4N0YH

Structure of the hepatitis c envelope glycoprotein e1 antigenic region 314-324 bound to the cross-neutralizing antibody igh526
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
226
structure length
222
Chain Sequence
VQLLEQSGAEVKRPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGWINPGNGNAKYSQRFQGRVIISRDTSATTSYMELSSLTSEDTAVYSCARDRGFDLLTGHYLGLDPWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IGH526 Heavy Chain
publication title Structure of Hepatitis C Virus Envelope Glycoprotein E1 Antigenic Site 314-324 in Complex with Antibody IGH526.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 222
sequence length 226
ec nomenclature
pdb deposition date 2013-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n0yH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n0yH01
4PUBL 5IBUB 4TVPL 3T3PE 1ZLWK 2GCYB 4HF5L 2BNQA 2I9LA 4QGTA 4YZFF 3U30B 2WIMA 1Z5LA 1A2YB 4KROD 3PGDB 2DWDA 4KVNH 5JW4Q 5GJTH 1OP9A 2R1XA 5L2KD 3DUSB 2EDFA 2CGRH 2XTJE 4HBQA 4AK1A 1KLFA 2VXTL 4UIMB 1MQKL 3SKNA 3VRLE 3NCBB 3NIDF 1OP5H 1AKJB 1LDSA 4ZXBA 2BSED 3QNXA 5C0BD 2ERJB 5KSAC 3WDIA 5F9JB 3WS3A 2PW2A 1MF2H 2A9MH 4ZAKC 2QHRH 1G6RA 4ZPVB 2IPKA 3AS0A 2AK1H 4JM4H 3B6SA 4P3DB 5FF6B 3QHFL 1MWAA 1YQVL 1BVKA 3CFCH 5IF0B 1MCOH 4LDOB 1RK0B 1IL1A 1KACB 3ZYZA 2AV7A 3WJJC 3MLXL 2PYFB 4PRBB 2R29H 3O4LE 4WFGE 2MPAH 2ZOKB 4N8CH 1EFQA 4Q2ZA 4PJ5D 1AGFA 2XY2A 4IRJA 1NUFA 3PE9A 5DLMH 5KSAB 3BVNA 3KYNA 4EI5D 4PLOB 4ZAKB 2Z91A 4EOWH 2P5WE 5HI3C 4UUJA 1N6QL 1OTSC 4KK8D 3S34L 1G7LB 5GSVA 4JDTL 3HC4H 1JWMA 4YPGB 2KZWA 4K23H 4Y2DC 5DD6B 3OB0K 3U7YH 2EDYA 3P9WB 2OR7A 5I15L 3TVMD 4HJGB 2OJEA 3ZE1F 3S35X 3I02B 2YC1B 3UTSD 3GMOA 1NUDA 4F7MA 4RAVB 2D7NA 3QEQE 4JO3L 2HWZL 3P9MB 2V17L 3Q48A 1TJIH 1QP1A 5GPRA 4O2FA 3BEWA 2BMKA 3QP3A 4YC2B 1IZKA 1LEIB 3F8UB 3S98A 3JV5A 2DS4A 3G6JF 1NFIA 5D4QA 1IC7L 4TN9A 5A3ID 5LGJB 4IMLB 1MCKA 2MMXA 4YAQA 3ARTA 5M95B 1WZKA 4LKCB 3VFTB 1U93A 3BO8A 4D9QD 5D7KE 2VZSA 1WZMA 1LO3H 1IM9A 4JKKA 3S4SA 3HAEA 5DEFA 4WW2A 3H3KA 2JELL 4KDTA 1WZ1L 1VFOA 4EDXB 3O9WD 1KXTB 1ZVSB 5T5FL 4ZPTB 4NUGH 3MNVB 3LB6D 1R6VA 5H37G 3RIFF 1DBAL 5D7LB 1MIEH 3TC9A 2ZJSH 1HSBB 2XXMB 1KG0A 4MJ6B 2EC9U 4XCNB 2ESVD 3GB7B 3QIWD 2W0KA 3SE3A 1ODAA 1WICA 2HN7B 3SE9L 2XQYG 1AD0B 1CT8A 5C0GB 5C0IB 1I7ZA 5IHUL 5SWZA 3BHBA 5GGUA 4PJFE 4HUWB 3BKJL 3HG1E 1WC7A 5KJRL 5JHDE 3TYFA 3WN5A 2DKUA 5EBMA 2PXYC 5IIEB 2F53E 3CPLA 4M1CC 1LHZA 1YC7A 4YNYB 3FQXB 4LLMA 2I5YL 5BO1L 1FVEB 2DF3A 4HIXL 1A7QH 2VN4A 3CLFH 4V2CB 2GFBB 2R4RL 2YPLE 32C2B 1Z6JT 4KHXH 3TF7C 3IDXL 4LRIA 1OQOA 4QRSA 1FGVH 1R0AH 4TUKL 4BSWA 4U2ZA 2XKNA 3FN3A 3RWDA 2BSSB 2J8UB 5SV3A 4CNIB 4Z7NF 4X8JA 3BQUC 2AEWA 4XCFH 4BUGA 2LU3A 4NFCA 4DUXA 1D3CA 1RQ5A 5FGSA 4Y4FD 1WBYA 3OPZH 2PXYB 3UPCA 3ILPB 4L9LA 1TVBB 2FEEL 4PJ8D 5LBSL 5DMKB 4XNXL 3QCTL 4PJ7B 4OCYH 4DOHE 4PFEA 4WHTA 3O3UN 2Q7YA 4JKWA 3U0WL 1M7XA 2CUIA 3V0AC 4MA1B 2BSRB 2NQCA 3BAEL 1A6ZA 5EO0B 2FECI 4OGXH 4OZIE 1TETH 3L7FB 1HHHB 3BQUB 4Z0BH 2R1YB 2KL6A 1PZ5A 3NIFF 2EIZB 1YY8B 2VH5L 4M1DL 3VW3L 4QRTA 1VENA 5IJKC 1WAAA 4ZFZA 1ORSA 2AGJL 1QLEH 1AD9B 4N8VA 2ZG2A 4LHUA 3SDAD 1BF2A 5TF1L 1IGFH 5HGBB 4AIZA 4M61B 3MGOA 4PG9B 2Z31A 4HKZB 5IG7B 3BYTA 1T66C 2Y5EA 4DAGL 4CU6A 1L0QA 3LPGA 3MOBL 4U1GB 1GYAA 6FABL 1M6OA 1V7ML 5JPNA 5KVFH 5IESH 1EH9A 1KJMA 2YK1H 1P7QD 4JGMA 3TBTA 2V7NB 3C6LC 3VGDA 1A5FL 4U31A 3RGHA 1XT5A 4QT5B 1FJ1B 3H9SB 4GH7B 1K5NA 5DJZA 1DLFL 4PJGF 4DVBB 2E6JA 5D7SH 3EUUA 4MWFB 2CDGB 2XRAH 1IGMH 3QULB 4WUKH 2BCKA 5DFWH 4QO1A 2BK8A 5BS0B 4MD5A 3UJTH 2P7TB 5EZJB 4X6CF 1RURL 3KPQA 4JQIH 3UPAA 3VI3E 4J1UB 4WHCA 3RWEA 1E6JL 4KJQD 4OCMC 3P11L 3P9LA 3CZJA 2VYRE 2FSEB 3ZDYF 3C6LB 3LD8B 1K4CA 4J6RL 5HTSA 3V0VA 2X4NA 4MD0B 1BGXL 1IGCL 4O9HH 5F9OL 4GBXA 1PW3A 1TCMA 3HC3H 3RA7H 4YHOH 4XNQA 3LZFH 5TE4H 4LSQL 4KMTL 1J88A 2Q6WA 4PJDE 3GSQB 4HIIB 1B0GA 1JRHH 5IM7B 1AE6L 1U8JB 3PJSA 2FD6H 1YY9C 2HT4C 4JPIB 4MA3B 4JO2L 1HINL 1JGUH 3CXDH 2WWKT 3HMWH 1NC2D 3BGFC 2VL4A 5KSVA 4NP4H 1B0WA 1T7ZA 1HI6B 3L3DA 4ORGB 4PREB 1M05B 4UDUA 4Y8DC 3F6LA 2NYYC 2IFFH 5DUBA 1UH3A 1RZJL 1U3YA 2JCCF 4PV9A 2Q8AL 3W81A 3QDGD 4XWGH 3MTRA 4FFVD 1ZV5A 5GRZA 1U3ZA 3VFWA 4U1JB 1E4WH 5IKCA 3VXPB 3N1MC 5C6WH 1T2JA 2Y23A 1WT5A 5EZOL 3OZ9H 1RUQH 1IEHA 1FVDB 3Q3GB 2YA2A 3BGFB 2BDNL 1J0YA 1Q1JL 5E99L 2ZUQC 3DO7B 2HLAB 2C1PB 4XZUA 4JFXB 1ULVA 1VFAB 1V3KA 2VLRE 1KN4H 3Q5TA 3DROA 3VD4A 4JPKL 4PJ9C 4H0GA 4YXKL 3OXRA 5GS2H 1K8DA 1UWGH 2EDQA 4U6HA 5HDQL 3BD3A 4OM1H 2Z4QA 2PUQT 5F7UA 4G6KH 1H3UA 5HYEA 1INQA 4KTEH 3MLTB 4AEEA 4U1HB 4PGJA 2A6DB 4U7SA 4NQEA 4LL9A 4GKNA 3CXHK 1X4XA 3M8OL 3DXAE 5EZLB 5IVZA 1EJOH 2Z92B 4BH8A 2FIRT 3R0NA 2X40A 3HRZA 3MA7A 2ZUQB 3FHAA 2VDMH 5IK3B 3TFKC 1I7TA 1JRHI 4I9WE 1HHIB 2VC2L 5GGTH 2XWBA 1DBKH 3QWOB 3TNMB 3I75A 2ZOLB 4YO0A 4LSTL 2Z35A 5MP6H 3MRBA 3BIBX 2GIYA 2BY1A 3MZTA 2J6EH 1X5GA 1SM3L 2EYSB 3P0YL 1EFXA 2YD3A 2YD4A 3G5ZA 3W11D 5F7WC 4LLYA 1N4XL 1KELH 2CLZB 2EDTA 3HS0B 1PZUB 1NEZG 4P4KC 4YPJA 4WI8A 3PP4H 2X4OB 4R7NB 5LXGH 2PYED 1SEQH 4OLUL 4XMLL 5DJ0B 4WCYL 5CIPH 1NL0L 2NX5D 3EZ8A 3FB7B 3TO4C 3VFVB 4XCEA 5DHVA 5KVMC 3PWUB 1P84J 