1RJZB

Mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpies simplex virus mutant glycoprotein b peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
MIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Structural Basis for the Restoration of TCR Recognition of an MHC Allelic Variant by Peptide Secondary Anchor Substitution
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 14
structure length 100
sequence length 100
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rjzB00
1WAAF 1CN4A 5K9KA 5DD5L 5FUOH 1KN4L 4KI5D 1HH9B 4HWNA 3QG7H 1UB5A 4N1EA 2F58H 4Q0XH 4NO3A 4NRZB 3OKLB 4D9QD 4LCWD 1OSZA 2DBLH 3RVXC 2HYMA 5GRUL 1NJ9A 3MLVL 5FGSA 2OX5A 5IHLB 3ROLA 5FV1L 2OI9B 2KL6A 5DUBB 2Z8VC 5EOCH 2CXGA 2AQ2A 2OP4L 4JZJA 3TV3H 1N6VA 4K94C 3UTOA 3QEQA 1T3FA 5ESAA 1YPZB 4U1SA 2YSSA 5HI5D 4HK0B 5K9JH 1GGBH 4PJHA 4B41A 5D6CB 4ELMB 1Y0LB 1Q38A 3QYCA 3RX5A 1DZBA 1WC7A 3WIIH 4PRPD 2ESVE 3DXAD 4Y4HD 4M1DL 2E7LA 1LP9A 1LQSR 4DZ8B 5DK3A 1U8PA 4U1HA 3PDDA 4LIQE 2AKRA 5BOZG 4OI7A 4R7DA 4U6VH 3S5LG 3UYOD 1S7VA 3EHBD 3CDFA 3D3VE 4PRNB 2AJSH 1XZ0B 3FAWA 1ZE3C 5JW5B 5DZNA 4CVZB 3RIFF 3OXRB 3MYJB 3BN3B 4M5ZH 2DLFL 4H1LG 1HHKB 2D2OA 3VXUB 5IROA 3QCUL 4K55A 2DLIA 4ODXA 2FATH 2BERA 3RWDA 5JXED 3GSNH 4Y4FB 5IB1B 1I3VA 4U1MB 2R69H 3P0VL 4R90H 5J0BA 3HUJB 1UM5L 1AIFA 1A7PL 5IFJA 3T3PE 3S35L 1BBDH 3HCVA 3UYPA 1CGTA 3FRPA 2OYPA 4KTYA 3VE0A 3MRCB 4LP4A 2VNCA 1JF6A 4HHAB 3UJTL 5ICXB 2EE9A 2G60L 3I6KA 1U93A 4K8RD 2W38A 2EIBA 5TDOA 1T0NB 3MMEB 4XWGH 4JFDE 4X7TA 1QRNB 3TJEL 4F7PA 2HTKC 3EJZD 3MV9A 4KMTL 3V7AE 1C7TA 4MB4A 5E8NB 1D6VH 3NA4A 4OLUH 1UG9A 4JG1L 3O8XD 4OI8A 1GGIL 2P49B 5SX5K 1Z5LB 5F7EL 2B0SH 4YBQC 1RZJC 4OD1L 3SDXE 1U8QB 3DJ9A 1CD9B 5IK3A 1N8ZB 2QR0B 3MRFA 1GJIA 2YD3A 4YHLL 5D7IB 4PJDF 4JPVH 4ZUUB 3NVQA 5ESVB 4L4JA 4JRYB 4NZTH 2DLGA 1BJ1J 4X9HA 4KC3B 4PBVC 1U41A 3MLWL 2D03L 3QXTA 5EDXA 1NC2A 2VDNL 1T1YA 4PJIB 3WUWG 2BXZA 2HKFL 4Y8AA 3RNKA 1XGTB 3KVQA 1ZGLA 4DJMA 3WHE1 1CFVH 35C8L 4M8QB 5KVDL 1WTGT 2GITA 2Z31A 4LK4A 3CD4A 4HIEB 4WU7B 1F11A 3G04B 4JRXD 3IS1X 4P9MH 2R9HD 1ORSB 3DX9A 3FAXA 2CLZA 1PDKA 1IM9B 3V5HB 2XT1B 3DURB 5CZXC 1QLFB 1JYNA 4PV8A 1X5LA 5L7XH 5EUOB 4QKXB 3DYMA 4DN3L 5IBLD 4M1CD 3H42H 3MV11 4H20L 1F4WL 4JZNB 3SO3B 2VLJB 4NFCA 3D0VB 1VA9A 3U30B 1J12A 4IM8A 1AGCB 4LVNB 3A6BL 3OJ2C 4JFQB 2CGRH 1MHEA 4ZFZA 4BM7A 3AM8A 1I7TA 1CXIA 1EGJL 2BSRA 4BA8A 4MS8D 1QSEB 4XH2B 3P73A 4OFPA 2EIEA 1QR1A 4N9GB 1ZHKB 2P5EB 1MJJB 3GRWL 4JKKA 4NN5B 4RGNC 5LAXB 4DGYL 2J5LC 2J12B 4D3CH 2VL5B 3PQYB 3RVXD 4MAYA 1T7ZA 4X8JA 3DOSA 5I0ZA 1J87A 3IU4L 4F9PC 4P3CH 1IC4L 2BJMH 4RAUB 2BNRE 2HJFB 5HYSB 1VFUA 1FZMB 5T3XE 4WFFE 5I16B 5E0QA 4G7YL 1BBJA 2OL3H 4LLMA 5D4QA 1F42A 4HD9A 3T0WA 3T4YB 3EJYC 3SE8H 3GB7B 4JGMA 1NUDA 2YD2A 4OLXL 4Y5XB 3EDJA 4O2CB 4W70A 1F8TH 5GGQL 3U46B 1DVFC 4NM4H 3FB6B 1Q9LA 1DP0A 3ARPA 4GRLB 4M43H 4MJ6A 4IOSD 2WK2A 3JZ7A 5D2LF 2FRGP 1MELA 4F57H 2EH7H 5B39A 3KLAB 3BAEL 4WVRA 1OAUH 1QQDA 3GMNA 5T5NF 4YUEL 3ESVF 2J8UB 3SKJH 5JPNB 3VI3F 5HI4C 5T3ZD 5I2IA 3MREA 4L4TA 4EUPB 3ZLQC 2IQAA 2DLEA 1S9YB 1K3IA 3V4PL 2IH3A 5CP3H 5E9DB 3ZE2F 2X4UA 2EDTA 2CD0A 4P46A 3GI9H 3RTQA 1D5IH 1TTUA 4JFEA 3PWUB 2CKBH 3CVHL 1AE6H 4UT6H 1MRCH 1YYLL 1Z0NA 1FZOB 1RY7B 4OIAA 1MFDL 4X8XA 2BX5A 5JQ6L 3QDGA 2ZUQC 5E8OA 2W0FB 1I3UA 5DHVH 4NQCD 3HRZA 1FFNB 4EVNA 4U6YB 4KAQH 4U1LB 1MIEH 3FTGB 4P4RA 1F2QA 3HZKA 5FIEA 5HHQB 5DJDB 4DKEL 1CDCA 2UZYB 5EO1A 2NYYC 2A73B 3K80A 1CF8L 1TENA 5T3XD 1EPFA 1RI8A 5FDWB 1MREL 5AEAA 2D7TH 3NA9H 4FNLL 1U8IA 2PTUA 3IJHB 2DQHH 3VH8B 5DJ6B 1ZA6B 3KPSA 3T2NH 4NZUH 5LQBL 3MRBB 4R97C 2X9YA 3UC0H 4YBQD 1IT9H 3DVIA 4LGPB 4Q9QL 3UYRL 2OXHA 3AS2A 1VCAA 4WW2F 3ZDYF 3QT2A 2VERN 1HCVA 2ZUWA 5FGRA 4ZXBB 1IVLA 1RVFH 4ENEC 3GBLA 3UTTB 2D0HA 4TQEL 5F9AC 1JN6A 3GHBH 4L3CA 5IBUG 4NQTA 3QG7L 4XB7A 1MHPL 4Q0XL 2EKJA 4U0RC 5FO8A 5D2NE 4FTVB 4CADA 3ZYJA 1UXSA 4MNGB 5FECB 4HUWA 3FT3B 4NFDA 4P2QA 3K2UL 3MXWH 1QSFB 3AFLA 1A3RL 1NBZB 4ZQKB 1C5DB 3FO0H 3IJYB 1QNZH 4OLWH 5E2WH 3TV3L 4FXKA 3I2CL 4Q6IA 5EBGA 2EIZB 1JRHH 2CLRB 5JW3H 5JORA 4HWEL 5LGHH 3UTSB 3VFWB 3P40A 2IF7A 5AUMB 3RWHA 5TH2B 4QYOB 4HJGB 1D5BA 3WIIL 4NNYA 3QIUC 4R2GC 2ZG3A 3ZL4H 4R0LC 3OKEB 1QBMH 4XMLL 2FSEA 1AGEB 5H37H 3LDBC 1NL0H 4WO4C 2BNUB 3IDIA 4UUJB 1T03H 5KZCB 4XRCA 5I17A 3G08A 2ORBH 1LO5B 3GK8L 4RGND 4U6VL 1UM6H 2LABA 5MP6L 4QGTA 4QRPE 4NNXB 2AJSL 3O4LE 3MBXL 3SDCA 3DX6B 4H25A 3TBSA 4KKLC 4RISH 4C56A 1I9RH 4YJZL 3SDDC 1MNUH 5FKAA 2PR4H 2QQLH 2AJUH 3KS0J 3BHBA 5CWSA 1KJ2H 5C0AE 3BDYL 1N7ML 4R90L 2VZTA 2JB5H 3EJYD 3WN5B 1G7MB 1ZT7B 4WI7A 2BSED 4GS7C 3U2SA 3WXVL 4JGJA 3NCBB 3S7GA 2FH6A 1NEUA 5J11B 4XWGL 3EDEA 1IEBA 1ROWA 5C0CD 4LHUA 2W92A 1BFOB 3DRTA 2CR6A 4ODBD 3DSNA 5JHLH 4UZGA 5DWUL 3UPRB 4J2XA 1YQVL 1CLOL 3BGFB 1NFIB 4OQTH 5I66A 2W9EH 1XF5B 1OP9A 2HWZH 1I4FA 4ZPVA 1JFQL 2B0SL 1NH6A 1RZGB 1DFBH 1M7DB 4LCWA 3MLUH 2ZZUT 3S37X 3HS0B 3BD4A 2GSGB 2XZQH 5AZEH 2VZ1A 3VXRB 3UTQB 2YEZB 1P2CB 5FF6B 1BD2B 3LY6A 1P9MC 4ZUSB 4I5BB 3VD4A 1K4CA 4L9LB 4NQDE 1WIUA 4NO5B 3QG6A 3E8UH 1BQSA 5E99L 5I76A 3FQWA 3MLYH 