5K9OB 5ESVB 5F9JA 4PTUB 5DO2D 5TH2B 3P4OB 4YHMH 3UJJL 5J89A 1KPRB 3SQOH 4XWOD 5F6IB 1IM3A 1ZGLA 5C0IA 1RFDL 3VFWA 4XTRC 3C09C 2YSSA 3NABL 3G6DH 4L8BB 3VH8G 1EJ6A 5GGTL 5INDB 4F7PA 2I07B 4YFLF 5J3HD 5FO8A 5MP6L 1I7RB 3L95A 1T22A 1ZVSA 2X4PB 1Y6MR 1OP5K 4HKZB 1DCLA 3VD9A 5E8EA 3P11H 1HYSD 1BBJA 2VABA 4ZNCD 3HC3H 4AL8H 4KXZI 3UROR 2XI9A 4G7YL 1VPOL 1UXWB 2VDOH 4NM4H 4P2YA 3BEWB 4YR6A 3S6CA 1C5CH 5CINH 1YMMB 3O0RL 4PJ7B 1BOYA 3HCVB 4NZUH 1GZQA 3KNBA 3HRPA 3I6GA 2C3HA 3U46A 3ELAT 3NCYS 4U1NA 2MFNA 5FYLE 3LQZA 4JN2A 2ZOKA 3A67L 3PL6B 1EMTH 2XQYG 3BPOC 4TVSa 5IT2L 3OL2A 3LDBC 5TDOB 4HMCA 4I2XA 5ACLA 3U0WH 5ITBL 1KIUA 2RGSA 5DJ8B 3RVTC 5L7XL 4YHPA 1MIML 1T83A 4P4RA 2ITDB 3K2UL 3MBXL 1U3YA 3JTTA 3DUSA 3U9PL 3VI4E 3O3EB 2D7QA 2VAAB 3EDKA 1S5IL 4MJ2A 2P44B 2AEQL 2CGRL 3OJ2C 2H2SD 3IDJB 4LRNL 3RL2B 4F33A 3S4SG 5DHVB 3IJSA 5E5RB 3KLAA 3HTLX 2BSTA 4MZ3A 5JLZB 4J3TA 2B1HH 3W5NA 4J23A 4M8QA 2Y7QB 3CPLA 3E1F1 5DFWH 5IF0B 4ERSH 4XPBH 3U0TB 4UNUA 1IKFH 1KNOA 3QNXA 4K9EH 5EOTB 2ADGA 5F8QC 5CWSA 4ZTOH 2Y6SD 2QADD 5TDNB 1LEKB 3LEXB 2COQA 4WFHE 4LPWA 4U6HA 1I8MB 1L4IA 1PEZA 5CZVH 2N56A 1Y0LA 3WFEH 5I1JL 4P3DB 3J8F7 3BWAA 4DKFH 2R4SL 5I71C 1TJGH 2V7HB 3UAJC 1A0QH 3WSQH 3LKRB 2HJLA 1B6DA 4UB0L 4Y7MA 1KG0B 3T8XA 4H0IA 1JHTB 3W81A 1HSBA 3HI5H 4EUPG 2R0LL 4JDZA 5DMKB 4H25A 3IT8D 4PB0L 1S7TA 4WI5A 3V6ZA 1FFNB 4P9HH 1H3GA 3NOIA 4BFBD 4XBEL 1J88A 3SKJH 1EEZB 1QVOB 1NC4B 2OI9B 3GSQB 4LPYA 4MXQD 1A1MB 4PJGF 3ULUH 1KLGA 2PO6B 1ADQL 3BIBX 5HGDA 2WBJD 4YO0B 3KLHC 2ZUXA 4HKBA 5F88B 1UYWL 3U4AA 4KK8D 1QR4A 2Y25A 1CFBA 1LO3L 1JWUA 1A47A 2XTLA 3S98A 2Z8SA 2ITCA 1F4YL 3CCHB 1MJUH 4JPWH 2CK0H 1VKXB 2J5LB 2F54B 4LLWB 4HUMB 4HSQA 3VFGH 4KZDH 2ZCKL 3QWOA 1NC2B 1EJOL 1RJLB 5JORA 4GOSA 5GGRY 4TRPL 4IDJL 3N1GC 4Y1AA 1UC6A 2EKSB 3QO0B 5IESH 1M05A 4PGEB 5MI0C 4Q0XL 3C6LB 1N2RA 4WUUE 2HJKA 4U1GB 4ODXB 4JFQA 2R39A 3OKMB 1JZ4A 4WFED 5F7DB 3MUY1 4IS6B 4MWFB 1NGPH 1FZOA 4XP4L 1TVHB 3TO4D 4MD0B 1ACYH 1TENA 4KU1A 4MQSB 1FNSH 3SCMA 4XCCL 2P24A 5GSRA 3BJ91 4GW5B 3WS3A 2WP3T 1AGEB 3QT2A 2P5EE 4GLRH 4BSVB 4D9QE 2WMPA 1LE5B 1JV5A 1MQ8A 1U42A 3F7QA 1J8HB 1DBAL 3DYPA 1CBVL 1GGCH 1JWSB 6FABL 3SDDB 4M4RA 1FBIL 1YEFH 1FNFA 3DXAA 4KKAC 3U4BL 1ACYL 3HC4L 1MCOL 3QAZB 1IZKA 1RJYA 3EBAA 4PLNC 1AQDB 2AJ3B 2FBJH 4Z7WF 5T1KD 3ARFD 2EH7L 3KR3H 4JG1H 3U7YL 3VRJB 1WBZA 5IB2A 3MV11 1ZS8A 1U8JB 1GAFL 1NCCL 2IANE 3U7WH 1U6AL 4PIRF 4JFEA 2D9QB 3MJGX 3QI9B 4U0RB 1FCGA 4GUPB 1MCSA 3RI5K 4JQXC 4PJEE 3N1QC 4DTGL 1EBAA 4XC1H 3LKSB 3MV9D 2B0SL 4LNRB 1EBPA 4MQ7B 3W0WB 1RD6A 4OB5H 3V0WL 1R5WA 2P7TA 1IVLA 3VXRB 4JO3L 2JB6B 2HTLC 1ETZA 3VCLB 4KHTH 3C5ZB 1A6WL 2A2QT 4J8RB 5ISZD 1N6UA 3VE0B 3FB6B 2X4QB 4NQDA 4Q6IB 3ZDYE 1IARB 1YNKH 2GJ6D 3DGGA 2F54D 3BMWA 3IXAA 1VEPA 3BZEA 3SY0A 3CH8A 5B39B 4M7KL 1PG7L 2QR0B 1BQLL 4RFEA 4YE4L 4HLZH 2AAVA 4NQCD 3AAZA 5CJBA 3MA9H 4FTVA 2BVTA 3MXVH 5D93B 1KB5B 2G2RA 3H8NA 5EU6A 4G80B 1XGPB 1U3HA 3L3OA 4CU6A 3QUYA 2WLYA 4JGJA 4Z0BL 1DLHA 4YFLI 1AIFB 1K8IB 2EH8H 4CDGC 2NY0C 5KVDL 3RX8A 1WAAF 2DWEB 3SN6N 4Z18A 3MV01 4NKIH 3NFSH 4LGSB 5F7NC 2WUCH 2DMKA 2DQHL 3FN9A 3PE9A 5ETUB 4ZXBA 4OUUB 3FFCD 4K23H 1FGNL 3S97C 5F44A 3RUGB 5CGYD 1HQ4B 3QO1B 2C9AA 4CBPA 3BGFC 4YGVB 4G9FD 2NY1D 1CFTA 2MTPA 3H9SA 2DKSA 5T3XD 3SCMD 5C0RL 1X4YA 4S1QL 5E7FA 1BGXH 4P4KC 5DMGC 1FRGL 4GAJH 3V0VB 2D7OA 1DEEB 3SO3C 3ILPB 2HLAB 1N0XL 1S7VB 3MUZ1 4L8SA 4PBXA 1NFDE 5CUSL 2VZ1A 5JIIA 4HZLA 2BOCB 1W8NA 2D7PA 4X99B 1OAXL 5B39G 4ONHA 4K71B 3CXDL 4M6ML 4MLSA 4N0YL 2F9BT 3DI3B 4WHTB 3W0WE 3NIFE 4O9HH 3KPOA 3ZTNH 1J18A 1FFPB 2ZUVA 5E08L 2I24N 1BF2A 2GT9B 1UB5A 2G60L 1EO8H 3U2SA 4WUKL 4K7FA 1G7QA 1U36A 5F3HB 1FIGL 4JFDE 5T1MA 1KTRL 3UJTL 2A0LC 1MH5B 1NEZA 5KS9B 1ZA3B 1T2QL 1T4KB 4JPKH 1C1EL 4XCNA 3V9FA 3JUZA 4A2LA 2EIEA 4GG8A 5IG7A 3ZTNL 1MREL 3S4SA 1DBKH 2IADB 2WSKA 4GMSL 4Y4HB 4Q9QH 3VXSB 3EOYG 5BW7A 3VW3H 3CVHL 3QWRA 1LO5A 3IETB 2MQCA 4HLJA 3ARDC 1JN6A 3MZGB 1GC1L 4EQ3A 2YPVL 4E41D 2IBBA 4BUGA 3DTXA 2PTVA 3ULVE 3P77B 4MCZB 2HLFD 5DEFB 1P4LB 3MFFA 4PJBF 5DD0L 3AY4C 5IIEB 1HINL 2LVEA 3NFPB 5IEKB 5BOPA 1XFPA 1YN7A 4RMQA 3S5LG 1OWWA 3WFHB 1FORH 5D7JB 3SOBH 3VXQA 1OGAA 5AWNH 3RGVC 1CE6B 1K4DA 2D7MA 2B4CH 3EJJX 3MUGA 4GJTB 3QDGE 1D5BB 5ITBH 4IOIA 5JDJA 3QDHA 4YIQA 5J11C 2P5WB 3KPSB 1KCUL 3MA7A 1MCWM 4KK9D 1N6VA 3RPKA 1ZANH 3FFDB 2H3NA 4Y5XB 1T1WB 5IKCB 1GCFA 4ZTPL 4Y4FD 2BOBB 5CBEA 3ALPA 3H3PL 3G5XB 3IFPA 4OQTL 2BY0A 3JWOH 3RWGB 5EBWB 4HV8A 4DCQA 1U2CA 2VQTA 5L2KB 4JKKA 4KK9C 3I9GL 4PGCB 3WJLC 2FGWH 3GRWA 4OCNC 2IPTH 1RK0A 4P9ML 2FEEL 5CGTA 1JGLL 4OI9A 3ARGB 3CJJA 1NDMA 1FLRH 1HYSC 2JJSA 4Q2ZA 4PTTA 4FOMA 5I0ZA 2VXSL 1VACB 3PP4H 2XG4A 3OV6A 3DMMD 4TUOA 4EXPX 3ALXA 2V5SA 3S7GA 2BNUA 1MCDA 1MF2L 2D0FA 5IB3A 3RAJH 4OD1H 1MFAL 3CFKB 3FCTB 4YPGA 1AGFA 3ARDB 1SJVA 3TA3D 3QUMA 3EYFB 1F58H 3WFCL 