5JR1L 5EC1A 4ERSL 2YRLA 2Y06L 2NY1B 1DEEA 2YEZA 2O26U 3D2UD 4L8BA 4OF5A 4YHNA 3CZFB 4JLRA 5E1HB 2WWKO 2DIAA 5IMLB 3O45B 3RWCA 2VR4A 4BQ6A 1TNMA 5IBLC 3BISA 4P4KB 1CFSB 3X13B 2DM2A 3EJYC 2JLLA 2DQJH 3K2UH 3KWWB 1ZTXL 3NCYP 4KV5F 5JO5B 3U2SA 4MA8L 4BH7A 5KSBB 2FHFA 1RV6X 3IB4A 2MTPA 5T3XD 4JRXB 4JHWH 3TO4B 4R26H 4G6MH 2CUHA 4YDVB 2XN9A 4F58H 1JWSB 2R0WH 2H6PA 1D6EB 1N59A 4QXTA 3BKCH 3C9NB 1S3KL 3HUJB 1S7WA 3EOBA 1HH6A 2KUTA 5FA4A 3ZLQC 4QRPD 3B5HA 1G0DA 1RVFL 4L4TE 3ARPA 1DR9A 1OAQH 1ZGLP 2XT1B 4TSBL 3HUJF 1NBZB 2FBJL 5J13B 1I7UA 1QPXA 4GW4B 1L0XA 3BD5A 1RUKH 1NMAH 2V2XB 1MHCA 2WSKA 1OGAB 4NBYB 3ULVH 5SWQA 3RBGA 1T1XA 2WBWB 3C5ZD 5SX4H 3DRTB 3I9GL 1MVUB 5IBTL 2CDEB 1ZLVK 2AS5M 2APBA 1RIUL 1MRCH 1X5JA 4FOMA 2B4CC 3QQ4B 3ULSB 1ES0B 1FQ9C 3OKMA 4PGDA 3L3IB 5LWYL 4PGCB 1B6DA 5DEZA 3BPOC 2XA8H 5J11C 4Z76B 5DVMA 3BWAB 2C1OB 1LEKB 3MA9H 4PTUA 1FFOA 3LN4A 1CS6A 1WQVT 4K8RH 5CBEA 4OCRL 5GISL 4JY5L 1KC5H 3MCLL 1F6AB 5CSZB 4BZ1L 2JJWA 1CFBA 4PJHA 4KQ4H 5D1QB 2R2CA 1OSPL 1VPOL 2CIKB 5KOVC 4MCZA 5IQ9A 4OQTL 1YEHL 1E4XL 5J4MA 1F4YL 5FM4A 3LN5B 3MV01 3BPOB 3FN9A 4QY8A 4M43H 4G8FB 5HPOA 3LHPL 5DFVD 5J11B 4G6FB 4MCYB 1UEMA 1UZ6E 3FOLA 1QBLH 4D9LL 1K2DB 2GT9B 2IGFH 4PP2B 1QVOA 1EHLL 2I9TA 5E5MA 1CG9B 4DTGL 3FN0L 15C8L 2DLHA 5D93C 2R8SH 4UT6L 4QRUB 4WNQA 1JHKL 3IDMA 1S7UB 4NO3A 1PG7W 3IETB 1BVLB 1KENL 1I1CA 3O6LH 4MXQC 2G2RB 3FT2B 2RFXA 3VXOB 5SX4I 3QFDA 5DK3A 2ZNXA 2OTWA 3TLRA 5F21B 3UTTD 3IFOA 4NQTA 4YR6A 1W8OA 3MYJB 4JZOA 4EN3D 3FRPG 2APWA 2NZIA 3Q5OA 1AXTL 2EDJA 5DD5H 1JGEA 1N5AB 2GTZA 2IADA 3GJEA 5CHNB 3Q6FA 5C8JA 3WIFA 2O61B 5A2KH 2EDLA 3O2DL 3I3BA 2JK5A 5D93B 1A7RH 1T0NB 1CFNA 4WFHE 5HJ3A 1F3RB 1V3MA 1I9RH 5D8JH 2WNGA 1NDMA 2FEDC 3DURA 4LCWA 3P0VL 3TBYB 4HEME 5IHZB 1GC1L 1FZMA 1FYTD 4QHUB 2J1KA 4ODTH 5DTFA 2VQ1B 3RBSA 1KIQA 5CGTA 5E8DL 4XBEL 5TE6L 3DX7A 2GY7B 5F7EH 3V0WL 2OX5A 3OSKA 3L5HA 4LIQH 2NY2D 5A2IH 1YYMH 1GGTA 2YD1A 3IJHB 3T2PA 3KHQA 3CDGA 3ARFC 1PBYA 1JHLL 1CI5A 3S5LG 4NZRH 3NABL 2NXYC 3AM8C 3PQYD 1NDGB 4DZ8B 1SMOA 3DTXB 4OB5H 4FABL 3MODL 4E42B 4UV7L 3ZSTA 2SEBA 4HWEL 3WXWH 1U3HB 1NJ9B 3TNNB 1YEDB 4I18A 1IRAY 1WBZB 2A77L 3AXLB 3QIBD 2DQCL 1GRWA 1CDJA 4FQCH 5I30H 5EU6A 2IF7A 4YLQT 4QOKB 1QSEB 4HBCH 3TP4A 4HV8B 3FAWA 4TTDD 5I8EB 4YBLC 2V5RA 2ED7A 2R23B 3HNSH 3DARA 2VLJD 1Z9LA 3U7WL 2NXYB 3SGJA 2EICA 5GGVH 3GSNH 5HYSG 1OAYH 5JXEA 2H32B 4MAYD 4MNQE 5AYQA 4J3SA 4JDVA 1N0XL 1QFUL 3FMGL 3EYUL 3QIUC 4RGND 1ZE3C 5GZND 1I8LC 4LPVA 1FNEA 1I85C 1IQDB 5CIPB 5EBWA 4FZ8H 1J05B 1QG3A 2BSTB 1I1FB 3E1F1 4YXLH 3IKCA 5I1EL 1KPVB 3VXNA 3DV4B 4OI9A 4K3DL 4YBLB 2GSGA 1AQDA 4KPHL 1NCAL 1UWXH 4V1DA 2ZUXA 4P2RD 3E6HB 2J8OA 5FGCE 5K9OB 4KUZL 1KJVA 5GRUL 3ZHLA 4G8IA 1MAKA 3RPIA 1IAOA 2A6KB 3RJQB 3QIUB 3MLUL 1AR1C 3O3EB 1HHGB 3CMOH 4MYWB 5GIRB 5T1MA 5ACZA 4NQEE 3HMXL 4XX1E 4OBSA 1YEEL 3FO9A 1GOHA 4OI7A 4LU5H 1FFRA 1BZ7B 4I5BA 4PRAA 4TSAL 2ZUTA 3R0MA 3BI9X 3LQZB 3IU3B 3VXUB 3S96A 3DVNA 2AW2A 2VXSL 4HC1H 2PO6C 5CCKL 2YPKB 5I8OH 1T3FA 1I3RB 3FQWA 3O11A 4O4YH 3QCVL 4XGZB 4JN1L 2VB5A 1TLKA 3REVA 1CWVA 4Y16A 4FXGA 3QWRA 2HT2C 4QCIB 3KXFB 1RJYB 1ZMYA 3WIHL 3G5XA 2JIXB 3VH8A 4P99A 4AH2B 2NW3B 5HHQB 2IPTL 2Y72A 4HUVB 1J7VR 1QEWA 2L7UA 1FLRL 4C56B 5HY9B 4F8TA 1A9EB 5I1IL 3Q6GH 3RZWA 4WDIA 4MSWB 5FB8A 1KCSL 3MJ6A 4LLWB 1YNLH 5DC4B 1Z3GL 3S36X 2IANB 5CEZE 4WGVB 1KN2H 5IQ7H 3ULVF 3QI9C 1QD0A 1S7QA 4S1QH 1MI5E 4U1KA 2LQRA 1JYNA 3FO0H 2YRPA 4OLYH 2HG5A 4TRPH 3DO3A 4OQ1A 3U9UB 3BDYH 2IWGA 3TIEB 1AP2B 5E8PA 1G9MH 5EBLB 3BE1H 4KJPD 3ZMRA 4GKZA 4AEIH 3V6OA 3MBEA 3ECBA 5D5ME 4P2QD 2R0LL 5GRJH 1S7SA 3CXHJ 4UBDD 1RUML 3QUZA 1LQSR 3IRZA 4OZHB 4U6YA 4F9LC 2OP4H 2OTUA 1JPGB 2DI9A 4IRSC 4RAHA 5IWLC 1JNLH 2AEIT 3B5GA 4MNGB 1AXSA 3HI5H 4YHML 1UQSA 5JIIA 3QI9B 4XVSL 3TESA 1P4LB 3OJDB 4N68A 2J5LC 3FO2A 4HLJA 2JJSA 3KYOB 4TUJB 3MV7B 4LSUL 3CVIL 3OR7B 3GHBL 3D1MC 4R2GC 4M7JL 4U1NA 3VDBA 2HYMA 3EO0A 1A47A 1AHWB 3K80A 3VXTA 5B4MC 4NNPH 5IMOA 2A0LC 5ADOH 2ATKA 1AI1H 4XPGL 2P45B 2B39A 3ARDD 5F8QC 3O6MH 2MSPA 1AFVH 3TYGL 1JI2A 5FYLE 3L3KB 1M7IA 1AGEB 4ODVL 2VXUL 4G8GD 3MRMA 4NQCD 4BKLB 2GAZA 2IBGA 2ZPKL 1M1SA 4JY4B 1MCIA 3UAJC 1JYWA 1DFBL 1YMHA 2J5LB 3B9KA 2DAVA 1DE4A 1MCDA 5C0EA 2VIRA 4LCCC 5CJXC 1ZHKB 4R2GB 4UV4L 1J12A 1F4XL 1NCDL 3MV11 3DUHA 3MRRB 1KPUA 1PFCA 2C3VB 4OSUL 4PLJD 2AJVH 4G80B 4J8RA 1P6FA 4N5EC 3DX6B 4M7ZC 3WE6A 2G75B 3VXRA 3BN3B 1FFQA 1FN4B 3AROA 3BPCB 5JQHC 4Q6IB 5DJXA 4R96B 5MENA 1YMMA 4S10A 3JWOC 2NLJB 3MLZH 5DYOB 3TBVA 5T3ZH 1UZ6F 2EYRA 4EDWL 5MHSD 3MLRH 1QA9B 3U4BL 2BVEA 3O2VL 3F7VA 3HMXA 1N6VA 1HKFA 4LCCB 1XF5A 5MERA 1RHHA 5IFHL 5C3LD 5FYLH 1IM3A 3SDDD 2QQKH 4R4FH 3T2QA 3UJIH 5FUOH 4R4ND 1AKJD 4YE4L 3LDBC 1MFAL 4M7ZB 4OCWH 4L4VE 5TQ0L 1ZLUH 1FORH 1RY7B 4P23A 4QF1B 4FA8A 5EN2B 5DA4A 4NQXB 4D94A 4X6FA 3LS4H 2WMPA 2VO5A 4ZMAT 4I48A 1UCTA 1XEDA 2VDRH 3MV8D 4RAUA 1QSFA 1B4RA 1MPAH 2EDXA 3IAQA 3KLDA 5DQJB 4HFWA 3RHWK 5FHBH 2Y9RT 1BFOB 3QEGL 5DJDB 5ESQA 1RK1A 2ADGA 4PRIA 5FXCH 5JORB 4MB5A 1SJEB 3LRHA 4C4KT 1KPRA 4RX4A 5IV2A 1HXMA 1H3TA 1URLA 3AGVA 2IQAA 3DUUB 3RUGB 4W6YB 5C09A 2VSCA 4H20H 3KR3H 5C0FA 1DLHA 