4UIKL 1X5YA 1JWSA 3EYFA 5JQHC 2PTTA 4UDTA 3GMMB 3H9SD 2AV7B 2R0ZL 1CFVL 3QB7C 4M7KH 1N2RB 3RI5K 3Q6GL 3VXSB 4PRPA 1XR8A 4LKCB 3DXAA 3JTTA 4QY8A 4Y4HA 5ITFB 4X4ZA 1GL4B 5F9WC 1ZWIB 1J1PH 4DKDC 4QRTA 1HINH 1IAIH 2IANE 2HFFB 3WIHA 2P8LB 3ALXA 3QWOB 4KMQA 4RFEB 3OKNB 4P3DB 3C6LC 3EUUA 1BVLB 2EKSB 1A3LH 5K93A 4PJ7E 1FO0H 1YEDA 4EDXA 2ED7A 2FIRT 1GGUA 2K1MA 2WINB 1KLUA 3KPPA 4I0PC 1E27A 5DQDH 4Z7WF 4RMRA 4YHML 1C16B 1UZ8A 1EEUA 3S96A 4I77L 5JXEA 2VKWA 1HHIB 3P11H 4EZMA 1QO3B 3HNTL 1W8NA 1GRWA 3SDAD 2HJKA 1G7PB 3WMSA 3EFDH 3UZVB 4D3CL 4E5XB 3GSUB 5GSRB 5F72S 5FK9A 4ZTPL 4ETQA 4U4BA 4XB8A 3QH3A 4WY7H 3MV8B 4HWBA 4R9HA 4S1SH 1F2XK 2DQFA 5GISL 2BJML 2FYYA 1VACA 3P0YL 1RZ8A 4KPHH 3ELAT 4MD4B 4ZNEA 4OIIL 2MQ0A 3PL6C 3O8XA 3OKDA 5D7SH 1GZPA 4PUBL 1MI5E 4JDZA 3MROA 2ILLA 2DYPB 4BFGA 4LU5L 1RJLB 4F7MA 4ORZC 1R3JB 4TSBH 2XNAB 1F8TL 4R2GD 2YUXA 3DHJA 4I9WE 2FBJH 4OCWH 4WO4D 5MEOB 5DVLA 4XCNA 4F57L 2EH7L 5EH1A 4MD5B 3FMGL 1EAPB 4P5MA 3BE1L 3V6OC 4FQ1L 3GSWA 1RUPH 3ZE0E 4PJGE 3BMWA 3ZDZF 3IFLH 1KT2B 2G2RB 2HJLB 2IPKA 1N5AB 4KKLD 4UIMB 5TE6L 1FNFA 5AG9A 3LN4B 1MOEA 4FS0A 3GI9L 3TYGH 1T2JA 5GS1C 3SDDD 2OZ4H 3Q2CA 1CE1L 2CKBL 1TQCC 4JRXA 4A6YA 1B2WL 3KLDA 4UT6L 1NLDL 2DTSA 1NCWL 1OW0A 2OJEA 4X99A 5KSBF 3GJFA 3NIGF 4Z0XB 4KAQL 2WBKA 1MIEL 4LAQH 3IKKA 4XP5H 3IDGB 1VERA 4JANA 4FZEH 5DVMA 1AR2A 4PJXB 2NXZC 5ANMB 4X7SL 1T22B 5KS9F 3INUL 4DGVL 3G6AB 2CO6B 1BF8A 5T1DL 5ICYA 3AY4C 5IT2H 1S5HA 4GKNA 2D7TL 3NA9L 3MOBL 2BRRL 2C7UA 2VIRB 1ND0B 1GVIA 2V2XA 4N8VB 1MI5D 5DURB 3VXQA 1G6RA 4NZUL 4F8TA 4OCYL 3DIFB 3SKOB 2LVCA 1AY1H 5CBAA 1U58A 1IT9L 3GSXB 4P3WA 3EFFA 1ZGLM 3CVHB 1XEDA 4GKZB 3KAAA 4UV7H 4JE4B 2EDHA 3KPLA 3QO0A 5T1MB 5BQ7A 5C0JA 4G8GB 1RVFL 5IJVB 5C07E 1NGPH 2IAMC 2YC1B 5E2UL 4G9FB 4Y5VB 4AEHL 4UOJA 5FHAH 2FEDC 1GAFH 2VZOA 4X7DC 2WUCL 3UJJH 4PJDA 5EZLB 5JTWA 2YZ8A 1FYHB 1QFWM 4IDLA 4PY7A 3QI9C 4L8CB 4ZOEA 2XKNB 1MPAH 2HLFD 4UINH 3SO5A 1TZHA 1OWRM 4PLNC 1NAMA 4CJ1A 5JW3L 3V6OE 2EDFA 1DLFH 4QHKI 1L6XA 2PCPA 1I7ZB 4XCCH 5B22A 4APQC 1WV7T 2G5BB 2ITDB 1M7IA 5D1ZC 5J9PA 3BEWB 4GW4A 4PYGA 3ZL4L 5HVHC 1G0DA 1X5GA 1RIVH 1U8HA 1NL0L 4LCUB 1FAIL 4DOHE 4JO3H 5CAYB 4JFHD 3U4BL 1H5BA 4Y16D 4TNVK 4O58L 1XCTB 3BZFA 4P5TC 1BPVA 1UM6L 1BVKB 3ARGC 5BVPL 3TBTA 5HHOE 1NCTA 2GFBA 1BJ1H 3W0WE 3AXLB 2V5RA 4Z78B 5I0DA 1B4RA 4RISL 4JHZA 3MJ9A 1VPOH 4GXUN 4ZFOL 3QJFA 2GUOB 5LG1A 1MNUL 4IJ3B 1CK0H 2EDRA 3AB0B 2I07B 5L88L 43CAB 1UADC 3OJDA 1CE6A 4K07A 5F96H 4PJCF 2JB5L 5DRWA 3CH1B 3BIKB 1KYOJ 5GS0H 5DJ8B 3BJLA 3G5ZB 2LU4A 2XY2A 1YNKL 5I9QC 5CUSH 3ZYIA 4KDVA 4YWGH 5A16A 4Z7NF 5SV4A 5C0IA 2AJXH 2IMMA 2B1HL 2R0WL 4IS6B 4HKJA 3AU1A 5SWZE 2NY1C 3NCEB 2X4OB 4JFZL 4HIJB 4JFFE 2GK0B 4IRSC 4M93B 4GG8A 2YK1L 3HMXA 4NRXB 1HHHB 5ISZD 2A9NH 5F6HI 5TQ2H 1DFBL 3IFPB 4M9PA 3MLUL 3GSNB 5D2LA 4H0HB 1GC1L 4EI6B 1K8IA 4IRJB 5B3NA 5IV2B 2VQ1B 1M71B 1ZT4B 4L3ED 4MGXA 4NC0B 1BQUA 5GRYA 4ZFGL 1JP5A 2FX9H 1XGQA 2YZ1A 4NJAH 3MLYL 4WEBL 5JA9A 4PJFA 1CT8B 2EDNA 2GJ6B 3PABB 3MSPA 4X4XA 5T33H 4LKXB 1FYTE 3MJ7A 4O2EA 3KXFD 3KYKH 3CMGA 1S9VA 3RI5F 2Y5TA 3B2UD 4KK5C 4Q9RH 1KTDB 3HG1B 4OZ4B 5B4MD 2DWDB 3C08H 1T2QL 4TVPH 3VFRB 1ZSDB 4LASL 3VXME 3JWDH 3OKOA 3HAEG 5EIVA 1FO0L 3VU2A 5IFHL 5HVGB 3FO2A 4Z6AT 2X44D 1FNGB 3EO0A 1ZLVH 2ZJSL 5DQDL 4TPRL 3EAKA 1MQKH 3QUXB 1G0YR 4YX2L 1A21A 4WEMB 4IOIB 1M4KA 1OTTD 3U4AA 4N9OB 1KIQA 1CICC 5CJXC 4HGKC 2MWCA 2P47B 2A83B 1NMAH 2XQBH 5BOPA 5DLML 4M62H 3KPOB 1LMKA 2BVEA 5D1XC 4WW2A 4MCYB 3PP4L 1I3GL 4MAUH 2J8HA 5EU5A 5F7UA 4OKVB 3CZFA 1SJHB 1ED3A 4BUGA 4HLZG 4S1SL 1OAXL 5DQ9A 1U8JA 2WP3T 5C0CA 1CCZA 3PDOB 2GY5A 1D5ZA 4KKAD 3QUYD 1D6EB 3MRGA 1FJ1B 5T1LD 1P7QD 4D0CB 5FCUH 3D85B 1H3UA 3MNVA 4I3RH 2VDOH 1KV3A 4TSBL 3SBWC 2PW2B 2OI9C 4YDVB 2ZP0T 4LLDB 4MCZA 1FZKB 1K8DB 3KPMA 4I8DA 1RFDL 4JG0L 1BF2A 1S7RA 3G9AB 2JIXB 3L9RA 1S7TB 1JZ6A 5F7WC 2RGSA 2X7LB 4MWFA 5TJWK 2EC8A 4QRRB 2A6DA 3MRRB 1NDMA 3QSKB 4PV9A 1J1XL 4K7PL 5E5UB 3TVMD 4MDIB 2CH8A 4MX7A 2OZ4L 2R1WB 1QKZL 5CMAA 5J3HC 1NGXA 3EOAA 2AK4E 3DYPA 1RZIB 2KDGA 4LLUA 3L6FB 3O3UN 1MCPH 2VLMD 5L2KD 3LKNB 1IAMA 3LKQA 4UT9H 1QZ1A 2XQYK 3EOYG 2H3NB 4PJAE 2EEDA 4XP9L 1NC4D 1X7QA 1RURH 1AO7E 4Y4FC 4PTUA 3S6CA 3NTCL 1T4KA 3VXTB 1UWEL 5GS2D 5IT2L 4M03A 1WIPA 4XXDB 2VR9A 3ZHDA 4RMTA 3VCLA 4L4VB 3S8WA 3QA3B 5GJTL 1EXUA 3SDAA 4Z7QE 3D39E 1FL3A 1UCTA 3V6FB 2BY3A 1S9XA 2CKBB 2ICWB 2Z93A 5JHDB 3ALWA 4S1RH 2KKQA 2XV6B 4HIIB 5DMYA 3DV4A 3MA9L 5DK0A 4F3FA 2ZKHH 3O0RH 3WUZA 3ZKQD 2F53A 1UEMA 4LFHG 2Q7YB 4XVTH 4XP4H 3VFSB 1UWXK 4YHOL 3KS0H 4PJ8B 4LSQL 1KENH 4QHNA 1FV1B 3GMPB 4ELMF 4NC2B 1GAFL 3NACL 1I9EA 4KK6C 4XPTH 5C0RH 3WS3A 3ULUF 1HYRC 4R0LA 2UWEB 3QCTL 3KJ4B 3RDTB 1LD9A 1JBJA 3FFCE 3FN0L 4WO4A 2O5YL 4PP1C 3FHQA 2GT9B 3P4NA 4S11A 1YPZE 4UINL 3BX7C 5JW4R 1JF1B 3ARYA 4HFWA 4P0DA 5CJBA 1DLFL 3UBXI 1MJ7H 2P7TB 3C6SA 1KLGA 1HH6A 3MRPB 5I1HH 1INQA 4HKXA 4DGIH 3L7FA 5H94A 1S7SB 3U7WH 3BQUD 4JO3L 1HXMA 3BP5A 4K9EL 4KQ4L 3SDDA 3JWOH 2D9QB 4KRNA 1ZHBB 3VRIB 1QA9B 4CUCA 3K1DA 1EA9C 1X5XA 5E4IA 1VKXB 2HFGH 4IIQA 4TNVF 5HDOA 3SO3C 5BZWA 5I1KL 3KHOA 