1RJZB

Mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpies simplex virus mutant glycoprotein b peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
MIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Restoration of TCR Recognition of an MHC Allelic Variant by Peptide Secondary Anchor Substitution
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
total genus 14
structure length 100
sequence length 100
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rjzB00
2OTWA 4FFZH 3ARBD 1F58L 5BQ7B 3KPMA 4M7KL 5T3XE 4IIQB 4YEFA 1WBZB 1R3IH 5EN2A 3TJEH 3MRGB 3BHBA 4XB7A 2KDGA 5FO8B 1WFOA 4JR9H 1CQYA 3FO0H 1G9ML 2C7UA 3MRPA 4MJ6B 5AYQA 5KSBA 3TBWB 2PO6D 1JHKH 2AKRA 1SJEA 2R15A 4OKDA 1HCVA 4JN1H 3K0WA 1FO0A 1KACB 1CFQA 5HGBB 1DEEB 5JHDD 3RTQB 1MY7A 5FA4A 4JM4H 4EQ3A 3O41A 5DC0A 1S9VB 5B3JF 3D0VA 5LGKA 3Q6FA 1JWMB 5IMLB 3BKCL 1R3KA 1MVUA 5BZWB 4JG0L 5JW4M 4P57A 4FABL 4TOYL 5CZVH 1Q72H 3I50H 4KTDH 4HWZB 3MOAL 4D9QD 1V05A 1MEXH 1NLBL 2OP4L 3O81A 5EBMA 3TA3A 4F8QA 2ICES 2CIIB 5J6GB 5ADOL 3NVQA 4QOKB 5C08D 5DHVH 1L0QA 4CJ0A 1ZEAL 1GGIL 4PY8J 4L4VB 3B8SA 5D5ME 2NY4B 3OPZH 1ZLVK 2DAVA 1CG9A 2FHBA 3FN9A 2AV1B 3L5WB 3W9DB 5ACZA 2ZOLA 5I66A 4UUJB 1MELA 5FM5M 1F4XL 3DETD 4XMKL 1KPVA 1VESA 4K3HA 1JGUL 1YNKH 4QWWC 4MJ6A 4LSPH 3CH8A 1UWGH 1IM9B 2F15A 4YBQC 4JHAH 3SGJC 1TVHB 2VZ3A 1BPVA 1MJ7H 4ZPTA 3PHSA 5GGVL 3VXUB 3NACL 1BM3H 4RRPA 1KJMA 5EO9A 5I74B 4UIKL 3F65A 3OL2A 4XVTL 4KJYB 2X42A 3SOBL 1MHPH 4G43B 1Q9KA 1JTPA 1X5XA 1QEWB 3KHQA 4J4PC 3PHOB 3MYZA 4BUHA 5HYJE 1QBAA 5FA3A 3RUGE 1Q9LA 3D39A 2OTUA 3HUJA 1IKFH 3VE0B 2J1KA 4J4PA 2Q6WB 4Y16D 3QDGB 4LLUB 1GHFL 4ZTPL 3Q3GA 2XKSA 3GSNL 4GBXD 4UDUB 4E5XB 3BPCB 3PWNA 5GRWA 4FQ1H 3V4VL 3FFCE 3V0WL 4FOMA 5DC9B 2P5WE 1CF8L 4KRNA 4OBSA 4I77H 1S3KH 5A2LH 5I18H 4M7KH 3NN8B 4RMWA 1HK6A 