2JB5L 4ZO8A 4JFQB 2QQLH 4ZAKD 3MACL 4XP4H 4WGWB 3X14A 4M48H 2HVKB 3U46B 1G7MB 1XR8B 4OGYH 2K9UA 3UDWA 4ZS6C 3RNKA 3D9AL 1P4BH 1WBXA 1J0JA 4LCWE 3ZYJA 4CN1A 1T83A 1J8HD 3LIZL 2P8LA 5IEKA 3LH2L 4JHBA 5FUZH 1M7DA 3MO1B 3A6BH 5EUOE 1I7RA 4YX2H 5E56A 5CZVH 1T04A 1MIMH 2UZXB 5EBGA 4PGEB 4WWID 3SOBH 3C5JA 4H25B 1A1OB 2B2XH 4LKXB 3N9GH 4WTZG 2YN5A 3B2UD 2VZ1A 5DJ2A 1X5LA 5HI3D 3IJSA 3WUWA 2GJZB 1OTSD 3U1SH 4LHJB 3WNMA 1JGLL 3KHOA 5CSBA 2N7BA 5KN5A 1BFVL 1MCLA 2D7PA 5F44A 5IB1B 4MXWH 2MWCA 1C08B 1ZA6A 4R97C 2DN7A 3T4AB 2DQDH 3SKMA 4YFDB 1UXWA 3A67H 3WHE1 4FQXA 4CJ1A 1TCRB 2GK0B 5BZWA 1NBQA 4UQ2A 2Q3AA 43CAA 2X7LA 4D8PB 3QAZC 5KS9F 1CFVL 2MQ0A 4XWOC 5EU6E 3FB6B 5EU7E 2FH6A 5TH2B 3VXMA 4MHHI 2KDGA 4R8WL 3MRCB 1VACB 1DQLH 1P5UA 1CXLA 3ROLA 2ZSWA 4P4RB 4IIQC 5IBUG 4WUUE 4X5XA 4DVRH 5DGQA 1NUNB 3L3HA 1F2QA 4R97B 3DVGB 2EC9T 1CN4A 3ZT6A 4LGSB 1UZ8A 2EIDA 1LDPL 2DQTL 4HKBB 5F72S 2HJFB 3MGTB 1IEAB 4JDZA 3VWKA 3HZYA 3QAZB 1QKZL 1OM3L 1XF2B 4DW2H 2FX9L 4QYOA 1HKLH 1JUFB 4B50A 2E7LC 3WHE0 4XBGB 1G9NC 3WO4B 1CDGA 5EA0L 4V1DE 4HDIA 3WD5L 4GUPB 3IS0X 3W9EA 2QKIB 4U6XA 4UT7H 3UYRH 4JFOB 4IIQB 2C7UB 2PW1B 5D2LA 4C4KO 3VGAC 1CVSC 4ALAL 3CX2A 1RZ7L 2QJDA 2XFXA 4PJBB 2IH1B 2BY0A 4Z7VF 3U0TB 4LFHD 1JHTB 1N2RA 2HVJA 1XGTB 4EI6A 1JMXA 2B1HL 4OFYA 1WISA 1H8NA 4M1CD 5E8NA 3RDTB 3CK0H 3MRIB 4NBXB 3MJ9L 4BSJA 4HS8L 4N0FA 5CJ5A 3RVUC 1BIIA 3THMH 4TULH 1ZSDB 5C86A 1OW0A 4W81A 2EYTA 3RGVC 3SE8L 1Y18A 2ICWI 3T65A 5I1JH 2A74A 1NGPH 1YPZB 4KY1H 3OJMB 3QUMB 4TNWK 4PJ5A 3P30L 3K8MA 3GMRA 2DQEL 1MHEA 4EI5A 1U42A 5J1SC 1CXFA 8FABA 2ZCKH 4OT1L 1MHHB 3QJHB 4L3AA 1I4FB 4D3CL 1OSZA 2APXA 5IFAH 2FATH 5AWNH 4JPWH 4S2SB 1XGUA 1YDPA 3ZHDA 2WWMC 4XAWL 2IQ9L 5K93A 5FK9A 3PGFH 4UDTA 3CFJB 2BVOA 4Z78A 1OTUC 3UTSA 5EORL 3PWNB 1P1ZA 3SCMA 3ARVA 1EDQA 4KZDH 5E9DB 4WEBL 3WEXA 5D5MF 1U8LA 3KNBB 4EUPA 3TH2T 3ZE2F 1MAML 4IOFC 4NQSA 4N0CD 2A1WH 5IVNA 2I25N 4FG6C 4JY6A 1T20A 5CKAA 1KBGH 1G7JB 4FNLL 2B20A 4YDJB 2NY7H 4WEUD 5BS0D 4LLQA 2R0KL 2Z93A 5AAWA 1UXSB 1GAFH 2DLIA 5TE7H 2OSLB 1T66D 4N0UA 2QQNL 5INCB 5HGHA 1EUTA 4WI4A 3GDBA 4CVXA 3IDIA 3VFPA 1HWHB 2AJZB 3QUKB 1D5XB 4XC3L 4XHJC 3ULUE 1EERB 4AY0A 3KYAA 1U95A 3C6LD 4LAQL 5GGQL 3HZVB 2BVPA 4G42B 4F9PA 4P3WA 4JKPL 5KG9B 2F58L 1RIHH 4U33A 1U58A 3O9WA 2Q7NA 3RWGA 4JZNA 3QEHA 4GJTB 1OTTD 1NCWL 2QLVB 3FOMB 4HIJB 1KT2B 5B38B 4W4OC 2RCSL 4KTDL 1FNGB 3C8KB 5F7KC 2ESVA 4MX7B 4J2XA 1B0RB 5IP4A 5C07B 5DA0B 2ARJB 3SDCD 4I77H 5E6IC 3KLAB 4JJ5A 5FO9B 1I8IA 4FXKA 4NO0A 2GW5A 2F19L 4GXUN 2LV4A 1HHKB 4H88L 1W0VB 2E9IA 4QEGA 2VDLH 2A6JB 1NBVH 5EO9A 1Q0XH 1OAKL 3F58L 3MRJA 2DI8A 4NZTH 5ECJE 5H2BA 1OAZL 4ZYKB 4XPTL 3RI5F 2DI7A 4LFHG 4HPYH 3PV6A 4Z7UA 3GMQA 1GGIL 2D3VA 4TUOA 4MJ2A 4OD3L 3LN9A 3JUZA 3DMMC 1YY9D 4Y89A 5F93C 1FGNH 2IH3A 1G7PA 1NCCH 5FO7B 3MOAH 4A6YL 3SDXB 1UA6L 5E6IB 5F7HA 4L3EE 2M2DA 1YMME 1U91B 3T4YB 3VMPA 1RUAL 4Y4FA 1SJVA 4YWGH 4S0SD 4XI5D 5HHOB 4K3EL 5DMYA 3O6FB 5DJ8B 3QT2A 3L5WA 3H9ZA 1HIML 3T0WA 1G7QA 1E4JA 2VLKB 4ZNEA 1CU4L 5ICXA 1L7IH 5JW3L 5TDNA 4ENED 3DMMB 3QQ9C 4KXZH 3UZQA 4LQFL 5MEOA 3LQAC 4RQQB 4DGVL 2XOTA 3IFNL 4X8XA 1TZIA 2BVTA 4PRPA 1X6LA 1LNUB 4O02H 3VA2C 3RAJH 1NCTA 4Z95H 3QO1B 1FNSL 2B4CL 3G5YA 1T2QH 5JIKA 1U41A 2CXKA 2ITDA 4N1EA 1YUHB 3ARXA 3OAYH 4OJFH 4PRIE 5AZEL 4N1HB 3NFPB 5HI5C 1F90L 4GOSA 3FRUA 3SGKA 5CJOH 4XPAL 1KIPB 5BW7C 1FAIH 1J11A 3MRLB 5C09E 5KSUB 2K7PA 3N1PC 5DQDL 2OL3H 25C8L 1UM5H 2F5BH 4HUXA 1A7PH 1Q94B 3NFNB 3TFKD 3GJFB 4OGZA 5F8RC 3UTZA 1P7QA 1KXVC 4M6MH 4QHKI 4P57B 1XF3B 1EAJA 1BM3H 4RFEA 2Y5TA 1CD0A 3QZWA 5DVKA 3L7EB 4IHOB 1KNOB 4PJIB 5EUOF 1QLFA 5JNYA 1DDHA 2NY1D 4OLVH 2MCG1 2FX7H 4YHLL 5F7NC 1EMTH 3M07A 4HJJH 2W1NA 4GRWE 4X9GA 5C0RH 4PJIF 1HDMA 2YUZA 3FFDB 1BX2B 4F37F 4P4KD 4YUEH 1WTGT 4MXVF 3RVWD 3STLB 4DZBA 1MELA 2AK4B 1GZQB 1W72H 1XGYH 2XTJC 3GSOB 5K9JH 4Z7WA 4O2EB 2BNUA 2OR8A 4A2MA 4R4BB 3RU8L 4K7FA 5DHYB 4FFZL 3PDOA 3MC0A 4JRXD 4KXZI 3FQUA 5DEGB 1A3LL 3RJDA 1BEYL 4POYA 1ETZA 3MR9A 3TZVC 4P2OC 1CD1A 3LCYA 4V2BA 3BP5A 2VL5A 2OZ4H 2VR9A 3QXAA 5FCSH 5IBLD 2Y1VA 1OWWA 4OM0L 1MJ8H 2H9GB 2O5ZL 4ZQKA 5I2IA 1ZGLB 3EJYD 3ZDXE 1X5ZA 1D5BB 1PQZB 4I3RH 4KAQL 4NRXB 2XTJB 3EJZC 3DYOA 5B8CA 4BSVA 5DMIH 5TGBA 5ICZB 3KPRA 4XC1H 1INEH 1OGAD 5DZLA 1P9MC 3VCLB 4PJEF 4U05A 4ZTPL 3HI1B 3RVTD 1S9XB 1ROWA 4WVRA 3OAUL 2EE3A 3TZVB 3C09C 5JMRA 4P2OB 3JV4B 3I6LE 5IVXF 1IT9H 1EGJA 4W4NA 3G5VA 2IPUK 3OKYA 1FV1A 1GZPB 3FQNA 3QUYD 4XBPB 2CLRB 2DBLL 5DR5L 5IMKA 4YDIL 4LLDB 2PNDA 1CK0H 2AKRB 4BZ2H 3CVHH 3PWPA 1EO8L 4EVNB 3VWJC 1QBML 4R90H 2X4RA 2XACC 5D1QD 5L2KE 5D2LE 5K9QG 2G5RA 4Y5XA 1JZ6A 3MROB 5ESAB 3V8CA 2E6PA 1Y6NR 3K7UA 1J0ZA 3RP1A 1BJ1J 3WFZA 1LILA 3C8HA 1SBSL 4KJYA 1H5BC 2CKBA 2P44B 4G6FD 4WU5B 1BF8A 3LKQA 1PLGH 4EXKA 4N5UA 1VKXB 1LE5B 3DV6A 1Y6MR 4JFPB 2KQMA 5DI8A 3A0OA 4AT6B 1VCAA 3RY6A 2R2BA 2YXMA 3BZFA 3QEQB 2V5MA 3SBWC 3VWJB 4ZUVB 5I1CH 3ORJA 1U8QA 2VDKH 2AJUL 1IC1A 3WNPA 2AXFA 2VZ3A 1EEZA 4NO5A 5GS0H 1FCGA 3MXVL 3FQTB 4PJ5E 1FFPB 3H7BA 3O8XA 3HZKB 1LK2A 4XRCA 1V5JA 4WHYG 5FHAH 2B5IC 2VAJA 3IXTA 1H5BB 2CH8A 5D1XC 2FB4H 4H1LB 3KVQA 1CFQA 2GKIA 2H2SC 3ELAT 