4LLVA 5D1XD 3OKMA 3U30C 4ZO8A 1TCMA 4LVNC 1VPOL 4NHUB 4ZFFA 4Z7WA 1U3ZA 4MA3B 2B5IB 3WJJA 1A6AB 1FC1A 1VFBA 5F70A 4HXAL 4PP2A 1AXTL 1IMHC 1DQDH 1Q9OB 4MJ5B 4YR6A 1JWUA 3HUJE 3LN5A 3BH9B 1ADQL 1KPVA 3U36A 2V7NB 1KJVB 2ZG1A 1JYXA 3O2VH 1YNTA 3T04D 7FABL 5IVXA 1Y6KR 2G9HB 2D4FA 2A1WH 1EMTL 1KTRL 2VXQH 1G7LB 4MXVF 4X6FA 2AGJH 1GPOH 3BSZH 4U1NB 3BYTA 3WIHH 3E6FB 4LLWA 1UKQA 5JPMA 2BVOA 1CTNA 3L3JB 1LO2H 1DBJL 4NUJA 5F9DC 4XNXH 1CD0A 2XN9A 2I60L 1QFWL 4ZFOB 1MFBH 3QFJE 4J1UA 5SWSE 4EQ3A 4XBGB 2E7CA 1K2DB 4GRLC 4Q97A 4LPYA 2X70A 2DAVA 3ABZA 5D5ME 2DLHA 1KCUL 4OGXL 1TFHA 1HN1A 3RWCA 2XA3A 2Q3AA 4WUUB 1TETH 4PJIE 1H0DB 2DQJH 5FO9A 4E41D 3MV7E 1F6FB 2BFVH 3T0DA 4K8RH 5IW6B 3TIEB 2OTPA 3EYVB 4HWBH 3VXUD 4EOWL 3QCVL 4Z76B 1ZS8A 1MH5B 3VA6A 1AJ7H 3BESR 2QTEA 5IR1B 3RZWA 1A1MA 4RMVA 3ECBA 5FYLD 4GFTB 3KPQA 3W2DL 4G6KH 5EUOE 1KG0B 4Y16A 1HEZA 3EJJX 5KSBA 3C08L 3T0AA 1S7QA 3TNMA 2IPUG 3CFCH 3K8KA 3PJSB 4PGEA 2VISB 1RZKC 4HUXB 1QRND 4MXWL 5KS9A 1UWGH 3I3DA 3CSPA 1TVBB 3HR5B 3T3PF 1XGUB 1QFUL 1WBXA 4JN2A 1CDHA 4XCYA 4ZDHA 5FHBH 3V2AR 4P5KA 1DSFH 2APTA 1RIUH 2F74B 1MQKL 1ETZA 1QSEE 3U82B 5F3BA 3DTXA 2P5EE 2RFXB 4MQXC 2RAMA 1QPXA 3EO9L 1G7HB 5JDSB 4P9HL 1BLNA 2HG5A 1HHJA 5FYKU 5EC2B 5IIEA 1T5WB 4ZO6A 4A6YH 1X4XA 1XGRA 5K9OA 3RJDA 2E27L 4EQ2A 4U33A 4JRYD 2R0LH 5CEYA 3G6JE 2VH5L 4PP1D 1P4IH 3MR9B 4LL9A 4ODSL 4ZUVB 3GJFH 3SDXF 3OAZH 1NGYB 1FO0B 3BKCH 4LP5A 5CD3A 1ODAA 3F58H 1I1AB 4WUKH 2ZCHH 2ARJB 2P24A 3QQNA 3LSOA 5ISZA 25C8L 2QEJA 3OWEA 5LKNA 2E8ZA 5C6WH 5DF0A 1T04B 1QR4A 3CC5A 1BZ7B 5DJCA 1S8DB 1L7IL 1PGRB 1MHHB 4GMSL 1HQ4A 1G6RH 4L3EA 4PR5A 4PGCB 1NDGB 3MGOB 3SPVA 1NSNL 5DMIL 2VLJD 4L8DA 3OPZL 5E9DE 4M6NH 4RDQG 5GRVL 3BZEA 1WUNT 4PG2C 4X6CB 1IEHA 1W0VB 1OSPH 3D1MC 5L2JA 3UDWA 3V8OA 1QSED 4X6BB 3KXFA 1A9EB 1MUJB 3VD5A 2J6EA 1JYWA 1BQHG 2P5ED 1P4LB 3TBYB 3AY4A 3PQYD 2WW8A 1MCPL 4NJ9H 5JZ7C 4G6FB 1PSKH 4NKMB 2GSIB 3B9EA 3L3HA 4EN3B 4QNPF 4UT9L 4I48A 4YEEA 2DI9A 2X42A 2ZOKA 4PRBB 1XGYL 5BMFL 4OZHE 4R96A 5EC1A 5GGUB 4MJ2A 1NAMH 5TFSH 4OZIE 1YEIL 2CLVA 3V6ZA 3IXTA 3IF1B 4PJCA 5T3ZH 3FOMA 4GXVH 1JZ2A 4L3AA 4XBEL 4HCRL 4OB5H 5TF1H 3TN0C 5FYKH 3TO4B 4OCSL 3NFSH 1RZFL 4OUUB 1X5HA 3X14A 2NLJA 5K33A 5K9KB 3D2UD 5J11C 1Z9LA 2EYSA 1NANH 4GUPA 1IGFL 2EDJA 4M6OH 1JGDA 3SDYL 2V5MA 1OSZB 1X4YA 3U79A 3SOBL 1KB5A 1LNUA 1AC0A 3CDCA 3UTTE 2C4FT 3A0OA 3NGBB 5DXWA 1KXQE 3OB0K 5F88A 3QUYA 2A0LD 3T0EB 4XP4L 3MJ9H 2W91A 3BZ4B 3KPRB 5C0DB 4XNMA 3MLTB 5T1LA 1JVKA 5ESAB 1P7QA 2H41A 4U1SB 2YSSB 4I3GA 1QSFE 5C0RL 3MOAH 1Z9SA 2P8MA 5ENWA 4OLYH 2ZNWA 4L9LC 3MFGB 1AD9A 1FG2B 4OD2B 5AD0A 1LP9B 3UTSE 1CD8A 2FZ3B 4OCNC 1P6FA 5F7NC 4OTXL 4U1HB 1HIML 3C2SA 1NGQH 4DAGH 4HGWA 2D0GA 2HT2C 3QRGH 4OZFA 4QLRA 5DK2A 3THMH 1R5WB 5IKCB 4JB9H 4JQIL 4I2XE 4ONFH 3TVMA 2B7DT 4LDLB 2IG2H 3HLAB 4LHJB 1KN2H 1KGCE 3HMXH 4O00A 3PGDB 1DQLL 4IRZL 5E00B 4MQXD 2N1KA 1MLBB 1FIGH 3RWDB 1BFVH 3HB3D 4R26H 3MGTB 3LKRA 2KH2B 4H88H 3BN9D 4KZDH 1WZKA 3FB5A 3IDNB 5L2KA 3NCCB 1BX2A 5DDHA 4YHKH 4HLJA 5DMJB 4BYHA 4ZXBD 3TT1H 3BKMH 1NC4A 1NCBH 3SKUD 3VFNB 1F3JB 3UTTD 1G7QA 5I8KH 1U93B 4YQXH 2FGWL 4JJ5A 4KU1A 3MJ8A 1NUGA 4TUKH 4F7PB 4HSQA 4FTVD 2XACC 3NAAL 1PYWA 3FQRA 5DGQA 1F6AA 3CFDB 2A1WL 2K7QA 3QAZB 5B38A 2VXTH 2A6JA 1OF2A 2VXQL 4RAVB 1J8HB 2AGJL 2VTFA 4LSRH 5I1JH 3H2WA 4Z77A 4ALAH 2IEPA 2MSPA 4NYLA 5IK3B 4JDVA 1CDBA 1ONQB 3IU3A 4NM8H 2D7PA 4XNXL 5E4EB 2E7MA 4S2SA 4MLSA 1JHTB 1OAZH 4BUHA 1PG7H 1Z9OA 2GJZA 3TH2T 1DBBL 5JO5B 3H9HB 4JQVC 3EOTH 2NY5H 1NC2B 1T1YB 3VXRE 4OF6A 3MUY1 3QIBB 5KZCD 1ES0A 4HEPG 3UBXG 1BD2E 4U6HA 5C0FB 1P84K 5EZJB 4LLAA 4TYUA 1YN7B 1FN4B 4Z7UF 4Z5RB 2CMRH 5JZ7D 1UZ6F 3DX9B 2CLZB 2A6KB 4L5FL 1NFDB 4DUXA 3S3PA 1QTYT 5FKPA 1UJ3A 2AV1A 3BPOB 4GAGL 4MQ7A 4XNYH 4PGDB 5H2BB 3FZUC 4DVBA 5TE4L 1J8KA 1KXVC 1C1EH 4J23A 2HVJA 1JZ3A 3C8KB 5DVKA 4Y89A 1QBLL 2VDKH 4IOFC 3BT2H 4LSPH 3BQUA 4G42A 3QDJB 5BO1H 3DGGA 5DHYA 4FP8L 2R4SH 1UC6A 3GGWA 3TH3T 3VFTB 1LO3H 4JFOB 1PKQB 4FQLL 4PRAA 4OSUH 1YN6A 5CEZH 3PWJB 5DT1L 3Q3GA 3HC4L 1YEJH 1GZQB 1UWGL 4HPYH 2JELH 2UZXB 5GGRB 1R3LA 3C2AH 3OHXA 4X8JB 5FHBL 5F3HB 2NY7L 5I71C 4JPKL 2AEIT 3RWFA 1IAII 1ZK9A 2AI0L 2RQ8A 1F4AA 3GEWB 5IUSA 3GJEA 4NRZA 3OKLA 1CGWA 1BBJB 4LGSB 4KVCL 1T0PB 2Y06L 3ULVL 4GG6B 4MJIE 3QQ9D 1WFOA 5BJTA 3MV8E 3SBWA 5DUBA 2YD7A 2R0LL 4WFGE 5D96C 1WZ1L 3BPLB 1KCSH 5IVZB 4Y5VC 4ELMA 1QQDB 3GMNB 3F58L 3VFGL 1CU4H 1MFCH 3VXSD 3BRGC 4TRPH 2HT2D 5I2IB 2BXYA 4ONGH 4L4TB 3MBED 4NCDA 2Q1EA 4DZ8A 4LARH 4HF5H 2IH3B 2W0KA 5D7LB 3P77A 1T20B 1P53A 1G6RL 3DX8A 3RTQB 2HT3C 4JFEB 4AIOA 3MODL 4UDUA 4POZC 5HHMB 4PRNA 2I9TA 2J2ZA 2OTWB 4E41A 1XZ0A 4G3YH 3WFEL 5JW5A 4M5YH 3MYJA 4U3HA 3HNVH 1HHKA 3QDGB 2EDKA 3VXUA 5E8OB 2JK5B 1LK2B 1V3LA 2QSTA 4EVNB 1BAFL 4DUVA 2VXUH 4JY5H 1QHOA 4Y1AB 5EO1B 4PJ7F 4XVJL 1UEYA 3MRCA 2YUWA 1PSKL 4XPAH 5ICXA 2IPTL 3DX7A 1T0NA 3MMEA 3DETC 4IMKA 4NQVB 1RIHH 5TFSL 2YRLA 1A6PA 3AB0C 4M1GH 1PKOA 4XNUH 5C70A 5E8NA 4HV8B 2I24N 1B0RB 1QVOA 1Z5LA 4BZ1H 3TBVB 2IC2A 1G7JB 3OGOE 3ARTA 2DYPD 4GBXA 5FYKL 2F54E 1DQML 5EIIB 3WE6B 6FABH 1I1YB 5GZOC 1JN6B 