3O8XD 4NBYB 4GQ9H 1WWBX 2YPVL 4D0CB 4S1RL 2X4UA 1D9KA 4FTVA 1B2WH 1TZHA 2J7LA 4HW6A 4Y19A 1T7YA 3SE8H 3UO1H 2ICWI 3LKQA 1EPFA 1INQB 4P46D 4WI8A 5DFWH 5MHSE 5FV1L 1S7WA 3DI3B 4N0YH 4DN3H 4EIGB 3SGDH 4PJCF 1A2YA 4X5XA 4BSWA 3NGBB 4OV5A 1HH6A 1U8JB 2DI7A 4FQCL 1E4JA 1PYWB 4LVHB 1NBVH 3BW9B 1KCSH 3IKKA 1YEDB 4OZFH 1Z3GL 4XC1H 3X14B 3ZDXE 4AIZB 5IMMB 1YEGH 3VDCA 5D1XD 3ULUL 1PSKL 1IAIL 3QUML 4R7DA 5MEQB 4WY7L 4QRPD 3O6ML 5GGTH 4JM2B 4M62L 2VAAA 2YUVA 4OLWH 4F9PA 4S1SH 1L7TL 3OJDB 3NGBC 4FMFA 4RIRA 1CL7L 5HHPA 3I2CH 1A6TA 3CPLA 4RFNC 4YK4C 5DUPL 4X83A 3RDTC 5HDBE 5D1QB 4PRIB 4OFVA 5I17A 3NIGE 1FPTH 5HHOE 5F3BA 4P46C 2DQGH 1R3LA 5TDNB 3FAXA 2DM4A 3SDXE 1XGYL 4Z7UA 2NY2C 2ARJA 1X3DA 5C0DA 3B43A 1QFWM 1NLDL 4XWGH 5HDQH 4KKCC 4XPAH 1F4HA 2FD6H 4Z7VF 2D2OA 2AQ3A 1FHGA 2PO6A 3HPJA 4LF3A 1A6ZB 2E9BA 2QL1A 2DQUH 4GXUN 4OLXL 4LSQL 3ARTA 2E7CA 3C8HA 3NACH 2IH3B 2HRPL 4PRHA 4RMRA 4WWKC 1UH4A 4QCIA 4AEIL 3G6DL 1JPGA 3FTGA 5FCUL 2UWEE 3DLQR 4NJAL 3FN0L 4R97B 4OGAD 3EGSB 3VWJA 2AJYH 4QHUA 5TE4H 1KJ2L 4RAUB 1V3JA 1SHMA 1J10A 1K6QH 3H9HB 4MXVE 5CHNB 2F9BT 3S36L 3D2UD 5E2TL 3VFNB 5JMOC 3PWVA 1FE8H 1I7RB 3OPZL 4NM8L 5BRZE 5LJYH 3GSWA 1U36A 4FQXB 4C56A 3UTOA 1BHGA 1HHIB 4XNYH 5CEYB 4JQIH 1QRNE 4OF0A 2ZWLT 4JY4B 5KANI 4HGKC 3BUYB 25C8H 5DK2B 4A6YL 4QY8B 1EIBA 5F3BB 4PG9A 4O02L 5FFLA 1HQRB 2R1WB 3BP7B 4QHNA 4RAHA 5E7FA 3QJFA 4YHYB 4HD9A 5HVWA 2Z92A 5GS1A 2FEDD 5IQ7H 4JFZH 2Q8BL 4QRSB 4UIKH 4FQJH 5F8QC 3KPNB 2VDQH 3O2WL 4M4RA 5EC1A 4D8PA 4XZUA 1ZVYA 3NPZB 1TZIA 3E3QC 4QYOA 4U1JB 1JF1A 2MOVA 2BDNH 5EA0L 4PJ5E 3OR7A 4YXHL 4WCYH 3HAEB 1U8MA 2ICEA 2XACC 4OLYH 4DAGH 4E9LA 3ARSA 2CMRL 1OAQH 1S5HB 1NFDF 4ZAKB 4Z7OE 3T77B 1SBBA 1MJ8L 4F80A 1VENA 1NCCH 3NMEA 3WS6C 5AD0B 5CP7B 1A4KB 4K3JL 4BH7A 1FDLL 3CC5A 5EA0H 1DN0B 1FG2B 5IBTL 2AS5M 3VXUE 5C8JA 1VA9A 