3S3PA 2PYEA 4XCYA 3TBWB 1WITA 4NNYA 1CD8A 3UZVB 5HPMB 1PJ9A 2IEPA 2NX5A 4P3CH 2ORBL 4UINH 3RWIB 1MWAH 4KKCC 1R3IH 3QG6B 2BP3A 1KCVL 4FZEH 5J6GB 1AY1H 1GCFA 3BSZL 2FJHB 3D2UA 3JTSB 9CGTA 3UTSE 4JFFA 5JHLH 5JIHA 3RL1B 1KCUH 1S7RB 3HC0A 4MXQD 5JOPD 4RZCB 5ISZD 4PJCA 1DSFH 2B5IB 3ZTNL 4FMFA 5EOTB 4DN3H 2NR6C 2X4TA 5D1XB 3B9VA 5T33H 1F3JB 4GW5B 4D0DB 3LSOA 2R2HB 4WFED 1IVLA 1G7HB 1HK6A 2IBZX 5E8EB 4PJFB 1UT9A 3W0WB 4X7EC 1MLBA 4AEHL 4N0UE 1EO7A 4U6VL 2F53B 4JFYA 4D9QE 2OQJB 4RWYL 2E6QA 5SX5H 5HYQB 3I6KA 4OLEA 5T1LB 2BVQB 4ZTOH 1R5IA 1RJLB 2FEDD 4KDWA 4RGOH 1LMKA 1EEUA 1H3PH 4QRPA 5E1AA 3RQ3A 1UVQA 2QV2A 5DD0L 1U3HD 3EYFA 4JO1L 3T0EB 2APVA 5IJVB 3L6FA 4PRDA 4PRNA 2ESVE 4QOKD 1QSED 3A6CH 5CFHA 3TV3H 1NC4D 1BWWA 1FE8H 1MJJA 3C5ZA 1YYLH 4ELKB 5KVGH 3DVIA 3GJFK 1MJ7H 1KTRL 4Y1AA 4JR9H 4MVBD 3NVQA 4MZ2A 5HD8C 2Q87A 5E8OA 5I18H 2AP2A 3FHQA 3TN0C 3U4AA 2BNRA 4NKQB 1S7TA 4UB0H 3E2HC 3B9DA 1JIBA 5D1ZC 4XNUL 5L6YL 1MCRA 4CJ0A 4GG6F 1WLHA 4LPYA 3OGCA 1KTLA 5E4IA 4OZIB 2V5YA 3P73B 1MUJB 1N26A 3GRWA 4OZGB 4AENB 1OLZA 3IF1B 1D6VH 5E2VH 5EO1B 4MA7L 2ED9A 1T1ZA 2HFFB 3HNTH 2QSVA 2CRMA 2YA1A 5HYSA 1DQTA 5CEXA 3T3ME 1INDH 4NRZB 5D6DA 3DI2B 3O3AA 3DGGA 4UU9A 1FH5H 5ICYA 4PLKD 4U1IA 1J5OH 4OCLC 3TN0B 3TWCL 3JTTA 3GIVA 2DICA 2CJUH 3X11A 3E2HB 3Q1SL 3JWDH 5D1ZB 2FX8H 1UC6A 1JPTL 3QIUD 4ZNEE 1W72B 1XCTB 4LDLB 3P40A 1KB9K 4PUBH 4BFIA 4TVPH 1XIWC 1A7BA 4HF5H 3S3SA 4PJAA 3D18B 3RWJA 2CRZA 2R9HC 2Y7QB 4JM2F 4L29A 3HLAA 2XQBL 4HIEB 2RB8A 2VXTH 4UAOC 1MQKH 2F74B 1PVHA 2PETA 1ZHLB 5KBNC 1PYWA 5TPWL 1XGPA 2Q8BL 2DMBA 4E5XA 1DJSA 5JLZB 3UTTA 1ADQL 1I9JL 3OKNA 5DVLA 43C9A 3KXFD 3BUYB 3OX8A 1AR1D 4OV6F 2JIXD 3FO1A 2VABA 1TPXC 4P5KA 3VGHA 1XIWB 3RZCA 2XKSA 3QHFH 3ULVD 2ARJQ 1YQVH 3ZE0E 2G5BA 4AM0A 2W65A 3QA3B 1AO7A 1T21B 1XGQA 3VD3A 3MLXH 5C0CA 1E28B 2APTA 3JWOL 4PJDB 4FQLL 1JPFA 4UAOB 1AGBA 4G6AC 4DGIL 2ZZUT 2DTML 1FYTA 1N5YL 1N6UA 4L8DA 2K7QA 4MZ3A 1Q9LA 2HT2D 3QUXB 5C2BL 1KF9B 3R06A 4CVWA 4OZFA 1N6QH 4AL8L 4K8RD 3S34H 2UYLB 4NSKA 3WNKA 4JDTH 1TPXB 1EV2E 3BW9B 2W59A 3BZ4B 1QSZA 3NH7L 5I15H 1QLRB 1WIOA 2LU7A 4Q9BA 4OIIL 3PQYA 1P2CA 3CH8A 4ZXBC 4PG2A 1S5HA 3LKNB 4QHNB 4JO3H 3QI9D 4NZDA 5ITBL 2HWZH 2V17H 2CDFB 2ZCHL 3QIBA 4NHCL 4ODBD 1R5VB 4CN6A 1RZGA 2ATPA 3REWB 2DYPA 2VJXA 2X4UA 1IC7H 2RAMA 1HNGA 5D7IF 1E6OL 2BNQB 2I9LB 3SN6N 4NDMA 4NWTL 2MQCA 1Z5LB 1C5CL 2WUBL 2R1XB 3S37X 5I1DA 2DQUL 2VLJA 3KPRE 2P8MA 3QDGE 4JFZL 4IRJC 4ZXBB 3QNXB 2JELH 1G6VK 2DJSA 4MAYA 5IW3A 1WZ1H 4P59L 2P24A 3WS3B 2PW2B 1TJGL 3GK8L 2HKHL 4F2MA 5FYKL 1O7SA 1G6RB 2EH7L 2R4SL 3INUL 1DBAH 1Q9WA 2W91A 3EYVA 4KRMB 2P8PA 5CEYA 3B6SB 2NTFA 1IKFL 4R2GD 4S1DD 3VFNA 1MWAB 5HI4C 4PRHD 1BVKB 5FYJL 4DJMA 3IAPA 4GO6B 3X3GL 2IG2L 1IL1B 2AV7B 4HD9A 3SE9H 3MRPA 2A0LD 4QHLA 5BQ7B 5IHUH 2H45A 3VRIA 4P2RA 3BKJH 3PWPE 5KJRH 3HKFA 4Q2ZB 1AGFB 3KPTA 4IRJB 3ABZA 3PXJA 3MMEA 1TXKA 1A9BA 3KYNB 4JZJA 2I5YH 5BO1H 4PJXA 3UAJD 3GMPA 2Z91B 4HIXH 1CGSL 5A16A 3WJLA 1RSFA 1T1YA 5GSVB 3D69B 2R4RH 4L1HA 1JWMB 5DZNA 1LP9E 5AD0A 5JOEA 4OUUA 3QQ3B 3IDXH 4OFDA 4I3SL 4TUKH 1DUYA 1HCFX 4N5ED 2OJEB 3CDYA 1MFEL 4OZ4A 5IB4A 2ITCA 4WW2C 3GMOB 1F42A 4IEFB 3WLBA 4F7MB 3LKSA 4KDTC 3ARBA 2HKFL 3J8F7 1J0HA 5JA8B 4O2FB 3BEWB 2DM4A 4RRPA 5LBSH 4F7EA 2F54D 3OKEA 4HG4J 4ZOBA 5GS3A 3RL2A 5JW4M 1NFIB 4XNXH 5GJSL 3QCTH 1QQDA 5KTEL 3ES6A 1HYRC 4XMPL 3BZDA 1FL3B 4PY7A 4FHBD 3HE6D 3ILQD 4FFYL 4YAQB 2EO9A 3SE3C 3U0WH 2VLMD 4WFFD 1U93B 2PYEE 3BAEH 3IAGC 4UZGA 1IM9B 2XG5A 1G9NL 2NX5E 3WN5C 1QRNA 3S4SB 4U0QB 5DEFB 4K9EC 5EPMA 4WW2B 1PSKL 2VH5H 4M1DH 4M3JA 4NKMA 3VW3H 3KPMA 4YHYC 1SYSA 2AGJH 4UQ3A 1F5WA 3F7QA 2EEBA 3QUML 3LRGA 5TF1H 4Q9CA 3QCUL 2WLZA 1KG0B 5FGBA 2VUYA 1FIGL 4RCAA 4LRIC 4GAFB 5KVEL 1R3KA 4DAGH 3MOBH 4P2QA 4Z9KB 6FABH 1CT8B 1V7MH 4CVUA 3MRKA 1I7ZB 5SWZB 1BQHA 5GGUB 4LRNL 5FO8A 1JGDA 5C08A 5T3XE 3FCTA 3NIGF 3TYFB 3WN5B 5EBMB 1E4KA 1A5FH 3KYMA 3CPLB 1MFDL 4YHYB 2M26A 2H8PA 4LLMB 1DLFH 4M3KB 3LKOA 4X98A 5ALCL 1BBJA 2FO4A 4ELMA 1R24A 1WK0A 4ZS6D 1T7WA 3KJ4C 5D2NA 1A7NL 4QRPE 2YSSA 5F88A 3G9VA 2AABL 1EBPA 3MRHA 4KMQA 2FEEI 2DDQL 3GSVA 1C8PA 4QRSB 2FCBA 4LSDA 4BSWB 2XKNB 3V4VH 1RURH 1CGXA 4P9ML 1CFTA 4X8JB 1YJDC 1UJ3A 5IW1A 2YBRA 1E6JH 3P11H 1T22A 3SO3C 1A6PA 1FZKA 1WBYB 4G8GA 5F9WC 4NQCA 4J6RH 4L9LB 1BGXH 2FJFB 3QRFM 1IGCH 4ZO7A 5F9OH 4N0YL 1CZ8L 3ARZA 1P5VA 4LSQH 4KMTH 1SHMA 3KJ4B 2Z31C 2BNRE 5HHPA 1AE6H 2PKDA 4WHTB 1UM6L 3NBNA 4KGJA 2Q7YB 4JO2H 1HINH 4YBQD 3L3JA 4NM4L 1I8KA 1HNFA 1A6ZB 4M1GL 5JTWA 4TVSa 4XWOD 2UWEE 1RZJH 5HGDA 4QRTB 2Q8AH 3SO3B 1U8NA 5F9WB 4ZFZB 1ORSB 2X4PA 3S88L 4U7KA 4N8VB 1RULL 3PWLA 1EA9C 4LHUB 3T77B 3C08H 4AIZB 3IJYA 1YN7A 3MGOB 2Z31B 4F80A 1S7XA 3PWVB 5EZOH 1D9KA 1DBML 4UIMA 4BQCA 2ICEA 5CJBA 3SDDA 1M6OB 1Q1JH 5E99H 5J1AA 5JPNB 5BXFA 3U6RA 1KJMB 5DK2A 3NFSL 1MCWM 5F9JA 1T89A 3D3VA 4F57L 1UKQA 2ICWJ 3RDTD 3TBTB 3S36L 5IROA 2DJUA 4PJAE 2XZCL 1XFPA 4JPKH 4M8VA 3BUTA 4YXKH 2D9CA 5HDQH 4GBXC 2YUWA 5E2UL 5DJZB 4QRQA 4P3DA 3MV8A 1KULA 4Y19D 2VITA 5IF0A 4WV1A 4GKOA 5F3BB 1RK0A 1E27B 4LCIL 2BCKB 1JV5A 2GEEA 1JF5A 5EG6C 2VSDA 4MD5B 4MJ5A 2P5EA 3VMNA 3M8OH 3UTTE 4DKFL 