3BZDA 3PWUA 5EBLA 3RKDD 3WXVL 5SWZD 5BXFA 5B8CA 3L3GA 1EUTA 1MI5A 4I13B 4ZD3L 1X5GA 2BVOB 5E8NB 1MAML 3MGTA 2IFGA 4QF1A 4Y4FB 4G42A 4NIKB 3ULUL 5BO1L 1ZXQA 1X5HA 3MGAA 4K94H 2BVUA 4NUJA 1ES0B 2XACC 2JE8A 4X6CA 2UYLA 4DFIA 1FG2A 3AS3A 1AY1H 2JK5A 3KDMB 3MLYL 5IK3A 2AERT 2AVGA 3TJEH 2OP4H 1EH9A 2AEPL 3X14B 2BVPB 5TPWH 4WWKB 4Z7UE 1VCAA 2DWDB 5DZNA 4FQXD 4G6KL 3VFUA 1V7ML 1IGIH 4J6RL 1CQYA 4K71C 4KJWC 1MJ7L 3TPKA 1A6WH 1CFNB 5FA3B 3O9WC 3BYYA 3T4YB 1F6AB 4ONGL 1CE1H 3B2UC 4DEPC 5FYJU 1LP9E 2EDYA 5CZXD 2HYMA 2HT2D 2DIAA 3MNZB 3MRHA 2NY2C 3L6FB 3H0TA 1G7MB 2OR9H 4HW6A 1JRHI 5F8RC 4AEFA 2AEQH 3GZKA 3T1WA 4HWBL 5KS9F 3ARFA 5IOPA 3LKNA 3L3HA 4HUKB 7FABL 1LWRA 1LD9B 3S5LA 4P23D 3GI8H 2NY4B 2KUTA 2ICES 1NCAH 3UJIH 5EIIB 1SY6A 4P23B 3H7BB 4FQQB 4E0RA 1A1NA 5GISH 1FL6A 4WNQB 1FYTB 3IFOA 4W4OA 2FX9H 1ZT7A 3IDUA 4NQCE 1BFOB 4GRWF 1OB1A 2HVJB 1OGAE 2CUMA 5KG9B 4HIXH 3TNMB 3T2OA 4DN4L 4HS8L 5BJTA 1CGVA 2GHWB 5MENA 1CZ8L 5F93C 5FYJE 3V6OA 5JNYA 3LS5L 2GYSA 3NZ8B 4ELMB 3U6RA 4LCCB 1FV1B 2JCCB 4R7NB 3OKYA 4RMSA 1HEZB 2R2HB 3B9VA 3FN0L 4CVXA 5D1QC 1UM4H 4XAWH 2ZG2A 2BRRH 1GIGL 1DUZA 1KEML 4NQDE 4XC3H 2ENSA 4JCLA 4P23C 5J06A 3RWFA 1YMHA 1YEEH 4ZFFB 2NY5C 4U1HA 2X2YA 1HI6B 3QUZC 5H37H 4JRYD 2YRZA 1CLCA 5IWLC 3WN5B 3IAQA 1NQBA 3IDXL 5I16A 1NJ9B 3D3VD 3WXVH 3QCUL 1L6ZA 3TIEB 4AYFA 3K74B 5LGHH 1P4BH 3ZE2E 1F4WL 4M43L 4JM2B 1NDGA 4WY7L 1RZFL 3CZFA 4G9FE 1EERB 1CFSB 1IL1A 2X09A 3VFTB 4EUPB 3BGMA 2OX5A 5HDBE 4FZ8L 4F9PC 3J7HA 2Q3ZA 2NXZD 4ODVL 2QQNH 3EYSL 3ULVF 4ZFZA 2NLJA 3D5OF 4ALAL 4X6BA 2C3WA 2VLRD 3OXRB 4R26L 4KUCF 4LDOB 5EO0A 5F89B 4EOWL 1KF9B 4PJ5A 4BQBA 3WFBH 3CLEL 4DOHB 3OKLB 1DR9A 3BP5A 3UO1H 2FR4A 1LGVA 4JJ5B 4I3RH 3AGVA 4OD2B 5JUEH 3I02A 4PJXA 4N8VG 3ULVL 1MCRA 3C08L 1XGUA 3VWJA 1UACH 3V7AG 5EUKA 3VGAC 5BMFH 1CDHA 1KFAL 2G75A 3HI6H 2X05A 4NT6A 1HOCA 3QDGD 3PWVA 4R90L 4DKEL 3MRPB 1JK8A 3O4OB 2IAMA 4YXLH 3IJYA 4OGAD 5DRXA 2L7UA 4JRYE 5L8KB 5E6IA 1FYHB 3QSKB 4N0FA 5DJYA 1OAZH 5JW5A 5C0AE 1FNAA 4KJYB 4X5LA 1FZMA 4TQEL 4MDIB 4APQC 2HTLD 5D7IF 3PWPA 1JUFA 4XVTH 1GOGA 4X6FA 4Z7VF 2DJUA 5TGBA 2P8LA 5BVJB 2DLIA 3WS6A 2MHAA 1LO0H 4U1SA 4PJDE 4N0UE 1WCBB 4M6MH 3RBGA 3O8XB 2L0DA 4RAVA 1QLRA 3MR9A 2UWEB 4TUJB 3FONA 4HGWB 3RDTC 1AO7D 5C0CB 2X4RB 1N4XL 4X4MA 2X5PA 4JM2F 1MEXH 1IFHH 5D1XD 3G6JB 4ELKB 4Y2DA 3VWKD 2E27H 4IMKA 1I7UA 5M95B 5LCVL 5HBBA 1A1OB 5EC1B 1W2KT 4Q9QL 2VLME 4J1UB 4BQ8A 2B5IC 4LOUC 1DSFL 3FO0H 1I8LA 2NZ9C 5F7LB 2BHZA 3D9AH 3VFSA 5F21B 4LSQH 2OJZH 5GRWA 3CSYA 4Q0XH 2XTJE 3VWKA 5I66A 3QNYB 4K07A 1YYML 1MRFL 1QTYT 3LVEA 4RRPA 1E28B 3BKCH 1JZ5A 1UB6A 4NO5B 4AQOA 3WDIA 5HHMD 1OAKH 4N0YH 4LDLB 5HTSA 2HJFB 4YDLC 5HGAB 1J8HE 4ZPTA 5GGUA 1NL0H 3EYSH 4PRHD 1FGVL 4HS8H 1ORSA 2W92A 2GQHA 1TETH 4LP4A 4X9FA 5DD6A 5KSVA 4JFFB 1VADB 5MHSE 2XZZA 3OX8B 3QDAA 2JJSC 2VC2H 5TE7H 3FRUA 5DMIL 4YHYC 5FYKU 3MV8D 1NCDH 1CTNA 2CRYA 5DJ0A 5GSVB 4BK5A 5EUOE 5F3BB 2NW2A 1QBLL 2WUBH 3DX8A 1KCUH 2ED8A 5EZJB 4XX1G 1NKRA 5A16B 3DRTA 1J1PL 3MV9A 2IH3B 3OKKA 4K3DH 4AMKH 3VH8A 4N8CL 4R4FH 3MOQA 2DM4A 3T65B 1J8HD 43C9A 1YY9C 3GRWH 3D0LB 4W6XB 3T2NH 3UX9B 1KYOK 1TQCC 1UXSA 1NAML 1U95A 3CFDA 5BV7C 3MOAL 4YDKH 5BV7B 3BIKB 4KKBC 1AE6H 1X5KA 2OL3L 5C6WH 5E9DA 1XGTA 1U8PB 4UDUA 4NWTL 5FO7B 5C08A 3ZE0E 2IF7A 5M94B 1DDHB 4LPUA 1CL7H 5LXGL 3PP3H 4G8GB 1UWXK 2UWEE 4HC1L 2XN9A 5EU4B 1A21A 2UZIL 1BZ7A 1JYXA 1N6QL 3ARTA 3VU2A 2H6PB 1WTGT 5C08E 1G7LB 1GGBH 5D7LE 4QYOA 3C6LD 3RX5A 3QDMD 1I1AD 4C54A 1K8DA 1G84A 5HDOA 5TE4L 1IGCL 3DV6A 5CEYA 4M61A 5CJOL 1ZWIB 1OVZA 4N5EC 1I8KA 3VG9C 3NIDE 1J0KA 2X1WL 3PGCA 1YNKL 1R3HB 5HHNA 5CEXA 1H8NA 5AG8A 4NRZA 4RFNC 5DFTA 4OCYH 3AMKA 5JW4Q 4U1IB 4NQSA 4XNQB 1F3JB 1OGTB 4L8CB 1T7WA 4YWGH 1IEBB 4NKMB 3BP7A 1JF1B 2EC9U 2Y9RT 5LKNA 3QZWA 4L29B 1OAYL 4TYUA 3CZJA 3MLRH 5JO5A 2DMBA 4LSTH 4Y5VC 5BO1H 5E8OA 5KZCB 2ZCHH 5SWSE 5FUZH 3GK8H 3K46A 5ICYA 4X80H 4M03A 4C4KO 5IW6B 4UZGA 5F9OH 4IDJH 4ZSOA 4JHAL 1KTDB 5LGHL 4XWOC 1K4CA 4ZODA 1HHGA 3GUTB 4AEHH 4NFDA 3DSNA 2UUDK 3L9RB 3FAWA 2BC4A 1VPOH 3I75B 4MD5A 2YK1H 4M5ZL 4HGMA 2ESVA 1QHOA 2R0KL 4GQ9H 3MCLH 1C16B 3OAUL 5GZNC 4ERSL 4P2QB 5FGCB 3V4VH 5D1ZA 4YQXL 4NQTA 4NZRL 2H2PD 1Z3GL 4XVJL 3SHSA 1UH4A 3QUXC 2ZUTA 5MEND 1OP5H 2OXHA 3GBNL 3L3KA 1NCTA 2DD8L 1YEIH 4S1DD 4U7SA 5DZOA 1IGJA 2A9ML 3TESA 2CLRA 1CG9B 3S35X 2XKNB 4D0DA 4HK0B 1AI1L 5GZND 2B8OT 3HKFA 4QRTA 3I6KA 3KYMA 4CN6A 5F96H 3GKWL 4PB0H 5DK2B 4XMLL 5I1JH 2DLEA 1JWMA 2ATKA 3AVEA 1FLTX 1MLCB 3RDTA 1Q9KB 4IDLA 2DJSA 2AGJL 3QPXL 1G6RH 2RCSL 3M07A 3QUKA 1CYGA 1X5XA 1JNNH 2DQEL 3VI3E 3GO1L 3P9LA 4LCYB 4PLKC 5KSBE 3BT2L 1FNGB 2WV3A 4XTRD 1R3JB 3MLPA 2H8PB 3DO7B 3SKJL 5FA4A 1KEGL 4FXLA 4GLRI 1YJDH 4P4KB 4K9EL 1P5VA 5C07B 3V6FB 3QB7C 2R1XB 1EV2E 3V0WH 1GAFH 3U7WL 3HR5B 2ZSVB 5EOCJ 3O2VL 4X7CC 5IMOA 5F9WC 1XF2A 3H2WA 4KROC 