2R1WA 5I8KL 3MLZH 3NZ8A 1BFOA 3SDCC 2VAAB 1I8MA 2BVYA 3TO2A 4B5EA 1A9EB 4LQFH 4LEOB 4PP2B 3DVIA 5L88H 1UYWH 3DUSA 2XQBL 4U49A 2OZ4A 1L6ZA 1U8IB 5HSFA 1OAZH 1OGAA 4U0RB 1HSAB 4YK4B 3K8MA 3NIFF 2WBJA 2OJZH 3R0NA 1EUTA 2AJXL 3ZDYE 4F7MB 2VNCA 1AP2B 2D7NA 1R5WB 4W70A 5EOTA 4JN1L 2P48B 1UCTA 2VE6B 4YR6A 3CFEB 2NY1B 2OZ4H 4WFFD 3QPQC 4CADB 1RIHH 1F3DH 3NCFB 1T66D 4PRPB 2FX7H 5ANME 3MRPB 1LK3L 2IG2L 4L29A 3S36H 4BSJA 4RSVA 5GRJL 3CK0H 1IL1B 4J3XA 5IFJA 4LPXA 5LCVL 1KNOB 4LHUD 5HYSA 2UVFA 43CAB 3PP4H 1PQZA 5T1LA 3OJVC 4QHMA 1J1XH 1EVUA 2BNQD 4OUUA 5M7QA 2ZZUT 3MCLL 3DX6B 4FQCH 3UZQA 1A6TB 5BS0A 4CN6A 3C8KA 3QXDA 1FGNH 4JFDD 1FVCB 2R2EB 5KANG 2G9HB 3TZVA 3GBNH 1FYTA 1IGJA 3TT3L 1DVFB 4C4KO 5IEKA 4O9HH 4HWNA 4X7DC 3MNVA 4NO5A 2V9RA 1OSPL 1A22B 4CJ1A 4XAWH 3J7HA 1MI5E 1FLTX 3GIVB 4JPWL 1HYSC 4XNXH 3CJJA 2ED8A 3U0WL 1K3ZA 1DL7H 3PGFL 4KUCF 3J8F7 1YECL 5DTFA 1ZHLB 4LIQE 4NDMA 2B20A 4J6RL 4Q9QL 2DD8H 3CDGA 3BE1L 5DGQA 1MCIA 5DHYB 1DUZB 3QO1A 1QA9A 3ULUD 5TPWL 1BVLA 3RWDB 4L1HA 4W4NA 2PXYD 3UXFA 3M1BA 1T89C 3CMOL 4QOKA 4FQIL 5D7JA 1UENA 2XY2A 1P7KB 4NQCB 3KYKH 2QHRH 5AAWA 4ZODA 1JUFB 4X6DB 1A9EA 5GGRB 1O7VA 1EMTL 3IJYA 3NCBB 5DYOA 3SCMD 1BM3L 5D72H 1BFOB 3NFSL 1I8MB 1RV6X 4NN6C 3DJ9A 3GNML 3A6OA 1E4XH 3MLSH 2F5BL 4KKNA 2BHUA 3CCHB 2H32B 1NEZB 2YPLD 1KENH 4BQBA 2DBJA 4I3RH 2CH8A 3L3OA 1FG9C 4LLMB 4OD1L 1X5YA 4Y89A 1ZHLA 4LRNH 5DSCB 5HY9A 4L8CB 1CCZA 5I1CL 1FZMA 1QFUH 2IH1B 2MNUA 4KQ3L 2BNRE 1CD9B 1CIUA 4DZBA 4Y1AE 2YSSA 3VXME 3HKFA 4PJAF 4U05A 4MWFB 1WFUA 2I9LA 4JFHE 1U3HC 3EFFB 1P1ZB 2WWKT 5I9QC 1ITCA 5EC1B 3MBXL 4KK8D 3O3EB 4NT6A 5F96H 3RI5K 1RIUL 3MMEA 2DQDH 5I1HH 2VLJB 4MXVF 4RAVA 3D18B 4P2RE 2P24A 4IRSB 2P7TA 4DVBA 1JTOA 1CDHA 3MV7A 1BLNA 3ARDD 1BFVH 5ERWB 5KJRH 4I3SH 4GG8A 4S1DD 2MCPH 1TZGH 3FMGL 4S2SB 1CFVL 3SGKC 2C3WA 3NZHL 