1A64A 1MCCA 1ORQA 2ZOKA 3KPQB 2D31A 5E94A 3RWEB 4OF0A 1X7QA 3BX7C 1PAMA 3ZE0F 5C0AA 3AVEA 2W9EL 4KMLB 5ADPL 2DWEA 1JNHA 2VC2H 3P9LB 2DLFL 4ETQA 4NQDA 1K4CB 2HFEA 3V0VB 1KOAA 2P46B 2X4NB 2COQA 5ID0A 2ZUYA 4LSTH 3NZ8B 1AO7E 4GBXB 3MV9B 3CDFA 4GMTL 4XNQB 1SM3H 2Q6WB 3P0YH 4TSCL 3VXSD 1EHXA 1J8HA 5DZOA 3PJSB 2AJXL 3L5JA 1N4XH 4HJGA 1FYTE 1OAXL 3G6JA 5KSVB 1A7OL 3L3DB 1NLDL 2R15A 4UDUB 5ERWA 5E9DD 3U0PA 1JNJA 2A6IA 3P9MA 4KHTL 1MRFL 5DUBB 1CL7L 4OLUH 1UJTA 4WCYH 1EX0A 4XMLH 1NL0H 4PV9B 3UBXG 4N1CA 4ZSOA 3GZKA 3LQAL 1KB9J 4HQQL 2E8YA 5JR1H 4ERSH 1L9MA 3VFWB 1JYVA 3WSQH 5CP3H 4OKVA 3PQYE 4HFUL 5T3ZD 3SQOL 4M7KL 4MMXC 2WWMD 4GAGL 2JE8A 4Z0XA 1A0QL 5TFSL 4XNMB 3PL6D 4LDEB 4XZUB 1ZTXH 3FT3A 4MA8H 5DD3L 2F8XC 1CGTA 3DROB 4HJ0C 4FFWD 4YH6A 2EKJA 3MNVA 4K2UL 3EKCA 3OXRB 2VISA 1K8DB 4IOFD 4U6HB 5FGCB 3UMTA 1XMWA 4FG6D 1B88A 2Z4QB 3KYKL 4XCNA 1FCCA 2VLJE 1QR1A 5C07D 2CRYA 1S3KH 2AJSL 3SJVA 3GUTA 1RVFH 4BH8B 4FTVD 3HRZB 2K1MA 3MA7B 4XHJD 4Z77A 4RGNE 4JFDA 1I7TB 4TSBH 4U49A 5ANMA 2ZUWA 3FQXA 2FBJH 2XWBB 2IAMA 1H8SA 3BDXA 4H0IA 4PGZA 12E8L 5M94B 4YO0B 3L5XL 2Z35B 4D0BA 3I9GH 5IBTH 3T8XA 3FT4A 5DJAA 1RIUH 1EFXB 3P4OB 4KTYA 3TJHC 4P2RE 4RFOL 5LWYH 4LLYB 5DFTA 2J2ZA 1BZQK 5E6ID 2CR3A 4ZS7L 1IQWL 2FGZA 2QBWA 1MY5A 3IFLL 2CK2A 3EO9L 5SV4A 4PJXE 1LP9F 2NTSP 4QRRB 1CICA 5DC0A 2EEAA 4OCRH 5GISH 5HHOD 3O6FD 4X6DE 1PD6A 4JY5H 1EAPB 4Y7MA 5DHXB 4YHZL 4XCEB 3MCLH 3ZKSD 4BZ1H 5BRZD 2VLKD 3V7AG 3QXDA 1KLGA 2Y6SC 3QNZA 5EC1B 3IVKA 4GRLA 1TVDA 1OSPH 1VPOH 1DEEB 2YEZB 1KSRA 4L8BB 4LSRL 4OLXL 3SKJL 1GL4B 4OQTH 1YEHH 4JLRB 1E4XH 2ICES 1F4YH 5CGYC 1N8ZA 3RWCB 3FQRA 2EDDA 3LHPH 2R1YA 3LPFA 4X7SL 5BMFL 4U0RC 3BOVA 5DC9B 1J0IA 2WW8A 4LNRA 4CADB 4D9LH 3WYRA 2QSTA 3U2SB 2N7AA 4I0CC 4BH7B 3G6DL 3C87A 4G5ZL 3EHBC 5INDA 1EHLH 3CX5J 4QHKJ 1H3XA 1TIUA 2XN9B 4DTGH 3FN0H 3OB0H 1PG7L 1FO0A 15C8H 4M61A 4PG9A 4UT6H 4XMKL 1N59B 4M93C 4AG4L 1JHKH 4HKZA 5I9QC 2IPUG 1T6VN 3CLEL 3QQ9D 1S7WB 3VFUA 1KENH 3EOBB 1HH6B 5FA4B 1GIGL 4PJGA 4GQ9L 5H8DA 1UG9A 4GT7A 4B5EA 4KK5C 3AMKA 4U0RB 1GJIA 4HCRL 1A1MA 4GMSL 1I7UB 4X6CA 1AXTH 5AYUL 1JMZA 3HTLX 1MHCB 5SWQB 1T1XB 3BP7A 2W0FA 1TDQA 4P2QE 1V05A 3O2DH 5CBAA 1T0MB 5E0QA 4M93B 4ONHA 5I9QB 2BXZA 2QADB 4PGDB 3OKMB 5B38G 4H5SA 1TQCC 2C4FU 1D5MA 3P0VH 3RVXC 3VFGL 1LEGB 5CLWA 1GC1H 2JJTA 4PTUB 4ELME 1TZHA 1FFOB 3LN4B 5F6HI 5D2NE 1E4XI 5E8DH 5CBEB 4XBEH 5E2WL 5TE6H 3QR2A 5BW7A 3V0WH 2OI9B 5ENWA 2X6MA 1UADC 4KKLD 1NEUA 4PJHB 4YGVA 3CSPA 4J4PD 4I3GA 1BVZA 1L6ZA 4MCZB 2JCCA 5IQ9B 1JHLH 5IGXL 3SDCA 5HHNA 1T4KA 3NABH 4PREA 4XPBL 4G8GE 4NQCE 4QY8B 4FABH 3MODH 1JZ3A 2XTJD 4HWEH 2IMMA 2ENYA 7CGTA 3FOLB 5D72L 4DN4L 2A77H 3NA9L 2DQCH 1EZVY 1KJ2L 1V7NL 1QVOB 5B22A 3BT2L 2I9TB 3K8LA 3RY4A 4U1JA 3GI8L 5E5MB 2P43B 1I3UA 1QHOA 2UWEF 4DGYL 5DSCA 2EE9A 3OR6B 4YZFE 4PB9L 3IDMB 4NO3B 6CGTA 3Q3GA 4WW1B 3U7WH 2RFXB 3G08A 5LQBL 3CU7A 4JFXA 2OTWB 4LPTA 3ARQA 4XVTL 4QNPF 1N0XH 2X1QA 1J86A 5EOCJ 3UPRA 1QFUH 1KTKE 3FMGH 3NIDE 4XPFL 3EYUH 4YR6B 1VERA 2EZ0C 2FBOJ 3HE7A 4JZOB 4HWZA 5MHSE 4NQVA 4P49A 1D5IL 5FM5O 1KB5L 4Y0GA 1OT2A 1JGEB 2GTZB 2IADB 5C8JB 3Q6FB 3RX8A 5JOFA 4OF8A 5D96C 1R5WB 3UZEA 5I1EH 3QHZL 4ZO9A 1CFNB 3N85L 3OB8A 5HJ3B 4K3DH 4NC2B 3ZZ1A 2C5DC 3MNZA 4HZLA 4XH2A 4KPHH 1NDMB 3DURB 1NCAH 5EU3A 2MFNA 4KJWD 4ZFOA 2BVYA 5IK3A 1MH5A 4LEOA 2HTLC 1NCUA 1FZMB 2MJWA 3NCMA 1EK3A 2Y36L 4KUZH 4I18C 5I6XC 3MV8E 5GRUH 4JRWA 1YEGL 3ZKND 2P5WA 3WMSA 3P77A 2YPVL 3MLUH 1O7VA 3DX7B 5IVOA 3HMXH 5EU7C 3UC0L 1YEEH 2A83A 2GUOA 4TSAH 5D96B 4WI6A 3CDGB 4HLZG 1SBBA 5C0AE 3ZKQD 1G0XA 5B3NA 2VXSH 4LPUA 3SGJC 5CCKH 1JF6A 4Z7OE 4NQDE 1K8IB 4G43A 5EOCL 5JXEC 3QCVH 3ZE1E 4JN1H 2OK0L 2SEBB 4KFZC 4PY8I 3MBXL 4P5TC 5CJ8A 4OLWL 3LKRA 1BREA 4QHMA 3L9RA 4PBWD 4MB3A 1J8HE 2NNAA 3WIHH 1FZOB 1NBYA 1WZLA 2IPTH 3ZDZF 3CGTA 1FLRH 1U8IA 4E0RA 2ADFL 2FRGP 3WDJA 4MJ4A 5K59E 5I1IH 4PYHA 1ZT7A 5AG9A 1PX3A 1KCSH 2AJ3A 1Z3GH 5D1XD 5I76B 4WO4D 2H2SD 2I24N 4JDVB 4DUVA 4HWUA 3W0WD 5HDBE 1T5XA 3T04D 3TEUA 3HHRB 3GKWL 1JWSA 3HCVA 2AJYL 1G9EA 1FNEB 5EBWB 1CCZA 2VXQL 2DQIL 1ERNA 5DJCA 5T1LD 2E27L 3HUJA 3IKCB 3F7YA 3HR5A 4JG1L 3VXNB 4ZUWA 2R0LH 1ZT1A 3HZMA 2ZG3A 1TITA 2GSGB 1AQDB 1RUMH 4V1DB 3T0ED 2EXYC 5JHDA 5EZIL 1MNUL 2NR6D 4DEPB 1HH9B 4YHMH 1NBZA 4ODXA 4F3FB 4XVSH 1KJVB 4Y16C 2VDPL 4MAUL 4JQXA 4G8IB 3RPIB 3VFOA 1IAOB 4U3XA 3NCYS 3P4MB 5FIEA 3GSRA 5T1MB 2WP3T 5ACZB 4FMKA 4OLZH 4LSUH 3CVIH 2CDEA 3O3DA 3GHBH 1U8OA 3FO9B 2A2QT 4M7JH 4PRAB 4I5BB 3QQ4A 5C0DA 1ES0A 2BOBA 5ANME 3DVNB 5T1DL 2YD5A 4NN6C 2C1OA 1T3FB 3O11B 5IOPA 3TYGH 3ZT7A 1F4HA 3QUYA 3CNKA 4ODVH 2VXUH 4ONOA 2O5YL 3REVB 1CR9L 2C3XA 2ZPKH 4Y16B 4FXGB 1DFBH 2ADIA 4ZUSA 3G5XB 4PJXF 4XP5L 2BY3A 3RTQD 4MQXD 3VH8B 1KB5A 3MQIA 1QEWB 4UV4H 3V6OC 3MBEC 1F4XH 1G6RL 1NCDH 4PD4K 4X6DF 5HD8D 3LN5A 1K4DA 2XWJB 4JGUA 4OSUH 5M7QA 1Q0YL 2WINA 4YHIA 3QUZC 4LSVL 4NWUL 4WDIB 2QSQA 5FB8B 3S6CA 4NN6B 1HSAA 4ZUTA 2FJGA 3BMWA 3JV0A 1S7QB 5EIIA 4U1KB 4PJ7E 1JFQL 2B0SL 3ULUC 2HG5B 4H1LG 1NANH 5GS1A 2JJSC 3U82B 2OR9L 1N3NA 5E8PB 2GJ6B 4P46A 4EDWH 3GSWA 3U4BH 3O2VH 2MKLC 3L1OL 2IBBA 3AU1A 4S0TD 4F7PA 4GKZB 5IFHH 3MBEB 5CZXC 