1RJZB

Mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpies simplex virus mutant glycoprotein b peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
MIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Structural Basis for the Restoration of TCR Recognition of an MHC Allelic Variant by Peptide Secondary Anchor Substitution
pubmed doi rcsb
source organism Mus musculus
total genus 14
structure length 100
sequence length 100
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rjzB00
3VFNA 2WSKA 4K94C 1N8ZA 3V0AC 2DS4A 4PRNA 1Q9WA 4X6CB 5MEOA 5KSAC 1ETZA 1NQBA 3W5MA 3MJ9L 3S5LG 4QOKD 2ZUTA 5D2LE 3ELAT 1P4IH 3BI9X 2BP3A 3MBEB 5HHNB 5I15L 4FFWD 4OLYL 3W11D 3FFDB 2RQ8A 4HS8L 4PRPA 1I9RL 5MI0B 5CGYD 4YHMH 5IBUB 4YBQD 5EO9B 1G7LB 2R56L 1WT5C 5GS1C 3FMGL 4XB7A 1TJIH 4P2QD 3QEHA 4Q58C 2XA8H 3A0OA 3O6KL 3IU4L 5I8KH 1G7PA 3IDYC 4Y8DC 3SDCA 4HIXL 3BKCL 3BN9D 5FCUL 2XZCH 1S7XB 4QXTA 5TGBB 5FO7A 2Z91B 3W5NA 5I2IB 3GIVA 3EO1B 5AWNL 4YHYC 4KTEH 3QQ4B 1YPZE 4JJ5B 1NAMH 3AROA 3C9NA 3P30H 1EHXA 1AHWC 1HINL 3VGBA 4WI5A 4MB4A 5LGJB 5IHUH 4JO4L 4ZSOA 1WITA 4Y4HC 1A3LH 2YPLE 3RWFA 4JKPH 1JYXA 4KY1L 3WJLA 4QNPF 2DI8A 4Y19D 1CGTA 1FZMB 4R96B 3PHQA 2JJWA 4JY6B 2IGFL 2VXUH 4KKNA 1T22A 1GC1L 3WKML 1EZVX 4LSUL 5DHXB 1JJUA 1QRNA 1X4XA 1F3DH 4GKOA 1NUNB 2AJXH 3HG1A 3CFBB 4H88H 4KVCH 1NJ9B 1SVZA 3L95B 5KAQF 5I71C 3MGTA 3ULVL 4XNUL 5MP6L 3ULVD 3PL6D 3QNYB 4I0KA 1DQDL 1FIGL 2IG2H 4WU5B 1MFCH 4DAGH 4U6TA 3GIZL 4MCZA 3KGRA 3T77A 5SX5K 4BK4A 5TQ2L 4PRIA 2D0FA 3MV8D 5TDPB 4HWBH 2AXGA 3ILPA 3F7YB 1JWUB 5GGUA 3MRQA 2ZUXA 2XN9D 1RJYB 3OF6A 4KVNL 4F37K 4AIOA 3Q5TA 3QDGD 1AE6L 2WUBH 1CU4L 4UMGA 1ITBB 3PWPB 1KLGA 4DGYH 4W6YB 2Y72A 4JFXA 5ABDE 3GUTB 1P4LB 3V4VH 1I3RA 1PG7H 3DX8A 4K3JH 1LO2L 3WIIH 5BRZA 1R3KB 2BCKA 1CF8H 3TPKA 3VXTA 3KWWB 2CK0H 5MHSE 12E8L 2H9GB 3FQXA 4XP9L 2MHAA 4XX1G 3HPJA 5KSBE 1OP3H 4F7TB 2XY1A 5CFHA 1DR9A 1OARH 1BJ1J 1L0QA 4NQUA 2KDGA 4GW4B 5AG8A 3BPCB 4UBDD 4JFPA 2A2QT 3DYOA 5L9DL 4H26A 1LK2B 1MVUB 4Z7OF 3HLAA 5L7XH 5FOJA 2MQ0A 3LKNA 4OKVB 4KV5F 2DJSA 1WC7B 5D2NB 1I7TA 2CSPA 2E6JA 4TRPL 5DFVC 2DQGL 3QXAB 4GMSH 3HZMB 2V5YA 3GMRA 1TVBB 4ONHB 5LQBL 3BZEB 2P5EA 1TCMA 1QSFD 5DK3A 5DWUH 1BD2E 1UG9A 2EDTA 1LP9A 1RIHL 3MACH 4FP8H 4QHUB 5JQHC 4GMTL 1T6VN 2EXYC 4F7MB 1MAJA 4LSRL 4ZTPL 4ZUSB 4PRHD 5SV4A 3LB6D 5GGTL 5HGBB 3ARDC 2GAZB 1K4CA 1N59B 4QRUB 4G9FD 2JK5B 3LRSB 1FCCA 4BZ2H 4KWUA 4HPYH 5K9QI 4EEEA 3F6LA 1YMME 4LCWD 3ZKXC 4R4BB 5IVZB 3TVMC 5AAMA 1LO5A 4G7YH 3ARTA 5HHPB 2FX9L 4NZUH 5KG9A 4EN3A 2E8ZA 1ZVSA 2X70B 3QULA 5I1GH 4QRRB 1LO4L 3RX7A 2G5RA 3QG7H 5HVFB 2K1MA 2A1WH 4L3EB 4LQFL 1IZKA 2F5BL 2KZWA 3N85L 5B22A 4R4ND 5JW4Q 2Q3ZA 4UTAL 5EWIH 4LSQL 2YUWA 2CLRB 4Y2DD 1HHJA 2AJ3A 4DZBB 1DQJA 5LVEA 1Q9KA 1K3IA 4R7NB 1U6AH 5E2WL 4YGVA 1V05A 1MI5E 3ARGB 2FHFA 3O9WA 1J11A 3IJYB 4JFHD 1IGTA 3ZE2F 5FM5O 4YHKH 4FZ8L 2DQFA 4P2RA 1CK0H 2VITB 5KW9L 4JN1L 3SDYH 1KEML 2JTDA 2JKXA 4S1SL 3HI6L 2JE8A 1CFVL 2FIRT 2X4PB 3V7AE 4G6JH 2C4FT 4HZLB 3NZ8A 5CMAA 2O26U 2DKSA 4YBLC 3U2SB 3OV6A 3B8SA 3MNZA 5IEKA 3H9SE 5IVXA 1RZIB 4XP6H 1AR2A 4YC2C 2IAMC 1QBBA 4Z0XB 5FDWA 4P2OD 1P1ZB 2JJTC 1HILB 3BZFA 5I15H 1BF2A 2ATPA 1YN6B 5L2KD 4OLYH 2HT3C 2CIIA 3CH1B 1K2DA 1S7SA 2ZP0T 4FXLA 4HS8H 1I9RH 3ROOA 1REIA 4JG0H 1VPOL 3C8KB 2GK2A 5J3HD 3VFRA 3FAWA 1ZEAL 5E56A 1F13A 1BGXL 1TDQA 4OCLC 4QGTA 2J6EL 4V1DA 1RPQA 4APQD 2WINB 3O6KH 3IU4H 5SWSA 1AR1C 3VFWB 1JHKL 3DIFB 3QDJD 4ZQKA 3BKCH 5FCUH 4JO2L 4M1DH 2BHYA 3UTTB 2GSGA 4OZFA 3T4AA 4NKQB 1ZWIA 3W0WE 5DVMA 1BLNA 3VFUA 1B4JL 1WV7T 5IV2B 2ADGA 4LVEA 4UDTA 3ULUF 5AWNH 5C08D 1YECL 4BH8A 1J5OL 2EDNA 1DLFL 2H32A 2J4WL 4HXBL 4PLKC 3NACL 3OHXA 3CPLA 4DKAA 4U6VL 2E3VA 3UTOA 4HK0A 3HRZB 2EDBA 4OAWA 4M8QB 1HINH 1RZJC 3QNXA 3ZDYF 5JDSB 1K8DB 1GZQB 1ROWA 3IDJA 3SE3A 4XXDA 4UDUB 3U4BH 1D5MA 4MZ2A 1ZHLA 4KY1H 5DJDA 5F7LB 4N90D 3SDCC 5EOQL 4QXGL 5J12C 2E7LA 4NSKA 1LO0L 5JW5B 5F7HA 1GC1H 4ZO7A 4E41A 1BFSA 4OT1L 5DFWH 2EO9A 1YQ2A 5DRZB 4M02A 1D6EB 1P5UA 1VKXA 4YJZL 1WVZA 1TVHB 4P46D 4CN4A 1IGJA 3ULVH 4XNUH 5MP6H 4WO4D 1KTDB 4OD2B 2X4RA 1FIGH 2V7HA 3BP7A 4QCIA 1SYVA 3NIFF 3GSWA 1MLBA 3JWDC 1SJXA 3GIZH 2V6HA 2AXHA 5TQ2H 4Q74A 1CLYL 4ODXB 2VO5A 1X4ZA 3WJLC 3WLWC 4OUUA 3E2HC 1F8TL 2G9HB 3GO1L 3B9KA 4HLJA 5DK0B 2YD5A 1ONQB 3T0BA 1AE6H 1FORL 2D03H 1BQSA 4PD4K 5ESAB 4CUCA 4HCRA 3TIDB 4NO0B 3QUXB 1CDUA 4QHLB 3O8XD 3S7GA 2UYLA 1LO2H 1FLTX 5E24E 3CH8A 3I6LD 1BBJB 3T1WA 5C6TH 1SJVA 5D7IF 12E8H 1X5ZA 1QBLL 4ZOBA 5JORB 3R0MA 5EZOH 3MYZA 2BNRE 2HJKB 1L7IL 3C6SA 1IAOB 4LLVB 5HYQB 4GFTB 5JO5B 4LSPH 5I1DB 1C5DB 2JB5L 1DQML 1I7ZB 3KXFE 2HT2D 4RGMC 3JV4B 3MTRA 2NZ9C 1CD9B 3NZHL 5T1DL 2XV6B 5F21B 5L9DH 2MTPA 1QSED 3D85A 4NNXA 2CRMA 4EUPH 5K9OB 5E1HB 2D3VA 4FZEH 3FO2B 3RVUD 4TRPH 3A6OA 2GTZA 3WN5A 2DQGH 4X6DF 3BGFC 3SE8L 2FR4A 5LQBH 5BS0E 4A6YB 4TUKL 2ESVE 4Z7QE 4DVRH 1RIHH 3SGDH 4QO1A 5H94B 4LSRH 4ZTPH 4U1SB 4UQ2A 5GGTH 2WAHA 4JM2F 5F1IA 3K80A 4LPTA 3G5XB 4I77L 4QF1A 1INEL 3UDWA 3VXNA 3CD4A 4X80H 5EFIA 5F7NC 4UT7L 2HVJA 1YY9C 2WWKO 5I1CL 3TN0A 5D6CB 1T20B 3O4LE 3MRKA 