3LZFH 4JZNA 1LK2B 4JFFE 4KK6D 1E4XI 5I17B 2XRAL 3NPSB 4UQ2A 1BREA 3ULVC 4HAGA 3WE6A 4G6AC 1WCQA 4NQXA 1TTUA 1ZAGA 1YQVH 1SJXA 5DJZB 3BN3B 3NCJH 1BOGA 3OR7A 2F5BL 5IJKC 3BH9B 3CXHK 3KYKH 1EAPB 3RVWD 4DEPB 4F7EB 1I7TB 3FO1B 4P46D 4L3AA 2ARWA 3PWLB 5F7WC 5ID0A 3WFDH 1NBVH 2R2EA 3TJEL 2AXGA 4Y2OA 3OGCB 5C09B 5EN2A 4N0CD 1LO2H 3V79C 2DN7A 2X1PA 5DQ9B 5CILL 1RZGB 4I3SH 4GBXA 4JZOA 4BJLA 2EECA 1NGYB 4Y5YA 4JM4H 1HN1A 5KS9E 1A4KB 1G6VK 2BSED 1F2XK 3CFCH 4LHUA 3HMWL 5DXWA 3VFPB 1MHHB 4CUCA 1MPAH 4ZFGH 5IB4B 1ITCA 1UCBH 2HFGL 5I76B 1S9XB 2IPUG 4I8DA 4ZYKA 1FJ1A 2MSPA 2X41A 4KGLA 1M7DA 1INQB 2KQNA 2ZUUA 4RMTA 3EYUL 4MJIA 1B90A 1J1XL 4H20L 2A38A 1IGCH 3FT4B 3GMRA 4OZGF 2I26N 4PS4L 1MCQA 3CMOH 1DE4A 2UZXB 5HI5C 4YQXH 3STZB 2XPGB 5GHWL 3CVHH 1PVHA 3FQWA 5DK0A 1SYVB 1TLKA 4WW2F 3BN9D 1CD9B 1GC1C 5EA0L 4PJDB 4OZIA 1LEGA 3AU1B 4GAJL 2ZPKL 2WUBL 3TBTB 2X70A 5J6HA 4LLQB 3CUPB 5DJ2A 4BFIB 3SO3B 2I60L 1NCDL 3VXNB 5CJ5A 2WW8A 1PKQE 3LRSA 5C0BE 3LPGA 4L8SC 5B21A 1OLZA 1HXYA 3TYFA 3MGOB 1NUFA 4R2GC 4HPYH 1NBZA 1N59B 3QHFH 3TLRA 1KC5L 3UTQA 4NWUL 4F7TB 4QRPB 4UT6L 1AKJB 4G6JL 5FGRA 1U3JA 4EOWH 4D8PA 4WI7A 5E4EC 5IB1B 2V2WB 2A9NH 1WLHA 1R3LB 1SEBB 4YUEH 3QIUA 4MD4A 2ICCA 5FM8A 1YZZA 3OB8A 1JGVL 4HBCL 3INUH 5C07D 4ODVH 3HMXL 4GMTH 5JMOC 5ESAB 5D7IA 2DQFB 3QDJE 1NGWB 4G8EB 3H6JA 5I9QB 1WFNA 1JNLH 5I8EA 3QXAA 3BRGC 4MJIE 1J05B 4H8WH 3UPRA 4M7JH 5DLMH 4RGOH 5E5MA 3GJEB 2AJZA 2XWBA 3D0VB 4PP1D 1WF5A 3QJHA 3ARVA 4XRCA 4WW1B 3RGHA 4EVNA 1W0VA 2VDQL 4KUZL 2YN3A 3O9WD 2YXMA 1DN0A 2PYEA 2CH8A 2CDGA 4BZYA 4X5WB 3RWIA 2FWOA 1CK0L 3MXWH 3NFNA 5GGQH 5GGRA 1WWWX 4HUNB 5K93A 3R1GL 3HC3L 3JWOL 4P59L 3UTSB 4H1LA 1FVDB 5DD3H 4Z5RB 4DTGH 3FHQA 3BI9X 3W11C 4X80L 1LDPL 1XF3A 3R8BB 3BYTA 5SX5K 5MP6H 3SGDI 1SJHB 4JKPL 2XZAH 2Y5TB 3QULB 1FDLH 5C0IB 1P5UA 1G9NL 1QEWB 2R8SH 2R1YB 4Y5VA 3WFCH 4KTDH 1GGIH 2EYTB 1CDGA 4GKZA 2PR4H 5J12C 2C3VB 4X83A 4Z78A 1D6EA 5D2LA 1W72A 1J9CT 4G3YL 3QH3B 3DJ9A 4N68A 5EZOH 2HFFA 4G8FA 1CXIA 3MRKB 3BZ4A 1FNSL 2DKMA 2GTWB 3ZDYF 1T21A 1Q94B 4NHUA 3E6HA 1SJEB 2QTEA 4JN1L 5D5MF 2FJFA 3FFCE 3ARGD 3G5YA 3OG4B 3RUGF 2W0KA 3MRLA 4NYLA 1TZIA 5CLWA 4U1NB 5KN5B 4O58L 3I9GH 2NTFB 3PHQA 4U2YA 3MRCB 2ZJSH 4R7DA 4N0UB 4RFNB 4PRPE 4ONGH 5T5FH 3EOBB 5HPMA 3EHBD 4XXDB 1TCRB 2C1OB 3TCXA 4K23L 3PQYB 2R56L 3WEXB 1HHKA 2H26A 1CVSC 2Z93A 3MCG1 3ZKMC 3BGFB 1OLLA 1M7IA 4PG2A 1URLA 2OBGA 1MFAH 2XXMB 3CVHB 3BDBA 1MJ8H 5D5MB 4AIZB 3T3PE 2QV2A 5DVKA 5K9QG 3OPZL 1S9WA 2F19H 4LBEA 5BZDA 3ZKNC 3ZE0F 1ZHNA 2WBJA 1WC7B 3M1BA 5GRZA 5DURD 2R69L 2V2XB 4UBDC 4D0CA 5J9PA 1BJ1J 1WIUA 3V5HB 2EDKA 3HNVL 4V2BA 1U8NB 3CFEA 1Q38A 3BD3A 4D94A 2W38A 2HG5B 2H9GB 4JY6A 4KVNL 2FYYB 2EEBA 3K1DA 5D93C 5IJVB 4HS3A 5IV2B 2CJUL 4P5MB 2EO1A 5CWSB 4MMXC 4Y19B 4UB0H 5CZKA 4Z0XA 2JB5H 3B9DA 2AEWA 3VFRB 4LEOA 5L9DH 4MGXA 2XIDA 4QXGL 5I18L 3QFJB 3MOAH 5HHQA 2ZCLL 3GIVA 1DLFL 2DICA 3MJ8B 3M8OL 4GRWH 4YLQT 4DGYH 1IAII 3AY4A 4LVHB 3VXRE 2E5EA 5A2IH 4WIQA 4MQXC 3TV3H 3R06B 3E8UH 2V9QA 1KLUA 2C4XA 3V6ZB 4HMEA 4HJJL 4R0LA 5MEOB 2AJVL 4KRPB 2DYPA 4DUXA 1MHCA 1IQWH 2VLJD 3C5SB 1BX2B 4K7PX 3IKCB 2XKUA 3DETD 4RFOL 1AGCA 4RWYL 5HYJB 5JPNA 1IM9B 1E0OB 3MBEB 2C7UA 1T0MB 5T1LB 4G9FA 3QEUA 3GJFA 4I18C 3EW3B 1QFHA 1TPXC 2F74A 4QHMB 4JG0L 4Z77A 4JPVL 4G6MH 1ZANL 3SDAA 4J3WA 3C9NA 3AXLB 3O9WB 3NIDF 4OLWL 5F1SA 4QRQA 1OSPH 1CI5A 1ZHBA 1QRNE 1NC2A 25C8L 1ZSDB 4Y8DC 1G9MH 1FAKT 2E6PA 4BH7A 2Y72A 4AM0A 2FO1A 3TVMA 1FL3A 2RIKA 2Y06H 3N50A 5HGBB 1HCFX 3O11A 5E4EB 1HHHB 1Z9MA 4KKLD 3Q0HA 1JFQL 1A2YA 5DD1H 1C7TA 5DFVC 2PTUA 2UUDH 3B83A 2I9LA 4XCEB 1V8HA 3FOMA 4CDHA 1NLBL 3BKYL 4MDJB 3BPLC 3O0RH 4JPVH 2A73B 1TJIH 1B6UA 4FQ2H 4GKNB 2IPKB 3FQNB 3MRGA 1QKZL 4JFDB 4CW1B 1M7XA 4X7EC 1JGEA 5DJ6B 4K94L 3QP3A 5I1IH 32C2A 4KI5C 3CDGB 4S2SA 2BVQB 5FHAH 3ECBA 3WUWB 2R23A 4JM2C 3VWJC 4Y16A 3DVNA 2BJML 2H32B 2P5EB 3DROB 1P2CB 4P9HC 1YN6B 3IS1X 3QDMA 3RWCA 3B9KB 4EZMA 4H88L 4EDWH 1R24B 2PKDA 4O2FA 4YHOL 5EPMA 5EUOB 3WKNA 3RNQA 1JNLL 4I1NB 3RWJB 1KULA 4W68A 2PCPB 4X7DC 1FCCA 4Z8FL 1WVZA 2AJXL 2GCYA 2BERA 3T3MF 3NCFB 3CK0H 2ICWB 3AC0A 4LHJB 3G6AB 2XOTA 5JIPA 2AS5M 3WJJA 2WQ8A 4FABL 5JDSA 3OKEA 6CGTA 3QJFA 4M48H 2DLTA 1BZ9A 1N5AA 1MVUB 3A6BH 3QIWC 4GKSB 2JB5L 1T5WB 1XF4A 1NBQA 1RUML 4OGXL 4OZIE 3I84A 5DRZA 4LLMB 4NQVA 4JFED 2J1KA 1RJZA 4YXKH 2D03L 4MJ5A 2R4SH 3DVGB 1H3UA 2EC9T 3TN0C 4C56D 4J2XA 3R1GH 1L7IH 4UQ3B 5CZVL 5B3NA 3CK0L 4EJ1C 2DIJA 4HFWB 4Z7OF 1YUHB 3QI9D 1EDQA 1AP2B 1T1XA 1UWGL 5FV1L 1CE1L 5BOZG 4X6CE 2RB8A 3TT3L 4JRXA 4RISH 4I9WE 2J4WL 4JO4H 3D25A 1VGKB 1ORQB 3X17A 2OTUB 3PG2A 4P2QE 4UT9L 2A74A 3G6JF 5FGCE 3RGVD 2FLRT 1F42A 5B39A 3TN0D 4R2GB 4UTBL 2G9HA 5D7JD 5C9KA 4RFEB 4YAQB 1H3TA 1A64A 2FO4A 1X6LA 4FTVB 1RUPH 3K8MA 1FH5L 2PW2B 4NO3B 2Q86B 2HLFC 4K55A 2IALB 3D18B 3HPLA 3DYOA 4XAWL 4OT1H 12E8L 