1SMAA 3ECBB 2G2RA 3FFCD 3FT2A 4U7MA 4G7VL 4YE4H 4U6YB 2OTUB 1JJUA 4ZD3L 1LD9A 5FCUL 1MFAH 3AC0A 5TQ0H 4FQQA 1LGVA 5HVGB 1NMAL 3NA4A 3FO2B 3B9KC 1XIWD 2W60A 3G9AB 3UO1L 3TT1H 4M4RA 1BOGA 2ENSA 1UENA 2NY0B 2R9HD 4Q97A 3QEGH 4U1NB 1ZWIA 5HVHC 5E6YA 1KLUA 2C3HA 5DMJB 3K81A 3RWHB 5IMOB 1A21A 5ISZA 3TBYA 4DK3A 4X99A 2ATKB 5IHZA 5KVDL 4XB7A 4LASL 4RDQG 1VADA 1RZKC 2JB5H 3TCLA 1JYXA 1M7IB 3HA0A 2MHAA 3MRMB 3MACH 3EYOA 3QUXD 3TIDA 1A4JA 3BKML 5BS0E 2WP3O 2FR4A 3AREA 1YMHB 4QXUL 4XT1C 3B9KB 1JZ8A 4NM8L 3BESR 3D9AH 1DE4B 5FDWB 1ZLSL 2ICCA 5C0EB 2VIRB 2R2EA 1F58L 3LIZH 3BJ91 3B8SA 3LH2H 1BQUA 1NANI 5HVHB 1KPUB 1U8PA 4HKXA 4Y5VA 3PHOA 4TNVK 4HH9A 5KAQG 4G6AD 4E42A 4EUPH 3VXRB 3GM0A 1U3HA 2H41A 3DSFL 4P23C 2X5PA 4K55A 2VAAA 4JRYB 2F5AL 4CW1A 3OWEA 5DJXB 3N50A 3PF2A 5K9KA 1F97A 5MENB 1YMMB 4KKAD 5GGTA 2JCCE 2BNQD 4QOKA 1ZLVH 1NC4A 1JGLH 4HV8A 2WBJA 4KWUA 3TBVB 2EYRB 1BFVH 3J7HA 4LMQI 1KCKA 1P69B 2J6EA 4XTRC 3F7VB 4RSVA 1XF5B 5T1KA 5MERB 1RHHB 5GS0D 1IM3B 2NY6B 2NY5C 1BHGA 4NYLA 4ZXBD 2VLRA 3I85A 1U2HA 1CFVH 2AEQL 4P23B 3KGRA 3OXSA 4X6FB 4I13B 5I74C 1M71A 4I48B 3SEPA 1K9TA 1MJUL 4LVEA 4ODUB 4R8WH 3UDWC 2Y07L 4RAUB 1QSFB 4XXCA 1T83C 3F5WA 1KPVA 5ESQB 3V4PH 1RK1B 1KGCE 2ADGB 4PRIB 5D9SA 3DXAA 4W68A 1KPRB 4MJIB 2E9JA 5IV2B 3S9DB 1LDPH 1KEML 2DQTH 4IRJD 2IQAB 5HBBA 5C09B 1FG2A 5C0FB 1DLHB 4HUNB 3DRQA 3ALWA 4LLAA 1QKZH 1OM3H 2A6KA 2EKSA 2AEPL 4OGAC 2FX9H 4NZJA 4UI2A 5I74B 1YJDL 5J3HC 3BH9A 3T0DA 5EA0H 3RNKB 3WD5H 2X9XA 4OF3A 4Z7QF 2P8LB 5IEKB 3IU3A 4Q9RL 2J88L 2D7MA 5KZCB 4FQXC 4ALAH 3U4EA 1RZ7H 3PHQA 2UZIL 1I7RB 3JZ7A 4HZAA 4GRWB 1T04B 3I50L 2VZVA 4PP1C 2B1HH 1VEPA 3C5JB 3WKNA 4NJ9L 2BHUA 3GMNA 5DJ2B 4F7TA 3MJ9H 4Z7OF 4HS8H 3IJSB 3WUWB 2JIXA 3BPNC 1QFOA 4K07A 3NACL 5J7CC 3EDDA 3HNVL 1DANU 1ZHNB 2C3GA 5KN5B 5HY9A 2C26A 2VDNL 1A9EA 1NCBL 4X5WA 3SE8H 1ZA6B 5EIQA 3S97C 3SKMB 1IM9D 1UXWB 3B9AA 1NGZA 4FQXB 1IFHL 5HHXL 3WFEL 1J0KA 2PCPA 1OPGL 5BZWB 43CAB 2X7LB 3VWKC 4IDLA 5A40E 3P30H 3MZGB 4Q0XL 5K59F 1VFBA 2DQEH 4KV5E 3LQMA 2D9QB 4Y2DB 5B3JE 3VXMB 4L3CB 1J1PL 5SWSB 35C8L 3BRFA 3KG5A 5JW4R 2BC4A 4OT1H 4ZDHA 4KRPC 2AI0L 3HPLA 3ROLB 4KROC 4D3CH 5HDBF 1NCNA 4X5XB 4J3OC 4Y4HA 4XAWH 2IQ9H 2VLLA 4L4TA 1MREL 5SWZD 4EXPX 1KTDA 1UZ8B 3GEWB 4JRXE 1DQML 5EORH 2AVGA 4JDZB 3TJEL 3VWKB 4WEBH 4A2LA 1NLBL 3HZYB 1CTNA 4M6OL 1CLYL 3WUZA 3D6GA 1IGTA 1MAMH 3D0LA 3HUJE 4QYOB 4TUJA 4APQA 1OOAA 1IGJA 2HAZA 1OY3B 1N64L 3NPZB 4FNLH 3EYQD 1OW0C 4TVPD 1P4IL 4M9PA 4HDIB 1H0DA 4KRPB 2R0KH 5GHWL 3W9EB 4U6XB 5E24E 3MX0A 2QQNH 1QSVA 1DZBA 5D2LB 1PY4A 2OMNA 5I1HL 4WHYH 3L3KA 4WRLA 1N0LA 4XC3H 3V6BR 1JVKA 4NPYA 1N2RB 4LAQH 5GGQH 5JDJA 4JFHD 2HVJB 5DXWA 3ZL4L 4EI6B 2HTKC 4JKPH 1C5DA 1J1OL 1HQ4A 2F58H 5E8NB 3D25A 4WI5A 4YXHL 4EI5C 4CGTA 2VQTA 4KK8C 1NCWH 4E9LA 1TFHA 4X4MA 4N0FB 1S9VB 1BIIB 2KPNA 4ZFFA 4NNXA 2RCSH 4LSPL 4O58L 4KTDH 5DRZB 4PRHA 2Q1EA 1U8MA 3B5TA 2NCMA 5F7YC 4G80A 1JPSL 4OCSL 3GSUA 4GAJL 2FYYA 1Q72L 4YDKL 2F19H 2J8UF 4H88H 3T65B 2A74B 1I1AA 3QG7H 3V9FA 3SCMC 4Q6IA 5K9QI 3MJ8A 4S1QL 4TPRL 1BBDL 1OAKH 3F58H 1K6QL 3GMRB 1OAZH 3S8WA 4XPTH 4TQEL 1MHEB 1GGIH 1PGRB 3CFKA 1NFDB 8FABB 3V4UL 5CD3A 2NMSA 2Z31D 1OGTA 4OD3H 4PJ7F 1OSZB 2V9RA 4DK6A 1GOFA 2NY3C 1YDPB 3CSGA 4A6YH 1A3RL 5FK9B 1XF1A 1NFDF 1UA6H 2LU4A 3SY0A 3QDHA 2BVOB 3O2WL 4H0HB 4KVCL 3STBA 4Z78B 4DFIA 3ROOA 4F9PC 1P1ZB 3SCMB 2ZCLL 1RUAH 1HE7A 3WEXB 4EUPB 3O9WC 4LLVA 3S4SG 4DKEL 1IAIM 3HAEG 3LB6C 4K3EH 2F54A 2KH2B 4NQSB 3BPLC 5F96L 4JY6B 1ITCA 2CD0A 1T20B 2HLFC 4KI1A 2XXCB 1CU4H 4QTIL 3V52L 3HE6A 1RZ8A 3QXWA 4LLQB 5JW3H 2RBLA 5CEZL 1QUNA 3MGAA 1SJEA 1C5BL 4N0UB 4LARL 4LQFH 1C12A 1TJHL 4DGVH 5HGHB 4CVXB 2NY3B 3IFNH 1A8JH 4J3VA 3IDIB 1AR2A 3VFPB 1ZKAA 2J4WH 4OFVA 1F11A 3K4AA 1FNSH 1XCQA 1GOGA 2B4CH 1U95B 2DLGA 3ARRA 2BVPB 5EC2A 3GSNA 3T2NL 2HVKA 5CP7A 1U0QA 2UY7A 1U58B 3O9WB 5TQ2L 4GBXD 3MV9D 4JZNB 3RWGB 2X1OA 2WIIA 3BPLB 1F90H 1HEZA 5JOPE 4XPAH 4BK5A 5EUKA 5ISZE 2ESVB 3FB8A 1AGCA 2XPGA 1KV3A 5DQDH 1DP0A 1T5WA 2JJVA 2AQ3A 1I8IB 1ONQA 1WFOA 25C8H 4FQHA 4FXKB 2DJ4A 4NO0B 4WFEE 1ND0A 3S37L 5BZDA 3ARUA 4OV5A 1XF4A 4H25A 4KI5C 4Y4FC 4LKXA 2H2PD 3MRJB 5AEAA 4L8CA 2ID5A 5H2BB 4E41D 1B6UA 3PV6B 4Z7UB 3GMQB 3WV0A 3W2DL 4HK3J 1ZHBA 3DIFA 4YHLH 3C60D 4FQJL 5KS9A 1IKNA 1EEYA 1MCPL 3VE0A 1X5YA 4U6TA 5DO2C 2IH3B 3BD4A 3V6FA 5GZOD 5L0QC 2FGWL 3C5SA 2P48B 5BJTA 4MNQA 1X9QA 2PR4L 5F9AC 3NTCL 4HC1A 4QOKE 2ZUSA 3FB6A 1IAIH 1FNLA 3RU8H 4FFZH 1R3JA 4Y4FB 1A3LH 3LKPA 1AQKL 5I8KL 5BV7C 2QL1A 3PP3K 5F1IA 5J6HB 1BEYH 1I1YA 3CJJA 1VACA 4K7PY 3L5WB 4WJ5A 3SGKC 1PDKA 5FHBL 3Q2CA 1G7QB 1XR9A 4N8VG 5EH1A 5ICXB 3IDGA 4LHUG 5TDNB 2EO1A 3DHJA 1UB6A 5MEOB 4OM0H 2O5ZH 2X42A 1TZIB 2A73A 3DHMA 4PRPB 5L0QB 2IALB 2Z8SA 3MGTA 4YHKL 3IRPX 4KAQH 4RIRB 3TBSB 3G5YB 4HJ0D 2ITDB 1TQBC 5BV7B 4NBZB 4ZTPH 1H3WM 4NRYB 4HS6A 4Z7VA 5I71C 3FJTA 1NKOA 1EFXD 3OAUH 3FRUB 3BP6A 1MFCL 2C7UA 4KUCD 5ESVB 1ZANL 5DRNA 3MLVL 4EBQL 4I4WA 3TM6A 3LOWA 5TDPA 3WFCL 3U0TA 1JK8A 1FL5A 3OF6A 4PJ9B 4AYFA 4QRRD 4TOYL 1RUPL 1EHNA 4FQIL 4HUXB 1ZEAL 3UTZB 4WHDA 1HOCA 1JTOA 2DBLH 5DR5H 3RKDC 4YDIH 3N9GL 4RFEB 2Y5TB 3QZWB 1EO8H 