4GRLB 2IEPA 5BXFA 3UZQA 3FHAA 1LO4H 3L3DB 4JPIA 5DFTA 1INQB 3CGTA 3S4SA 2MPAL 3NBNA 1M6OB 4U6YB 1AQDA 4QKXB 5EIVA 4HX1B 3JV5A 3V8CA 2VLRA 4C83B 2F5BH 5F9AC 1TJHH 3N85H 2J5LB 3OR7A 4MA1C 1MELA 2XZAL 1TZHB 1XT5A 2WBJD 4YXKL 1U91A 4XMKL 1T5XA 1W0WA 3VRIA 2AQ1A 4EI5A 5BMFL 4UTAH 3T0DA 4GAJL 4CVWA 4LSQH 4OQTA 1JN6A 2PW1A 3T08A 5E2WH 5HGGS 3NABL 3VWKB 3IXAA 3CFEA 1T1XB 4PJ9A 5EBGA 4XGZB 2BVPB 4I18A 4M5ZL 5GGVL 4JN1H 2VWEC 1KEMH 1ZKAA 4BYHA 4S1SH 3HI6H 3ORJA 3U9UA 4EKXA 1CFVH 4EN3C 1EO5A 4QY8B 3IJHB 4RBPK 3V5KB 2W9EH 4UNTA 4LEOB 1U8MA 3RZCD 2EYTA 2JCCF 3QCTH 4HJJL 4U2YA 3HZVA 5HDOA 5IIEB 4C56A 5BV7B 2XPGA 5I17A 3DBXA 5DJAA 2ZCKL 4PGBA 4HAFA 1PSKH 3K1KC 4GBXD 2HH0L 2DQHL 3MBXH 1QSVA 3PABB 1CDIA 1F3JA 3O9WC 3BP4A 4HUMB 1VPOH 3EFDH 3FZUD 4OZHA 1KG0B 1WZ1L 3BSZL 1LILA 4MAYC 2GJ6D 4NO3B 1XGTA 2VDNH 1ZEAH 2P24B 5C71A 5E8OB 2ZZUT 1X5HA 1BGXH 4W4NA 4Z7UA 1FAIL 4XNQA 2YBRB 2J6EH 3VXRE 3T3ME 1KV3A 3OKNA 1ORQB 2CDEA 1NDGA 1JHKH 3PGCB 4JO2H 5IFHL 3AXLB 4Z77B 4JY4A 1Q9LA 2PXYA 1VFAA 3AUVA 3OAZK 4KUCF 5F1KC 1B4JH 5C7XL 2C5DC 2Z92A 3FONB 4FTVB 4J7RA 3R8BB 1YECH 4TVPE 5HSFA 4TPRL 3TFKD 4HHAB 4LLYB 1T7YA 4U6VH 3FQRA 5FYJL 1UT9A 3H3PL 5I66B 4ODSH 5FYJD 3QUMB 2O5ZL 1KN2L 3JWOH 5E00A 4X7DC 5DHYA 2OX5A 4WWKB 1KFAL 5IB3A 4JFOA 1MCOL 3DTXB 3W9DB 1UADC 2RGSA 5EOQH 4QXGH 1BWWA 4KXZI 1DVFA 1JK8B 3WL9B 4L4TE 1LO0H 1FVEA 4F57H 4U7SA 4M7LL 4OT1H 2BVOB 1T7XA 2R2BB 2PR4L 4LAJH 4WNQA 2YA1A 4XWGL 4OKDA 3VWJB 3S35X 1OAUL 5E6IA 4HH9B 2VE6B 3WHE1 1OGAE 3QT2A 1FO0A 4JRWA 4IIQB 5JDJA 4NCDA 4YHLH 5GGRA 3SE3C 1F00I 4M7JL 1I7RA 1M1SA 5TDNB 1CICB 1CLYH 4TOYL 4Y16A 1F8TH 4OCSH 3GO1H 1AP2B 4N8CL 2MKLC 1XF5B 4NOBA 3WJJA 2J1KA 3FT3A 2DKMA 1GGBH 5EPMB 5ID0B 3U1SL 1AI1H 2A74A 1HCFX 4LSSL 3OKMB 1QD0A 4QRTB 5DLML 1NFDB 3P4LA 5D2LA 3QJHA 4QXUL 2QHRL 1RZKC 4F37F 1QBLH 3BDYL 1R3LA 3REVA 3GSQB 4NYLA 4QOKE 4FXKB 3EYOB 1S9VA 3QXVA 2H6PA 3NZHH 4BFBD 2H8PA 5J9PA 4KK6D 3B9KC 3MYJA 3LKOB 2G5BA 3QFJD 4HUUB 5C0BA 3CK0L 1E4XI 2YD7A 3R8QA 3F58L 5FO8A 5IOPA 4RGNC 3PWPD 1FG2A 2WIIB 4MWFA 3TO2B 1YPZA 5EBLA 5CGTA 4CAGA 5EZLB 4KC3B 1GIGH 1G6RB 4I77H 4I0PA 3DARA 4WHTB 1AXTL 1HK6A 3GRWL 1EEYB 3H3KA 2YPLA 1XGQA 4ISVB 4ACPA 3DV6A 3ZT6A 4O02L 5FKPB 1OW0A 5I1CH 2NW3B 4MXWL 4OGAC 3ZYIA 4IOFC 3CNKA 3O3DB 3DVNA 3AS0A 3WN5C 5AYUH 4NO2A 4YEFA 1Y18B 2MPAH 4FMFA 3OPZL 1ED3A 4Y5YA 5ICYA 1M7IA 1KPVB 3VFOB 4Y19E 2XZAH 1D5XA 3VGDA 1N5AB 4YXKH 1CI5A 2VR5A 5BMFH 4GAJH 3BVNB 1MCWW 3IDUA 4G42A 1AKJB 3NABH 1E0OB 3F6IA 1YEEL 3UDWC 2CLVB 3I6GB 4M5ZH 5GGVH 4ENED 1B6DA 1A1MB 1YEDB 4O51B 4GG8A 5T1KB 3TN0C 4ZFOA 4ERSL 2FH6A 3ULVE 1SJHA 4WFHD 1MLCA 3RNKB 1DUYB 4DOHB 5HY9B 5SX4H 3MV8E 3VDAA 1T0NA 4J12A 4QRRD 1JUFA 4NM4L 1MHHB 2A6JA 2HKFH 2J3SA 4P23B 1G7MB 1YNTB 4L3ED 4WI9A 4ZAKD 3MNWA 1HDMB 3IGAB 4HZAA 4EI5C 4UAOB 3BAEL 3QDGE 1UVQB 2HH0H 3UPCA 2DQHH 3LS4L 5E95B 5KSBA 5GIRB 4PG9A 5C0FB 4PJ9C 1BX2A 5JA9A 5D4QA 1KIQB 4I18C 2DYPA 1JWMB 4I5BA 2XQBL 3DVIA 4M5YL 4KJWC 1HSBA 4AENB 1WZ1H 3ARGD 3BSZH 1A3RL 1U8OA 1CG9B 2XIDA 1NFKA 1QFUH 3SGEH 4W81A 1BVKA 1FAIH 2B4CC 4EJ1C 3NVQA 3DROB 4NQDB 3AMLA 5IESL 4H0GA 1XZ0A 1ZSDB 3QRGL 4QHMB 5IFHH 3GGWA 3QR2A 3O6ML 4UINL 2LVEA 1BD2A 4KDTA 3QXDA 5C7XH 3H7BB 1C7TA 4NHUB 1K4DB 2NW2B 3B9AA 2DWDB 4TPRH 5HHQA 3HS0A 1PYWA 4AYFA 3LRGA 4OFYD 1Z0NA 4CGTA 5AYQA 5FYJH 5IMMB 3H3PH 4C59B 4R2GD 2XICA 4XHJC 5E8PB 3L3IB 2O5ZH 4PTTA 1XGPB 1KN2H 5CD5C 5EC1B 4JCMA 1JRHL 2VIRA 1PBYA 1YMMA 4PRHE 4NZDA 4M03A 1MFEL 2X10A 5T33L 1KFAH 2PW2A 1I8MA 4P2YA 4H1LG 1MCOH 2CRIA 2E9JA 3BQUB 4G9FE 5ICXB 5FA4A 5JXED 3PJSB 5HI5D 5DR5L 1TNMA 3X13B 1TCRA 2DLFH 5INCB 2HKHL 4LCWE 1KXVC 4M7LH 3RUGB 4BUHA 5DDHB 5ALCL 3UTTD 3VE0B 1WBZB 2PR4H 3OSKA 4XWGH 5CZVL 4HK3J 4RIRA 4JZNB 3NPSC 4WUUB 2VLLB 4LLDB 3HI5L 3S88L 1UFUA 2RFXB 3V0WH 1XIWD 4BSWB 1MI5A 4HIHA 1LO3L 5D1XA 2R0KL 1BFOB 4HMEA 1YYLL 3CFDB 3LD8C 1W8NA 5HHOD 5KSUA 1GZPA 4TOYH 3ZYZA 5FYJU 1DVFC 4OF5A 4N8CH 1S7TB 4JFHE 5F96L 3O3BA 5IF0B 3SO3C 1H8OA 3GKWL 3P9LA 3H9SA 3U1SH 2JLLA 1U58B 1KCUL 5DLMH 3V4UL 5E6IC 2G75B 4QXUH 2QHRH 4ZMAT 1T0MB 1MREL 4GS7C 4GO6B 1G7QB 3RIAK 3CXDL 2MJWA 4MVBD 3HUJF 4YO0B 4MQXD 4Q2ZB 1M71B 4LNRB 1F6AA 3G04B 1ZT4A 1XF3B 5GXBB 3QEQE 5E94A 2NY0B 3WUWG 1QOKA 4CL7A 2X4TB 4W6XB 4CMMB 4NPYB 3WJJC 3V4PL 4LVHB 4C4KO 2YXFA 2X05A 5HDBE 2XTJB 1IGCL 2VSCA 2R9HC 1GXEA 2ICWI 2W9DL 4DWHA 3CK0H 3DVFA 1OF2B 1ZTXL 3F58H 3W0WA 3PHOA 4MJ4A 4LPCA 3BPOB 5J4MA 1ES0B 2NY4B 5FOBB 4NO0D 3QUXD 1OP9A 3K74B 3QDJE 1GAFL 5A43C 1FN4B 1NBVL 3TF7C 3MJ8A 4UV7L 3MRNB 3QIBD 2A6DA 2GITA 2C4FU 4PGCA 2R1XB 1GGIH 4PGEB 5C08E 1JTOA 4XZUB 5ACLA 1AXTH 5ANMB 2FL5B 1FNEB 1R5IA 3GRWH 2NY5L 3U36A 5HYSG 1U8HA 1I3GL 1NMBL 2UUDK 4ZNCD 2FJFB 4O02H 1EJ6A 2OSLA 3FT4B 4JAMA 4CU6A 4PGDA 4PP2B 4LNVA 3TV3L 4J4PD 3F65A 3INUL 4M4PA 4U6HA 3LKQA 4JFQB 5C92A 4X4ZA 3OPZH 2R29L 5DGQA 4AT6B 5I6XB 1A1OA 4X5XB 2VNCA 2VXSL 4N90E 4A6YL 4S0SD 1U95B 4NNYB 3WS3A 2EE2A 5DGRA 2WP3O 3OJMB 1OB1A 3VRJA 4QRQB 1QZ1A 3GM0A 4HLZG 4JZJC 2E9IA 1LVEA 3LEXA 3NFNB 1YEEH 4RAHA 1FNFA 3CAFA 3D0VB 4NCC2 4RMSA 2XFXA 3MV7B 5HI4D 1OW0C 4PY7A 3SKMB 4Z9KB 