4L3CB 2VXSH 1XGPB 1JHKL 1U8QA 3F6LA 4J3UA 1N8ZA 3F6IA 2QR0A 3FB8A 5FO8B 5I8EA 2P5WD 2AJ3A 4N5EC 5D7IA 1UXSB 2JTDA 4NHCH 5I1DA 5DJAB 2BSSB 2FECL 4HUWB 1ACYH 4JRYA 4M93C 4PBXA 4FFVD 1P1ZA 3S4SB 4LSSH 4DN4L 2AS5M 1AQKH 1U6AL 4D9LH 3MJ9L 3O81A 3VFPA 4N0UE 1XGTA 1N0XH 2XKSA 2VLRE 2W60B 4J12A 4M8QA 3EYOA 1T66C 3M8OH 2VC2H 3FZUD 4IRJC 3O6LH 5CSZB 4WU7A 3RWHB 3G04A 4IEFB 1QYGH 1BGXH 3ZE0F 1N26A 4NNYB 3V95A 3V5HA 4IOFD 4P2RB 5JR1L 1QLFA 3HE7C 2EO1A 2FD6L 1A6WH 1J0KA 4YO0B 5TGBA 1IE5A 1ZEAL 2BY1A 4XRCB 5I17B 3G08B 4JZNA 4JVUA 2VLJA 1ZAGA 3D0VA 4DVRH 2ID5A 1X6LA 4RSVA 1AGCA 4WWID 1SY6L 2NY6B 4JB9L 4JFQA 4H25B 2WWMC 3VMOA 1KN2L 3QDAA 1DL7H 5DI8A 5E5MB 1EHLL 3KJ6L 1AXIB 2GW5A 5FUZH 5DURD 2MKLC 4N9GA 3WLBB 1MJJA 2VDLL 3QNXB 2FJHB 3BD3A 1FIGL 1MHCA 2FGZA 4LRNH 2VL5A 3L3DB 1BFVL 3BHBB 4R26L 4XTRC 3S36H 1BM3H 5EG6C 3IVKB 2B39A 4UV4H 4OZGF 1EERB 2OK0H 3CSGA 1MY7A 3OKKA 4HKZB 2QKIA 1ZVYA 3BKML 4G8GD 5HJ3B 4RAUA 1NCBL 3CK0L 3QUXC 2HJFA 2IFGA 3B8YA 5HYSA 1FZMA 5I16A 3UPAA 4KHXH 3I02A 4YQXL 1IEBB 1RULH 4O5LH 5HBBA 4IHOB 1Q0XL 1CFSB 1J86A 2KZWA 3P4OB 3T4YA 4Z0BH 4G9FD 3GB7A 3E6HA 2N7BA 4M48H 4Y5XA 2AABL 4O2CA 3B6SB 3ARRA 2VXTL 4EIGB 2BNQE 4CU6A 2D7QA 4YH6A 3D2UA 3FB6A 4D9RE 5I66B 1I4FB 4GAYB 4ZPVB 4PJEE 1VGKA 4CNIB 1CLZH 1Q94A 3QXWA 3HFMH 3KLAA 4LCWB 1WCQA 4XHJC 3NABL 3RWEB 4LVOB 2J8UA 1OPGH 1MFEH 5JPNA 1TZGH 2HT3D 5CJ8A 4NWTH 3O6FA 4K3JH 1A7NH 1S9YA 1CXHA 5DMGC 1OAZL 3M45A 5LGJB 1PG7L 2P42B 5D72H 4EDWH 5GHWL 2GI7A 5E8EB 3EOTL 2NY5L 4AH2B 3EYFB 1H3VA 2EZ0C 2PTTB 4UDTB 1EEZB 2HAZA 3PWUA 3AMLA 1OCWH 3K74B 1GGYA 4K7FB 1IGTB 4X6EB 4PRPB 4XBPB 5CILL 1SHMA 1EO8H 5ADPL 5HPMB 4ERSH 2IMNA 4IDJH 2EDXA 2GJ6E 1FFNA 15C8H 5J57B 4D8PB 2QHRH 4U1LA 2AEWA 5BV7L 5HHQA 3DETD 5DJDA 5C7XH 3ILPA 4GRWF 5TDNB 4KGLA 3FQTA 5CGYD 1EHXA 4X0KB 4L8BA 2Q20A 5FDWA 1YEDB 4LSPL 3LRHA 2Y07L 5BO1L 3IJHA 3TLRA 2R4SL 3OAYK 4XP1L 1UZ8B 1LO3L 5DJ6A 1S3KL 5D71H 3MRBA 3S96B 4R6UA 5CEZL 5B21A 5FA3B 3BIBX 4JO1L 2MQ3A 4HPYL 4N5ED 4F7EB 1WCBB 3NIDE 5FK9B 1LO4H 4ZXBA 5ALCL 4PB0H 5ADOL 5JOFB 1AGBB 3MGAA 1I8LC 4HEME 1I9JH 3I85A 1EAJA 2FYYB 2BNRA 1JGUH 1RZ8B 2FWOA 3CCHB 3X3GH 4BFEA 4FTVA 1VEMA 5I1GL 1RV6X 4MNGA 5C9JB 1CGSL 3O8XB 2BCKB 2C3XA 3VRLE 4IRJD 2J6EH 4ORGB 4JDZB 3MROB 1C5DA 3IJYA 4ONHA 1YC8A 2EIZA 2CLRA 4NGHL 4OI9A 1KCSL 3MOQA 4PJ8C 2ADFL 1YMME 2EDEA 4QXTB 5AUMA 5TH2A 1DLHB 5F7YC 4QYOA 2WLZA 3VA2C 1TMCB 2VDMH 1V3KA 1DANU 4RWYH 3GSWB 4ONGL 5EOQH 3OKEA 3S88H 5DEGB 3RDTC 3VGBA 1AGEA 4LARL 3O2WH 2W59A 2VLLB 4HF5L 2Y4SA 2WWMD 3PDGA 4UUJA 3V52H 4GKSA 3B4NA 5IMLB 3HG1D 2X89D 1RU9H 4J6RH 1CFTB 4HJ0C 2OR8A 4EXPX 3V7MA 5KVFH 4JRXB 4XTRD 1G9ML 3DX6A 1C5CL 1MCQA 2A38A 1KB5H 4MA1B 2R2EA 4KVNH 4YHIB 2NY3D 4X99B 3I9GH 3QUXD 3GJFB 1CD1B 3VD9A 1ZLSL 1CZ8L 2VXUL 5FM5O 4JY5L 1UKSA 3SGKA 1TNMA 1L9NA 3KNBB 2BC4B 3WN5A 2V6HA 5ITBH 1ZT7A 2FJGB 4QXUH 3JVGA 5ICYB 8CGTA 4GKNB 1XT5A 3S5LA 4BFBD 4ODVL 4XP6H 2C7UB 2B5IC 5F7LB 2V2XB 4F7TB 3VXQB 1G6RB 2FHBA 1KFAH 1EEQA 4M1GL 1GH7A 4H1LA 4WV1B 5HYJD 5D6DC 3UPRA 2LAAA 2Z92A 1OD7A 2NCMA 5HGHA 4OGAD 2B4CL 4BZ1L 3D85D 2CR3A 3QO0B 4OZFH 3VMPA 2UZIH 1FVEB 5DMGD 1T89A 1WTLA 6FABL 2CPCA 4ZSOE 1RZGA 1B6UA 1M7DA 5JHDE 3CSYA 2R2HB 3HS0A 1VEPA 2EZ0D 2YEZA 5FF6A 2JIXD 2UWEF 4MQTB 4ZUSA 4I5BA 3CLEL 3WO3B 2FR4B 4LNRB 3B83A 5GSVB 2Y72A 4NO5A 3RGVD 2YD4A 4QRRD 1EHNA 4PY7B 1AQKL 3SKMB 1NPUA 1U0QA 5TQ0H 3GMMA 5HI3C 2Y36H 2AV7A 4YLQT 1N2RA 3VXSA 3M8OL 5JUEL 4EI5C 5LWYL 4LKCA 1OAYH 3O6LL 5ITFA 4YK4B 1JF5A 3K0WA 3LMJH 4B5EA 2DKSA 2LV4A 3L5HA 1BGXL 3MBEA 3G6DH 3TA3D 5C8JA 1ZWIA 4NKIL 5J9PB 2FO1A 4Z7UA 4OD3H 2DBJA 4GW4B 4JDTL 1HXYB 2IQ9H 4YE4H 4D2NA 2HFFA 3QWOA 3OKNA 2R0KH 4P3DA 3MTRA 2EH8H 1H5BB 3RNQB 5LGKA 1BVLA 1OLLA 3OF6D 4JFPB 2XZAH 3MNZB 4BQ6A 5I1EH 3WUWA 1NLBH 2EXYC 5HD8D 2OQJA 3P9LA 4KRMB 4WTXA 5IWLC 5DD3L 2PO6B 3IAQA 4N0CD 4WI5A 4WFHD 2Q86B 2I5YH 1MCOH 5A2KH 4N68A 3BO8A 3TGXA 4GJTB 1IC7H 3MLSL 1GYAA 4XAKD 3ARBB 3QJFB 4YHZH 1U8MA 2R1XA 4L4VD 1GC1C 4U7KA 4LRNL 3GNML 3S36L 5GSRA 1BM3L 5JHDD 1RPQA 1UYWH 1CE6B 5L9DL 5DRWB 4DQOL 4UT7H 1EJOH 3SKNB 4UOW0 4O02H 3HZVA 4QRUB 5I8CB 3IETB 1Q72L 4MD4A 4KHXL 2XICA 3W82A 4PJ8D 4Z0BL 5I1IH 2RBLA 3C60D 3AU1B 4HDIA 3H3PH 2BOCA 1D7FA 2DYPA 1RJLA 1SEQH 4WFEE 2XNAA 4I18C 1JNLL 4GG8B 2DIBA 1EGJA 3RDTD 1PY4A 4G8IB 4OCXH 3GUTB 3F7QA 2AJYL 1CLZL 3DI2B 1KIUA 3GRWA 4RMSA 2NZIA 2P5WA 2R29H 4MD5A 4NDMA 1EAPA 5D2LB 1JI2A 1RMFH 1OPGL 1P4BH 1K8IB 3VJ6A 1I1AC 2XA8L 5A2IH 4K3JL 5JA8B 2HJLA 1A7NL 4GOSA 5DVOA 2E7BA 1N5AA 5D72L 4EDWL 3LN4A 3CFIC 1XGQB 3BKJL 2RJMA 1MRDH 2YUZA 5TPWL 3U0PB 4PJBE 3I3EA 1OCWL 5DGRA 4X4XB 2FB4L 4YXHH 1EO5A 1A14H 3IDUA 5DQJB 2E9BA 3O9WB 4O2EB 1MFAH 5HDQH 1S9VB 4HS8H 3WD5H 3D18A 4IDJL 1UACH 3Q48A 2J88H 1JZ8A 4JCMA 1R5IA 4KKCD 4Z0XA 1Z3GH 5F9JB 2QHRL 2NPLX 3IDGA 5MI0C 5C7XL 4P59L 3ZHKA 4PJXA 5ANMA 2R15A 1INEL 2I25N 3G6AA 4GAJH 3OKOB 1DBAL 1FL6B 1YEFH 1F02I 3Q1SH 3CVIL 3FO2B 1PY9A 2VIRA 4GW1B 1ND0A 3EO0B 4EN3C 3PWLB 5EULV 5LVEA 3LS4L 5D71L 5E7BA 4I0CC 1PFCA 1GOFA 1KIQB 2IPUK 4MYWB 3OX8A 2DQEH 4F33A 1T1XA 4GKZA 3JBG7 5CCKL 1NMBH 5TF0A 5C0BA 