4HAGA 1X6NA 2BRQA 1QBMH 4HUUA 1QLFB 2GY5A 1TQBB 4UOW1 5JNYB 1DDHB 2H32H 4YIQA 4G9FD 2L7JA 3H9HA 4CMMB 5C3TA 5I71B 4Y19A 5E7FA 3TJHD 3H0TA 3GBNL 1IAII 4U4BA 3O81A 4ZODA 4UMGA 1HDMB 3A67L 1SBSH 1FDLL 4IS6A 4DZBB 1CLOL 1MI5A 4QKXB 4Z7WB 5B8CC 2BNUB 2UZYB 1JZ5A 4K7FB 1TTFA 4NKIL 3PDOB 3ULVE 2F8OA 3FQUB 3T0BA 4FFVC 2XN9D 1IBGH 4D2NA 1FVCA 1F4WL 5JMOC 4LHQB 2AJUH 1QZ1A 3H6JA 1ETZB 3MR9B 5I1GL 4PTTB 4HXAL 1CD1B 3VXSA 2NXZD 3KPSA 5D5MA 5J12C 1Q9KA 3MXVH 5B3JF 3BP5B 1JGVL 5CGYD 4X9IA 5CGMA 1FRGL 2VL5B 5E6ZA 3QXAB 4ZQKB 5I2IB 3DSNA 5TDOB 4KQ3L 4UOW0 2VZUA 4LCYA 1BZ9A 5E9DA 1VB9A 5B8CB 5CJQL 4BSVB 5TGBB 1HQRA 3KPRB 2ORBH 3EHBD 4G3YL 5KSBF 1FNHA 3FZUC 3WFBL 1G7JA 1KCVH 5F1NA 1F3DH 5F6HJ 4Y5XC 1YEFL 3BSZH 4OZHE 4J3TA 4XB8A 1BJ1H 3OKLA 2QADD 4PBVC 3B3IA 5INCA 4MNGE 1YECL 5J12B 2OBGA 4N8PA 5HYJB 1B2WL 1JTTA 1V8HA 4AEFA 4DCQA 3G5VB 5LGHL 2CK0L 5HHME 3ZTNH 1NUGA 1FV1B 2C4FT 3PL6A 3FQNB 3MJ7A 4A6YB 3NCJL 3TA3A 4U2YA 4NCDA 3PWPB 3RY6C 4BZYA 3BIKA 3FOMA 2ZG1A 4AEHH 2X4RB 3EO1A 4U6VH 4AJ0A 7FABL 1OQXA 2AERT 2R0ZL 1KIRA 1DQJB 4RWYH 4Y5XB 2YUXA 3U79A 2GTWA 4NFBA 5C07A 5GQBA 3W11C 3O0RL 2LVEA 3O8XC 3EOAB 1FL6A 4M7LL 3RRQA 1HHKA 3RVXD 3SO5A 3DWTA 5DD0H 4FTVA 3P4NA 2QQQA 3GI9L 3LKQB 4JO1H 1SEBB 4X4ME 3VRJA 1DTUA 3DV6B 5DI8B 4PRHE 3WS6A 2R2BB 3BZFB 3K3QA 2MOVA 1XAUA 2HRPL 5GGRA 4L8SA 1U8QB 5EULV 2AXFB 3C2SA 1EEZB 4NO5B 3DYPA 1ACYH 3QFJA 3MFGB 5I8CA 2Y25A 3O8XB 3H7BB 5I1AA 3W39A 3KPOB 2W07A 1LK2B 4XRCB 5I73C 4L4VA 5L8LB 3IXTB 2E9WA 4DUWA 2YWYA 4XNUH 5L6YH 1CFQB 4LVOC 2CIIA 5JUEL 3TT3L 5BOPA 1YNTA 3PGCA 4NKDA 4H26A 4LIQE 1WEJL 3O6FA 5BRZA 1LO2L 3MREB 3TO2A 4X6EA 5FECA 3K0WA 4KRLB 2JKXA 3D2UB 1GH7A 4JFFB 3EYSL 5L88L 3RY5A 3HC0B 1EXUA 2DBJA 5L2JA 1HWGB 2GK2A 3C2AL 4U1MA 1CF8L 3TWCH 4JQVA 4PJCB 4QXGL 5I73B 2X89A 2F54E 3Q1SH 3EDEA 3LSOB 1JPTH 4LVOB 2AV1B 3TPUA 1MLBB 5HVFB 1CXIA 3C5ZC 4PY8J 4UNUA 5L9DL 1BFSA 4JFYB 2ICWA 4WFFE 2F8VA 4WY7L 3RUGE 3KDMA 4LAJH 4POZD 3KPPA 4LGRB 2XQBH 4K3HA 5F7MC 1R5IB 2GYSA 5EUOA 4Z5RB 1H3VA 3HPJA 3BZEA 5E1AB 5TPWH 1UVQB 2Q8BH 3EYFB 5DDHA 1ADQH 1I9JH 3L6FB 4LPXA 4PJIA 4PRDB 2DM3A 3D85B 4PR5A 5HYIA 1SY6H 2H1PL 4GLRH 4PRNB 2ZWLT 1ZAGA 2DLEA 1DBJL 3C5ZB 1MJJB 2XV6B 4XP6L 5ID1A 4Y1AB 3M17A 1FGNL 4P2CG 3ULUL 3QEUA 1A6TA 5D6DC 5E8OB 3WL9A 3STLA 3JWOH 4FQLH 1OLLA 1OB1A 2BNRB 3MUGB 4DGIH 1K3IA 1LK3L 1S7TB 3GSOA 5DFVC 5DS8A 4O2EA 3IDUA 1NGWA 5ACMA 4MD4A 2DTMH 4ONGH 4I0PA 1U9KA 1N5YH 5KS9E 5C2BH 1KTLB 4AL8H 3ARFB 5CILL 5DT1L 4OFPA 1A1NA 1A3QA 2V5SA 1V3JA 4GKSA 4UILL 1T1ZB 4J4PA 4WUUA 3NH7H 5CEXB 4V1DD 3D0VA 4P5TA 4UU9B 3O3AB 3DGGB 4OIIH 4PJEA 1IEBA 5ICYB 4R0LA 4U1IB 2XWTA 3JTTB 2R56L 3GIVB 4NRXA 3T1FA 1I3GL 5D70L 2X4SA 5ITBH 3RIAK 3RHWF 3MCKA 3BJLA 3X11B 1S78D 3RWFA 4EN3C 4UTAL 3IDJA 2ZCHH 5IVXA 4NHCH 2G60L 1GGCL 4HT1L 4Y5YA 4J7RA 4BFIB 3T0VA 2AQ2A 3OJ2C 3RZCC 3D39A 1E6OH 4P9HC 2EXWC 5J0BA 1RZKL 4XCCL 3KLHC 1CDBA 4NWTH 2BVUA 3RWJB 1FPTL 3OKOA 1C5CH 2WUBH 2ZUUA 3QDMD 5E2TL 4Y4KA 4L29B 4X6BA 4HMEA 2YXFA 3RX5A 1IJ9A 1NAKL 1ZA3A 4GLRI 2DQUH 5AUMA 5HYFA 2HJKA 3VD7A 2EXYD 4RMQA 3E8UL 1FFNB 4JFZH 1PYWB 1Q8MA 1W0YT 2W9DL 1EHAA 4E5XB 1D7FA 4P59H 4Z7VE 4Y16D 3UTTB 1X5FA 3IFPA 3GK8H 3QWRD 4HGWB 2HKHH 3OKNB 43C9B 3QB7C 5FYKH 5HGAA 2EH7H 2R4SH 3OX8B 3INUH 3FO1B 2VABB 2NY2C 3RZCB 1IKFH 2G5BB 5FYJH 2VXVL 4AM0B 3X3GH 2W65B 2IG2H 3WFHA 3BN9D 1AO7B 1XGQB 3B2VL 4NJAL 5C0CB 4XNYL 1IC4L 2ZKHL 3B83A 1AGBB 4PG2C 1UACL 1FYTB 5C71A 4Y88A 1BFTA 3QIBC 4L8DB 4Y19E 1Q9LB 3UCRA 4WENB 2NY5L 5CD5D 3R06B 4OZFB 1CGSH 2GJ6D 4CBPA 4NSKB 1AGDA 4C58B 4H8WL 1WWBX 4ODWA 2PO6B 5FGRA 5B39A 3IDYC 3MBED 4TTDC 1QFPA 3O41A 4FRWA 4I3SH 1HILA 1CBVL 3O6KL 3UEZA 5EFIA 1TNNA 1P2CB 4F7CA 1MFEH 3DVFA 1PKQA 4MAYC 1RU9L 2Z0BA 2HKFH 2CSPA 3F62A 4LVNC 1CE1L 1UEYA 3QIBB 3VXSE 5BCAA 3KPSE 4JFED 2L4OA 1RZGB 4X5LA 2ATPB 2DYPB 2X4UB 1JI1A 5GJSH 2E5EA 2NY0D 5KTEH 5JPMA 2EE6A 4XMPH 3ZE2E 4NDMB 5FYJU 1IARB 4X4XA 4FFYH 4EZMA 4M03A 4IRZL 3IDYB 3R1GL 5CZXD 5E9DE 2D0HA 3UBXI 2JB6A 5I1DB 4ZOEA 1IE5A 2VLJB 1MHPL 2X41A 1G9NH 2P8MB 5C7XL 4OZHF 5D7JD 1PSKH 4WO4A 2HJLA 2BXYA 4MAYB 1G7HA 3EIFA 2P24B 4JZJC 2PTUA 3WLWC 1BIHA 1U8KA 4F2MB 1DUZA 2XA3A 4IBLT 3WJLC 5T3ZE 3QUMH 1Q9WB 3EYVB 2KQNA 3NMEA 3QCUH 5CEYB 2NTFB 3OTTA 3UX9B 3VFNB 1A6AA 1FIGH 1QR4A 5A1AA 2BY2A 4IRSB 1RJLA 5KVEH 1A4KA 4HGMA 3MRPB 4QHLB 3VXRD 3T0EA 4LRNH 3VRIB 1KEGH 4NC1C 3OHXA 4JRYD 3GFUA 2FZ3B 3ARBC 3QHTC 4S11A 5EOQH 1VHPA 5MEND 1MFDH 2YD2A 3LEXA 1OD7A 3MMEB 1A9BB 4JZJB 3MUZ1 3QDJA 4KKNA 4JREC 3GMPB 5C07E 3QPXL 4UIKH 5ALCH 1G7IA 1T1YB 5ALBL 3DETC 1I8MB 5DJYA 1A7NH 1BD2D 5TJWK 5AD0B 4TNWF 2AABH 1KCRL 4FQPA 4FTVE 4OUUB 5D71L 2AXHA 2DDQH 4GG6A 3WFDL 2NY6D 3UJJL 3VH8G 1DUYB 5F71A 3ZKMC 5DJ6A 4P9MH 3JBG7 4L3EA 3IGAA 1OWRM 3MRFA 5IB4B 2ITCB 2OL3A 1WFNA 3LKSB 4X80L 1X4YA 3ARBB 4LPWA 2RR3A 4ZO6A 1T1WB 3P73A 4BM7A 1YEKL 4F7EB 3OKEB 3V5DB 4N0YH 3RL2B 1CZ8H 1QSFD 3QFJE 5J56B 3GGWA 1QQDB 3RTQA 3ES6B 5FGBC 2O5XL 4PRID 4KJPC 4XTRD 1UM6H 4LP4A 3BGMA 3VMOA 2LVCA 1NFKA 4MJID 2O93L 4UBDC 1U8HB 3RVVC 4KU1A 5HHOE 2BOCA 1JCKA 1QRNB 4M1GH 4BJLA 1E4KC 5EPMB 1XH3A 5BRZE 4NKMB 4JM2A 2VLKE 1W72A 2WV3A 3MNWA 