4WV1A 4ERSH 3K2MC 1MAMH 1UEMA 5IVOA 1OGTA 3IFPA 5F72S 3ILQC 4YBHA 3BMVA 1RUPL 5CSZA 2BOBB 2X4NB 2WV3A 1P5VA 2BSTA 5D8JL 4PJDF 4Y5YC 4NM4H 4OZGF 5ESQB 2HRPL 3GSRB 1W72B 2YUZA 4G5ZL 2BSRB 1I1YB 3BAEH 5CEZL 5EO1A 3MLZL 2AV1A 5CEZD 5BOPA 3G5ZB 2YN5A 2BNRA 3SPVA 1RY7B 3DETD 4WW1A 1LEIB 5I8CB 2UZYB 3UMTA 3KXFA 3I6LE 2XQBH 5I1HL 1U8IB 4M5YH 5ETUA 2APWA 2XG4A 5FUOH 1VACA 5D5MB 5EIQA 3WEXB 4PRDB 1LWRA 3I9GL 1NGWB 1OOAA 1JI1A 3RAJL 5C07B 4JPVL 1OD9A 1KJVA 4NZJA 5EUOF 1JZ4A 3OQ3B 2V2XB 3QRGH 4WIQA 4B5EA 4UB0L 5BW7A 1IMHC 3O6MH 4HSQA 3KPNA 2P7TA 3RP1A 1UM6L 4KJQC 5BS0A 1ADQL 2ESVA 1QSEE 5B8CA 3ZYOA 1HYRC 5BV7L 1JGEA 4IDJH 4NC1E 2YUVA 5F7YC 4GQPH 3RGHA 1WFNA 1R5WB 1RAMA 5CKAA 1A4KB 5L2JB 4Y4KA 3IAQA 1JRHH 5C6WH 4XPTL 4M6AA 1XF2A 2PYFB 4U1HB 4HT1L 3QDMB 5SWZB 5D93C 5TE4L 1IC7L 1NFIA 2Q76A 1XFPA 4HIIB 3O4LA 4JHZA 2EXWC 2Y5EA 5DR5H 5B39G 3KPQB 2LTQB 1G0XA 1S5HB 4GAGL 5ID1A 5IMLB 3LQZA 2C1PB 3WNNA 1WAAE 1P2CA 2EH8L 3TZVA 4KDTC 3GMMB 1UWXH 1DBML 1HEZA 3DHJA 5DVLA 1X5GA 3WSQH 3DV4A 2BVYA 4L4VB 1OD7A 4FTVD 3AC0A 4KKLD 5IJKC 2R0ZL 5IR1B 1IM9A 4DKEH 3HI5H 3S88H 3STZB 2DI7A 3EUUA 1S7UA 4MA3A 5D1QA 4WHYH 1RUMH 2APVA 2EC9U 2CLZB 4PRBB 1R3JA 1LO3H 4XPHL 3MPCA 5ITFA 2R0KH 3QUML 1YYLH 4F15B 4PY8J 5KOVC 2CQVA 3VI3F 4LSTL 3EYUL 5GHWL 3BXNA 5JA8B 2OYPA 4G43B 4OQ1A 5DJZA 3RVTD 2DJUA 1ZGLA 4WU7B 1T1ZA 2BJML 2FSEA 3S96A 4P9HL 5F96H 3QJFA 5A2FA 4X4XA 4MD0B 1FNLA 1J9CT 5I16B 1QLFB 4DGIL 1VADB 3SKOA 4KJYB 1JZ8A 1N3NA 4ORZC 2OL3A 4D0DA 4R4FH 2VC2L 2OR8A 4DFHA 1KCUH 3IJSB 4GXVL 4L1DA 1WEJL 1KGCD 3VMOA 3UPRA 1C08B 3LKPB 3VWJD 2XQYK 1NBYA 1DEEA 1JF6A 1MJUL 1VFBA 1ZA6A 2CIKB 5D1XC 2QEJA 3S9DB 1NBQA 3NCYP 4KMQA 3QDHA 4PJ5B 1CXEA 2IAND 1CICD 3V4PH 1G7IA 3VXRA 4L8DB 5GSVB 5E4EB 1QO3A 1IGCH 2C9AA 1YNKL 3TCLA 5M94B 2W9DH 5LAXB 1YUHA 3MGOA 4M93B 5F1OB 3D69A 4NZTL 2GJ6E 4OIAA 5ALBH 1ACYL 1ZTXH 4LRIC 4KQ4L 4EXKA 4MX7B 4CN6A 5I1LB 2OMBA 1ZS8A 5K33A 5T3ZL 5BJTB 5HVGB 1RK1B 5T3ZD 1GAFH 2H41A 5IMOA 1BQHA 3IETB 1NBVH 4YQXL 3JUZA 4PV9A 4M1GL 4OD1L 5ITBL 5JIKA 1RMFL 5HGDA 4X5WB 2NY5H 5CP3H 3GMNB 4PRAA 1I3GH 1KUMA 1NMBH 5CIPA 4LVNB 5AEAA 4NN5C 2IMMA 5DMIL 2Q86B 1DDHA 1X3DA 5EBMA 5IQ9B 5FYJE 3B9EA 3L6FB 3TV3H 3INUH 5F7UA 2ZOKB 3VGAB 2Z35A 3BX7C 2R29H 5JMOC 4RNRB 2UZXB 3CSGA 4FQHA 4JHAL 2VXSH 4A6YH 4LSVL 4LKCB 4L9LB 3RWCB 1PJ9A 5CGMA 3EKCA 4PJEF 3JWNC 5HJ3A 5D7IB 3AS3A 2XNAA 1NCAL 1EXUB 3KPRB 4PJFF 3OKLB 1G6RL 4AIXA 4PJAF 4GAFB 1RI8A 1A5FH 1MQKL 3SKNA 4N9OB 2VXTL 3TC9A 2DM7A 1VSCA 1RUPH 2PN5A 4O5LH 5JHDD 5C0CD 2E8YA 4G6FD 4O2CB 5D8JH 2APXA 3EJZC 2HRPH 1J1PL 4KJPC 2FJHB 1OAKL 4G5ZH 1CQKA 1RIUH 3T2OA 5FEBA 5E2UL 5CEZH 2EKSB 1F3RB 1VENA 4HDIA 5T1LB 5DRNB 4KRNA 4JQVA 4PJ8B 4OF0A 3QUKB 3Q1SL 2FLRT 3MJ9A 3KJ4C 3VFGL 1GJIA 1SEBA 4GKZB 1EH9A 3TWCL 4QOKA 1AKJD 4HV8A 5AD0B 4BELD 5I1HH 5DK2A 4HUVA 2IPUG 1QR1B 3TJHC 3FQTB 4N8PA 4WV1C 3BD3A 4H5SA 3I9GH 4PBWD 4R97B 3RAJH 2QR0B 1JV5B 3O2DL 2ZOLA 2V2WA 3A67L 4JPVH 4ONGL 3V6OE 3ZHKA 3NCJL 4N8VB 4FQIL 4I48A 1P9MA 1A6TB 2NY6C 4UB0H 4UNUA 3ZL4H 1UM6H 1ADQH 2WUCL 4P2QA 4F7PB 5HD8D 5BV7H 2J8UF 4RQQA 1FZKA 3STLB 5JQ6L 3QFJE 4K23L 4P23D 5F7WC 4DN4L 4PTUA 2VAAB 2V7NB 1UA6H 4ALAH 3KHQA 3AS2A 1B0RB 4LASL 3PWPE 1I8KA 2ZUVA 2X2YA 3X17A 5F89B 5J1TC 5GGRY 1ZLVK 3C5JB 1U8KA 3KPOB 2I9LB 3BEWB 1YZZA 3CFJB 4HT1H 5DJXA 3EYSL 3FKUS 3HAEG 5TE4H 4R90H 3GSXB 3VFSB 1V5JA 3MXVH 4XPBL 4Y89A 1CDHA 3H42H 4LLWA 1F4HA 2F53B 5GGQL 1RVFL 3RJQB 4NQDD 4GAGH 4MQTB 4PR5A 1P4BL 4IS6A 3JTTA 2Q6WB 5B8CC 3KVQA 5CS7A 4Y19A 3F12A 1BZ9A 1DBMH 2LV4A 2AJSL 1KXQE 3KPMA 2B39A 2HTKD 3SCMD 3FQUA 3RL1A 2R0ZH 5IFAL 2VDLL 1RK0A 3NGBC 2FHBA 4Y4KC 4K7FA 2R1WA 1OP5K 4G8EB 4R3SB 1OLLA 1N6QH 1HKFA 2ATKB 3L5XH 1TIUA 3KR3L 3CU7A 3PWLA 3QUMH 3U83A 3KJ6H 1L0YA 4LSTH 2P43B 3EYUH 4HD9A 4UQ3A 5ERWB 5BZDA 4P4KB 2VZOA 2VH5L 5J56B 3BWUC 3PL6A 2IQAA 2JF1A 3PP4L 5F9JB 2BJMH 3QO0B 3PQYB 4M6NL 4KHTL 2UVEA 3BQUD 4YX2H 1UCBL 1BZ7A 4DGIH 3TBTB 1WFOA 3MV8A 7CGTA 4QHNA 2B0SL 4JREB 2VC2H 1BOYA 4GXVH 4WFHE 1IGFL 1CGXA 4EDXB 1WEJH 1WWWX 1TTFA 3ZZ1A 3V6ZA 3QDGA 9CGTA 1N7ML 1X5XA 2H2SC 5C0AB 5MERA 1MJUH 4QRRE 5F1NB 3R1GL 2FZ3B 3CDYA 1U8JA 1RJZA 1UWGL 5GS3A 4PP1C 1YEJL 2EDHA 2H45A 3MCG1 4HIEA 1JGDA 2I07B 3V79C 5I74C 2UWEA 2YSSA 3QH3A 5DEGB 4Y5XB 3RIAF 4KAQL 2D4FA 3P0VL 4KK5D 3I50H 1YNKH 3O3UN 5A16A 4LFHD 1U8LB 5I1AA 3B5HA 4NZTH 3V5DA 3PIQA 1ACYH 5GISL 1NUDA 4NKDB 1NGXB 4KQ4H 5DQJA 5BZWB 1J10A 4LARH 3BH9A 4Z95L 4M7ZC 3H2WA 2ICWB 2XWBB 5DEFA 2QQNL 5TF1L 2FH8A 4MJ2A 1DQLL 4MDJA 3RI5K 1JF1A 1I4FB 4NUGL 3OKDA 5KSVA 4RAVB 4X9BA 5GRJL 4CW1A 4RX4D 1RHHA 4OB5L 2AJZB 1RMFH 1T04A 2R23B 2PTVA 4LGRB 1OVZA 4WFED 5GZNC 1AGFA 1C5BH 4PRHA 3SOBL 4QGYA 2NY0D 3EOAB 1I7UB 3CXHJ 4U3CA 3IDNA 2VJXA 5GGTA 4G9FA 1QFHA 2HWZL 5DMIH 1VEOA 5C0ND 3Q6FA 3MJGX 5DD6A 2XTJD 4MJ5B 3ARXA 3FO9B 5IW1B 1OQXA 4XNXL 4LCWA 2VDML 2DMCA 1HOCA 3HMXL 5B4MD 1QFWI 4LSVH 2Y25A 3IDMA 5C0JA 4RAUA 2NY4D 4PS4H 3UBXA 3RX8A 3P9MB 3DO7B 3WFEL 4OZIF 1FL3B 1T7WA 1U3HC 1QFOA 3O6LH 1IGYB 3VXUB 1BJ8A 3BJ91 4Z7WF 1NCAH 2AI0L 4OIIL 4QLRA 4Z0BL 3UTTE 5C0DB 2X9XA 3L3OA 4X7TA 3RVXC 4BSVA 