4WW2B 1DQTA 3FKUS 1QD0A 4G8GA 4HUMB 4PB0L 2GJJA 3MLRL 3TO4C 2O5ZL 3WFBL 2CKNA 4DKFH 3K4ZA 3CXDL 5DQ9B 2E9WA 4MA7L 5C0CB 3WKMH 4AM0B 1D5ZB 4FHBD 1A6VL 4G9FA 3X3GL 5JIIA 1FPTH 4X4ME 2WBJB 3MRGB 1WFNA 3GDBA 4OLVL 3MNVB 5FYLH 3FT4B 3OG4B 4F8QA 3NGBC 4WUUD 1TZIB 1OL0A 5IQ9A 2XKNA 1Q8MA 4UNUA 4FQHA 2HMIC 4XVUC 1S7WB 1PZ5A 4MCZB 3N85H 1ULVA 1I7ZA 4YHNA 4LOUD 1S7RB 5DZOA 5CKAA 3L9RB 3OSKA 3HI6H 2VDML 3HNSH 4MWFB 5C08E 4RWYL 4E42A 4YXLH 3O4OC 4LCUA 3PWNB 3WO4B 5CSBA 3V52L 4NQED 4BH8A 3GSRA 4OFIA 5KVEH 1XCTA 4HJJL 1LK3H 4UTAL 4MX7B 4C83B 3GMQB 1OHQA 3RAJL 3SQOH 5KVFL 5IESH 4HXBH 4PRHA 4K3GA 5CMAB 5I18L 3EBAA 1HKLH 3QQ3B 1A7BA 5DJZB 2XTJB 4HAFA 4LLUB 4X6CE 3LKQB 5EN2A 5IF0B 2D7NA 1AP2B 1QLRA 3LRSA 2VZSA 4HIXL 4XPHH 5HHXL 5IROC 5DR5L 4J4PD 2I07A 2EIDA 2R56H 4KDTA 2OR9H 3VFUB 1CLYH 1ITCA 3BIKA 1K85A 4XPGH 5BS0B 3G5ZA 1PG7W 3IFNL 4OZGA 2P1YA 3SGDH 2ZPKL 4YPJA 4POYA 4H5SA 1AQDB 3A6OA 2AXJA 5DUMH 3SDAB 4NT6A 3PHOB 2YD9A 4LPVA 1S9XB 4LEXH 2ADJA 1F4XL 2X4OA 5KTEH 3MXVH 2GK0A 4NSKB 1NQBA 5I6XC 1I1AD 5B39G 3QAZC 2UZIL 3BMVA 5DK0B 1U8KB 1YYMH 4F3FB 2C3VA 1BWMA 1IM3B 4Q9BA 3HMWH 3U1SL 2F53B 3D25B 3IFPA 4OKDA 2OLDA 3QPXL 3GIZL 3LQZB 3BVNB 4HUUA 3RVUC 4JHWL 4EI6A 2GY7B 4IRJA 5DRZB 2VQ1A 4O9HH 3VI4E 1OB1A 4V1DB 4YDLB 1A7OH 5IV2A 5CHNA 1AHWB 1DN2A 1WBYA 5MHSE 3WS3B 1UQSA 5E4EC 1LDSA 2YA1A 4M02A 4KTEL 1LD9B 4JO4L 2W9DL 3WS6A 3QEQE 4Q9CA 3P4NB 3TPKA 1CT8A 3RWJB 5GRJL 4HFWB 4PJHE 2MCPL 1NANI 3QIBC 2Q6WB 3C6SB 3H9ZA 5GS0C 1HH6B 4RFNB 2GK2A 1EBPA 5M94B 1IQDB 3L7FB 5IBTL 4G7VH 2CDFB 2EO9A 3EYSL 1NUNB 3HG1A 2X89A 4NQUA 4OZ4A 3V5KA 1XR9B 3D69B 2DWDA 4M4RA 4Y2DB 1HXMB 1B90A 3DVFA 5C09D 5K59F 2EH8L 1F4YL 3UTPE 1ZSDA 1P84J 3BPOC 3OJVC 5M95B 2X1WL 1T21A 1RUKL 4LCYA 1G6VK 4YAQA 3A67H 4IIQB 4LMQI 1LO0H 4P2OD 4LLVB 1NCDH 3N9GH 3PP3K 3S37L 4AENA 1T5XB 4J8RA 4QRSB 2JJVA 3TO4D 4BZ2H 4YHZL 1U2CA 4HBCH 4OZHF 4PP2B 1PD6A 3VXPB 2A83A 1JWUB 3KPOA 4OZIF 3U36B 4MCYA 1UVQB 4PJ5B 1YNTB 3WFCH 4PLOB 4UT7L 5KN5B 1SJHA 4ZPTA 5ABDE 5B8CA 1FHGA 4PB9L 3BP7A 3TBWB 3PDOA 4X6FB 4QHMB 4WWKB 1JMXA 3T0ED 1Q9WA 2HMID 3W11D 4XVUD 4TTGA 5HYJA 1D6EA 3MRDB 3MV9E 4KRLB 3KPRD 1NAKL 4PD4K 5I1IL 5GGTL 1JNJA 2IADB 3VDCA 4D0CA 1E4XI 4JY6B 2BVOB 2FEEI 3D85A 4S0SD 3H3PL 3LH2H 3NBNA 4NUJB 3AREB 2XN9B 1CIDA 1YEEL 2PW2A 5FYJL 4YDVA 3V0WL 4LLDA 5B3JE 4OCXL 3TNNA 8FABB 5E7FA 1FZKA 5TDPB 1LE9B 2X70B 4HFUL 4TSCH 3BPLC 3JWDC 4MMXC 3TFKD 1RHHA 3QUKB 3CNKA 2JIXA 4QGYA 4GW5B 2X7LA 1J0ZA 5E8PB 1P4BL 4WI3A 3RGVA 1TNNA 4QRRA 3BH8A 2E9JA 1TJHL 3KG5A 2AXGA 4LSVH 2DI8A 1E4WL 2HN7B 3I6LE 1MRDL 4MDIA 2C1OB 4P9HC 1WEJH 2DJSA 4MB5A 1ZS8B 4P46C 3RTQC 5IQ7L 3HC3L 3TA3A 1A14L 2HRLA 4AEEA 1RZIA 3L6FA 2AQ3A 1MFAL 4TUOB 5HDQL 3OBAA 3ECBB 3WD5L 4HQQH 5J6GA 3QHZL 2K9UA 3KPQB 5F7DA 1IBGH 1A7QH 2J88L 3BPNB 4Y16B 2H3NA 3OF6A 5DEFB 2MHAA 1HEZB 1QPPA 5KSBB 1RAMA 3W39B 3NMEA 1HE7A 3QZWB 4YC2B 1U91A 4PGEB 1QLEH 4GAJL 4M9OA 5IW3A 3WNLA 1HCFX 1JPFB 1NCUA 1YEFL 2WZPD 1YECH 1A1OB 3SJVD 4LHUG 4XXDA 3ULUL 1I8LA 4JN2B 4NKOB 3TWCH 1UH3A 4P5KB 4L4VA 2X1QA 2V2WB 3QA3A 5DD5H 2X6MA 3DTXB 1J8HD 5F3BB 1II4E 4XMPH 3V6FA 3MRMB 1WBZB 3RZCD 1HILA 2DQEL 4K23L 4XMKH 1HHJB 3RVUD 4HIIA 2YPVL 3DUUA 3HZMA 5IIEB 3MLVH 1YMHA 5K9OB 1XGRB 4Y19B 5FO7A 2Q7YA 1H3WM 3VFSA 5HGGS 2OP4H 3WKML 2C5DC 1YNLH 1GHFH 1ZT1B 2KQMA 4XPFH 3C60A 1FV1A 3GMPA 1I1CA 4KRPB 3P0GB 1FPTL 3FB7B 1A02N 1P5VA 3QIBD 3KYNB 2UWEA 1NUFA 2O5XL 3RDTA 2P24B 2Z4QA 1FH5L 4P48A 5ECJE 4TVPE 4M1DH 3LSOB 4HIHA 2R8SL 2GT9A 5DRXA 5EIQA 2F5BL 1MVUA 3VGGA 1JF1A 32C2B 2JB6B 3C9NA 2P7TA 1HQ4B 3MRPA 4L4TE 3E3QC 3JV0A 3BISA 4H1LH 5JOPD 3SPVB 4YXLL 3N0PB 1S7SA 4L8DB 3MRKA 3RY6A 1D9KB 3QDJD 5EU6B 1DEEA 4WDIB 4YFLF 1OP3K 4JFEE 4Z7OF 1QA9A 3ZT6A 2ZUVA 4NOBA 5IESL 4HXBL 4C59B 1JJUA 2CIKB 1UM5H 1A7PH 3QDGE 4QF1B 3ZE1E 3S35H 1UCBL 2VWEE 3BW9A 3SDCC 2NY6C 5F93C 1W72L 4NHUA 3T8XA 1AC6A 1TVHB 5D70H 1A6AA 3UJTH 5F1NB 4XPHL 1PX4A 2BHUA 2ZOKB 4G6AC 1Q9OA 2PKDA 4MJ5A 3VG9B 4HX1A 3BH9A 5EC1B 4RDQF 2V7NA 1DCLA 3ZYOA 1Q0YL 2ZCLL 2G9HA 4KMTH 1CLYL 2NXYB 4CMMA 3RVVC 3IXTB 4JG1H 4XPGL 3FOMB 4NPYB 1GGIH 3GMRA 2P48B 3TC9A 3KPSE 4U1NA 4M7ZB 2NLJB 3MRJB 2IBGA 5DUML 3DV6A 1OM3L 4W6WB 3LQMA 4YHYB 3T2PA 2F8VA 4OD1H 2Y6SC 4LEXL 4GUPB 5D1QB 3L3JA 2A2QT 5KTEL 4LIQL 3QUZD 1KB5B 1LNUB 5HDBE 4G80B 4IMLB 4FQ2L 3SE9H 1NGZB 4XBGA 1K2DA 1YYML 4L4TD 2ATKB 4BQCA 3ULSB 4KI5C 2I9LA 3MLWH 2D03H 4BSVB 3QUYB 2VDNH 5EBLA 1JNHA 4JAMB 2HKFH 4QWWC 2NTSP 5D7LD 3IXAA 5J12C 4M6AA 5KVDH 3RTQD 1A7OL 4LVOC 4P2QE 3T0XA 5FFLA 1PX3A 4WUUA 3X12B 5HHMD 2P8MB 5ENWB 1H0DA 1W8OA 1LEIA 1L0QA 2MNUA 3QRFM 5AD0B 3NIFE 4U1JB 5IW6A 3QDGD 3TIEA 4YEFA 1T0MB 4Z76A 2ZUTA 4DN3H 1MH5A 4NUGL 2X40A 3HTLX 4H20H 1K9TA 1F4WH 4Y1AD 4YZFF 3UROR 2HFEB 4OZFB 4OV6F 1R0AH 4NQEA 5JMRA 1KG0A 1YA5A 4AYFA 3WEXB 3D5OF 1MF2L 1YZZA 2VLKB 1LVEA 1EGJH 3O3AA 5C6TL 3V7AG 1DBKL 5KG9A 3P2TA 3PJSA 4R8WL 3PHSA 2VISA 1MCFA 1N5YH 2H32A 4HUXA 3GRWH 4DGYH 3EHBC 4CVWA 3WFHA 1TVBA 1XGUA 3FB5B 5MENB 4C56E 1BX2B 1FNLA 3N9GL 2F74A 3IU4H 3H7BA 1FFQA 5C2UB 1AXSA 1IC4H 5IEKB 2RFXA 1OP5K 1NC4B 4K94L 5F1OB 4BH7A 5GGSB 