4N1HB 4MNGA 3SKOA 5DR5L 4JVPA 3RTQD 5JW4R 2O5YH 3OKOB 4HWBH 4Z7QE 1D9KB 5GGVY 3OJVC 2P8MA 5I8OH 5IW3A 1MSPA 2VLLB 1A7BA 5FYLL 4NO2B 5FDWB 1T04A 5T3XE 5TFSH 4TSAH 2NY3D 3KVQA 1EO8L 3TO2A 4HJGA 4M43H 5DVMA 4JEGB 3X12A 3WNPA 5D1QB 3MV8E 3S37X 2DAVA 1OQXA 2YK1L 5BV7L 3B9KD 2VKXA 3DARA 2BJMH 4JO2L 3WIIH 3DBXB 4NNPL 1EXUA 3VXOB 3M45A 4QT5B 4RZCA 1BLNB 2V17H 4JCMA 5T1KB 2NX5E 1GPOL 4ZUUB 3CMGA 5C0BA 4KZEL 3DX6B 4ONHB 4S10A 3K81A 5JR1H 1INDH 1LILA 3EOAB 4P5TB 1RI8A 3NBNA 4Z7WA 1BFSA 3GSNB 3HZVA 4PGBB 4J3OC 1RUKL 3OXSB 1OOAA 2ATPA 5E2VH 3FKUS 3THMH 3BEVB 2VWEE 3SDCD 4ZO8A 4DUVA 1QA9B 4GT7A 5F3HA 1XR9A 3Q5YA 3G04B 4P3CH 4IIQA 2GJ6E 4LARH 2ARJA 2XZCL 3LY6A 1KB5H 1YDPB 3NPSC 4D0BA 3CFBB 3AFLA 4S1SL 2KZWA 1J1OH 1OQOA 1NFIA 1UJ3A 2LQRA 4OCYL 1BFTA 1EHLH 2X44D 2R15A 4XHQA 4JFHE 4P57B 4MNQD 3IDMA 5FKPA 4DVBA 3NN8B 3LMJH 3RQ3A 3QDME 1QR1A 3JV4A 2DQUH 4IRJA 1PYWB 2R9HC 4Z76B 2AP2A 3FT3B 4AEIL 4DZ8A 3IXTB 3ARED 4HIJA 2CO6B 3WIFB 4XCYB 4DKFL 1JNJA 5EORH 2NY0B 1JN6B 4IOFD 1KJ2H 1ONQA 1X5JA 3NA4A 4WU7A 4EI5D 3BUYB 3WFZA 4WHCA 1CDYA 4GAYB 4DKDC 3P77A 2DKUA 1S7RB 4RMVA 3WHXA 1CICB 5JOEA 4OZHA 3O6LL 4OZGB 5BQ7A 4NWUH 2PXYC 4YDJA 5C71A 1J5OH 1CN4A 1O7SA 3O45A 4L3CA 3KG5A 3RIFK 1JYVA 4HIIB 2DLHA 1BQHB 5GJTH 3IDGA 4PREA 4IOIB 4GS7B 1KJ2B 3IU4H 3QUZB 1KJ2L 1Q8MA 4LASL 1S7SB 3GSOA 4ZD3H 4K7PH 3OSKA 5LCVH 2C5DC 1UADC 3GSWB 5DHVH 4ZOEA 5SWZA 4OKVB 4L3EE 2FSEB 3DV4B 1WFUA 4QHLA 5ESVA 3PL6C 4ODWA 1NAKL 2D4FA 3RJQB 2FL5A 4P9MH 4X6DA 3VXUA 1IEAA 2NX5B 4TVPE 3MLRL 1RZ8A 3W0WD 4D9RD 4K8RD 3TGXA 2AXHA 4CU7A 4LKCB 3B3IB 1C08A 3BPCA 3KPQB 3ROLA 2R0WL 3REVB 5FCUH 2VXVL 4X5XA 2Z31D 5INDA 3JTSB 3EFFA 1K5NB 1OTUD 1I7RA 3P4MB 2YHGA 4UUJB 1W8OA 1UZ8B 4OLVL 5KTEH 3T0AA 4XPBL 2AV1A 1B0GA 5L0QC 3EJZD 1FVCB 3CDYA 2V17L 5AZEH 2VABB 4WW2B 4P2OD 2B1HL 4JREC 4WJ5B 3S88L 4WGWB 2Q6WA 1P84K 3O6FD 4HHAB 1EVUA 4CADA 5GXBB 3A67H 3CFKA 5DUPH 1ZEAH 4LEXL 4UILL 1KBGH 3BUTA 2YXFA 3ARDA 3CC5B 4KAQL 5AZEL 1E4KA 3L3JB 2QEJA 4B7IA 4OLYH 5D72L 3UTZB 4U6XB 1L7TH 2ADJA 1AY1L 3ZDXE 3PJSA 3HNTH 5ANMB 3QXDA 1KYOJ 1OT2A 2Q7YA 3TO4C 4N9GA 5A2JH 3L5WB 3TO4B 1TETL 2FECI 1TPXB 2ZG3A 4JQIL 4JLRB 4Y0GA 4HCRL 2CMRL 1JE6A 3EO1A 3MV7B 1A4JA 1YC7A 4K7PY 5HHPB 3FB8B 5FF6B 3TZVA 1BM3H 2M26A 5C9JA 3H9SE 4IRJC 5I75B 1AHWC 3KYOA 4BKLB 1GXEA 1FL5B 4JG0H 4X6CB 2DM3A 2WWKT 3B8SA 4XP6H 9CGTA 3HNSH 1T5XB 5F1IA 1DQQA 3L7EA 2XV6B 4GAGH 4XB8A 4LSDA 3O6FC 2Y4SA 5ERWA 1WITA 3QRGL 5E8PA 5IW1B 5C0AA 3KLAB 4PJGE 3MFGB 3OKNB 3TN0A 1QFUL 2W9EL 1Z0MA 3HE7B 3QIBC 4M8QB 4LQFH 1T1ZA 4PBWD 3RHWF 3O3DA 2X1XR 5E99L 3F58L 4R9HA 4OZ4A 4S11A 3U0TA 3GHEH 1WFOA 3FQUA 3DSFH 4NQEB 1V3LA 2JELH 1H15B 5GGSB 4LF3B 4KV5E 3SOBL 3IGAA 3BPOB 1MNUL 3PABB 4X0KA 3H0TB 2BP3A 1G7MA 2OSLB 5CBAA 3E8UL 4RQQB 2JF1A 4NKOB 2VDMH 5JXEA 1CXFA 3VJ6B 3MLTB 4MA8H 3PIQA 4QXTB 2JJWA 5CMAA 2B1AH 4NN7B 4ZUWA 1AE6L 2MPAL 2NY7L 4ZOBA 4QXWA 3CDCA 4XBEH 2WBWB 4L4TD 5BRZD 1PY9A 1IGTB 2YD9A 5D96C 1TTFA 3TJHD 5IBUB 4AEIH 3X3FH 3PQYE 3GB7B 1FYTE 1FL6B 4PJCF 3W39A 5J6GB 4AZ8A 2VJXA 4TVPH 3N85L 4MJ6B 4DGVH 3TVMC 1AQKL 2SEBA 5T33L 1YEDA 1Q9OA 3WIHA 2VXUH 2Z4QA 3TCLA 4YO0A 3L5JA 2CIKA 4HS6A 1D5XA 1GOHA 2PW1A 4JRXE 3CLFL 3WS6C 1R6VA 3BP4A 2BXYA 3MROB 4QWWD 2BSSB 1F45A 1UQSB 2P42B 3FFCB 1P7QD 3ZT5A 1A22B 5GRJH 4APQA 5JIKA 3ARPA 2F54E 1EIBA 3PWJB 2EICA 3IRZA 1MJJB 2E3VA 3MMEA 3HUJA 4OCSL 3QIUC 3RNKA 3GSVB 3AMLA 3EYVB 3IDIB 4CNIB 1NGPL 1CFQB 3D3VE 4XC1L 2VAJA 4LDEB 5D1ZD 5JR1L 4QHUA 1TVBA 1WZ1H 2HFTA 5FDYA 4JZJA 3GSUB 5C86A 4DW2L 4FXKB 4OF3A 5KSUA 4JDVA 1BFVH 1HSAA 3HG1B 1YNTB 2YPLA 3ES6B 4MCYB 4W6WB 2XWTA 1EPFA 4XNXH 2NYYC 3OZ9H 4FQIH 1DBJH 4NKQB 4M4PA 1JTPA 4U0QB 1B2WL 5GGVH 2EIZB 3DX7A 3OJDB 4L4VB 4ZUSA 1UH2A 4JGUA 3MLUL 4FFVC 4XP9H 1TFHA 1M71B 3IDNB 4M7JL 4HPOL 3O3AA 4U3HA 4M7KH 5D7KD 1JPTL 5KSBA 1BEYH 3MLYH 2APXA 3MRRA 2UZYB 4F7CA 4PJEA 1G0XA 1WBXA 3BW9A 3QPQC 2GFBA 4JZJC 3HMXH 3MJ9H 1K85A 3BP5B 4NZJA 1T89C 2FBJL 4OD3H 2IPUK 3MA9L 1IILE 2QSQA 3ARYA 3L5IA 1X5IA 2IH1A 1EFXD 3E0GA 3G5ZA 4R8WL 2QQKL 4R3SB 2VDRH 2W0FA 4M6OH 5J1AA 1A14H 4CMHC 3VRJA 1RIUH 1FO0L 1GVIA 1YPZE 3HFML 2APWA 4PJHA 5CHNB 1XGYH 2IBGA 3RVXD 3W2DH 4HH9A 3QDGA 2P1YA 2J6EA 4RISL 2NR6D 1NAKH 1CVRA 4JFXA 4PGDB 1A6UH 4UINL 5DJYB 5JW5B 3GMNA 4DGYL 1V3MA 4RRPG 1ZTXH 3Q3GA 2VUOA 3QUMH 5ESQB 5FK9B 2YD3A 4Y4KD 5CJQL 1UM5L 1ZKAA 5HYSG 1E27B 5ICZB 5DHYB 3HZYB 1NGXA 4LVNC 4IMKC 1OSZA 1S9VA 2R2BB 3HFMH 5E2UL 1WCBA 4NQDB 1IFHL 5I15H 3EYQC 3C60D 4H20H 5BS0B 1PKQB 4PRAA 2XYCA 3MR9B 4TUJA 2C3XA 2RFXA 4PJ7E 1X6NA 4MB3A 3S3SA 4F2MB 3IJHB 2X4TB 3NGBB 4F3FA 1A3RH 5CSZB 5EZLB 4ZNEA 4Y2DB 4FQJH 4M7LT 5I15L 4OIBA 1KB5A 3D2UD 5J56B 1G9NC 1U3HB 2A6JB 1PAMA 2W60A 5GS0D 5HI4D 3QA3A 4P5KB 3QFDA 2M1KA 4A2MA 5I8OL 5AZ2L 1UEMA 1NH6A 2WP3O 3VWKB 5C3LD 2QSVA 4UT9H 3C2AL 1QSFA 2BNRE 2GJZA 3ABZA 5D1XB 