2HJFB 1G6RH 5IB1A 1JTPA 3MRHB 5B38G 2O61B 1EO8H 2WW8A 3N9GL 35C8H 4ZO6A 3QAZB 2GJJA 4Y2DA 4JVUA 2A6IA 4M62L 1YDPA 4ODBD 2VXTH 1A9BB 1U93A 5J7CC 4M48L 2IH3A 2LVCA 2VXQL 4E0RB 3QFDA 1OTSC 1BREA 5HHOE 1S7RB 4NKOA 1NAKL 4YAQA 3IDGA 5E7BA 2AK4D 1WCBB 4GAYB 2FECL 2Y9RT 2EYRB 1U8NA 3D3VB 3HZKB 5F9OL 1OAKH 1K5NB 3HCVA 1IE5A 2HRLA 5IMKA 1U42A 4TNVK 3MRLB 3SDDD 4LLAA 1HXYB 2NNAB 3OXRA 3Q1SH 3IT8D 2X4QA 3LZFL 2Y23A 1CD1B 2D31A 1ZLUK 1QG3A 2EEAA 3LPGA 1R0AL 4P2OA 3BYTA 3HR5B 4AZ8A 4NRYB 1HQ4A 2AGJH 3OGCB 2V5TA 4DW2L 5IG7A 4POZC 2QKIA 3O2DH 3A67H 3ZSSA 4ONGH 3TA3B 3NCJH 5C0GB 5IBLD 1FL6B 4FQIH 4P57A 4RFEB 4AG4L 4MA7L 1EEQA 3U30C 4XVTL 5T5NG 5IBTL 3TGXA 5A3IC 3RKDD 5E5MB 3BUYA 5MEPB 1D9KD 3DURB 4APQA 2EICA 2J6EA 1GOFA 3IDIA 1W72L 3C08L 3C87A 3IDYB 3FRPG 4OFPA 3QDJA 4LHUB 4WENB 5JQ6H 4K23H 2W38A 1CFQA 2MOVA 4JQVC 4DN4H 3LV3A 4U1KB 1IJ9A 3GMPB 2GK0A 3MRRA 3RDTA 4YHYB 5E8EA 1LHZA 1J0YA 2IALA 5C08A 2YD4A 1NCNA 4TVSa 2Y7QB 2WZPD 4FFWC 3MR9A 3W11C 43CAB 3FOMB 4Z5RA 1LEGB 3VRLF 1YN7B 3VDCA 5I18L 3EYSH 1KPRA 3KPLA 4D9RE 4XRCB 5CGYC 4NQEB 5CILL 4PUBL 4UILL 4XPBH 1JE6A 4YBQC 1P9MC 5C07D 2RBLA 4H20L 5J1SC 1Q0YL 5GGQH 1FNGB 1P4BH 5JIHA 3MFGB 1S9XA 5ICZA 3IVKB 2Z4QB 1XGYL 2AJVL 2XY2A 3BN9C 5JW4R 2VSDA 3MRIB 2Q7YB 4IOIB 3EOTL 1KNOA 4EQ2A 4S11A 1TZIA 5IFAH 1V3KA 4YPGB 3MRFA 5IB5A 4JY5L 5E9DB 3DSFL 3GSUA 3KR3H 3ARPA 5K9JL 1XGRA 3FAXA 3CLFH 5I71B 2D7PA 4P46A 5LKNA 5ENWA 5DMYA 2VH5H 1NBZB 5IKCA 2OTWB 1UACL 3BO8B 4WO4A 5HYFA 1ACZA 2VZ3A 3TO4D 5DA0B 3PP4H 3QDMD 5SWZD 4XH2A 4KHTH 1CXKA 5FO9B 3RWEB 4WVRA 2CH8A 4NT6A 5F8QC 1U92A 2R2HB 3DX9A 2B0SH 4D8PA 3LKRA 3UYOD 1UH2A 2NTFA 3EYFB 4P48A 5EBWB 3E6FB 1GC1C 3D1MC 5DUML 4L4VD 3B3IA 4PJHB 3BT2L 3R1GH 1YYML 4YR6B 1ZT1A 8FABA 2OI9B 3O8XA 5IGXH 1D5ZA 4Q6IB 2MKWA 1LEKB 5FGRA 1OT1A 5HHVL 4GW1B 5CEZE 4ONFL 1OTUD 3PL6C 3VGEA 3ULVC 3X12B 4YDJA 2R2EB 4KAQH 5CWSA 2ICES 4LP4A 3UTZB 1HZHL 4F2MB 2BY0A 3MROB 2W60B 1J0IA 2VQ1B 3MRBA 5GISH 4PPTA 2CXKA 3X11A 1HCVA 2WLZA 1QSEA 3MO1B 4ZOCA 5JW4M 3V0VA 4I4WB 3BHBB 4XBEL 1IC5L 5TF1H 2QQNH 3J8F7 3SQBA 3THMH 3ULUL 4RDQG 1DQLH 3ULUD 3SE9H 5A40E 4JVWA 4NUGH 3WFHB 3S3JA 1LGVA 3S35L 5GRJH 5MENB 2GFBB 1HSAA 2K7QA 4OB5H 1C1EL 1DUZA 3JBG7 3M1BB 2YS4A 5D7JD 3SOBH 2A9ML 4PJ5D 4WJ5A 1OCWL 4OLVH 2HWZH 3G9AB 3VH8B 2Q87A 1JGLL 3MMEA 3PNWA 3KPTA 3G5YB 4FQLL 4UBDC 1UJ3A 1WAAA 2VDMH 3UCRA 1UB6B 1PLGH 3MUGB 3HMXH 4PJGF 3JUYA 4XVJH 3WO3B 4H8WL 4L29B 3SDXF 5C9JA 3ZE1F 3UAJD 4DCQB 5CJBA 1UH4A 2AI0H 4LOUD 4MD4A 4OIIH 3WUWA 4Z0BH 1A8JH 3HUJB 4X6EA 4ZUUA 3VCLA 4OV5B 4XAWL 2WBJA 3BIKB 3WDIA 1B0WA 3VMNA 3ES6B 4LBEA 2OJEB 3LB6C 4YHOL 1UZ6F 4FTVE 1RUKL 1T3FB 3MV9B 3N9GH 4QT5B 3O3AA 2DWEA 4U0RC 1PZ5B 5HGHA 4WUKL 4M48H 4OZ4B 4OI8A 1DQQA 1CXFA 5DJ8A 2AKRA 1XF4B 4IHOA 3RNQB 1NAKH 3ROLA 2P46B 1FFQA 2DBLL 2OK0L 4X6CF 1H3UA 1MCDA 5KTEL 4KZDL 1OPGL 3LPWA 2BNQB 4YBLB 1MIML 2VN4A 4KKBD 3L7FA 5DJYB 3SE4C 2KUTA 4YDIL 3RZCA 3UEZA 4KZEH 1JNHA 4M4RA 5BQ7B 4TTDD 1AGEB 3MRGB 4R4NC 3RKPA 5IUSA 3KYNB 4UOW0 5F6IC 4PJCB 1KGCE 2IAMB 4OLWL 1KTKE 5D7SL 3KPRD 1R0AH 4Y2DC 4KMLB 4OGXL 4GBXA 4GKSA 1PY4A 1QVOA 4PG2A 2ADIA 2GJ6A 4MA7H 2X4OA 3QXWA 4ZUVB 3E1F1 4GRMB 1PD6A 5IBTH 2IANE 3TNNA 3UTQB 3SDAB 1WIOA 4MAUL 3OKKA 1W72H 3C08H 4PRNB 4MNHB 2E7BA 1AD0A 1ETZB 1JP5A 4NQSB 1IC4L 1EUTA 1OSPL 5T1LD 4L8CB 3DHMA 3P4NB 3MREB 4PJ8D 4DEPB 3ULSA 3AFLA 4P2OC 5T3ZE 4JM2D 4HQQL 4Z76B 2CGRH 3REWA 4JG1L 3EO9L 5SV3A 3IKKA 4BQ9A 5KZCB 4Z7VF 5I18H 1HHKB 3U0PB 5CILH 5FYLL 1V7NL 1RHFA 3FFDA 2B2XL 4UILH 5FYLD 5J3HC 5JW4N 4ZDHA 1TQBC 1L9NA 2K9UA 1Q0YH 2A77H 2YWYA 4XP1L 2AAVA 2WM0A 2E27H 3QEHB 3NN8B 4BFGA 4J3UA 5EO9A 1SY6L 3QXUA 5LG1A 3GBNL 1G7LA 4APQC 3WO4C 1XGYH 4OZGB 3TEUA 2AJVH 3WMSA 3PV6B 4GJTB 4MXQD 4U1JA 2DQJH 5FO7B 3EOTH 5EU3B 3O45B 1EIBA 1OAYL 1IEBA 4K3GA 1NGQL 2NPLX 4G9DA 3RPIB 3TH3T 5E08L 3ME0A 4JY5H 4FFZH 2Z91A 4HBQA 4ZFFA 3VG9B 3DSFH 4L8BB 3RPKA 3C9NB 3CLEL 5I2IA 3DWTA 3EO1A 5K9JH 2BERA 2DF3A 3P0YL 4JJ5A 2ZKHL 1UACH 4MQSB 2UY6A 4ZSOB 3U4AA 2AJYH 4HH8A 4IRJB 3JWOC 3FQWB 4GH7B 5LGJA 5EUOB 2VL5B 3MLXL 1A1NB 2JJSA 2P4AB 5LJYH 3BGMB 1FNHA 2MCG1 3CSBA 4MS8D 2EE9A 3SEPA 3RVVD 2X1OA 4UZGA 4KXZH 1A47A 5JHDE 5C0CE 4HKJB 1FZMA 1QRNB 2RJMA 4R96A 2EE3A 4JY6A 2HTLD 4JHBA 1YYMH 1QEWB 1ZHKA 1BIIB 1HHHB 1ZVYA 5CSGA 5D96B 1LK3L 4P46C 2P8MB 5HHVH 5E1AA 1IFHL 3KG5A 1NJ9A 4WO4C 1AFVL 4P4KD 3V6OA 4OCNC 4N0YL 3MA7A 4WU5A 4OI9A 1W8OA 1HZHH 2AXGB 3PQYD 4BK5A 1EGJL 3CIQA 5CHNB 3ZE0E 1XCQA 1OTTD 4WW2A 4MB3A 43C9B 3F7YA 3EDJA 4DUXA 2AABL 5C3LD 2FYYB 1RJYA 4NWTL 2DL9A 3BPLB 1I1FB 1IC5H 3QFJA 1CR9L 5FM5M 3VXPB 4U1NB 4XBGB 4DOHE 3DX8B 3HPLA 3ZYJA 3O8XC 3ZO0A 5C0AD 2BCKB 3PWPA 3S35H 3FFCB 3GUTA 1P4LA 2E5EA 2BMKA 3FQXB 1A02N 1Y6NR 1R3KA 1QFWM 3UZVB 2A9MH 1XH3B 1VB9A 2FGWL 1OCWH 2H9GA 4OM0L 2HT2C 1JGLH 4F7TA 2Q8AL 4L3CB 2XRAH 1CGVA 2R4SL 3PF2A 4MGXA 4JFPB 4KU1A 1ZHNB 4FQLH 4OCYH 3V52L 1J0JA 3GSNB 1TPXC 5FHBL 3GRWA 4KFZC 2WBKA 4GW4A 4ZS6D 3K4ZA 3LKNB 5I1EH 3BPCA 1H3XA 4NC1C 1QSZA 2A6KB 1LK2A 3RVUC 1MVUA 4LEXH 4H8WH 4NQDE 5K59F 1IEHA 3SQOL 1WC7A 1DBBL 2P5EB 3BPNC 4F3FA 1E4XH 1VEMA 