3L3GA 4N90D 4UQ3B 3CFEA 5GSRA 3S88H 4UT9L 2VKWA 1RULH 1JZ2A 3V6ZA 5D2NC 1BQSA 3LPWA 4K7PL 3LY6A 4O51A 3GHEL 3LDBB 5KSAD 3QH3A 5KZCD 3I2CL 3QBTB 1U3JA 1R3KB 1DBMH 4P2QB 3FFCA 1T03L 1UJ3C 3MRKB 4HKJA 1BQHB 3NFSH 3SE4A 2I07B 1MCNA 1JGDB 4XVJL 5C08B 3RUGF 3CSYA 1GGBL 4F57H 5FO8B 1G84A 1DVFA 3S36H 4QGYA 2XZCH 5F9DC 1JF1A 3U9PL 2AXGA 5LJYH 1AC6A 5MI0C 1SQ2N 2H8PB 2PTVA 5E2UH 3LKOB 4X98B 4ELMB 1BBJB 1FC2D 1LO4L 1R24B 3SGEH 2V7HA 5D2NB 1MJ7L 3ARGA 1K3ZA 2GITA 3PDDA 1L4IA 5E2JA 4LCIH 2YSSB 3QJFB 3MRHB 1R3HA 2E9BA 1DANT 3NCCB 4PLJC 3GSVB 5HSFA 4FQXD 3I3EA 4NO2A 4NFDA 3AB0C 4DKFH 5BVPH 3AY4A 1CFTB 4PJIE 4WI3A 3H8NA 1UJ3B 1NAML 5IW1B 4MXVE 2W9EH 2YBRB 5ADPH 5F97E 1T22B 1ZS8A 1WFUA 2DLFH 1FZKB 4G8GB 4Y2DD 3VXMD 5SWSD 1ZT4A 5MI0B 1N7ML 1ZGLM 1DQDL 3CVHA 2FL5A 5CINL 4GMTH 4OAWA 1U6AL 4TSCH 3UBXB 2RHEA 4FP8L 1AIFA 4LCUA 5HHPB 2VDOL 4NCC1 5I1LA 2AJXH 1D9KC 2D0GA 3BFOA 2V2TA 4J23A 1I8KB 3SDDC 1OAXH 1RAMA 3DBXA 1ZXQA 2FLRT 1A7OH 5J9PB 1NLDH 3AB0B 4XVUC 5D7LD 3F6IA 5D7IA 2QR0A 1T89C 3VWKD 5IROC 4KHTH 1MRFH 1CL7H 2DRUA 4NKOA 5HGDB 1XZ0A 4AMKL 1U8NB 3LQAH 2X4PB 4HQQH 1P84K 3GJFH 3PWLB 4OTXL 1C1EL 2VDQL 4OI8A 4KRPD 4WV1C 2X4QB 1FC1A 4PJEE 4HFUH 2OJZL 1E0OB 3IJYB 1YN7B 3ISWA 5IB2A 3SQOH 1RZFL 4M7KH 1S7XB 4GAGH 1D9KB 5EU5A 2BRRL 2ICEB 3O3BA 4HLZH 4X0KA 5D6CA 1A0QH 3SDDB 4WWKA 3SGEI 5TFSH 5J1AB 1VFMA 5IVXE 5DVOA 5BXFB 3U6RB 5DK2B 3VJ6A 5H35B 3D3VB 4OFYD 5DD3H 4MNHA 3D39E 2XYCA 4HWBL 1R3LA 1CQKA 4K2UH 4IDJL 3FB5A 2UV3A 5L2KA 4RBPK 4QRQB 3KYKH 3FTGA 3MV8B 4LBEA 4MQ7A 5J06A 3IXAB 2VITB 2XICA 4K71C 4WV1B 1JV5B 1UYWL 2PXYD 3VFMA 3RKPA 1VGEL 5C0BA 5DF0A 2AJSH 5BQ7A 3N1GC 2P5EB 4MJ5B 4CKVX 2DQHL 3GBLA 1ORQB 4DKAA 2D31B 1FSKC 4PJBF 5E94B 1IILE 4WI7A 5IB3A 5JA9A 1OCWL 1X7QB 2YD8A 4X4YA 4EEEA 5C0AB 3VFRB 3EZJB 4YC2C 2HTKD 3BRDA 2DWEB 1JNHB 4M5YL 2E7BA 4ETQB 1QFWL 4NQDB 2EH8L 3B2UC 4EQ2A 2CMRL 2HFEB 12E8H 3L5XH 5ID0B 2R69L 5GRYA 4LEXL 3D69A 3MRQA 3VGAB 3BQUD 1VEOA 3WUWG 1BJMA 1CL7I 3QQ3A 4K71B 4RFOH 1J8HB 3H3PL 1KIUA 1EPFA 5BV7L 1XGRA 1CGUA 4ZS7H 2VZTA 1IQWH 3G6JB 5H94A 2EECA 2YMXL 3VDCA 1JNNL 4UOJA 5FM5M 3IFLH 3EO9H 3SCMD 1FSKB 1EEQA 1YPZF 5ERWB 3U0PB 2A6IB 3GNML 4HXBL 3WNNA 2UUDK 4QWWC 5FAAA 2Z9TA 2XTLA 2P42B 4ZSOB 4JHAL 3RGVB 4X7CC 4YHZH 5ITFB 3WCYA 3TVMA 1FL3A 4OKVB 2WQRA 5IW6A 4LSRH 4OLXH 3SKJH 4BQBA 1PKQE 2YKLL 5KOMC 2NY3D 3H9SD 4LSSL 3L3OA 4Z0XB 3NAAL 3UTPE 3ETBF 4URTB 4X7SH 4HPOL 5BMFH 2V2WB 1RFDL 3FT3B 5AZ2L 3FL7A 4RNRA 4JN2A 5DUML 5L7XL 1HYSC 2IAMC 3G6DH 1NAMA 3WIIL 4G5ZH 5I17A 3H42L 1S9WA 4ZFGL 4S1SL 2VISB 4B53A 4YEFA 2HLFD 4F15C 1PG7H 4R3SA 5F6IC 4Z6AT 1WCBA 4XMKH 5FOBA 4AG4H 1CLZL 2PTTA 1QR1B 2A38A 2WK2A 4NUJA 3CLEH 1JWUA 1FZJB 4NO0D 1GIGH 1CVRA 3SJVB 4GQ9H 3ZTJH 3GUTB 3AAZA 2QSCL 4HIHA 3W0WE 1BQLL 1GPOL 1CICC 4Z77B 2E8ZA 3OJVC 4JFDB 4HCRH 5ANMB 1IZJA 5HDOA 4GMSH 1QO3A 2IAMB 5AYUH 4EQ3A 3QIWA 1X5KA 4PS4L 4H1LH 5F1OB 1OP3K 5DD1L 3V5HA 4GRLC 4D0BB 1LO5B 3DX8A 3GIZL 3T8XB 4F15B 3FT4B 5CUSL 5F6IB 5DJAB 4YHPA 3GBML 3T0EE 1WUNT 5F7DB 3MRGB 4MA1C 2ZSVA 2D03L 4XPHL 2BJML 2OCFD 4U1LB 3VFGH 3QDJE 4KI5D 1GGYA 4NT6A 1S5IL 4OCNC 1F02I 1CICB 1PEZA 4G7YL 3DPBA 3NN8A 3FONA 5HHVL 2FJFA 5E2WH 1EGJL 1Q9OA 2HT4D 3H2WA 4GG6E 4HWBA 4XP1L 3QXDB 1L7TL 1KLGB 3QNZB 3IVKB 4GRLB 5JQ6L 2HMIC 5MEQA 1U92A 2NYYD 4D0CB 4U1GC 5IGXH 2D7OA 5DO2D 4YBHA 4M62H 2B7DT 5C6PB 5DRWB 4PRPD 4XPBH 1N8ZB 4CVZA 3FQRB 4PJ8A 1I9IL 2Y4SA 4K94C 3SDXF 5C9JA 2UVFA 4G9DA 3T09A 1CDUA 4P5MA 4HSQA 4OZGE 4LNRB 5D72H 3EJJX 4DN4H 3NA9H 4HMDA 4BFGA 2CKBL 5FKPB 1KJ2H 1V7NH 5INDB 3BT2H 1NGYB 2XZQL 4N0CC 1AH1A 1TVHA 3T77A 3GI8H 3K46A 4EUPG 1FO0B 4DGYH 3MXWL 1T7XA 3S35L 4PB0L 2XZZA 4O5LL 3PWVA 4PB9H 4Z8FL 3VFUB 2X1PA 3IT8D 1KUMA 4PJ9D 4GAYB 1H15A 4PJGB 5LQBH 2JJTC 4XVTH 4HHAB 3SDAA 1D5ZA 3LD8C 4XPFH 5DQ9A 1A1MB 4P2YA 1TZGL 1D5IH 1KB5H 3GSXB 4X6CB 1OTTC 4KKBC 1GHFL 3DX9A 3BP7B 2W0FB 1NGQL 4WTWA 3FFCE 5F3BA 4N9GA 1E27A 1PKOA 5CBAB 3QHZH 4ONHB 4GG8A 2FIKA 3N85H 3SDCC 3T1WA 4M6NL 4H5SB 3V4VL 4WEMB 1D5MB 3PIQB 4NHUA 3IS1X 3NZHL 2Y36H 3RKDD 4CU8A 1NEZA 1TZHB 1YEGH 2XZAL 2YPVH 1CGVA 3QQNA 3NZ8A 4UNTA 2HT3C 3MV9A 5ENWB 2GJJA 3UC0H 3EFFA 4BUHA 1VFUA 4YGVB 1PX4A 2WANA 2WBKA 3MFFA 2JCCB 5T3XL 4IMKA 1IAKA 4PBXA 4WU7A 3OKKA 3SDCB 5HHNB 1T4KB 3TO4D 3LS5L 4MDIA 5EOCH 3LRSA 3BEVA 4JKLA 1UWEL 2OK0H 3KPRD 3R4DA 3MBXH 4HS3A 3HE7C 1QNZL 4OLWH 5ETUB 2CO7B 4E41A 1W0WA 3IU4L 4UNVA 2XIDA 3JVGA 4XI5C 3QXVA 2EIBA 3IKKA 1RHFA 4F33A 3CC5A 1NC2A 3C08L 2FWOA 3C60A 1SYVA 5DSCB 3W9DA 5MEPB 2NW2A 5D7IE 3GMMA 5I66A 2ADFH 5HYJD 2P49B 4ENEC 3ZDXF 4IOSD 4K3JL 4LLUA 3T3PF 2HH0L 3QDGA 4HH8A 4XNMA 3G08B 4CL7A 4R7DB 4HX1A 2BNQE 4XXDA 3UPRB 4W6XB 4ZUUA 3PWPD 1OARL 3SPVA 3HE7B 4M4PA 4HWZB 4NQVB 1DN0A 2CKNA 3FZUD 3VRLF 4OF6A 2RIKA 3GKWH 4ISVB 3RIFK 2AJYH 5I16A 2VXQH 3H9YA 5JOFB 2DQIH 2VUOA 1J1XL 1Y0LB 2E27H 3OL2A 1DBBL 1MQ8A 4JG1H 1EBAA 1S8DB 5JXAL 4HZLB 3MNZB 1BPVA 3GRWL 3O4LB 4XH2B 1RJZA 5EU3B 1KFAL 5EZIH 1MNUH 4ZFOB 1AC0A 2OM5A 4MDJA 4MQSB 4GXUM 1MH5B 4LEOB 4EJ1C 1O0VA 1VSCA 2VDPH 4MAUH 1QBBA 4QTHA 5HXMA 1F3DJ 3U7AA 3BXNA 2P5WB 3C09B 3P77B 4JO4L 2Z8RA 2H26A 3STZA 4RFNC 4AIOA 1OL0A 2NY1C