1IBGL 4PJ9A 3TBVA 4U7KA 2H1PH 3HS0B 4L3EB 2YKLH 2H45A 1NEUA 2OLDA 4R0LC 3SE3A 1B2WH 1S9KC 3CNKA 3RDTD 1N3NA 5ADPL 1U8HA 1JZ6A 1QSFD 1XH3A 1MFCL 4OIIL 5HGAA 4Y4KC 5GS0H 2VR5A 4K3HA 3AREB 1H8SA 3VXPA 5C8JA 3ZE1F 1ZLUH 4ZS6D 3BQUD 3N1FC 4KGJA 4S0SD 5EU3A 4HDIB 4Y88A 4BFEA 2UWEF 4PYGA 2ZSWA 4BQ6A 4QHKI 4LLYB 2P8PB 4XCFL 5CD5D 5IHZA 1EGJH 3RA7H 2GITB 1IQDA 2EXWD 1S9YA 4U6YB 3LD8C 4RAUA 3MRBA 4MA7H 5B4MD 4NNYA 3ARUA 1T2QH 4JANB 1RVFL 4D3CL 1WUNT 4Y2DC 3C08H 2QADB 3BPNC 1WZ1L 5IFAL 5AAMA 4BQCA 5FM5M 5C0BD 4XH2A 3QIWA 2K7QA 4HWZA 3BH8A 3GSNL 1KJ3L 3AUVA 3WLBA 4GRMB 4JDTL 1XMWA 2ADIA 2J2ZA 4I0PA 2Z31A 4DKEH 4L4TA 5BRZA 4Z7VA 5E4IA 3MYZA 1OD9A 3FMGH 4HUXA 1MCIA 2GAZB 3O2DL 4WUUB 2D31B 4DN3L 3TFKD 3IETA 2YPVH 4O2CB 5IVZA 7CGTA 3QQ3A 1OT1A 1QSEA 3U4EB 1I1FB 1G7LA 2QSTA 5D9SB 5GJTL 2DS4A 2AI0L 4GRLA 2ENYA 1C7SA 1BWWA 5I1AB 2XTJD 5CEYB 2QL1A 4QO1A 4HEPG 1R3KB 3ROOA 2P5WD 2X89D 3PGCB 1ZVYA 2PTTA 5L6YL 2Z91B 4OGZA 3TF7C 1CS6A 3D85B 1SYSB 1X7QA 1JZ2A 4X4XA 4PJXF 3SE8H 1OF2A 1A3LL 3WNKA 3ARSA 3PL6D 4MXWH 3T0ED 3CLFH 3GMPA 4EI5A 4YNYB 5DS8A 3BP7B 5GHWH 4WHYH 4YEEA 1BVKB 5DJXB 3SDXA 4AENA 4HUUA 3LSOB 4UTAL 4Q6IC 4XI5C 2X7LB 2FIKB 3QIUD 5KJRL 4PJGB 3U0WL 4GW4B 1J0JA 4PUBL 2Y6SC 4OQTH 4I48A 2VLKB 1UKSA 4PB9L 2J5LC 2E27L 4QEGA 8FABA 1OY3B 4UTAH 3B9KC 1IC5L 2WLZA 1Q9WB 2J8UA 1PD6A 4QY8A 1Z0NA 4HH8A 1FNEA 5H37G 3TT1H 1BPVA 3RJDA 4NP4H 4DCQB 2YA1A 2X4NA 1AXIB 1RZJL 1VDGA 3MNVB 2YPKA 4FFWD 3JSSA 1AC6A 4QOKA 2B2XH 5FO8B 5D6CB 5H8DA 3P0YL 1MREH 4LIQE 3U9UA 3T0EC 4KAQH 1JFQH 5DD1L 5IEHA 1K3ZA 1UJTA 2YOCA 1ZEAL 1NAMB 2AK4A 2WIIB 3LH2L 2OTWB 3T2PA 3MLZH 3G08B 4TUOB 5CINL 1D5IH 1AR1C 2CKBL 5BW7C 4YDVB 3M17B 1G9MC 1CF8H 2H41A 4OCRH 4PY7A 3SBWA 5HJ3B 3O2VH 3CLEH 5F6IC 5EO9B 5D7JC 5KOVC 1GGTA 3A6CL 1MY5A 2OZ4H 3VXMB 2ZOKB 1JGUL 2VH5L 3VFNB 3L3GB 1FHGA 7FABH 3JV5A 1QO3B 3UYPA 4F8TA 3WD5L 4Z7QF 5GS1A 3GMLA 4QF1B 4Y4FA 1KJVB 4WUKH 5C09E 2VXUL 4FQ1L 2BZDA 4A6YH 1F3DH 4PJ9D 4LCYA 1GH7A 3WDHA 5CIPA 4I4WB 1CR9H 3O3EA 3SE9H 5E2TL 4R96B 3VG0H 5FA4B 2BCKA 1LDPH 1DBML 2A83A 4TTDD 4MAYA 1FH5H 3GMQB 4OIAA 3X14A 4EN3B 4OLWH 2W9DH 1G9NH 3RL1B 2OR7A 3GHBH 2AJUL 3BFOA 4S1RH 1AD0A 5E94B 2YC1A 3MLXL 3OKDB 1KENH 4MA8L 5I2IB 1KCSL 4M1GL 1GC1H 2NNAB 4F80A 1S7XA 4NQCB 3CGTA 4ETQB 1F4XL 1BOGB 1MAJA 3OR7B 3QG7H 3HAEG 3QNXB 5EOTA 3T77A 1MOEA 5ILTH 5HYSA 2AJVH 5K9JH 5HVGB 5JA9A 3VXMD 5GPRA 3X11A 1JNHB 2WWMC 3HB3D 3D2UB 1DQDH 4RMWA 4B53A 5ACZA 1C5DB 5I73B 3C2AH 2FX9L 5CP3A 4AJ0A 5D70H 3KJ4B 2DBLL 2DLGA 5IROC 4MSWB 2XZCH 1CL7I 5E6ID 1ZHKB 4F15C 2DJ4A 3VXUD 2G5RA 4KJQD 5I76A 5I71B 4QRPE 4Z7UA 2Y23A 3BKJH 3RKPA 1EHLL 2XTJB 1INQA 1KC5H 4QHNB 2EDJA 3QPQD 2AJXH 1A9EB 1MQKH 2J88H 4PV8A 5DRNB 1HHJB 1YEEL 4POZD 4XP4H 1HKLH 4QCIB 1UENA 2X9YA 4QRRD 1FZJB 4E42B 3CCHA 2HKHL 4M93B 3DO3A 1VKXA 3LN4A 2JJTA 2QJDA 1I9IL 3BXNB 4ZMAT 2FD6H 2CDEA 3FHAA 4NBYB 5CJOH 1Q0XL 1AR1D 4ZDHA 1XZ0A 5EBMA 1UA6H 4JQXA 5SWSA 3QO0A 1ED3B 4LSPL 3KPLB 1AC0A 1ZV5A 4RGOL 3WN5A 3NIGF 4LKXA 4ZQKA 2OZ4L 4HK3N 1XGQB 1BQUA 4G5ZL 4NNXA 4ORGB 5IFHH 5M7QA 1NJ9A 4POUB 1BIIA 3I3EA 5IVXE 2FHCA 3HZMA 1QFOA 4HFUH 3GGWA 3T0EB 1V3KA 4KI1A 1SEBA 1IL1B 5ID1A 1MRDH 1KIRA 4BZ2L 4X6EB 4ZFOA 4N0RA 4NPYB 4QXUH 1WZKA 4NRXB 5DUBB 4ELMF 3EOTL 4IRSB 3RX7A 2DTML 4ODUB 1DBMH 3ULSB 4LSUL 3KPTA 3SQBA 5HHME 1J05A 2R0LH 1FBIH 1VFAA 4LNVA 5GJSL 2ED9A 5DTFA 3D0VA 2IAMC 4JPIA 1DL7H 3STBA 2GJ6A 4Y4HC 3DXAB 1DN0B 4JKPH 4R4BB 4ZO6A 2LVCA 3IYLW 3QAZC 2ZOLA 4UAOB 5H94A 5KSAB 4F58L 4JR9H 1CLYL 3A6CH 4HIEB 1KN4H 3RGVA 4CAGA 1EX0A 1FG9C 4WDIB 3ZZ1A 1J86A 3HC0A 3MX0A 5E2UH 5FKAA 4M7LL 1QRNA 3GBLA 2DQHH 5F9DC 3UTPD 1HIML 3KLSA 1INEH 2BRRL 3LIZH 4MQ7A 5EWIH 5DSCB 2RAMA 4PRPB 3VMOA 1L7IL 1LE9B 4JJHA 2VL4A 5F1OB 4FQXC 4NHCL 1KIPA 4MA3B 5DT1L 1UM5H 5HD8C 2DQJL 2R1YA 4KKBD 2YN5A 1MPAL 5K9KB 3ARBC 5E1AB 1KPRA 4WVRA 1GL4B 1X9QA 4PG9B 2R4RH 4NO0D 3CFCL 3JUYA 3EHBC 3VGDA 1T20B 1UFUA 2HWZH 4JFEE 1QG3A 3MRKA 4G8FB 4U1LA 4X4YA 1G6RL 3DGGB 3D39E 1B9ZA 2VZSA 3SDYH 4K3EL 3CMOL 3MREB 5I74C 3WFEL 3RVUD 1Q0YH 2QR0A 4D3CH 1A6ZA 5GS2D 3LKPA 4NHUB 2VITA 4GW1A 4LARL 1FRGH 1I1YB 4HKZA 3LN5B 4GBXC 1CIDA 2NZIA 3D6GA 1BBJB 4LVHC 5GIRB 5JA8B 1I7UB 2DQIH 4FQXA 4XPHL 3NACH 5DR5H 1XGPA 4OZFH 3CSBA 5CD5C 3PHQB 4OI7A 5HXMA 4IOSD 3LB6C 1S8DB 1DLHB 3NIFF 3D69B 5IMLA 1BJMA 4W70A 1H5BC 4ZPVB 4BA8A 3MRIB 5FIEA 5TQ0L 4OJFL 4PJBA 1WQVT 1WBYA 3DPBA 5GS0L 4H5SB 3LV3B 5FB8A 1RU9H 3PGDB 3ARRA 3LQAL 3Q1SL 4YC2C 1KLFA 1MNUH 4LLDB 5C08D 1INDL 2VDML 3HNTL 4WCYH 1EGJL 3QIBB 3T3PF 3MJ6A 1AFVH 3O8XC 3RU8H 4MHHI 2DQIL 3MLVL 4P3WA 3DECA 1H0DB 4CL7A 4U1JA 3C60B 2L7JA 4JFFA 4LBEB 4WFGE 5D2NA 4C57C 5BZDB 1T3FA 3GI9L 4OFYD 3ZKSD 1E4XH 2YD2A 1ZLVK 1LP9B 1RVFH 3H9YA 2BOCA 2HRPH 4DJMA 5F7FA 3VGFA 3V5HA 4OCWH 1TVDA 1AHWB 5EOCH 4G43A 2ZUQC 4JKMA 4LCIH 5ALCH 5DRWA 1FN4B 3MV9B 1QFPA 1AGDA 