1CIDA 2YZ8A 3QDJE 3SCMC 1M7XA 3TIEB 2YEZA 4U1HA 3BN9D 4NRYB 4KI5D 1J8HD 1S7RA 3MZTA 2ATPA 1D6EB 5MI0C 3LRHA 4HUKB 2MCG1 5GSRB 2DM3A 1UZ8B 5SWQA 3UBXA 3UTTB 3DARA 1HWGB 5AZEL 2BFVL 2ORBH 1MWAA 3VFWB 4FRWA 2IH3A 4GG6A 4P2OC 4XCNA 4YXLL 4PJCA 3QB7C 3GIVA 4TRPH 4ISVB 5IESL 3FQWB 1LDSA 4OZGA 2DM7A 4XI5C 3BKCH 3EOAB 3ZKMC 3QXAA 3IF1A 4Y16B 4TVPL 2NYYD 3MA7A 4BFIB 1QYGL 5HHNB 5IBUG 3AFLA 4ALAL 1A7RL 1PW3A 2ARWA 4G6KL 4F7PB 1JHLL 3T2QA 1SEBA 2J88L 5TDOB 4C54A 1R3LB 5T1LD 3O4LB 3IDGB 3SKUD 3KJ6H 1G9MH 2FJHA 5IGXH 4MLSA 4MXQD 1CVSC 3LKNA 1WZMA 3FMGH 1HQRA 4DOHB 1E4XL 2WLZA 2LE9A 2A83B 4PJ9A 1BFVL 4PJAE 4WTZG 4H1LB 3ARVA 3BWAB 1AGCB 3ARXA 2YD8A 4CUCA 5A1AA 5E4IA 3G04A 2VDMH 3QDHA 1X4XA 1A7NL 1AR1C 4XP6H 4ZNEA 2NY6C 5TE6H 3VRIB 3X14A 1KC5L 5CSGA 4NKDB 4LP4A 2EH8H 2QKIB 3MBXH 1FIEA 2YR3A 2JE8A 4JRXB 3IDJA 2ZSWB 1QBLL 3U1SL 2HVJA 4Y2DA 5ISZA 5D1XB 3QEHA 3ZYIA 1BWMA 1HXYA 5AAMA 1J0IA 3MACL 4MVBD 4PJ7F 1Z2KA 2Y36L 3IFNL 3RWJA 1B3JA 3AAZB 3BRFA 2EIDA 3K2MC 4XCEB 2G5BA 2R1YB 3MR9B 5IG7B 4ELKB 4RNRB 3GSVA 1T6VN 1VFBB 1NBYB 2CDFB 3FRPG 3EJYC 2Y7QA 3QWRA 3K81A 4LGRB 3TV3H 1G6RL 5LQBL 3B2VL 1BAFH 1FSKB 3LDBB 2A83A 4UNTA 1ZV5A 1YEJH 4N8VA 1BLNB 1OAUH 3K4ZA 3HI1B 3PWNB 3LSOB 1ZLSL 1A1MA 1EJ6A 3SDXB 5F6IB 1ZHNA 2X40A 5CJQL 5JOFB 4LCWE 2DQHL 1XH3A 5EIIB 2YXFA 2Z35A 3KYKL 4ZG1A 1DQDL 2A74B 1MCBA 1BBDH 3H3PH 2UYLA 3MJ7A 4RGMB 2BSSB 3GRWH 4QCIB 3S34H 2ZSWA 4EBQL 1S7XB 1JTTA 2QKIA 4BQCA 3L3HB 4NPYB 2R29L 1J88A 1YDPA 2ILLA 5CAYB 4MSWA 2ADJA 4NNPH 4PIRF 5ESVA 5LWYL 2R0KL 2IAND 5SWSB 3U7WL 3L3HA 3WD5H 3V52L 3PGFH 1C7TA 3U0WH 3CZFB 3K8LA 4MMXC 2XRAL 3RKDC 5I0DA 1QNZH 2VLKA 2DLEA 4P2OD 2BY3A 1FNAA 3MTRA 4X6CF 4JO3H 2VXSL 3SGDI 2KL6A 4LIQL 4HKJA 2VL4A 3TT1L 3VWJC 2XTLA 2YHGA 4U6XA 2HFGH 2OJZL 2XNAB 1KCLA 1INDH 1NFDA 1ROWA 1ULVA 4ZOEA 1FORH 4LRIC 