1LP9B 3QXAA 1CD8A 2AXJA 3C5ZB 3GJFA 4ONHA 1M05B 1WSST 4XAWH 2ITCB 3BZEA 3TT1L 3NA9L 3IB4A 3LHPL 3LMJL 4YHOH 4QHUA 1RUKH 4G80A 1MPAH 1PX3A 1L0XA 1PG7W 2D7QA 3ZTJH 5HGBA 3ZT7A 3BRDA 2GAZA 1N59A 1MCFA 1UJ3C 3U7AA 2JK5A 1X5FA 1EFQA 3C5SA 3EZJB 4N0CD 4KK8D 2P45B 5ADPL 2EIEA 4UT6L 5KG9B 2DBLH 5J6HB 2OK0H 1V7ML 4R4BA 3QULB 5IVZA 4KZDH 2H26B 1OPGH 1RZFL 4MXVF 2NYYD 1MIMH 5HHPA 4OFKA 4IJ3B 1MNUH 3I02B 2X70A 1G84A 4E42A 4QRRA 4HXAL 4KTDH 2D0HA 2F58L 2WBJC 3DSNA 3VXUD 4CVXB 4HW6A 4LP5A 4ZAKA 5FGSA 4OLWH 2DRUA 2AJ3B 4HGWB 1DQJB 1Q9KB 4KKAD 3DECA 3O9WB 4U3HA 4M7KL 1UYWH 4P2RB 1X5IA 5DMKB 4F7CB 4R7NA 1NCUA 3E0GA 1MJJA 3ARGA 3KYKL 3BIBX 2RHEA 3CX2A 5L88H 2VITA 4LMQE 4ODHL 4B7LA 3NZ8B 4K8RL 4RFOL 4K8RD 5C0EB 1J7VR 4HZLA 3RZCC 3L3KB 5HPMB 1BAFH 3MLPA 3U2SA 1IC4H 3GNML 4OLUL 4EOWL 4NQTA 4OM1L 4M1CD 3TH2T 3BZFB 3B2VH 4GBXC 2DQEL 4HQQH 1KSRA 3C6LB 1K2DB 4JG1H 4OFYA 3EO9H 1HWGB 1IAII 3WIHL 4PJAB 3U46B 4WI4A 4Z0XA 1GGTA 4PV8B 1JWSB 1JGVL 1HILA 3FZUC 5FYLH 4DN3L 1YN6A 1V7NH 1P7QB 2B2XH 3CH1A 4PRIE 4PG2C 4WI2A 4G6KL 4WFEE 3NH7L 3TBYA 3C8KA 3TA3D 4XP1H 4AY0A 4V1DB 4LLMB 2ERJB 1SY6H 3KLAA 2AEIT 2F9BT 3GBNH 4XVSL 5SWSB 3TP4A 2DQCL 3EDKA 5JXEA 3D25B 4K3HA 2GSGB 4OZFB 3T4AB 2WINA 2XTJE 3WXWH 4QNPE 3VFWA 3DIFA 4LHUD 1NGQH 3VGHA 4UDTB 1FNAA 5E08H 3UTTA 4BH8B 4EIZC 1QQDB 1TFHA 3TFKC 2H1PL 5CLTA 4FN0A 1U3ZA 4OGYL 3BKML 3P0YH 4XP5H 2YD8A 2ZKHH 2QBWA 2YRZA 5DZOA 3O6FB 1XIWA 5MI0C 3HRZA 4NQED 3IDJB 5HVHB 3QA3B 3RWHA 2CJUL 3GZKA 3OKYA 2PETA 5HHOA 5JDSA 1GZQA 3MLXH 5ANME 4UV4L 4UDUA 4Q6YA 3G6JF 5J0BA 3O2VL 2J8UB 5FF6A 5JW5A 3QISA 2AK4E 4MHHG 1VKXB 3KS0H 3P0GB 5E9DD 1QP1A 5DRZA 3HAEA 3DJ9A 4RGOL 2FEEL 2L4OA 1IFHH 4BFIB 3RHWK 2V7HB 4QCIB 4EDWL 4QTHB 1AJ7H 1AFVH 1W2KT 5I30L 3OB0K 1CE6B 4N0YH 4OD2A 2Y5TA 3QXTA 3QUYB 1Y0LA 2JJSC 2ZUWA 3B9KB 4JR9L 3HE7A 5JHLL 4OJFH 2G9HA 1T21B 5DK0A 1JVKA 1CR9H 1ONQA 4PREB 4OCMC 4Z7OE 3LAFA 4K3EL 2VAJA 1JI2A 4ZD3L 2VDQH 4KV5E 1G9ML 1T2XA 3LN9A 4NO0A 5HPOA 1C16B 2R4RL 3QUXA 2AQ2A 2V5MA 1NGZB 1KC5H 2Q8BL 1BBJA 2DJ4A 4CVUA 3UJIH 3QIBA 3V6OC 2FGWH 4OM0H 5JORA 4LLVA 2HJKA 2Q8AH 1IAOA 1CGSH 5IK3B 5I1DA 2R4SH 1C5DA 5I73C 3V52H 4KK6C 3L3JA 3JV4A 5FHBH 3D85B 5CP3A 2J88L 1BQUA 1Z9SA 5HHMB 5FECB 1KPUB 1UM5L 3AB0B 2FATL 5C07E 3RWIB 4J4PA 4LPVA 3D2UB 2ZCLL 3SQOH 3S4SG 3DXAB 5K9OA 1DBBH 3EO0B 3QIUB 4NUJB 1H15B 5T1MA 4A6YA 4XPAL 3TT1H 5MEND 3MRMB 3LHPH 1DBJH 5IW6B 1J0KA 1DLHA 1WUNT 4QYOB 5DA4A 4EBQL 1G0YR 4U1SA 4YHPB 3W9EA 4ZPVB 5GRVK 4IMLB 3VXNB 2BY2A 4K2UL 3I6KB 2DKUA 3MX0A 3OB8A 4WHDA 4UT6H 3ZE2E 1V7MH 5GJTL 5BXFB 3HE6D 3UZEA 4OTXL 1UB5B 4JPIB 1RZFH 5SX5H 3QDME 1T20A 2XA3A 3GHBL 1S9WA 1P7HL 1A6PA 5DD5L 3L3DA 4XMPL 4HXAH 1INQA 4U6YA 2F58H 1T03L 1F4WL 2W9LA 2AEWA 4C83A 5INDB 1MCBA 4S1QL 4HC1L 4MD5B 1TZHA 4NM8L 3MLYL 4L4VE 3IXAB 3MJ6A 3MV9D 3KPSB 1IILE 4JZOB 1WFTA 4ENEC 1V3MA 4M6OL 2R0LL 4XGZA 2BVPA 1U2CA 3KYKH 1NEZB 2IADB 3GI8L 4MCYB 1KCLA 4ODHH 5EU4A 3GI9L 1F6LL 1J12A 2VABB 4K8RH 1U8MB 4QY8A 4KDVA 3IJHA 4K94H 4L4JA 2BNQD 3RRQA 1EBPA 4U33A 4OZIB 1MF2L 1WGOA 3QB7C 5H2BA 3V5KA 3GNMH 3OJVC 1H5BA 4LEOA 4OLUH 5DJAB 4EOWH 1JGUL 2IBBA 4KPHL 2W91A 4ZAKC 5B38A 4OM1H 5DYOA 1ADQA 1Z3GL 2M1KA 3NPZB 5IIEA 2FEDD 2CKBL 2DQEH 2YA0A 4BA8A 1CDBA 1F3JB 3C2AH 3BP4B 4P5KA 3ULUE 1JGVH 3OGOE 4DN3H 1LQSR 3I3BA 3NCEB 3J7HA 1OHQA 3ARGC 1SHMA 4G6KH 1XGTB 3NH7H 3ZDYE 2E6QA 5H37G 4NGHL 4IRSB 4PJ5E 3OKNB 2NY1D 1EK3A 4XVSH 2P24A 5CD3A 2DQCH 4WTWA 3QEGL 3SDAD 1Q9LB 2PXYB 1ORQA 1VFAB 3KYAA 2GQHA 5GZOD 1GPOL 1LE9A 2F19L 4Z77A 3VD3A 5JOEA 2F5AL 2H1PH 1ERNA 3LDBB 4OGYH 3BKMH 3NPSB 4FTVA 4FQJL 2YEZB 4MJ6B 4U3XA 4HHAA 5ISZE 4R2GC 3OXSB 2BHZA 3NFSL 2C3WA 2LU3A 5KZCD 1O7SA 5ELIA 4GW5B 5I66A 4FG6D 3LD8B 3D0LB 3QUMA 2CJUH 3ZHDA 4DUWA 5F3HB 4D0BA 2VR9A 2XA8L 4YXHL 4HWEL 2AS5M 4ETQA 5JXEC 3IKCA 4UV4H 5HI5C 2XZCL 4HIJA 3DTXA 3W9DA 3O2VH 3ZTNL 1NFDF 1JK8A 1LE5B 4HEPG 4KTEL 4KROB 2OM5A 1NAML 1K6QL 4JLRB 2A73A 1OAZL 1ZA3B 5DMGD 3P4MB 1PG7X 1PKQE 3P30L 4GS7B 4RGOH 4WEBL 3VWJA 4LDLB 4HH9A 1XIWC 5LWYL 4HJ0D 2D4DA 4EDWH 1A6ZB 5GGRB 4HUWB 3PDDA 3LN4B 1I7RB 1A3LL 5I30H 5TF0A 2Z31B 4IIQA 3KPRE 3TT3L 4Y16B 4L5FL 4IRJD 1T4KB 1GOGA 4FOMA 2APFA 3T1FB 4JR9H 4PJXF 4LAQL 2IANA 5TDNA 1CICA 5JHLH 5FM4A 3RQ3A 4JFEB 3FT3B 1GVIA 1J0HA 2VXUL 4ODVL 3GJFK 4JPWL 4DKFL 1DE4A 1AP2A 3MRPB 5CJOL 1XF5A 3WXVL 4XCCL 2R8SH 3TCXA 4Y7MA 3BP6B 4K3EH 4ZD3H 1QRND 4KVCL 2L7JA 3E3QE 1JZ2A 4LLUB 1S9YA 5GPRA 4KRPB 4X6DE 2R4RH 4QRTA 2D0GA 2Q8BH 4MVBC 4MQXC 2QSCL 4EI6A 5D7LB 1D7FA 2QQLL 4HWBL 1A4JB 1EDQA 3H9HB 5CEYB 3G08B 5J9PB 3EYOA 3L9RA 2JB6B 2J88H 1FPTL 1MAKA 2R69L 5FYLE 1UM5H 2FATH 2FHCA 4NWUL 5FO8B 2ZCLH 1HE7A 4C56E 2GSIA 4K3JL 3WIIL 5IOPB 1IL1B 4HUUA 1CF8L 4P3DB 4X8XA 1YPZB 3QUXC 1BMGA 2ICEB 3KS0J 5I8EB 4XPAH 5FYKH 2P8PA 3FFCD 5AZEL 2WIIA 4XTRD 3PDOB 3TO2A 1OARL 3QIBC 4LVOC 4EBQH 4GLRI 1CFNB 4X9GA 1LDSA 4I0PB 5EZLA 2XKSA 3S37X 4XBPB 3MXWL 5MEQB 4K2UH 4NKMA 1G6RA 2NY5C 3DV6B 4PGZA 1DN0B 1MWAB 1MHPL 4MSWB 3DMMB 4WHTA 2SEBB 3GSNL 2EIBA 4YUEL 1EEYA 5GJTH 5CAYB 1RJCA 3DVNB 4OTXH 1O7VA 4J4PC 2EDXA 3V2AR 4NO2B 1HXMB 1KB9J 5JHDA 