1QPXA 4PD4K 5EFIA 1C12B 4BQ9A 1QBBA 4MNHB 1GGUA 3QI9C 3T04D 1UM6L 5EZIH 1BD2D 4U31A 4PJCA 2ICWJ 1PY4A 3QFJA 2ICWI 4NZDA 4JDTH 4C59B 1QFWH 1CU4L 1D5MA 4Z6AT 1XCQB 4WWKC 4PJCE 3VXME 3QHZH 4K3JL 1FC1A 4HG4J 1BZ7B 4F7MA 4YX2L 5IVXF 3S34L 3ZE2F 5C0JB 4GFTB 4XCCH 5HYJA 3U4BH 4HF5H 1IC1A 1HHIA 3ARBA 3FT2B 4G9FB 4HKJA 4CVUA 3UP1A 2WINB 4OLVH 2CK0L 1HCVA 3MFFB 3MRMA 1MFDH 1WEJL 3QEQB 2LE9A 4U1IA 4XNQA 3W11D 3ME0A 4PP2B 5SX5H 5KSAC 4CMHB 3T2QA 2PYFB 3MOBL 3SJVB 2X4UA 3KS0H 3QZWB 4PRNA 5F97E 1OAUH 3OF6A 4YIQB 1OM3H 2P5WA 3RPIA 1HHHA 1MWAA 3MA7B 1QSFE 3GKWH 4KMQA 4RNRB 5L2KE 5IR1A 1I4FB 1P1ZA 3H7LA 5IBLD 5FO9A 5FYJH 2H3NB 1MF2H 3DURA 1IGFH 5F9JB 1A02N 4C56A 2BSRA 4XP6L 3MOBH 4PGEA 3P4NB 3C8DA 1U3ZA 1CLOH 1N2RB 4OFDA 4LCWA 4HJ0D 3QG6B 2DQTL 1J1OL 4B41A 3L9RA 5HHOB 3OKMA 1BQLH 5HHXH 4JFOA 4BZ2H 3JV0A 4IIQC 4P4KD 5DMGD 5EG6C 5E8DL 4G7VH 4XB7A 5CEZE 2Q76B 4PV9B 1I1CA 3CSPA 1P7KA 4NWTH 4C83B 5EPMB 4BM7A 4DW2H 1NCCH 3HR6A 1F4XH 4N0CC 3PGFH 1PZ5B 5A2KH 3T4AB 4NO0B 3WS3B 4MVBC 4NCDA 2HKFH 1AGEA 1GGBL 3NGBC 2Y07H 3BAEL 3W9EA 4KXZH 4LRNH 4X7TA 4M1CC 3I50H 1MVUA 3MRQB 4YZFF 4A6YL 4KQ3L 4DWHA 5C2BL 2XWJB 1T2JA 1JPTH 3EO0A 2D9CA 2FBOJ 3HNSL 3MYJB 4ZXBD 3B9EA 1A7NL 1N4XH 2QADC 3BPNB 4X6DF 1RJZB 1DVFB 4O51A 3BHBB 1QYGL 4XAKD 1DVFC 4MAUL 3VRLE 5DJ8A 1RIUL 3RIAK 2YWZA 5J1TC 2R1WB 5IVOA 4PJ8C 3UTTB 2C4FT 4YHNB 4LHUD 1MHEB 3KPMB 1CF8L 4F57H 1NBYA 2IFFL 4F9LA 1YQVL 3O6KH 2BFVL 3SPVB 2R1XA 2OTPA 4OT1L 3MLWL 4PJ7F 5ISZB 1P7HL 5IMOB 4LSQL 4OZHF 3MLXH 4OCLC 4U3CA 5JLZA 5L6YH 5DWUL 1NFKA 4NOBA 3ZE1E 4KK5C 2ZCKH 4M5ZH 1BAFL 2AKRA 4IEFB 1Z5LA 2JELL 2OMNA 3TH2T 3JWDC 3DIFB 1OCWL 3HI1A 2GTZB 2JTDA 4AH2B 5F7EH 3IVKB 1KJMA 3VDBA 4L9LB 3K7UA 2DM7A 4ENED 1VSCA 1W0WB 3F8UB 1I9EA 4QRRA 5JTWA 4KFZC 1JTOA 3SGEH 4GKOA 4OLUH 3LQZB 4OZFG 4GAFB 3ARFB 1A8JH 1PDKA 2IQ9L 4YHYB 4I2XB 3U0PA 4G80A 4OLEA 2V2TB 1VGEL 3SE4A 1AXSB 1A4KA 4MYWB 1LO4L 3O6FB 5E03A 3C5JB 5EO1A 5D1QA 5LAXA 3PDOA 2W9LA 4IRJD 1A6TB 1YNLH 1ZT7B 1JPGA 2AJYL 4WI8A 4XWGH 1I1AB 4OUUA 2IQ9H 4JQIH 2FJHB 1M7DB 4I5BA 2GIYA 5HGDB 2P46B 3T09A 4HKBB 1Z6JT 3KJ6L 4QRSB 5DHVA 2VDQH 2XPGA 4KUZH 1ZT1A 4QGTA 3GSXB 2FECL 4OZIB 3V0VA 5GS3A 3T1FA 1WFTA 1OTSD 2R2HA 4ZAKC 2E9WA 4PGBA 4FXGA 4M6NL 5MEPB 4CVXB 3C6SB 4M7ZC 1G7IB 3PNWB 4H88H 1DUZB 4JFPB 3CUPA 5IVXA 2D7TH 3FOLB 4PRHA 5CIPH 3CFJB 1LEKA 1FO0B 4XPTH 1RFDH 4L8DB 5TDPB 2Z9TA 1NMCB 3SDCB 1JTTA 3ZHLA 5FECB 4P3DA 3ZMRA 1B0RA 4FQHB 4MQTB 4OGXH 4P57A 1NBZB 2R0ZL 2HJLB 5DZLA 1OPGH 2HVKA 4KKCC 5JW4M 3RTQB 5MERA 3C6LC 1NGQH 3BSZL 5IFAH 1PYWA 1DANU 1HK6A 1NDGB 4Y4FC 3BZFB 2A6KB 4HGKC 4XNZB 5KJRH 1NBVL 3AB0B 2IAMD 3VFTA 4PJ8D 3BGMB 5ECJE 4K3EH 1CU4H 1F90L 2J6EH 5AYQA 1N8ZB 4OI8A 1QNZL 5C0CD 1YJDC 5JOFB 3VFOB 2PO6A 4MNGE 4CKVX 1WZMA 3FZUC 4EIZC 3ALWA 2F8VA 3LEYL 3LQMA 3UPRB 1A7QH 5F7KC 3OKLA 4DQOH 3O45B 1T03H 3GNMH 1INEL 1BQHA 3LIZL 5EWIL 1MFEL 1RMFH 2PYEB 1P7QA 4DK6A 4EDXB 2F5AL 2FWOB 2IANB 4U05A 2GSGB 1QSEE 2NW3B 3TBSA 1OHQA 5IB2B 2EKSA 4UIMA 2H1PL 3SE8L 2APFA 1CE6A 1K4DB 4KI5D 3FB7B 4QHLB 1WSST 2OJZL 4DGIH 3MRPA 1V5JA 3MTRA 1C5BH 1CICC 1UVQB 1B4RA 3BD4A 2B2XL 1G6RA 5MENE 3MBXH 1U8IA 3T0XA 5HI3C 2ZNXA 4TSAL 3EZ8A 1FZMB 4MDIA 3NZHH 4X5XB 4U2ZA 43CAB 4LPCA 5J0BA 4GKZB 4HXAL 4PRIA 5JQ6H 2BVYA 3B5GA 4GRLC 4J8RA 1YPZA 5GRXG 5GSRB 4YXKL 3VI4F 1QUNA 4BSVA 3X13A 4AG4L 2AV1B 2DI8A 4KPHL 1IGMH 2XXCB 3O8XA 1MQKL 4PGZA 1S7UB 1U92B 2NZ9D 3FTGA 3MRJB 3U79A 5HHMB 3ZL4H 3JVGC 1Q0YL 2I07A 2VSDA 4KRPD 1XCTA 1FE8L 5IB5A 1ZVSB 4PJ5D 3TNNB 3QQ9D 4JHWL 3G5YB 1IC7H 2EO9A 1DFBL 1NDMB 4JE4B 3MSPA 3P30H 1DQJB 4NM8L 3U1SH 2R29H 1KELH 4N1EA 2HFEB 1VACA 4QLRA 3M8OH 3RWEA 3DETC 2V5TA 2BY1A 1U8JA 4FG6C 1D9KD 4TRPH 5IQ9A 3SCMC 3L3IB 2GSIA 2NY1C 3SJVE 5HYQA 2Q7YB 4N9GB 3DLQR 5I66B 1WJ3A 3QNYA 4OCMC 1ND0B 3KNBB 1PLGL 4U6TA 4JN2B 4U6VL 5SV4A 1TZGL 3P9MB 2JB6A 4LCWD 3RIAF 1MI5D 2BVOA 4JPWL 1HQRA 4WWKD 4OGYH 2N7BA 1UM4L 3F7VA 1EO7A 3VE0A 5F7MC 5I1LB 4M6AA 5ERWB 2R0KH 3KJ6H 1I3RB 1UYWH 3OKNA 1MFNA 4G9DB 1U58B 4YHZL 3QDJA 1I9RL 2JJVA 1IM9D 2V7NA 3FO2A 3UBXA 4GSDL 3QFJE 5EC2B 5GSVA 3VRIB 5DO2C 4OZ4B 4LCIL 5ALCL 2F58H 2PXYA 2FYYA 4RCAA 1AO7A 5L2JB 4OV5B 4WO4C 4JRWA 5EB9A 1GSMA 3ARZA 5IHUL 2GT9A 1EO5A 2G2RB 5EU6B 3SE9L 3VFRA 4P2RA 1MUJB 5DD0H 4HBQA 1G7PA 3F7RA 4QRRE 1I9RH 3PIQB 5E70A 4W4OC 3VGAB 2BMKB 1U95B 3CFDB 1PW3A 1LNUB 2DI7A 3FAXA 2LFGA 5LXGH 3ZKXB 3R8QA 3BIKA 5DYOB 5TDNA 2WANA 1F58L 2CRZA 1YA5A 1NMBH 1I8MA 4J3UA 2EDFA 1FFOB 5CSGA 3G5VB 5CJXA 5IOPB 1HQ4A 3QO1A 4NJ9H 4XGZA 4XPAL 4PPTA 3S5LB 4I0KA 1KCRH 1CFTB 2UV3A 3T0EE 2SEBB 1U8OB 1H3XA 3X3GL 2CIKB 3HG1E 3PWNB 5J4MA 4JAMA 4Q9RH 1CXKA 1F4HA 1DBAH 3BQUB 5BZWA 1DEDA 2AW2A 2AEPH 2YZ1A 2APTA 1Q0XH 2P5WE 4ELME 6FABH 4PR5A 3S8WA 3TNMA 1CBVH 1Z9OA 4FQLL 5BV7H 2VNCA 4TSBL 3FO9B 3VXQB 1AI1H 1JPFB 2IJ0C 3OF6D 4YHIB 1MLBA 3UJJH 2A9MH 