3OJMB 5FV2A 3ZTNL 4EKXA 1NMBH 4ODSH 2Q76A 2AXHA 4H1LH 3MZGB 4KUZL 4TSAL 4X6BA 5D6CA 5T5NG 3RVTC 3ARBC 2EKJA 2BY2A 3STBA 2APXA 3UJTL 5I1AA 3QUMB 1KC5H 5DMKB 4P4RB 4HPYH 2K7PA 4N1EA 3T4YB 5DI8A 3FQTB 3PP4L 1A7NH 5JO5B 1GRWA 5CMAB 1JGDB 4IOSD 1NGYB 3QPXH 4HWEH 3G9VA 4YDVB 3GMPB 3RTQA 4POZC 2CK0L 5HHME 1TQCC 4PRHB 4GRWH 2B1AL 2EDEA 4NKDA 5DMIH 3BH9A 3GDBA 1KB9J 5SWZD 3TCXA 1A7QL 5F7LB 4U1KB 4YWGH 3QAZB 4IHOA 1XF4A 4CVXA 2GCYA 1CFBA 1FJ1A 3EO1B 1Z6JT 4HXBH 3C9NB 1A6UL 4QEGA 5HYSG 1CZ8L 3N06B 3C5ZC 1ZOXA 5FK9A 3P0YL 4G80A 4LFHG 4M93B 3ZT6A 2GHWB 2D7MA 3FB5B 3ULSB 1RZJC 1KN4H 3SDDD 5BV7L 3BN3B 3WKNA 3ZLQC 4PRIA 1KUMA 3QXUA 2RHEA 4YAQB 2VLKD 1HEZA 2YRZA 3MV01 5EIQA 4A2LA 1IQDB 3BQUB 2QADB 2JTDA 1HOCB 3LKOB 5I8KH 1VGKB 4L4VE 1YN6B 1MNUL 5JHLH 1EJOL 2VLKE 2ZUYA 2NY1D 5JDSB 3STLA 4OZGB 4Z95H 3L5XL 3V5HB 1KPUB 4AIZA 5IMMA 4Z8FL 1IL1A 2G60H 1J0JA 5TE7H 5GS1C 4G8EA 1N2RB 5D96C 4L29B 5D1XC 5ITBH 2CMRH 1KJ2H 2VDPH 4LHUA 4YJZL 5A2FA 5EPMB 4DGYH 3PL6B 2W0KA 2XRAH 5IB5A 5IB3A 3HS0B 4H20H 4IOFC 5CD5D 2R56H 3HAEH 1IZKA 4LHUB 4I18B 4YH6A 5HGDA 1OSZB 3OAUL 1SEQL 3KDMB 1LO2L 1JPFA 1YNTA 32C2B 1EHLL 4JDVA 2CKBL 2F19L 5IVXE 3CFDB 1X5LA 4WO4C 5DEZA 3MLVL 1KTDB 3V0AC 2XZZA 4Y4KB 3BYTA 5CCKL 4EBQH 1DQLL 3UTQA 3RVUC 3IDUA 4KROC 4LSTL 1D5ZA 3BOVA 4U1GB 4HKBB 2XNAA 5FXCH 3L5JA 4FQXC 4AIXA 4K3GA 4HJ0D 5IW3A 4UV7H 2R8SH 3QUKA 2WIIA 2YPKA 3JWOH 3MBEC 5FGCB 1FPTL 3G5YB 2YRLA 1Q0YH 4KQ3H 1NL0H 4I5BB 1ORSB 4MCZA 3QQNA 4UQ2A 3DV4A 4J12A 1DANT 3TF7C 1GVIA 2A9MH 2ZG2A 5E2TH 2DLTA 5HGBA 5ICYA 3MJ6A 1BAFL 1RUKH 1ZMYA 3UC0L 1P4IL 2JJSC 4KJQC 3HMWL 4JPWH 4P4KC 1TETL 1J05A 4WU7A 1BVKA 1I9EA 3WN5C 4CU7A 1I1RA 1PSKH 2LABA 3QULB 1ZHKB 2HRPH 2CUIA 2IADB 5EU7E 4LSQH 4TTDC 1MHEA 1D5XB 2M2DA 2AJ3A 3EO9H 3DRQA 4WI2A 5JNYA 1X9QA 4LPTA 4Y2OA 3SO5A 3CSPA 5ALCH 1YEFH 3O6FA 