5C0CA 3UYRL 3QYCA 4Y5YB 2W59A 2VXVL 5DD5H 1M7IB 1UXSB 4BUGA 3BD4A 1MUJA 1A7PL 1Y18A 1G9NL 1D5XB 2P5ED 1VEPA 1T03H 1F4WH 2JCCE 4TQEH 1QFWL 1KPVA 3C5ZD 3IS1X 4S1QH 3MLWH 1MFAL 3VFOA 1EEUA 3HNSL 1J18A 1JPFB 4NM8H 1N5AA 3MLYH 3QQ3B 1JHTB 4PLOB 5FGBA 3EGSA 2YD9A 4OF8A 1J8HE 3BVNA 1AKJA 3HZYB 2EECA 3ESVF 5FYKU 4M6OH 1H8NA 1CL7I 2NXYD 5HI4C 3VFPA 4ZFOB 2R0LH 2CLVA 3IRPX 3I6GA 3GI8H 2D7TL 1A1MA 1MY7A 4G6AD 5HYIA 3KAAA 1IAIM 4O51A 2IPUK 3U6RB 4J3VA 3O2DA 4JGJA 5GRZA 3QG7L 4PJGB 4YK4B 3RNKA 3PQYE 1DUYA 2ICWJ 2QSVA 5HY9A 2A6JB 2DLGA 3SHSA 1SEQL 3EIFA 1JGUH 1DN2A 4KPHH 3CDGA 3KDMA 3MNVB 1MHHA 1WBYA 2J5LC 4CNIB 3AY4A 4P23A 1YNTA 2VDRL 3DYPA 1C5CL 3V6FB 4OI7A 1HDMA 3VXMB 1UVQA 3DETC 4GUPA 4I5BB 1CK0L 3CXHK 1UENA 5GIRA 5C0FA 2DIBA 3GKZA 4BJLA 3JXAA 1KIQA 2XZZA 3OWEA 5J1AA 1JWMA 4FQXB 3C60B 4G6JL 1BVKB 4AENA 1NUGA 2PCPA 2YD6A 3Q3GB 4NGHH 5D93B 1JCKA 1CG9A 5CINL 3SY0B 3RUGF 2ID5A 3QEGH 3X14B 2AV7B 3DROA 4NQDA 1U3YA 1H5BC 4XP6L 1GPOH 4QHMA 2F19H 3AAZB 2DTSA 3L5JA 4F7EB 4Z78A 1B4RA 2KH2B 5BV7C 5HHQB 3ARQA 1LD9B 1PYWB 2F5AH 1UWEL 3HI1A 1URLA 3H7BA 4JG0L 4FQJH 4NHUA 3SCMA 1K4DA 2NW2A 4NN6B 3WDJA 2DWDA 3S8WA 3C6LD 3ZMRA 5SWQB 3NFSH 4PTTB 3IF1B 2CR6A 4U7MA 1RZJH 1KB5B 3V95A 4RMUA 1YMMB 4LCCA 1P7QD 5E8PA 1I8MB 3L3IA 1XGPA 5EC1A 4YXHH 4HWEH 3LRHA 5FA4B 4PJIF 4ODWB 1CQYA 1TCRB 4AM0B 5C0BE 3S5LB 3V7AG 4M1DL 4MJIB 3BQUA 5ICXA 3PJSA 3ZTNH 3X13A 1VGEL 5C6PB 2W0PA 1U8PB 1U36A 1WBXB 1A64A 1K6QH 1S78D 3QP3A 5DDHA 2WANA 4RBPH 1OAZH 1GGUA 4KKLC 1YEGH 3VE0A 4WEBH 1AC0A 1D5BB 4PLJD 3LN5B 1VGKB 1MI5B 4HIHB 5LWYH 1CXHA 2VLLA 4LLDA 4Z7VB 3VXUE 1MCIA 2RFXA 5KANG 3U4BL 3EHBD 3O6FD 4BSWA 1KYOK 1MCLA 5KSUB 1GZPB 4HG4K 3TT3H 4JO1L 4L5FH 4LGSB 3CFDA 2AP2A 3RVTC 4HFWB 4LAQH 4GG6F 3RHWF 3O3BB 3QI9B 3MLSH 4ODVH 4P9HC 4JPWH 4DKFH 4LQ1A 5CJOH 1QYGL 1S7TA 3WXVH 3E6HB 2QADD 3H9SB 4XCCH 5DC9B 3TM6A 5IF0A 1L6XA 3GB7B 2GYSA 1XGUA 2P48B 3L3GB 5D71L 3VWJC 3DI2B 5F93C 1D5IH 2VUOA 4W4OA 4CADB 1PDKA 1HH9B 4MA8L 3Q2CA 3OAZH 1T0MA 3CZFB 4U1MB 2QSCH 1AXIB 1F6AB 4TUOB 1JZ5A 2QQLH 4ONOA 4YO0A 5FFLA 4RX4A 3UJJL 1M71A 4IIQC 4U05A 2VZSA 4LNRA 1EERB 3WFBL 1XF3A 4TSAL 1CICC 4X0KA 1F58L 2EYSB 1UQSA 3QUYD 1KXTB 1FPTH 4CMMA 4X7FC 2R69H 2D03L 4NPYA 2M2DA 4YE4L 2IH1B 2HFTA 5CJQL 3PHOB 4NWUH 1AD9B 5C6TL 1R5VB 5CP7B 3RWGB 3LIZL 1UM4H 5JIPA 2CD0A 4KKCD 1T80A 3HMXA 1ES0A 5DO2D 5EZOL 5FOBA 5AZEH 2YMXL 4LSPL 2DAVA 1FFNA 4P5MA 3FT2B 4RFNC 1FN4A 1MOEA 4PGCB 2F8VA 1N6UA 4XVUD 4D0CB 3MXWH 1NDMA 1U8HB 1CFBA 3ARBB 4RRPA 4XZUA 1MHPH 3RTQB 1LDPH 3GSNH 4WTZG 5ANMA 2BSSB 4PGDB 1FNEA 4YUEH 5EU6B 4FZEL 2V17H 3D85D 2FJFA 5HHMD 4NQEE 3FT4A 3MLRH 4DUVA 4PP2A 1ZOXA 3UYRH 4DVBB 2HG5B 4DVRL 2VXVH 2AK4A 3D2UD 3DXAD 1A7PH 3OX8B 1G9NH 4JFQA 5HVWA 3W39B 3WS3B 2V2TB 3QIUD 1QFWH 4X5XA 1OB1B 1MFAH 2VL4A 1FV1B 3HNSH 1NGPL 1U95A 1JL8A 4TUJA 3BRGC 3SDDA 2IFGA 5D5MF 1NL0L 4QRQA 1JPST 5C09B 4X80L 4EVNB 5DUBA 2LAAA 5E9DE 1M4KA 3GJEA 2ZUUA 2XFXB 3NFNA 4P49A 4PY7B 4DK6A 3PV7A 3SJVB 2D7TH 2LABA 3SKMA 5CSZB 5FUZH 2QQKL 3I2CH 4HS3B 1K85A 3HMWH 1WISA 1UGNA 1TJHL 2E9BA 5J6GA 1CBVL 1WZLA 2EDJA 1SEQH 1D9KA 4MB5A 1KTLB 3U7YL 5EO1B 5ESQA 3GSRA 5F7MC 1W72A 3B43A 2VDRH 1C5CH 2BSRA 5FGBC 5I9QB 1I1YA 1IEAA 3KXFB 4QTIL 4G8FA 5ETUB 5KJRL 5IHZB 2YXMA 4S10A 3KPSD 4MAYA 1LEIA 4JANA 5I8CA 3WIFB 1CGWA 5EZJA 1U8IA 4W68A 3G6AB 5JXAL 1JNJA 2JIXB 4MQ7A 4RSVA 2AERT 5CINH 2W9EL 3WEXA 1DBAL 1CIDA 3QCTL 5C07A 5FKAB 1N0XL 4LCIL 3UYPA 3CFIC 4ZS7L 4P4RB 5I1IL 2QHLA 2OCFD 2ESVB 2V2XA 5DRXB 5B8CB 4WDIB 1NH6A 3CMOH 5HD8C 1PSKL 1AC6A 3ARFB 3AY4C 4PYHA 1BFVL 5B3JF 4P23C 3MBXL 4JDZA 4A2MA 2YWZA 4KI5F 1UWEH 2O5YL 4UAOC 2ARJQ 2Z8WC 4PD4J 3P77B 3EFDL 1EBAA 3LVEA 3K4AA 1R5WA 1J88A 3PXHA 1MRDH 4N1HB 3MGAA 2VDNL 2UZIL 1FVDB 1D3CA 1A4KA 2KPNA 1KN4L 4G8GB 5L2JA 5MENE 4JRYD 1W0VA 3O4LB 2PYFA 4J6RL 4U1HA 3RWDB 3TO4A 4IRSD 3QDMA 5SWZA 1CTNA 5KVDL 1AGCA 4HIIA 4WCYL 2O5XH 3TZVB 4OZFH 1VGEH 1S5HA 3E8UL 5IMLA 2PXYD 2Z93B 2C1PA 3Q48A 3FRUB 3DV4B 4MMXC 1T5WB 3NIDF 2HTKC 3SCMC 1IM9B 4IRZL 3BE1L 4ODSL 5D1QB 3T0AA 4L4VA 3T2NL 3DVGB 1I85A 5IR1A 3JWOL 2YN3A 3IDXL 4LCCC 4LU5L 4O2EB 1FFRA 3HUJE 1OQOA 4PRBA 3NOIA 4JO1H 3NFPA 5DJZB 3WNOA 1ZGLB 1OAQL 4FQQB 5FV2A 3MV9E 3QJFB 2ZG2A 3BQUC 4G43A 4F57L 1A2YB 4FABH 2EDFA 4WU7A 5F70A 4KH2A 1QYGH 1SMOA 1ULVA 3MV01 3VXOB 2OL3B 3WNLA 1QLFA 1NKOA 3K2UL 5ACZB 1VADA 4KJYA 5E4IA 4KROD 5D71H 2Y36L 3GSOB 1CT8B 2EO1A 1NBYB 3IJSA 2W0KA 4MA8H 2X4UB 1RZKH 2BNQE 5T3XL 1BQHG 2YD3A 3VI4F 1CLOL 1C08A 5T3XD 4YHLL 2YK1L 5JNYB 4BQBA 4BH7B 1WWAX 5D1ZB 3UJJH 4J3SA 2CIKA 1BQLL 3T8XB 3WFBH 1F42A 4OCSL 4TSAH 4X98B 2HLAB 1KCKA 3GEWB 5D7JA 2Z31D 1F58H 3VXRB 4Y16D 4PJ5A 3U9PL 3BESR 3U0WL 4KK5C 5E5RB 1GGBL 2OQJA 4WEUD 1TMCB 2VYRE 1YUHB 5DMJB 2E7CA 4YE4H 3LKSA 3D69B 4JFED 4L8DA 3G6JB 4M3KB 5CJQH 1AI1L 1S8DB 4G6MH 4ELME 5LAXA 1ZS8B 4CJ0A 1J87A 3FHQA 3LIZH 4MX7A 4W4OC 3VFVA 5IMOB 1NC2A 2DM4A 3DLQR 3KYMB 1DANT 4Q9BA 3X3FL 1FFPB 3OL2A 2YMXH 1TVDA 4KRPD 1GGCL 3F62A 5F88A 5ISZA 3CX5K 3IETA 1K9TA 1RJLB 1RZGB 5D7LD 5HGDB 2JJUA 3B6SB 3B8YA 5I1JL 2NY0C 5CIPB 3VU2A 2IMNA 2R0WL 3OR6A 1DDHB 