1FFPA 5JXED 4MLIA 1EZVX 2DBJA 3TVMB 3UEZA 1FL3B 5SWQA 5IFJB 1RK1A 1EFXA 3BKJL 2D03H 3ILQD 2ITCB 3U2SB 1CDJA 4G8IB 2AXFB 1AD9A 1DQTA 2IQAB 3EGSB 4H1LH 5E8OB 1WTLA 3SKNA 5H2BA 2QKIB 1P4BL 5I1DB 3PV6A 5D7LD 4FHBD 1AJ7H 4RGNB 4OFVA 1S7QB 2OM5A 5FOJA 3V52L 5B3JF 4LRIC 3N1MC 5DURB 2MKLC 5DJ6A 3MXWL 2KPNA 5IMKA 3KPNB 5EBWA 4NDMA 4UDTB 4Z8FH 1T66D 3B5TA 2ESVB 2ZCLH 4MWFA 3BN9C 4XBGB 1C16A 4MD0A 3F12A 2X4SB 2VZUA 1U8KA 5DGQA 3UXFA 3ARGA 1P4LA 3B9AA 2YRLA 5IIEA 3CX5J 1FYTD 1U91B 2FJGB 5IEKA 4TOYH 2VDNL 4NN6B 1AH1A 1HYRC 3ZYZA 5F89A 2BNUB 4OF8A 1NCWL 1VEMA 2IGFH 4KK8C 5SWZE 4CVZB 4P9HL 1RY7B 5C0CE 5LGKA 2MMXA 1RHHB 1BVZA 1RZKH 1XEDA 2X10A 4X9BA 2CKBA 3RZCD 1MCBA 1RURH 3L5HA 3EDJA 2Q8BH 4LLMA 4PJXB 5C0FA 1OAZL 3UTSD 3KYNA 2CXGA 1TXKA 3RIFF 1A3QA 5EUKB 1NCNA 4JM4L 1BJ8A 1PG7W 3RVWC 2VC2L 3G5XA 3FJTA 1U0QA 3WBDA 1IM3B 1ZGLB 1G7HA 2D4DA 1XIWD 3RWGA 1R5VB 1BAFH 2YSSB 1TIUA 1NANI 5DUMH 4LNRA 3N85H 1OSZB 4V2CB 5GRUL 4P4KA 2EE2A 3V6FA 3VFVA 3EJYC 4QWWC 5GZOC 1HWGB 1TQBC 2Y1VA 1GPOH 1CDBA 3UJTH 2AABL 5TGBB 3F65A 1RJCA 4PTTB 2G9HB 1KT2A 3N0PB 4O2EA 5I1IL 1LK3H 1DQML 4XPTL 2FB4H 2X4QA 1YQ2A 2HH0L 4O9HL 1A7OL 3FB5A 2HKHH 4NQXB 1KSRA 5KVEL 5IQ7L 4JFYA 3P2TA 4K3DL 3BH9A 3U9PH 4PJ7A 4F57L 5ID0B 4JFHD 3EO9L 4I3SL 5DEGB 1C1EH 3U46B 2AQ3A 4LQFL 1A9BA 3PL6A 1MRDL 1DBKL 4GMSH 5EU7C 4WEUD 5DI8A 4HUWA 1LD9A 3C87A 3QCVL 5E2WL 2EDHA 3F5WA 4O02L 2OK0L 2A1WH 1HH6A 4YXLL 3WIHH 1V3JA 3INUL 3LRHA 1UG9A 1F5WA 3B6SB 1N3NB 3DUSB 1VENA 4X8JB 2XT1B 1UKTA 3ZKMD 5HVWA 3MLSH 3V5DA 1BWMA 5EOCL 2EZ0C 3QEQD 4KKCD 5I8CB 1BP3B 5E2VL 2ZUYA 3EYQD 3FL7A 3NIGE 3V4PL 3CX5K 3DBXA 4LPXA 5L9DL 2E8ZA 2H2PC 2BVPA 4F33B 2K9UA 3BP6A 5KANG 3JBG7 3C8KA 2NXYC 3VFUB 5C0NC 2HRLA 2CRIA 4ZPTB 1HH9B 3VXRD 1D6VL 5I9QC 3GSNA 3QUXA 5IF0A 1IAKB 3JV6A 3LEVH 4KTYA 3K4DA 3U48A 4RFOH 3ILPA 4IM8A 3TT3H 1S7VA 5T5NF 2BNQE 4TPRL 5LVEA 1OW0C 1F02I 4LLQA 4YDIL 4APQD 4JY4B 5C7XH 3VXNA 4A6YA 3KWWA 5F3BA 1EA9C 2F8OA 5SV3A 5EZJA 4D0BB 5A16A 4I18B 5EORL 3TBYB 5EOQL 4Q9CA 2O61A 1U8MA 5I16B 2ZUQB 1UB5B 3NN8A 4XZUA 2ARJQ 4YK4C 3UTOA 1HNFA 3LKRA 1MEXL 4U1GC 4F7TA 2MNUA 5CD3A 5F9OL 1JHTA 1HSBB 2V2WA 1BD2B 1I85A 4KY1L 4GBXD 1JHLL 4JQVC 1Y18A 3DRQB 5C0DB 2O5YL 5IG7B 2X1QA 4EUPA 4PY8J 2VXVH 1MCFA 4PJIB 1JGDB 5C1MB 3BUYA 5DJAB 4XVSL 4P2QD 1XT5A 3KPRB 2BNRD 4QGYA 5E7BA 3EYOB 3O41A 3V4VL 2H6PA 1DUYB 3QXAB 5FGBA 5JNYB 3UYRH 3P3YA 2Z91A 2IMNA 1OTUC 4HKXA 1SYSA 4X4XB 4RBPK 1B0WA 2VSCA 4ODSH 4LASH 3VA6A 3RY5A 3NH7L 2IBZX 1MWAL 2NYYD 1FZKB 2A6IA 4KDTA 4U1MB 1Q72L 4H26B 1YMHB 4ZFFA 3LKQA 1ZGLP 4P46B 4PJDF 2G75B 2OR9L 4LSRH 2P45B 3OG6B 4ODXA 3HLAB 2CR3A 4OJFH 5DQDL 1YY9D 1U8QA 4PJAF 3SKUD 5CJXC 3MV9E 3KPSA 2OL3H 2J8UB 5J13C 3IRPX 3SE4C 1IT9H 2VL5B 3FN3A 4G6FB 3VGEA 1KXQE 2VYRE 4YH6A 1DBBH 1MIMH 1JGUH 1CICD 2CLZA 2VH5H 1JUFB 4V1DE 1B3JA 3P4OA 1MCOH 1EEUA 1K5NA 2EIBA 4MX7A 1DVFD 2R29L 5I19L 3STLA 1UZ8A 2YD7A 5DMIH 1MIEL 1NC4D 4K8RL 1P53A 3TM6A 2NY0D 4U7MA 2PF6A 1RZ7H 4EEEA 3KYAA 4ZSOE 1T21B 4LAQH 1CD1A 2OL3B 3SDDA 1T22B 5B38B 2XRAH 4N5ED 3WIIL 2F53B 3AREC 4QRUA 1FPTH 4BH8B 4BSWA 4ZTOL 2EE9A 1MJUL 4L4JA 1F11A 4XAKE 4PJAB 1XGUB 2XA8L 4HXAH 2RQ8A 5CZXC 4F9LC 1R5IB 4U6XA 5C09D 4JHZA 5AEAA 5C0EA 4BSJA 4C4KT 3D39D 1A0QL 1SMOA 2M8XA 1TZHA 3REWA 4GUPA 5TE6L 5J12B 4X9GA 3FCTA 4YPGB 4NOFA 3LQAH 5GS1B 5JPMB 1TCRA 4GRWE 3KYMB 1ZLUK 1VEOA 4LRIA 3WXWH 3WKML 3VWKC 5IESL 4KY1H 3WHE0 3Q6GH 5TDOA 3KYOB 1FL5A 2O5XL 3WL9A 2K7PA 4NM8H 3U1SL 4X6FB 3RWHB 2ADFL 3HRZA 3MXVL 1FAIL 2VE6B 4RGNC 2P8LB 5BVJA 4HAFA 1DQQB 2HN7B 1EGJA 1NANH 2EYRA 3GMOB 5E99H 4TSCH 1FFRA 3CFIC 1ZHNB 1LO3H 2WBJB 2FDBP 3M1BB 3QEGL 1HILA 5E94A 3IXAB 2VN7A 1XF5B 2PO6D 3OKDA 4YHOH 1YEKH 4Y2DD 3SY0B 3BZEB 5IM7B 2V2XA 4PFEA 4HWEL 5I2IA 4JO1H 1KPUA 3UTSE 3KYKL 1ZHLB 4D9LH 2HG5A 1R3IL 2FB4L 3HR5A 3DX8B 2VDPL 3SGKC 2EXWC 3IJSB 3NVQA 4ZUTA 4XMKH 5KZCD 3SDAD 5CEZL 2CK2A 4U0RC 5CBAB 1QZ1A 43C9B 3CPLB 4KK6C 4NQDD 5ALBL 4XVUC 3VJ6A 4M48L 4UU9B 3L3OB 5EOQH 1NC2D 4MNQB 1WWAX 2LTQC 1AIFA 1G0DA 1K8IA 3WO4C 3FRPG 3GIVB 2CO7B 2W9DL 3EDDA 4R6UA 4ONFH 1C5DA 2CGRH 2DWEA 3L1OH 1GOFA 1NCUA 1TJIL 5GGSY 4PYHA 2PNDA 3SDDC 3FQTB 3WIHL 5CFHA 4QHKJ 3S3PA 4JREB 2CR6A 4HWUA 3TZVC 5DEZA 4Z7WE 1YEDB 2CDFA 3D39B 1MHHA 1OAQL 4FQQA 4HLZG 4FRWA 3V6OE 5HI4C 4KRNA 1OSPL 2FX8L 3BDXA 5CEXB 2CSPA 3C2SA 1RZKL 4APQB 3GMRB 5H35A 1M1SA 1P4IH 2NW2B 4HULB 4GRWB 3AROA 3MMEB 2GK0B 2DI9A 3DUHA 1RUPL 3OKKB 4OBRA 1CDCA 1F8TH 1JF1A 2RR3A 3O4OC 4AQ1B 4LLUA 3V5KA 1G7QB 5EU6E 3O4LA 4WV1B 4XMLH 2BY3A 3WFDL 5C2BH 1ZA3A 1YEHL 4HQQH 2LU4A 3QUZD 1CGSL 4X4ME 3VFMA 5E9DB 3DXAE 3SGJC 2ICEB 3H9ZA 3V52H 5F1NA 2VR9A 4WO4D 5BVPH 4H1LG 4DUWA 3GUTA 4Q58C 4JFQB 3V7MA 3ECBB 3ULUF 4TNWF 2R23B 4JVUA 5FYKH 4U1KB 4FP8L 4PJ8A 2VDLL 3DROA 2XY1A 1I3GH 3P11L 4ZFOL 3KXFB 4JM2A 3Q6FB 2VLRB 2YS4A 4PB9H 4R2GD 5FAAA 4LHQB 3ULSA 