3DECA 3MCLH 1P7HL 4MNQD 5DK0A 4AYFA 3HFML 3FHAA 1IFHH 3LMJL 5ACLA 4FS0A 4XBPB 3GI9L 4D0BA 1U92B 4AZ8A 1N7MH 2G5RA 1F02I 2VDOL 3UBXG 4KI5C 3RY6C 4BZ2H 1OTTC 5A16B 4JFOB 1CGXA 5IP4A 3MRHB 2EKSA 3RNKB 3RVUD 1NGQL 2ESVE 3AREA 1Q0XL 3G5XB 2NY2D 3HHRB 1I85C 2BNQA 2XN9D 4FFYH 2NXZC 4LCWD 5E4EC 1EO5A 4QTHB 3DGGB 1LQSR 2ZNXA 4A2MA 3ZZ1A 3MYJA 4OD3L 3VW3L 1T04B 4WV1B 1TJGL 4I3GA 1NANH 4WY7H 2HJFA 2VN4A 3NAAH 1UEYA 4R7NA 1ZVHA 5KTEL 1EFXB 2VDRL 3VD3A 3CZJA 5C3TA 3RPIA 3CX2A 1GCFA 4EI5D 3F8UB 4Q0XH 3KXFE 1HSBA 4ALAH 5HPMB 1K8DB 1GH7A 2OR9L 3QAZC 3O2DH 1YC7A 2MPAL 1MJUH 4PJXE 5FOBB 4MQXC 2Y5TA 5IEHA 3T2NL 1EO8H 3SOBH 5D96B 3SE4C 3GJFK 4WDIB 4CKVX 4ERSL 4R4BB 4AT6B 4J2XA 4E41A 1CD1A 3IVKA 3V0VA 1ZAGA 4CDGC 4HG4J 1YYMH 3QT2A 5D70L 4JRYA 1VFMA 4FA8A 2M1KA 2YRPA 5ENWA 1SMAA 5E2JA 3LQZB 5FOJA 1I1AD 4KK6C 4OCWL 4PRBB 9CGTA 1DEDA 3QDJA 3A6CL 2EE6A 3M8OL 4NUGL 4HPOL 4DK3A 3I6LE 4G3YL 3D87B 2FATL 5I2IB 3QFJB 2FJHB 2BERA 4HHAB 1X7QA 5DMGC 4PJBB 2D9QB 3O6KL 3MV7E 2NQCA 2GAZA 1NAKH 4MQ7B 1JRHI 5EU6A 1NGWA 3PWJA 4QXWA 3HLAB 3WKMH 1EUUA 2HYMA 4P5KA 4YGVB 5IIEA 3QUXD 1E4WL 4LMQI 5SWSA 4FQPA 2QV2A 1L0YA 2J8UB 3O2WH 3ARED 3BH9B 5LG1A 1YEDA 1A3RH 2BSED 3I6GB 4APQD 4JG0H 1MVFA 4MLIA 1JWUB 1S7XA 5KVDH 1QKZL 2PR4H 2DQDL 5I1HL 4LU5H 3S37X 4S1QH 5F96L 3L7FB 3MA9H 1CE6A 3K80A 1FH5L 4HH9B 2H45A 3ZE2E 5IFAH 4G9DB 1NGPH 3HRZB 3L95B 3KWWA 4TSCL 3JV4A 5DJ6B 1YNLL 3SJVA 2I9TA 5D2NA 1I8IA 3V7MA 4JG1H 1ZGLM 1R5VB 3FO0L 4XRCA 1MCPH 2NXZB 3O4LD 5F1IB 2FZ3A 1CLOH 2ZG3A 5J11C 4NO0D 3RNQB 1D6VL 2ZSVA 5HJ3A 2Q76B 4HWBL 4PP2A 2A1WH 1KLGB 3TO2B 1B9ZA 4XNUL 3RNKA 2Y7QB 1B4RA 1ZANH 3TYFA 5M95B 1MCPL 5GS0D 4EOWL 3HNSL 3QG6A 3VXRE 3MV7B 5FUCE 2PW1B 1PX3A 4NJAH 1MFBH 4Y4FA 3P3YA 5B22A 3BMVA 4JKMA 4HV8B 4QRQB 4Z6AT 1DLFH 2APFA 4DCQA 5DRWA 4L9LA 3GJFH 2FWOA 1EMTH 3V6FA 1FP5A 