5EBMB 5C0NC 1F4AA 3MODL 3GMNA 1A7QL 4L4TB 4LVHC 4NN7C 3QDAA 2XTJC 2VTFA 1WWBX 3QWRD 5IQ9A 1WQVT 2Z35B 1F3DJ 2HFFB 1WF5A 5DS8B 5FIEA 5B4MC 2ZOKA 1OWRM 3BGAA 3BPOC 1Z9MA 2NY4C 4RNRA 4PJDE 1PKQA 4F8TA 5HJ3B 1OGAB 4OZGE 1GIGL 3WFDL 1NGPH 3RWCA 1MFDH 1IAMA 5D7IA 3P4OB 1NL0H 4XWOD 2ZG1A 2F54B 4I0PD 1TXKA 1EXUA 3KPRA 4YXLL 3W82A 3OKLA 1T1WB 1MWAL 5C8JB 3QRFM 3TBVB 1HIML 4H25A 1TQCB 3ABZA 3DMMD 1E4KA 5AYUL 3V8OA 5DJ0B 1RULH 2QQKH 1F2QA 5C0IB 1J86A 1CBVH 3FO1B 5EUOE 2VLKB 4O2CA 5DD0H 2DQIL 4R7DB 5DJCA 3U7YH 4X6DA 4HDIB 5DTFB 3PXJA 4ODTL 2FJHA 3CFCL 1ORSB 3SDDC 1Z0MA 3H3BC 4Q9CA 4OQTH 3EW3B 4HKXB 3VGFA 2EKSA 4U1IB 3ISWA 1N5YH 1N6VA 5T1LA 1S7WB 4HV8B 4RA0C 4QTIH 4PJ8A 3QUKA 5KJRH 4PY8I 4HUVB 1N0LA 4UUJA 3UTSD 4GKZA 3KLHD 1IT9L 4JM2A 1RZ8B 3WNMA 4KRMB 2NR6D 3SGEI 4ZFOL 5JXAH 2V2WB 1H3TA 2R1YB 3FQTA 1MFBH 3WS6A 5IBLC 1DBAH 4I48B 5EOTB 2QR0A 1JV5A 3DUUA 4P99A 3OAYK 4JN2A 1N0XH 4LCIH 2UUDH 4N8VA 4ZS7H 2HKFL 5I1IH 2FB4L 3RKDC 4XCNB 3EYVA 1A6TA 1D9KC 2HMID 3K46A 3GSVA 2VISB 4M6ML 1SY6A 3ECBB 1BFVH 4TNWK 4WI7A 2O5YH 2W0FA 5IT2L 2V7NA 3VXMD 1I3VA 3JSSA 1NLDL 1B0RA 1KEGH 2UZIH 4U1GB 1TTUA 1QFUL 5IEHA 1J8KA 3FFCE 1KN4H 4P59L 5DJXB 1OSZB 5F89A 4FQXD 5JPMB 3C60D 3T0XA 1K3ZA 3C5JA 4J6RH 3KPOA 4LLWB 3BEWA 2ADJB 3CFJA 4XAKD 4P3CL 3GSXA 3VFSA 5KVDH 4WCYH 3VXQA 1NUFA 1KIRB 4LSDA 3E8UH 4Y19B 1CE1L 4GXUM 2JCCA 3FB8A 1SYSB 3MBED 1T2JA 3HB3D 4IRZH 4NRXA 3MA9L 5HXMA 3BE1H 1FGNL 2R1WB 3AREB 1QA9B 3T2NH 5EIIB 1J8HA 4MYWB 4YWGL 3IDXH 4LU5H 2IBZY 4G8EA 1KB5L 2CDFB 4R3SA 5E5UB 2XWJB 2ATKA 4MDIB 3VFTA 1GSMA 2YD1A 1B0GB 1OAQH 4WI3A 3TO4C 1UEYA 2DLFL 5ERWA 4D9LL 4JE4B 4DZ8B 2HJLB 4P4KA 1BZ7B 4WY7L 5DF0A 1AO7B 3PQYA 3QO0A 4HWZB 4URTB 3WCYA 3KPPB 4MJID 4X83A 3EZ8A 3K2UH 5F3BB 1EGJA 3OBAA 5FK9B 2Y36H 2EE6A 3N1GC 2NXZB 3V0WL 4AMKL 4BQ6A 3MUZ1 4J8RA 1NCTA 5T3XH 1I85C 4Y1AB 1CLOH 1CLCA 2YK1H 5F8RC 5C0AA 5DRWB 5F1NA 3LQAL 2BXYA 1WCQA 1BQLH 2YSSB 4F15C 3VA6A 1FL5B 2BOCA 1OTUC 4X4YA 2N7BA 1SBSL 3F7VA 2C1OB 2ED7A 3U9PH 3WKNA 3U0WH 4O58L 5E8NB 5DEGA 3DX7A 5I1AB 4OCWH 1UXWB 2HFGL 3BWAA 3PIQB 3TYFB 3QI9D 1UZ8A 1XCTB 4X6FB 1U8LA 3BH9B 4JEGB 2A9NH 5HYEA 4NKDA 3BH8B 4MNGB 5BZWA 3MCLH 3QCVL 4N0FB 3X3FH 3UBXG 3ULUC 1GGCH 2ICWA 2HN7A 2XWBA 2K7PA 3R06B 1I1CA 3NCBB 4GT7A 1T04B 3LQMA 1I4FA 4PJEE 4M3JA 4RAVA 4JFDB 1AGFB 5D7JC 5DSCB 5I1JH 4GRWF 2AJZA 32C2B 5IB2A 2P8LB 2R0WH 4G9FB 1JFQL 4PJFE 4PJ7F 3MODH 5KS9F 2P44B 3L5WA 4PJAE 4PJXB 3EOAA 1A7QH 2BY3A 1GL4B 4NC0B 1B90A 1H8SA 1YMHA 4P2QE 4HUXA 4M93C 1AGBB 3OKOB 1FVCB 4MJ5A 1HOCB 4OFIA 3FO9A 2X4SA 5IW1A 3IDMB 3K8MA 3MRDB 3P11L 4XC3H 2ADFL 3QG6B 4H8WC 3UAJC 3MLTB 5DJ6A 3WFDH 4LOUC 4JZJA 3DO7A 2ZUYA 3P9MA 1GGIL 4OSUH 4FNLL 1J05A 1IGYA 3VXUA 5IB1B 5EZIL 1BJMA 4FQ1L 1E28A 2OR9L 4YXLH 3V5HA 4Y2DB 1MCRA 4HULB 2B5IB 2HJFA 3ARBD 1MWAH 3MRHA 1KCVL 1P6FA 2VERN 4LPUA 2O61A 4LVNC 3RTQD 1HIMH 3RL2A 4GXUN 5EU6D 4ZYKB 5GRUL 4AEHH 4E0RA 3VGAC 4CKVX 1U8NB 1GRWA 5CCKL 2NQCA 1S7RA 2V9RA 4HGMA 5GRYA 5KVMC 2DQIH 1B9ZA 3HCVB 2RCSL 4GAYA 4KKBC 2EYRA 2NY3B 4L9LC 4ODTH 3CFCH 4JFYA 3HZKA 3OXRB 4I2XE 1K5NA 4TTDC 2X4QB 2J8UE 3QEQB 1MVFA 1HXYA 1Z6JT 5DI8B 4JDVB 4OGZA 3S97C 5C09D 1IT9H 1QLRB 4N5ED 5E03A 3MRCA 1MAML 4YHIB 1CD1A 4S1DD 3HNVL 4N68A 5IG7B 5T5NF 1E4KC 3B9VA 3NCFB 3WIHA 1JNNH 3AU1A 4ZUTA 3SJVD 3HR5A 4Y4FB 2X41A 1TQBB 3G5VB 4ZUWA 4OFVA 1B6UA 4WRLA 4OF3A 2XN9E 5C0GA 3ALPA 2FB4H 1FL6A 3E3QC 3QZWG 3IDIB 4JGUA 4AIZB 3QDJB 4M6MH 5EU7C 1D6VH 1FZJB 2DLEA 3FB6A 5E5MA 5MEPA 5TH2B 5E2TH 3DURA 3WLBB 2FD6L 1F02I 5JR1L 1X4YA 3DGGA 4LHUA 1QR4A 3MRRB 1L4IA 3RDTB 1TZGL 3RWJB 4PJ8C 5IT2H 5E8EB 4RMTA 4U1KA 3GHEL 2CUHA 1A21A 3GMPA 4MMZC 2FIKB 5FUOL 4JM2C 1NLDH 1T66D 2JJVA 4ZOEA 2UWEE 4Z5RB 4P59H 3CC5A 2ZUQC 3QPQD 1H3PH 1NKRA 2F8XC 2Y7QA 3WS6C 1IAIH 43CAA 3OZ9L 1R3HB 3FOMA 4R97C 3EFFB 1YN7A 2JIXD 5FM8A 2ARWA 4XRCA 1HNFA 4NQEA 4P3CH 1RU9L 5TE7L 5GSRA 3A6CH 5F7EH 1S9XB 2YOCA 4QEGA 5ICZB 3WD5H 4WGVB 4IDJL 1CE1H 1FNGA 4ELKB 4G8IB 4Y5VB 3BW9B 4XP4L 4PJHF 4MXQC 1KNOB 1MEXL 5HHME 4UIMB 2Z4QA 4EXPX 5IJKA 3ARFD 3MA9H 1OAXL 1QSFE 2Q7YA 4CDHA 1FGNH 1U8QB 1A9EA 4KRLB 2XWTB 1A7OL 3MLVH 5EU5B 1HQRB 3DXAE 1IGML 4WFGD 1G7JB 4J1UB 4YPGA 4YWGH 5E9DA 1KB5H 5CSBA 1G7HA 4WO4B 1T1YA 4G8GD 4P2CG 1ZHBB 1HYSD 1A0QL 3KNBB 4OLZL 4XH2B 4D9LH 3SKJL 1NBZA 3BO8A 3EYQD 4WY7H 2DQTL 2X1XR 5FO9A 3DX9B 3P73B 1T83A 3K81A 3TZVD 2ORBL 5ILTL 3WSQL 1IM3B 2NTFB 4MS8C 3T0EB 2UY7A 2FO4B 3CFKB 2R2HA 3RVVC 4DKEL 1J0ZA 5D9SB 4RWYL 2EH7L 1F11B 1RUML 4AMKH 1A6WL 3ARUA 1EMTH 3EYFA 4HK3N 2HTLC 5E2VL 1ZT1B 1KT2B 5EUKB 1EEZB 8FABB 3PP3K 4GOSA 4I9WD 1V8HA 3N1PC 5D1QD 3E6FA 4PJBF 1KBGL 1AGDB 4U7KA 4H1LB 3LQAH 1E4JA 1IGIL 1NLBL 5JZ7D 3NMEA 4Q6IA 4EIGB 1VHPA 2Q3AA 1SBSH 1LEKA 4WHCA 4P4KC 4GW1A 3UC0L 4PJIB 4O58H 3GM8A 3PWJA 3KPSE 4XPFH 2HFGH 4LDEB 3ZDXF 4LRIA 3BZDA 4R4FL 4RDQF 3EDDA 3VA2C 4HJGA 1OTTC 4F2MA 3HR6A 3MROA 2W60A 4ZPTB 2GUOB 2HFEA 4JREC 4LF3A 1X7QB 3RX5A 1HNGA 1S7QB 1S7VB 2X7LB 3MO1A 3QCVH 1HHIA 3EAKA 4I4WA 5F9WB 2CDGB 3BHBA 4RMQA 1HHGB 4RMRA 2XKNB 2MWCA 5D6DA 3GBLA 4OZIE 3WFHA 5BVJB 1V3JA 2IWGA 4Z7WE 5L2KE 4L8SA 1X5LA 