4HBCL 4J4PA 1G7HA 5JDSA 1G7QB 3SCMB 1A1NB 2HTLC 1FNHA 4G7YH 5F9OL 3VW3L 2FX8H 4F58L 5EC2A 4JPIB 1T5WA 2K3TA 3X17A 3FQRB 4OLXH 3T65A 5B38B 2OM5A 4K8RC 1CVSC 2Q3ZA 1L6ZA 3MR9A 4HUVA 1H8SA 2QQKH 2FIKA 3BAEH 2C4FU 3EJZC 4Z77B 5CZKA 3NN8A 3RPIB 3K1KC 1I1AA 3O8XC 4JDVB 3IU3B 4KI5E 3F7PC 4NBYB 4N0FA 5DFVD 3U7AA 3TT3L 4S2SB 4RZCA 1PEWA 3V4PH 1PLGH 1DR9A 4LCWE 4Y2OA 1BZ7A 2FO4B 4P2RD 2IFFL 1S8DA 2UVEA 1MHHA 4TSCL 3MLZL 4R3SB 4JM2F 1R24A 4PGCA 1B4JL 3F7VA 1ES0B 2NQCA 1NDGA 3SGEH 3MGOA 1V7ML 1YYLH 3KGRA 5IHUL 3L3KA 5LBSH 4HGMA 1MFDH 5JQ6H 3M07A 3JSSA 1W0VA 4LSVL 2QBWA 5KSVA 3TCXA 2L4OA 5J1AA 4X6BA 1A6TB 1UJ3B 4PRPE 3DXAE 3HZYB 1OT1A 2O61B 2IGFL 1CDYA 3BWAB 5JDJA 5BRZB 3STLB 3TBYA 1CF8H 2G75A 4I4WA 4LCIL 2HVJB 1FNEB 4NOFA 1VADB 4NKMA 3OQ3B 2GSIA 3LEVL 3LPGA 1OW0C 4MA1C 4FNLH 3FCTA 4G42B 4P57B 5C09A 3DGGB 5DHYB 4NBZB 3CFKA 3GGWB 4M1CC 5IBLC 5LQBH 3ZKXB 2UUDK 4PRAB 3H7LA 4ZAKB 3DI3B 1YN6B 4HPOH 5E94B 5GGUA 4GMTL 4Q9QH 3UYRH 1QLEL 5JXAL 3U83A 2V5TA 4P2OA 3V4VL 3LIZH 3OB0H 5I75B 1E4KA 2V9QA 4MHHI 5FGCE 4S1QL 1JZ5A 5DUPL 3TO4A 3UTZB 4OUUA 1MCDA 3RWFB 4TQEH 4MS8C 3JWNC 1EH9A 4XMPL 2OZ4A 1CXFA 4M61B 4OJFH 4QWWD 1MHPH 2DL2A 1R3HA 3GJEB 1UJTA 4XMKL 3F8UB 4WV1C 1YDPB 1JZ4A 5BJTB 1MLCA 3K2UH 1JGLL 2W65B 2ZUYA 1A3RH 3T0EA 1LE5A 3BUYB 3BZ4A 5EA0L 4G5ZL 3KPRA 1YNLL 1E6JH 4PJEF 5C0DA 3REWA 4ZNEE 3I2CH 1GHFL 1WWWX 3MLTA 4XPFL 2LU3A 4BFIA 4KQ3L 4HWEH 5SWQB 5DC9B 1MFNA 1IQWH 1RJZB 1VSCA 2IJ0C 5A2FA 1RZ7H 3CLFL 3G5YB 1FL5A 1FG2A 4OD2A 3U6RB 5CBEB 4XMLH 2FZ3A 4OM0L 1KB9K 3VFOB 1NEZG 3P77B 3ULVF 5DS8A 4PRIB 3DX8B 2YHGA 3GK8H 1A4KA 1ZA3A 4UDUB 4YK4C 5MP6H 1YY9C 2UY6A 2I9TB 4DK6A 3MBXH 4E41B 1R5WA 5IOPB 5IKCA 1GCFA 3HLAA 4LNVA 4NZDA 4ZOAA 4DUWA 5CP7B 3PGDA 5EZOH 5E00A 2JCCE 3ZDXF 1MLBA 2H2PC 1H5BC 3JUZA 3U0WL 4JRXE 2HTLD 2NY4B 3MGTA 1T6VN 3ZSSA 3BDYH 1N7MH 3IDNA 3RWGA 3HE6D 4KK8C 2PO6C 1TPXB 3WXVH 4XCEB 5D70L 4Y5YB 3QDMB 3VFNA 1F3JA 4V2BA 1MRFL 4LDEB 3DX7B 3GSVB 4PY8J 1EIBA 5I15L 4HS6A 1UXWA 2NX5B 1X5ZA 4L29B 5GJSL 3SJVA 4HH9B 5DWUH 3CFDA 3OR6A 1YQVH 3NIDF 1CLOH 1QVOB 4KUZH 2YXFA 4UU9B 4RAVA 2PYEB 1J8HA 1QFPA 4GBXB 1JFQH 3RZCA 1MWAA 1CL7I 5I30L 4K7PX 1F5WA 2RHEA 2PXYB 1JPSH 2P43B 3FB8B 1ONQA 2BDNL 4NQSA 5I8EB 1IILE 2AJ3B 1N4XL 1T80A 1K4DB 5HGBB 3VRJB 4GRWH 5CINH 5I1DB 1W72B 3SE9L 1JHTA 1SQ2N 3GSQA 5SV3A 4ONOA 1P1ZB 5JO5A 1WWCA 3H9HA 2OR7A 3FT2A 5E99H 4FQXB 4UIKH 3K4AA 1NBVH 3VFPB 3KPNA 1ADQA 2OTUB 5A3ID 3QIBA 5C0FA 2R0ZH 5DC4B 3EYOB 3Q6GH 4PJDE 4OBSA 5EZJA 3ULVD 1FFPA 2YD8A 1YN7A 1FN4A 4Z5RA 2D7MA 4P2CG 2Q76B 2A6KA 3SHSA 3TYFB 4JVWA 1NFDA 5HY9A 1J0YA 1FZJB 4TOYL 1U95B 5T3ZE 1KPUA 1MCWM 3I84A 1XF4B 4PGDA 5H2BA 2X2YA 5TGBB 1EEYB 5ESQA 1KEMH 3QPQC 3C8KA 3OJMB 1R3IL 3O9WC 2ZCKH 3MRNB 1K5NB 1R0AL 3D3VB 4J3SA 1NFKA 3QDJA 1KELL 2X4RA 1R5VA 4YHMH 1AD0B 3VFTA 4JFOA 5FB8A 1PKQA 3QWQB 2M2DA 4QHKJ 5DI8B 4I77H 3PWJA 5J6HB 3K46A 3WLWC 3HNTH 3VG0H 1MCRA 1N5YL 1R3KA 2JF1A 1GZQA 1MHCB 5GIRB 2QQQA 5GGRA 4NQCE 4ZTPH 2XRAH 1MJUL 3C5ZA 4JKPL 1ZV5A 5F3HA 3PNWB 5I73C 1F90L 3OKKB 2NY5C 2QKIB 4K7PY 5GISH 3P0YH 4LMQE 3RY4A 3ALPA 5JIKA 3I02B 2FX8L 4KTDL 4OIIH 3RPKA 1I8KB 9CGTA 4GG6A 3EDDA 4PUBH 3E6HB 1G7IB 4WW2C 4H8WL 3F65A 3VGHA 1ITBB 4LU5H 1N6QL 1XAUA 4JLRA 5KBNC 4M7JL 3D2UB 3PV6B 5DA4A 2YN5A 2QQKL 1VGKB 1Q94B 5IVZA 5AWNH 1FLRL 3FMGH 4XNQB 5JIPA 3QUZA 4TULH 4X9FA 3SDXB 3BE1H 1DEDA 1KBGL 5IW1B 4FQ1H 3U0TA 3VGEA 1YY9D 1ZHNA 3O6FB 4OLZH 5FYKD 2VOTA 1PLGL 5TE6H 2DB8A 5D7LA 5D2LE 4HK3J 1A7RL 1T20A 1J11A 4WHTA 3TJHC 1KTKE 3MO1B 2H2PD 4GLRH 2DJ4A 1CE1H 1I75A 4NO0B 2OTWA 1B2WH 1SM3L 3ARZA 1NLDH 5LBSL 3B43A 5JLZB 2H1PH 2YMXL 1NCWH 4KK8D 5ICZB 3BRDA 2PO6D 1FQ9C 5GGVH 1ZLUH 3WO4C 4PJFE 2JK5A 1LK2A 3ZE2E 3WNPA 1AKJD 2XWBB 2OJZL 1RK0A 3ARBD 4G6JL 4WJ5A 1T7XA 4Y1AA 3ILPB 4X7SH 4X9GA 3INUH 3FQTB 4DGVH 5D8JH 4L8BB 1HSAA 5T1DH 4MNQA 2XTJC 3MOBH 2BRRH 3CU1A 3P4MB 5FGBC 3L3IA 4RGNE 2VAJA 4NQVA 4CVXB 4OCYH 4HPOL 5IGXH 4K2UH 2NW3A 3QXAB 4HV8A 3LIZL 1B0RA 2QJDA 1PJ9A 5E6IB 3TBVA 3C8HA 1G7JA 1OAKL 3VWKD 3WE6A 5EIIA 1IJ9A 1I1YA 4WHYH 1XGPA 1JUFB 4OAWB 4RNRB 1T83A 2BNRB 4NZRL 4OJFL 3N1PC 3SDAC 5E2UH 2FWOB 4AEHH 3ZDYE 4XGZA 1G9MC 2F5AH 5E6ZA 3UAJC 1CDGA 2WUCH 5DJAA 2BSSA 2VXVL 3S4SA 5C0CE 5CGMA 2AW2A 5DJXA 5EORL 1MJ8L 4ONHB 3FQXB 1E6JL 2W60A 5F7KC 5IG7B 2H9GA 4FXLA 2BY0A 5CSZA 1TITA 1CDJA 4YDLC 5IHZB 1IQWL 1G0XA 5DTFB 4N8CH 3QPQD 3IRPX 4HCRA 3MRQA 1RZ7L 3O9WD 1RK1A 1AI1H 5CEZE 4P2RA 1CQKA 2PF6A 1SVZA 2VAAB 5EOTB 1FAIH 3U4BH 4YO0A 4GKSB 4LAJH 4O58H 4PJBF 4XZUB 3WLWD 1NKRA 3MYZA 1Q1JL 2JJTC 3NZ8B 4S1DC 5BVPH 2B4CC 4RFNC 3FONB 4OF5A 3JV5A 1KLFA 2R2EB 3H9SE 2D31B 5EZOL 2VB5A 5E5MA 2Q7NA 5GXBB 4FFWC 4ODTL 3WLBA 3QNXA 2FJHA 4XNZB 1YJDL 3LRGA 3L3DA 5EBMB 5L88H 3QBTB 3IVKA 5FOJA 4IIQC 5D9SA 1V8HA 4HKZA 5DSCA 5HJ3A 3S5LB 1YNKH 2X05A 3WJJC 4IHOA 4F80A 3P4OA 1CFSA 2B1HH 2R0WH 2I26N 4RMQA 3FRUB 1M7XA 4I3SH 4H1LB 3JXAA 2WBJD 4JFZH 2VDQL 3B6SA 4YDKL 4JQXC 2Z92B 5HGHB 1ZGLP 4KUZL 4FQJH 2YK1H 4GAYA 3ARQA 5HHPA 4CNIA 4WWKC 2DJUA 1HYSD 1BJMA 5CEZD 3CSYB 5HGAB 5DD6A 4D0BA 2E6JA 1JPSL 3TJHD 3RWEA 3DVGA 1GC1H 5D2NB 2H32H 