2AK4B 5DS8A 3MOQA 4OCSH 4ONHA 1T2JA 2NW3B 2W9EH 5C0BE 4ODVH 3P9MA 3ROLB 1A1NA 3H7BA 3KAAA 1IAOB 5C09A 2IGFL 5I0ZA 1F90H 3TN0D 2AXFB 5DJDB 3FOMA 3FQWA 1U91B 4P2RD 4FG6D 1TVHA 4CDHA 5I8CB 4U1IB 4BJLA 1AH1A 2IH1A 2FIRT 5FUOH 2O93L 4XXCC 4WWKD 3IU4L 3PGCA 3HB3C 1IMHC 3CX5J 1ZSDA 5LAXB 3SEPA 4HUVA 4ENED 4PS4L 5HBBA 4C59B 1K6QL 3X3GH 4GXUM 4KK9D 5I30L 4RGNE 3V6OA 1I7ZB 1A1MB 4S1SL 3CPLB 1IGYA 1CR9H 4ZMAT 5DURB 1MRCH 4XBEH 4K3DL 3T1FB 4WGVB 1NJ9B 4LQ1A 5HGAA 1CGYA 1JZ6A 4JKPH 5HTSA 2CGRL 2JB5H 1KXQE 4OZHE 3LKRA 5BVJB 4XMLL 2YMXL 4X6CA 5KVEH 4Z7WB 2WP3O 3CNKA 5SX4I 1RK1A 1CLYH 5FF6B 1IT9L 1UWXK 2V7HA 4WFEE 1FGVH 1P7QA 3QDMD 4LKXB 1JGLH 4PJ7A 5B38B 1YMMB 4OV5B 1J1XL 2H9GB 5SWZE 2IANB 3P4LA 3EFDH 4RFEA 4M7ZC 4GT7A 4XI5D 2EE3A 2RBLA 3IDJB 1S7WB 5GSRA 4UB0L 2F58H 4XHJD 1TJGH 2OI9C 2Y23A 5CEZE 4TTGA 1E28A 5ETUA 4UAOC 2IBBA 3QUYD 2J8UA 4GQ9L 2HLAA 3G6AB 3I2CL 1U8PB 4P2OB 3VFPA 1OPGL 1WSST 4X4YB 2A6JB 3DBXA 4LSSL 2OL3L 1XGTB 2B1HL 1RIHL 3K2UH 3BISA 1RZKC 3MLRH 3DHJA 4Z0XA 4G9FE 4LPCA 4MJID 2P49B 3L5WA 1QHPA 4RGOL 4D0BB 3LMJH 1CDIA 3BKMH 1C5CH 3HMXL 1OWRM 5E9DE 1DBML 3O4LA 5DJAA 2D4DA 2SEBA 3TVMB 1MAKA 4OFPA 4PYGA 3VRLF 3LPWA 1T1WB 2P8MB 4PD4J 5FYJH 5KVEL 4KXZI 5K33A 5T1MB 5IF0B 3OAUH 6FABH 1T0MB 4QXTA 3BP4B 4CNIA 4JKPL 4NRZA 3ECBA 4CGTA 3MV8D 3G08A 2CRIA 4KQ4H 4ZPTB 3A67L 3ZKXC 4ZXBB 5DJXB 4J3OC 1K5NA 4U1KA 4JQXC 1BVKB 4W4OC 2F8OA 4PLJC 1MH5A 3SKNB 1XZ0A 3B5HA 4R0LC 2ERJB 1D6VH 3S8WA 3PQYE 3TO4D 3L5IA 4CU8A 2EIZA 4CN4A 4LOUD 3Q5YA 4EI5C 1RZ7L 2AGJL 4MX7A 4WW1B 2PW2B 3KPMB 5GJSH 4N8PA 4NO3B 3G5XA 5C9JA 1YY8A 3X13A 4HEME 4NZUH 2DN7A 4JFZL 3CLFH 4DTGL 2IPUK 2SEBB 4DFIA 3BN9C 3VFGL 2X2YA 1TPXB 5IUSA 2WW8A 1ACYL 4XHQA 5EUOB 4PGEB 4K94C 3CVHA 8FABA 5DQ9A 1T1XA 1S9VA 5T1DL 4XC3H 5DHVB 1F3DJ 5IW6A 2MQCA 3CFCH 1S8DB 4A6YH 4L5FH 3P4MB 