5MENA 2GFBA 4GSDL 5D1ZD 2EIZB 1JFQH 1OP5H 3O41B 5KVGL 3M1BA 3MMEB 3FCTB 4Y5XC 3PNWB 3U82B 1EAPA 5ALBL 3RBSA 4GG6B 1MHCB 1UKSA 3VH8A 1PGRB 5FUCE 1F4YL 4ZS6C 3PDGA 4JRYE 3G5YA 4TSCL 4KUZH 3HE6A 3P11H 1UB6A 5C9JB 5HI3D 3UX9B 2ADFH 4TYUA 3JTSB 3UROR 3WHXA 5ESVB 1DZBA 3D39B 4MD4B 4PJCF 3QUZB 4L29A 3WUWB 3NIGF 3N50A 4ZUUB 4FNLH 3VCLB 2I9TB 3C09B 1G6VK 2WBJB 3P3YA 3TBWB 5EZIH 3WV0A 2NZIA 4FQ1H 1RUAL 3HUJA 2OR9H 2XOTA 4OV5A 2GTWB 3O3AB 5D72L 3BIKA 2YPKB 3MQIA 4HC1A 3ES6A 5HGHB 5LGHL 2OJEA 1KCVH 1T3FA 4N9GA 3MV9A 4L1HA 4QT5A 2P5WB 5DJ8B 1PEWA 2DI9A 1PZ5A 2OLDA 4L4TD 4N0CC 5GRUH 4KK8C 1X5YA 2M26A 25C8L 4S1RL 3HC3H 5CCKH 3RNQA 2RCSH 3TLRA 4O9HL 1ZE3C 2NYYC 3L7FB 3WUZA 4K07A 3M8OL 3M17A 2FDBP 1JNHB 1EFXB 2C26A 3ZLQC 4YIQB 2BNQA 4M61B 1OGAD 3OG6B 5HYSB 4W6WB 1YY8B 4ZG1A 1HWHB 1B88A 1KOAA 1S5IL 2DOCA 2A38A 5BQ7A 1CGYA 1AGEA 3MRGA 4WTZA 3OMZA 3T4YB 1A5FL 3TBSB 4GKSB 4KKAC 4HAGA 2F54D 3HNVH 2CKBA 1BEYL 3B2UD 3H0TB 3JV6B 4RZCB 3QAZC 5T3XE 4O5LL 4PLNC 1JBJA 4GRLD 5GQBA 2ADIB 2X09A 4B41A 3S36L 1CL7L 5IBUG 4ELMA 2LAGB 4HUNB 2AJUL 4O2FB 1RIUL 5EOCL 3OKKB 2VDOL 4ZUVA 3D18B 3LOWA 4GRMA 4K8RC 1NANI 2VLKD 3BP5A 3UTQA 4Z18A 3SDAA 4JFEE 2C3GA 4HS6A 3DOSA 4MNQB 3D5OF 2FD6H 3C8DA 4G3YL 5IJVB 5JR1H 4MNHA 2R2CA 1TZGH 4NQSA 2ICCA 4M1CC 3ULSB 3VWKD 1KJMA 5EC2B 3GHEH 5DVNA 3AMKA 3QO1A 3REWB 4L8CA 3P4NA 3MREA 5AAWA 1CFTA 3QWOB 4LCUA 4TNWF 3L1OL 4Z76A 1SVCP 1KJ3H 4ZDHB 3OZ9H 5J13B 5FA3B 1HHKA 3U0PA 5D7LE 5CBAB 3O4OB 3TA3C 1RU9H 5TE7H 3ZL4L 1AXSB 2CMRH 1KB9K 1VFUA 1XF1A 4JGMA 4NDMB 5F7DA 4XCFL 2DQDH 4JFZL 4XP4H 4U1JB 2EEBA 4X9IA 3NN8A 2I25N 4HFUL 4PJDA 1MEXH 1UA6L 4ALAL 1IEBB 4OZGA 1EHLH 4G9DB 3PV6A 1OAXH 1WIUA 3QEUB 4ZFFB 1A7OH 5EU3A 3O45A 3NA4A 1IGMH 1NAMA 3UO1H 3RPIA 3WYRA 1P84J 4NCC1 1I8IB 1XEDA 4L8BA 1YEKL 4R90L 3MXVL 2GJZB 4UU9B 3H42L 1X44A 2ENSA 1A0QH 5IM7B 4B53A 4OLZH 2G2RB 2ZPKL 2PTTA 1ZLUH 1TTGA 1A7BA 3SKJH 2H3NA 3CSYB 1AY1H 1DANU 5DHVB 2DQTH 3FOLA 4IRJA 4K3DL 3FQWA 2W1NA 5EUOA 1T7ZA 1WICA 2ORBH 5ILTH 1CXIA 2VL5A 4ZXBB 1A1NA 3BGMA 3EJYD 2ZCHL 4NQVB 4RWYH 2EH7H 1A6WH 2F8OA 4B0MM 1U41A 2NY7L 3BEVA 5E2VH 4L3AA 1ZHKB 1N6QL 4HKJA 3L5XL 3CJJA 3KJ6L 1FSKB 1KBGH 1FLRL 2IBZX 3ARED 1VCAA 1JTTA 4Y0GA 1QEWA 1BIIA 5E1AB 4PB0H 1IGIH 1NLBH 5I75B 1HHHA 5B39B 4WWKD 5I8OL 1G1YA 1MH5B 2C3VB 2E7HA 2P8MA 4YX2L 3UC0H 3MA7B 4POUB 1H0DB 3O2WH 3MCKB 1IKFL 4HWBA 3UTSE 1LNUA 5I73B 4LCYA 1T83C 4QRSA 3KLDA 1I9IL 4BZ1H 1XCQB 4WW2B 1UCTA 1QUNA 4YEEA 2OL3H 1AO7D 3L7EA 1IQDB 4NQXB 3QFJB 5EO0B 5CHNA 1LP9F 2D7MA 2W65B 43C9A 5TE6L 1KTRL 2FYYA 5CJ5A 3HPLB 2DL2A 1I1FA 2DLHA 4PJGE 2NXZD 3LSOB 3VXPA 1G9MC 4U1NA 4KGLA 1F2XK 4XBGA 4Y1AD 3SDXE 3ZE1E 2BMKB 2OI9C 4Q6IC 5CZXD 3FFCA 4GSDH 5EH1A 2PTUA 3DRTB 3JZ7A 2BK8A 5C0RH 3NCCB 3I50L 5KVGH 3ZKQD 3QCUL 3VXME 2EDQA 4PIRF 4JFFB 1UZ6E 1XH3A 2PO6B 2MMXA 3LH2L 4ODUB 1YEHH 4FXGB 4L3CA 1F4YH 4LARL 1ZHNA 4TSCH 4BM7A 3GSNA 3PGFL 1LMKA 3NAAL 3K4DA 2ZJSL 4TVPH 4XAKE 2DICA 1U3HA 2OMNA 4F3FB 4OD3H 4AQOA 2A6KA 4X6CE 2WWMD 5D6DC 3GJFB 4S2SB 3GMOB 2ED8A 3BJLA 1C5BL 2BRRL 4L8SC 4KQ3L 3PE9A 4G7VL 5KN5B 4G80B 1RUAH 1QLEL 3C5ZA 1M05A 4JFDD 2ITCA 5D72H 5CIPH 1JNLL 2Y06L 5LGHH 1HN1A 4YHNB 3MZGB 4GLRH 4EQ3A 3C5SB 4TULH 2CRZA 1MHEB 1WWCA 2UVFA 4M7LT 5LXGL 25C8H 1E6OL 5J11B 2A83B 3HE6C 4S1RH 4PS4L 3P40A 5IVXF 4YHZH 3RY4A 4O9HH 5J6HA 1RUQL 3O6LL 4I3GA 4OBSA 3M8OH 1YJDH 2H26A 4OF6A 4WEMB 4C4KT 4E42B 2PYEB 2GHWB 4MJIE 1Z5LA 4ZODA 1E27A 5K9KB 3F7PC 5FXCH 3I02A 4I3RL 5B21A 2C7UA 2GEEA 4ZAKB 1MRFH 1S5IH 1EO8L 35C8L 1WFUA 4CVXA 1BEYH 3MSPA 1R3IH 1IC1A 4HGWA 3S37H 4YFLI 1MJJB 4F33A 1INDH 4Z7VE 4NFCA 5DMKA 4F7CA 1NMCC 3S36H 1FZOA 1CL7H 2BC4A 5JOFA 2AJUH 2IPKA 1IAKA 5EOCH 2VDOH 4X6BB 1QBML 4YDKL 4A2LA 3QHZH 4QHKI 1TLKA 4G3YH 4OLEA 5C0EA 2NY3D 3L3KA 5HPMA 3MJ9H 3WFCL 3HN3A 4NHCL 3RA7L 4PJEA 1M7DB 2FEDC 4YZFF 3QEQD 2AGJL 5LBSL 2ITDB 4FFVD 1NCWL 5DZLA 4K71C 3TYGL 5T1KD 4R2GB 4PJFA 3L1OH 3TPUB 3C6LA 2RAMA 2H2PD 4PJAA 3VXSB 4F58L 3U46A 2WP3T 4WHYG 4PV8A 1JWSA 5I76B 3TBYB 3FQNA 1ZLWK 4Y4FD 1P7QA 4J23A 4N0UB 3KLAB 2NY1C 2R56H 1R24A 4P5TB 3FMGH 4XCFH 4JFZH 3SDAC 3U4EB 4LLMA 4HFUH 1CIUA 3IU3B 2YC1A 4J3WA 4HIXH 5GZOC 2FRGP 3D25A 3F8UB 3VFMB 3D87B 4UNVA 1CZ8L 5T5FL 3RDTD 4DEPC 5F6HJ 1UKQA 3M45A 2I24N 1QQDA 3SGKA 1GOHA 1YEKH 4JRXB 1XIWB 1BPVA 4CN1A 5GS0L 3X3GL 4KK9D 5GS0D 2ZPKH 4XNMA 4FG6C 3RWHB 5HHOB 4JO4H 3PWUB 3O6FA 4FMKA 2ZSWA 3S3SA 4K3DH 3BZ4A 3QA3A 4R8WL 4JKLA 3UXFA 1JPGB 4OFDA 1PQZB 5EU6E 5D2NE 5FF6B 4F9LA 2ZCHH 4C57C 1CWVA 3HHRB 4I2XA 4WI6A 2IGFH 3WNKA 2BNUA 2NY7H 3WKMH 2J8UA 4LSUH 3VDBA 4CU8A 2BXZA 3CVHB 4E5XA 5DMGC 1FYTB 3CLFL 1FLRH 3HAEB 3VG9C 1BF8A 2LQRA 3PWNB 4XX1E 5L8KB 4LMQI 4LKXB 5I8OH 4HJ0C 4BFIA 1U9KA 2NY2B 5DVOA 1DQDH 2Y5TB 3ZDZE 2GCYB 1Y0LB 2X40A 4QTHA 1IKFH 4IRJC 5C09E 2XN9A 3HE7B 3QIWB 1CE6A 1KCRL 1I9IH 3QUYA 3SJVE 3IRZA 4YNYA 4KVNH 3RGVB 3T0ED 5TE6H 4IDLA 4WUUD 1T21A 1CU4H 5IGXL 1G1CA 1T89A 3O11A 4L3EE 4PREA 4XCYA 4CMHB 1WIPA 5K59E 3T3PF 5D96C 3LPFA 3WBDA 1P53A 5M95B 1C16A 3QIBB 4LVOB 2NX5B 1NGZA 4XP9H 2I5YL 1MCJA 3QCUH 4YDVA 4UTBL 2B7DT 2AXFA 3LH2H 4X99B 3L3JB