5CINL 3P4LA 3AREC 3QJHA 3GKWL 3LZFH 2F53E 4P99A 1DVFB 4ZFGH 5LGJA 5EFIB 1H8NA 3L3OB 4LQFH 5E8EA 1DANT 3SGDI 1PQZA 4WEBH 1ZLVK 4AH2A 1NBVL 4MNHA 1EEZA 3BRFA 2R23A 2X4TB 4X7FC 5I1AB 4K7FA 1IGTA 4X6EA 4XBPA 1J88A 4UTBH 5MEPA 1X5FA 4FQPA 4U31A 5HPMA 3OAYH 3MBEB 5C8JB 5A40E 1ZVHA 4Z7UB 2XTJD 3GBNL 3O6ML 4KXZI 3VFVA 3BGMB 4B0MM 4KKBC 2HLFC 4D8PA 3GMOA 4LPUA 5IMOA 1T2QH 3VDBA 3DGCR 5TDNA 3RX7A 4LASH 3QIWB 1KEML 3UJIL 2BVYA 4X0KA 2X4NB 3WUWB 1U36A 1QRKA 2R1YA 2ZCKL 5IFHH 2OQJB 3P9LB 4QOKA 4QRPB 3UBXA 5BS0D 3CIQA 2ZJSH 3VDAA 4TPRH 3BPNC 3BO8B 4YX2H 4Y16C 2WM0A 3IS0X 1O7VA 4UQ2B 1CIUA 1U8MB 2OS7A 5FA3A 2R1XB 3VG0L 1GXEA 4YC2C 1A64A 3HE6A 3PG2A 4MVBC 3CX5K 5DLMH 4HLZH 5C0AB 4F7EA 1WCBA 2XRAL 3UAJD 3PP4H 1I3GH 2DKMA 2APWA 4Z7WE 3CFEB 3DUHA 5JOFA 1MCSA 1AGBA 1Q9KB 1WAAA 3ROOB 4U1GB 1JGVL 1OAXH 3HZVB 4PFEA 1V5JA 2Z8RA 3BIAX 2ITCA 2F53D 4V2CB 3CCHA 1BREA 1FRGL 2XWTA 5IVXE 5C9JA 3TO2A 1N59B 2BCKA 4HDIB 4V1DD 5F1IA 4ORGA 5KSUB 2BOCB 2GIYA 4G8EB 5LJYH 4UQ3B 1S9WA 5DJ0A 2ZG2A 3BZDA 1H3PL 3GZKA 2MTPA 4Y8DC 3V0VB 4U0RB 1RFDH 4JG0H 5AWNL 4QXTA 2P5WB 3MRLB 4NDMB 4TULL 2CQVA 2DWEB 1DLHA 4RIRA 2CRZA 2XN9E 4CU8A 1IGYA 1IKNA 3VJ6B 4S1DD 5DEGA 3KYMB 4OLZL 4M4PA 3MC0A 2VLLA 4NQDB 5IMLA 1J1XH 4K7PH 1CFTA 4Y2DD 4FFWD 3RA7L 2J3SA 1DN0B 4R4BB 1QKZH 3QIUB 4ZG1A 3ZDZE 3I75A 5FOBA 2H1PL 3R0NA 4N5UA 2C1PB 5GGVL 5KVMC 2AVGA 3D18B 4YHIA 2FL5A 1D9KC 4YXKH 5A2JH 1OOAA 1R5IB 1CD1A 2IANB 4XP9H 3UDWC 3KNBA 2BC4A 3NTCH 4HZAA 5F8RC 3LVEA 5D8JL 4O4YL 4ZTOL 4JFHE 2FJGA 3NFNA 4PJ7B 1UWEH 4PJ5D 3LKOB 5CJOL 4PS4H 2XG5A 3B2UC 2WP3O 5KSBE 3ISWA 1D5XB 5B4MC 3TIDB 4F7TA 3WSQL 5L0QB 2VN7A 4JGUA 3UO1L 5GJTH 4WWKD 1DQQB 4KHTH 3UXFA 4FFZH 4Z7VF 3RX8A 2NTFB 1WSST 4K2UL 3JV6A 4WV1A 5IGXL 5KS9E 2CRIA 4P4KB 1AGDB 3OX8B 4F33B 1T1XB 3DLQR 5D7JB 4MMZC 2NXYC 4X9IA 5C0BB 5TE7H 2O26U 4DFIA 2M1KA 3MA9H 3ARED 1FVEA 2XN9D 4LF3B 5FV2A 3CZJA 3CPLB 4HULB 1OTTC 4M7ZC 4KJWC 2R2HA 4YHOH 4IBLT 4YHYC 4LSQH 3QQ4B 5D1QC 2F5AL 4NC1C 3NACH 3T0VA 4BSWA 1E6OH 3B5HA 2RCSL 2FR4A 4LNRA 3QCTH 5GSVA 3DVNB 4KMLB 3FN0H 2BOBB 3SKMA 1LDPH 5IQ9B 2O5YH 4KKAC 4FQHB 3QUYC 1JGEB 4KKBD 1PZ5B 1JNNH 4YHNB 1CFBA 3QXVA 5DD0L 4N8CL 5IBUB 1QFHA 5ISZE 2DQGH 1HXYA 1AI1L 4E42B 1W0YT 2Y5EA 1W0WB 4QXWA 1O5DT 5F21B 5IB5B 4OF0A 3RNQA 4K9EH 4KQ4H 4BH8B 1NGWA 3GSRB 4L3EE 4JFPA 3ZTNL 4FABH 4OCLC 1MWAH 3MNZA 1OQXA 1D3CA 3PUCA 1M1SA 3JV4B 3NCYP 5F9WB 4PRHB 4MVBD 2PO6A 3PGFH 2Q86A 5I1KH 2BP3A 5EU3A 2QHLA 3ZHLA 3STZA 1AKJA 4YDJB 3B9KD 3ARBA 3TVMC 2VO5A 5EN2B 2X4QA 1QLRB 1U8LA 3C6LB 3L5IA 1OVZA 3LRSB 3QHTC 2QSCH 3VD7A 3X3FH 3KXFE 2OSLA 4HXAH 4U6XA 1AXTH 1ADQH 5EBWB 5E2TH 1QEWB 7FABH 1HWGB 3BGAA 2GAZB 3SKNA 1EMTH 3TWCL 4OZGB 3AS3A 4QRUA 5I8CA 4Y19D 2CRMA 3IETA 2LTQB 3QUMA 4H5SB 3K3QA 2WWKO 4O2FA 1L0YA 3MUZ1 5F7HA 1GOHA 4NT6B 3WJLC 2R4RH 4I3SL 4PJCE 4KRPD 1AGFA 2ADJB 1SY6A 1DBJH 3VWKA 1SMOA 3KLHC 3F7YB 2I60H 4Q74A 5IVOA 1X44A 2SEBB 1QFWH 4FQJL 4G8IA 4OV5B 1KJ3L 4ZOCA 5C07B 3GUTA 2C3VB 4K3HA 4GAFB 1L7TL 1E4JA 1XIWD 1KJMB 2Y7QA 3CSBA 1KCUH 4OGXH 4W68A 4HUUB 3N06B 1DDHA 1OB1B 3B9AA 5CHNB 2ZOLB 1WBYB 1UQSB 3LZFL 2YWYA 1TTFA 4LQFL 3V5DB 5ILTL 3FO9B 2AXFB 2NZ9C 4BSJA 1D9KD 1B0WA 3U0PA 3OZ9L 5EU6D 1A4JA 4EOWH 3QCVH 4K3EH 2DLTA 5INCA 4XCFL 1QHPA 1KC5L 1YEHL 4QRQB 4UTBL 5AZ2L 5DQJA 3O9WA 1PVHA 1YUHB 1KSRA 5A43C 4CAGA 4N90D 1I7UB 2Y9RT 4WHDA 2GTZB 2N56A 3SGJA 3W2DH 4ACPA 5IB2A 4XVSH 4YPGA 1SBSH 1V7NH 5EO9A 5F9JA 2ARWA 3V5KB 4DOHB 1G1YA 1MCHA 1MCLA 1F13A 5IEHA 1MIML 1TQCB 1UJ3C 3RIFK 1J10A 4X6DF 1P69B 2QSQA 4JREB 1A3QA 2B1AL 1T21B 4GRWB 4NP4L 4LCYB 4MXWH 1FL6A 3O3EB 3KR3L 4YAQB 4RQQB 1KULA 2NXYD 1QFUH 4GW1A 5HHOB 2NY0D 3PWLA 2NY3B 3BQUC 3ARXA 1WQVT 4AENB 4J8RB 4LLQB 2RIKA 3KYOB 2APXA 4KJWD 3EO9H 3ZKXC 1NCNA 4ZAKC 4P9HH 5CD5D 2VLME 3IB4A 5L2KE 2C26A 1J5OL 5D1QD 4DKAA 2P44B 2DM3A 3BEVB 1JHLH 3IDYB 2C3GA 1QACA 2E27H 4ZPTB 4UNVA 5B8CB 3BP7B 2MJWA 2E9IA 1CR9L 2DKUA 2VH5H 2P45B 4AM0A 1TJGL 4AMKL 1Q9WB 4ODSH 5EPMA 2N7AA 3WHXB 5HYJB 3L5JA 5EUKA 2WBJA 5I8OH 5SWZB 3BP6A 4F15B 4U2YA 3FT4A 4UMGA 5HDBF 4LBEB 4JFFB 3CH8A 1TZIA 25C8H 3BUTA 3K7UA 3CFJB 1S7WA 3TNNB 3LS5L 1L7IH 2AJVL 4GMSH 1RHHB 5E5RB 2MPAL 3ARDB 5I74B 4BJLA 4ZODA 1H3GA 4M7LL 3ULUC 1NSNH 5DMIH 3BWUC 3RGVB 4M8VA 3OPZH 3BH8B 3PWNA 4RRPG 2YPKB 2ADGA 2AXGB 2DMKA 2VLKD 1MCCA 4C83A 3GMQA 4APQB 1FYTB 3QQ3A 3TA3B 5HVHB 5DJZA 1MY5A 5I1LA 4HS3B 5MEND 5J6GB 4U0QB 5FGBA 5IF0A 1AP2A 4JR9H 4YXKL 5F7DB 2XTLA 4X7EC 4XAWL 4P5TB 3CFBB 2MHAB 1XGYH 4NKDB 5BMFH 3D87B 3GFUA 1OAQH 1G1CA 2YPLD 3SCMD 3P3YA 3VXMB 3NH7H 3VFUA 5HYSG 1U91B 4PTTB 1YEIH 1RQ5A 1HOCB 5BS0A 1CDUA 4PS4L 5DJ2A 1KYOK 3KLHD 4XBEH 4HCRH 1D5MA 4OCSH 1MCJA 1RZFH 4Y5YC 2HVKB 4OQ1A 1U3HD 2Z91B 1AQDA 2V2TA 3BP4B 3WDJA 4MSWA 1PG7X 4KHTL 4FFZL 3PHOA 4IMKC 3TM6A 5KSAB 1IGFH 2KBGA 2VDPH 3EYUL 1HILB 3OR7B 3SDYH 2BHYA 3SOBH 4NSKA 4TUJB 2ATPA 1UKTA 2QQNH 3DUUB 5TE7L 3HZMB 3ILQD 5DZLA 1YMHB 1U8KA 3JTSA 4UBDD 1IM3A 3V4UL 5AAWA 4WNQA 5FO7B 4GBXC 2DD8H 3D25A 4WIQA 4PGJA 4ZS6D 4EUPG 2NZ9D 4O51A 1IRAY 3LQZA 4OM1L 3BVNA 3MX0A 1ZVSA 3C60B 1U3JA 2NY1B 5DRZA 5MERA 1FIEA 2PXYC 