4OZFA 4ZS7H 4ZUVB 3U7AA 5KOMC 4S1QH 5T3ZH 2AJSH 1TNNA 2IG2L 1A7PH 1LMKA 1PG7H 2NY2B 4YBLB 5ESAA 1QSED 4RX4A 4LAQL 2VDRL 1CLYH 1I7ZA 1AXTH 4JY5H 3PUCA 2BHYA 1IMHC 4JM2D 1OD7A 1KEGH 2XY2A 1QYGH 2R9HD 4KRLB 4Q6YA 3RBSA 1OARH 1UGNA 5I8EB 3VGGA 1F3JA 1OGTA 2OZ4A 1RSFA 4L8CA 4R3SA 5DQJA 1M6OB 2YD4A 4JRYB 2FR4B 3RVVD 2DQJH 4OD2A 4PJAE 3CXDH 3QDGB 3AM8C 3DNKA 1Q9LB 5T5FL 4KKLC 4XI5D 5IW6A 4XNUL 3CH1A 3IU3A 5GGRB 3MRDB 1GIGH 5I1EH 4OM0L 2FGZA 1HHGB 3MBEC 1KOAA 4WU5A 4J3SA 4NJ9L 2A6DB 5GRYA 5E1AA 1BGXL 5DQDH 3RVVC 5L2KA 3ZDZE 3B43A 1RUAH 4N0FB 5MI0B 1XGRA 2XQBH 5AYUL 1IKNC 4JFFD 4PGCA 4PBVC 2XNAA 3GSRA 3MBED 5I1EL 4Z95L 1CT8A 1T66C 2OTUA 2DQTH 2X4OB 3VCLA 4OLXH 3C5ZA 2DQDH 2JIXD 5EU5A 5KSAD 4XP9L 4Z78B 2DRUA 2QBWA 2P5ED 3BKML 2MHAB 3BO8B 2ESVE 1YC8A 4LCUB 3QH3A 4P49A 3OR6A 5CCKH 5GGTH 5AYUH 3UAJD 4JO2H 1CGUA 4ZOAA 5ELIA 2Q3AA 1FC2D 4LPVA 1QLRB 4GH7B 1NCAL 3ESVF 2XN9E 4FA8A 4MNGB 2X4RA 2CIIB 1JMXA 2Z92A 2I5YH 3QFJD 1AGFB 3OKOA 4YDKL 2VZ3A 2AXGB 4IHOB 3Q5OA 1OAYH 4V1DD 1NAMH 3MRLB 3I3DA 3SKMB 2C4FU 4IRSD 4KMTL 1IE5A 1G7JA 1YMMD 2OCFD 4JKWA 4L1DA 1T04B 1NGYA 1MFBH 1Q9KA 2UZIH 2WAHA 4PD4J 3D3VA 2VLJA 4HX1B 1BQSA 3TJHC 4M02A 1BFVL 2HRPL 3RA7L 4OF6A 4HXBH 2JK5B 2QQQA 5I75C 2VRAA 4OQ1A 1WT5A 5TE7L 3VFGL 4POYA 4GXUM 1JVKA 3IFLL 1QSZA 5C8JB 3BISA 3RL2A 3QDJD 1DE4B 4DAGH 4YGVA 1MCCA 5TQ2L 2EYSB 5C0ND 1SYVA 4TVPL 5I6XB 4WW2C 3BDYL 3NPZB 5FA3A 2JJUA 5I17A 5DRWB 4XNMB 1FN4A 1GRWA 1C12A 3QQ4A 3R0NA 5MEQB 2IPTL 2VXTH 4E41E 4JANA 3TBWB 3L6FA 4JO1L 1TCMA 5KVGL 1JP5A 3K80A 3S34H 4CVWA 2OMBA 3MUHL 4E9LA 3BH8B 1Y0LB 1H3WM 1MFDL 3WLBB 3MNWA 3KPOB 2DQUL 4DN4H 4I0PB 5SWSD 2QHRH 4I77H 5FOBA 4K7FB 5FFLA 3RAJL 1KG0A 3JV4B 4PRBA 3I3BA 1UXSB 1MH5A 1NEZB 5KS9A 3OHXA 3QCTL 3H7BA 1OM3L 3EUUA 1V7NL 2HT4D 5CGMA 4D9RE 4GG8B 4DOHE 4H0HB 4XCYA 4LLVB 1A3LH 1I1FA 4YDIH 5FO7A 5C08B 1DQDL 4KKAD 1QQDA 3D9AL 3BMVA 5HYJE 3GSQA 4G8GA 1A1MA 5I1KH 1JGLH 1II4E 2YMXL 4G8EA 3SDXF 5A40E 5HDQH 4AG4H 1YECL 2CXKA 2DDQL 4P5TC 4KI5E 1CICA 3FQWB 2CLVB 1K2DA 4RGMC 1E6JL 4YDJB 3MCKB 4XX1E 1K8DB 2PO6C 3GMMA 1KB9J 3CU1A 5DEFA 5FM4A 5I0DA 3QWOB 4X6CF 3HAEB 4HUVA 3VW3L 4FZEH 3O9WA 1T0NB 3MV8A 3NFNB 4OSUH 5D7JA 3NACL 4GW4A 1M05B 5SWZB 2VOTA 5C2UB 1D5ZA 4V1DA 3H42H 2B39A 4BH7B 1BVLB 4WI4A 4LMQI 1F4YH 4ENEC 3MO1A 8FABB 2VMFA 5FUCC 1X5LA 5I19H 1U8LB 2ZNWA 5FEBA 5IT2H 1UT9A 1KTLA 1N64L 3P0GB 2OK0H 1T0PB 4TNWK 3B3IA 4ONOA 2DIBA 2XFXA 1PX3A 4H0GA 1A6AB 3CZFB 4M3KB 1CFSA 4KK5D 2MQ0A 3REVA 4YFEA 3VRLF 4CN4A 2DLFL 4RGND 4PP1C 2D2OA 5DDHA 2OQJB 2IEPA 2BNQD 4DVRL 3IFPB 3GFUA 5EUOF 3W9DB 4E41B 2DOCA 1JGEB 3D1MC 1NGWA 5BMFL 2KDGA 2CD0A 4G8GE 3CXHJ 2V9TA 1FVCA 2HFFB 3O2DA 4P59H 1IGYA 3F6IA 5AD0B 1O5DT 2LAAA 2W1NA 3NA9H 4NO0A 5FXCH 3BKMH 1AGBA 5HI3D 2BNQA 2WQRA 1IQWL 4GG6E 4HEME 3W9EB 4JJ5A 1ACZA 5E8EB 1JHKL 4LSVH 3DXAD 3LPWA 2AV7A 4Y4KB 5JHDA 2CDGB 4Q2ZB 4X5WA 5HJ3A 1RIHH 1RJYB 1U2HA 1UH3A 4NYLB 2BX5A 2VIRB 3ARDD 4PJFF 5LGJB 2ICWA 1VFOA 2I9TB 5IUSA 4EBQL 3HE6A 3MYJA 1HOCB 15C8H 5DUML 5JXAL 5D71H 3IDYB 4W81A 2IWGA 4Z5RA 2X40A 2XKNA 4D0DB 3BHBA 1JHKH 2FGWL 3HCVA 1CFVH 2YRPA 4WENB 3DMMB 5ICXB 1JZ8A 2R1WA 1ZLVH 3I2CH 4WFFD 3MODL 2H2SC 3PWUB 3UZQA 1N7MH 4LSTL 1F13A 1MI5B 1UCBL 2BCKB 1U3HC 1HZHL 1YY8B 4LHUG 4G42B 2DQCH 5JOPD 2A83B 5ENWA 1FSKB 2NY4C 3Q48A 4RAVB 1CDUA 4R26H 4F7PB 3GJFK 1KIQB 1QFWI 2YBRA 4HWEH 4YBQC 4WTZG 5C0CA 3QXTA 1GYAA 2GY7B 3NCBB 2R4RL 1UEYA 3VA2C 1SJEA 2PYED 4NQCA 4NQEA 5K59E 4AIXA 5IJVA 4P5MA 1IAOA 1L0QA 3KPSD 5B38G 3ZHKA 5I1HL 3D85D 4JZNB 5DC9B 3WE6B 1A6PA 1KB5L 3QUYB 4LIQL 2HP4A 3BEWA 3OZ9L 5IJKA 3U0PB 2FATH 3CSYB 2ADGB 1YMMA 4TPRH 2XG5A 1NMBL 3V4PH 3I6GB 5I6XC 1KLUB 3EOTH 4MSWA 3QYCA 3L3HB 5J3HC 1RUQL 4GG6B 4RSVA 2XN9D 3C5SA 1NGZB 2DLFH 2K3TA 2VXQH 4PJHF 4AMKL 3HE6C 5JPNB 3VFPA 2FLBT 3ARXA 3C8HA 4P23A 5FYLD 4AIZA 5F7UA 5I8KL 1S7TB 1FFNA 1KPVB 5IB4A 3MRFB 3C5ZD 3H9HA 3RKDC 1S9XA 3C5ZC 1I8IB 2J12B 5DJCA 1TJHL 1GZPA 1I8LC 1RZIA 1YYLL 1CQKA 1HXMB 1ZA6A 4FXGB 4O02H 2J6EL 3CFEB 3LN4B 3IDJA 4RZCB 4ODTL 5T1KA 4XVSH 3FQXA 2D0HA 1S5HB 3T0VA 3BXNA 5IV2A 4OB5L 4WHTA 2ILLA 2JIXB 4EDWL 3DX6A 2CPCA 4PJEF 2VISB 3MACH 4L4TE 4Z7VE 5BRZE 2JCCA 1N6QH 4ZDHB 1FO0A 5ADOL 2Y7QA 3SDCA 5HY9B 2V9RA 3DUUB 5DC0A 1L9MA 4HFUL 1WGOA 2KKQA 5FYKL 4MCYA 5C0GA 1QA9A 3U7YH 2HVKB 4OCRL 3LEXA 2ARJB 3S4SB 1YDPA 1EHXA 3S35H 2KZ1B 5ADOH 3F7PC 2YD8A 2IPKA 1UJ3B 3FQNA 3MRGB 4LQ1A 2YKLL 5CJQH 5FKPB 2V7HA 4S1DC 1J8KA 5IBTL 5ITFB 4P2OC 4OLXL 5B3JE 3T8XB 4WFHD 1H5BA 4JPKL 2J3SA 4JO4L 5KSBB 2Y06L 1FZOB 1R3LA 3QIUB 2NY1B 4MD4B 5KAQF 5SX4I 4JHWH 4PJEB 2DTSA 3PXHA 3TZVD 35C8L 3ZHDA 5CLTA 2VLJE 1NFDF 3ARWA 4LGPB 2VLKE 5D7IB 4MXQC 4ZG1A 2NLJB 3SDAB 5EH1A 4RDQF 1QHPA 4QTHB 5AAWA 1CXHA 3HNVH 4PRDA 1TTGA 2E6QA 4OM1L 2W0FB 1ZSDA 3SBWC 4XNUH 3O2WH 5AUMB 1D5BA 3CAFA 4K2UL 35C8H 2UVFA 1F6LL 1WV7T 2XWBB </