4KDWA 4V1DA 2WWKT 1AHWA 1H9VA 1S7XB 1E6OL 4IRSB 4H26B 2Z9TA 4H0IA 3CUPA 5EU4B 5ALBL 2Z4QB 1BFSA 1TIUA 1HK6A 1LDPL 2V17H 4HIHB 1KIRA 2CDEA 5DRXB 1MVUB 3RWJA 3TESA 4KY1L 3TEUA 5F89B 4ELME 4OTXH 3ZKND 1JNNL 1HIMH 3FOLA 3C9NB 2Q6WA 2JJTA 3PP3H 3A6CH 5BRZD 2DQGL 4QO1A 1IQDA 1LEKA 2CDFA 1J0JA 1YEGL 3VXNB 1IEAA 4JQIH 5FYJD 3MRKB 1XR9A 3D69A 4Y2DA 2AEQL 3REVA 1I8IB 3H3BC 1DEEB 3FQNB 1DQLH 1U8OA 4IRZH 4FABL 1MWAL 3RUGF 5D7KD 3R0MA 4ZAKD 4YHPB 3VH8G 5E24E 1BMGA 4E41E 3Q5TA 5J1TC 5C0GB 4JFXB 3MRIB 3PGFL 2AK4B 3VXUE 3EZJB 3BW9B 2ICES 3T8XB 1T5XA 4QRSA 4JEGB 2QSCL 3X3FL 3KWWB 3MCLL 2O93L 3VXPA 4PJAB 1FSKB 2FGWH 1EV2E 4HX1B 5FYLE 4N1CA 4NN5C 5KOMC 5E2TL 1UVQA 4YBLB 4PJ5A 4PG9B 5I19L 4JQXA 3NAAH 4FRWA 5KN5A 2JJSA 4CMMB 3S34L 4GRMB 3GMRB 3TBWA 4QHMA 4WWKA 1QRNE 5DO2C 1MCWW 4UILH 3MRDA 3DV6B 5I1CL 4NIKB 3D39B 3O2DL 2IADA 2R4RL 2CSPA 4JY6A 3DSFL 5CJQL 2VDRH 3AREA 3C5JB 1I9IL 2DQDH 4Y5XC 5JW4Q 4U6TA 3ULUD 2R2BB 4J7RA 8FABA 1DBBH 4OF3A 3MA7B 5TDPA 1LE9A 2I9LB 3SE3A 1VGEH 3T0BA 5EBLB 1JNHB 2IWGA 3QUKA 2FBOJ 3IXAB 2DL9A 5D7IE 4GW5A 4TTDD 4POUB 4KJQD 5E8PA 1F6LL 4PRID 1MQ8A 4JRYE 1EVUA 3O6FC 2ZUXA 5KW9L 1UGNA 2A0LC 4RBPK 3EYQC 3LQAL 1LEIB 4L5FH 2HN7A 3FFCB 1KNOA 4U1IB 1UT9A 4PRDA 4UI2A 2C1OA 2EE6A 3MFFA 5F7FA 2N4IA 4XXCA 1OGAD 4K3EL 1CBVH 1MAMH 4GAGH 4LVHB 2UYLA 5TE4H 2J8OA 1BVZA 3KDMB 4AJ0A 1ZOXA 2NY4D 1P7HL 3HC0A 4TUOA 5ACZA 1PAMA 2Z35A 1QBLH 2EDYA 1RUMH 4XVSL 4NQEB 1SBSL 1V7NL 4X98B 5DEFA 2X4PA 4FP8H 3QDMD 2FHFA 2JCCF 4FQLH 3O3AB 3W39A 3QZWA 5KG9B 5DT1H 2VLJE 1FFOB 3DROB 5HTSA 3HC4H 2DQUH 2H32B 5IMKA 1I7RB 2NX5D 1JPFA 1CLCA 3WFHB 1A1OA 3B9KA 1HHGA 4NKOA 2NY7H 1N64L 3H7BB 2V2WA 3BJ91 4JPKH 1AXSB 4X4YB 2PYED 4GBXD 2AI0H 3MRMA 4YGVB 1WBZA 5ELIA 4BH7B 2LFGA 4R4NC 4Z7VA 1YY8A 4HZLA 3LB6D 4CJ0A 2W07A 3PQYE 3HB3C 4KVCH 3BN9C 2Y06H 2PXYD 3ULVH 3GHEL 2VKXA 4TVSa 1ZTXL 1JHLL 5E6IC 1EFXA 4Y19A 2M26A 1NCCL 4MQSB 4URTB 4ZXBC 3T65B 5E2JA 3OGCB 3BFOA 3HAEB 3RVWC 5FCSH 3ES6B 4AT6B 2W0PA 1JPGB 1ZT1A 3WFDH 4HUVB 1WZ1H 4FQXD 3FB7A 1VESA 2FIKB 2H2SD 3KYNA 1SBBA 3NCFB 5I8OL 3NN8B 1IGMH 3VFGH 3QWRD 1WITA 2E7HA 5IP4A 1OP3H 12E8H 5LCVH 4N0FB 1XIWA 4WU5B 2XWJB 3QFJB 4RZCB 5SWSB 2ESVD 3NZHL 32C2A 2JB6A 5DC0A 3L3GB 2J8UE 2YA2A 5D5MB 4F2MB 1R24B 2C3WA 4DZBB 3MODH 3F7VB 3QFDB 2Q8BH 2IH1B 3WNKA 3S36X 4XX1G 3DARA 3L3KB 3WFEH 1D9KA 5INDB 3D3VD 3GO1H 3RWIA 1T7YA 4R4FL 5EU6A 4WDIA 3MV7B 3I6GB 3WXWH 2H6PB 5KSVB 2WSKA 5J1AB 1BAFH 1FVCB 3R06B 2KUTA 2C4XA 2CIKA 4B7IA 2F19L 4QF1A 2G75B 4I4WB 4NN6B 4XVJH 2APBA 1SJXA 5K9QI 3TCLB 1TVHA 4JR9L 3FCTB 1X5IA 1IGJA 2IPTH 5F1NA 5C09B 2EDBA 1JTOA 3QHFH 3KYAA 3CFKB 5DO2D 1OAQL 3G5XB 4XNZC 3NH7L 1FC2D 3SGKC 2YKLH 4GLRI 4JFDD 2EYTA 2ICWI 4P2OB 2H45A 4NPYA 3WN5C 1JYVA 5ID1A 4QNPE 2EDOA 3JVGC 1AR1C 4J3TA 4G9DB 5DD1L 2I27N 3MRJA 1DQMH 4A2LA 1MSPA 4WCYL 1QOKA 3TPUA 1JHKH 1FGNH 5D1QA 2VDPL 1R3HB 2J1KA 2D3VA 2QQNL 4G80A 4IMLA 1MLCB 1NGZA 1IC1A 3BGFC 3O6FD 2ATKA 4DN4H 1BWWA 3ULSA 3FO1B 1CFNB 4BSVA 2DD8L 1LE5B 1T89C 1MAJA 1U6AH 3EYQD 4JAMA 1SYSB 4FTVE 4KJPC 3PIQB 3G6JB 3REWB 1UB6B 4MNGE 3HI5H 4BFIB 3IFOA 3QQ9C 5D2NC 2BVUA 3X12A 3HPLB 4NO0D 4ZS7L 1MEXL 4ZYKB 3IGAB 3PGCB 3H0TB 5BW7C 1FL5B 5AYQA 4JM4L 1JWMA 2V17L 1DBMH 4U1JA 5JR1H 3MUGB 1T0MA 2FD6H 3GMLB 4BQ9A 2GYSA 3LV3A 3RL2A 3QUMH 1ZEAH 5DS8B 2ERJB 2E8YA 3A6CL 1A4KB 1ZA3B 5EWIH 2HFEA 1IZKA 1OP5H 3MBEC 1SY6H 2J4WH 2UVFA 2A9MH 3OL2A 3WEXA 3CMOL 2APVA 4KROB 2VLKA 1B88A 4PJFF 2FH8A 4EBQL 3D48R 2HRPL 1EHLH 3KJ6H 4HBQA 3LHPH 1OQOA 5HPOA 4PPTA 3K2MC 4DWHA 2VDLH 4R4ND 1JRHI 4X6DA 3QIWC 4N8VG 2HH0L 3E2HB 4NNPL 1C7SA 4P23A 3LOWA 5MENA 3RWGB 2AP2A 4L1HA 3Q0HA 3VMNA 4XPBL 5E6ID 2ENSA 5IEKA 4Q2ZB 2FJFB 3CK0H 5GGSA 3RVWD 4F9LA 2YPLA 3SCMA 3FHAA 1A1NA 3WJLA 1CFQB 4OZHB 2BNRD 1T1ZB 3C87A 4HS6B 1Q0XH 2HTKD 4FQQB 4JPIA 4WFFD 1UXWB 5BXFB 4RX4D 4OZIB 4Y88A 2AABH 3SJVB 3OR6B 3BKYH 2A77H 1U3HA 1HDMB 3MRHA 1J0HA 4U1GC 4OLEA 1DUYB 3HKFA 5E1AA 4UILL 4MZ2A 3RZCB 1MWAB 4PJ9A 4LQ1A 1JPST 3CX5J 3ZSTA 3IDXL 1SMAA 3RPIA 3NABH 2ICCA 4ODUA 3QR2A 4NQSB 2VDRL 2DQDL 1EBAA 4D0DA 3GSQB 5FUOL 4LEOB 3UEZA 2FO4A 4HMDA 4WGWB 5GHWH 3FT2B 1VGEL 2HFTA 3WNNA 2F58L 3O3DA 1I1RA 3RJQB 4FXGA 4R3SA 3AC0A 3KPNB 2DBLL 3CXHK 4OFKA 3VGAB 1FFPB 4FFVC 5CILH 5ADPH 1CYGA 4FZ8H 5EOCL 4ELKB 2UUDH 3D0LB 5CZXD 4LLYA 2YS4A 1XCQB 3H9YA 4QCIA 5HY9B 1DUZA 5GGTA 3VXSE 1A6TA 5BV7H 4TNWK 4UOW1 1MAML 3HZYA 1CBVL 1KPUB 2O61A 5K9JL 1GGBL 1F97A 3BWAA 2CIIB 5ESQB 5BRZA 3STLA 4Z7UE 1FNEA 3R1GH 4H8WC 1VADA 4RAHA 1UZ6E 5IHBA 1RUML 2Y07H 4P57A 2X4RB 4PREB 1R5VB 4FFYH 4I2XB 1AR1D 4XP1H 5FB8B 1S3KH 4XX1E 4P2YA 1IGCH 1EK3A 4ZAKA 3TF7C 5E94A 3ARFB 3ZMRA 1KACB 3DO3A 4L8SB 2DQUL 1R3KB 1A0QH 1GOGA 4JO1H 4FQIH 3S9DB 3ZYZA 1XF3A 2NY2B 5T1KA 1EFQA 3C5ZB 3UTZA 2BZDA 4M5ZL 1IAIM 5ALCH 5ADOH 1A2YA 2QV2A 3PWPA 1IARB 1MAKA 5L0QC 2EECA 2FATL 4M61A 4W4OA 3GSNL 2X9XA 4KJPD 4UB0H 2VUOA 4ZOBA 2R69L 5I1GH 1YDPA 4P4KC 5ETUB 1CGSH 1BBDL 4Z9KB 5D7JC 1WJ3A 3TN0B 1FDLH 2W65A 3WV0A 4NO2B 1M6OB 5HGDB 1WGOA 1T1WB 1BQLH 1DVFD 3BUYA 5CIPB 4QHLB 4JLRB 3U9PH 4GT7A 3WFDL 4JHBA 4NGHH 3R4DA 2ADFH 2IBBA 3VFMB