4QNPF 4P5MA 2C4XA 4EQ2A 1UQSA 1OAYL 4PY7B 3KYOB 4HMEA 2WINB 1H5BB 4M6NL 1JGEA 3VD5A 3VFTB 2I07B 2EZ0D 1GPOH 1X5AA 4FQQB 3KS0H 1TDQA 4FFZL 3LEXA 1W0WB 2BVEA 4PGDA 3S37L 1CU4L 1SVCP 2VWEC 2XKNB 1FL5B 3DRTA 4PUBL 1UM5L 3UTSD 3O3BA 1IGIH 4TQEL 2X70B 1UGNA 1T80A 1VADB 4TSCH 3REVB 5IHLB 1KFAL 1UB5A 1AY1H 1CE1H 1NGZB 4WEUD 4PJ5D 2UUDK 5E8OB 4MJ4A 3FCTA 3N85H 4Y4KD 3UYOD 1Q72L 4KKLC 2PYED 3QXDB 3BAEH 2AAVA 4M7LH 1I7UB 5C0FB 1CDYA 2R4SL 4ZO9A 3U30C 3FZUD 1YJDH 5CILL 1CDUA 4Z0XB 1C5DA 1TNNA 2P5EB 4D94A 1E4WH 5M94B 2JB6A 2P5WD 4U1SA 3V2AR 3HNTL 5J1AB 2VDRH 2QJDA 5A3IC 4JO3L 3ZKND 1N5YH 3WO3B 1XMWA 1KEGH 3NOIA 3L3GA 1H3XA 2V2TB 3C5SA 3TJEL 3TESA 3N50A 2C9AA 4NOFA 1CLCA 4Y2DC 3MLYH 5EO0B 1KTKE 35C8H 1JN6A 2Z31D 3BXNA 2JCCE 4P3CL 3TGXA 3W11D 1A1OA 1MRFL 4PB0H 2AEQL 1MH5B 4YDIH 5EPMA 5EZIH 2ZOKB 1MCOH 1BD2D 1JGDA 2Q3AA 2VUYA 4G6MH 4PJIA 2YN3A 1P7QB 4WHTB 3VXNA 4UMGA 3F62A 5KVGL 3HAEA 3PIQA 2DLHA 3D25B 1D7FA 5DEFB 4ZXBA 2ZCKH 3KXFB 3S3JA 5L8KB 3QPQD 2BCKA 4NBXB 3U7YL 1YEHL 2D7OA 2DWEB 4UILL 2HKFH 4HEPG 4FXGB 4H26B 2LFGA 1KJ3L 1X5GA 2VAJA 1MCRA 4BQ9A 2OR9H 2OTPA 2DMKA 4P23C 3T1FA 3MREA 2HT4C 3AC0A 3QRGH 4Z7VA 2Z35B 2VDKH 5KN5B 4H8WH 1LO5A 2XN9B 3LS4L 2E6JA 3LSOA 1IKNC 5F9OH 5C0ND 4V1DA 1MCEA 4G6FB 1A14L 3MLUH 4XWOD 3VXPA 4LSVH 1KXTB 1NCTA 4Y5VC 4X4XB 2VQUA 3MRLA 4HJJL 1RUQH 4I77L 4EN3A 2DYPA 1WICA 5JW3L 1RZGB 3UEZA 3IFNH 1JNJA 1KPRA 3ZSSA 3OR7B 2GTWB 2R0KH 1QSVA 1UADC 2NY3C 2UUDH 3P77A 3DO7A 3FKUS 4C58B 5IKCB 3GIZH 2R29H 1V3KA 4IOFD 5JIKA 4NPYA 3QHTC 3S7GA 5E5UB 5J12C 2FH8A 2WANA 3JTTA 1DBKL 4MD0A 5E00A 4QGTA 2VTFA 3KNBA 3VA6A 4U7MA 3HNVH 1KG0A 15C8L 3ILPB 5EU3B 3QWOA 1MI5B 3S5LB 3LV3B 5IJKC 3VGFA 3QRFM 1OGAB 3QIBD 2A6IB 3HI6H 3MSPA 4KXZH 3HCVA 4AEHH 4ZFZB 2X05A 3BPNC 3WFCH 3OB8A 3NN8A 5IJKA 1NGWB 2LTQB 1NBQA 1TETH 3QEQD 4H1LA 5HJ3B 4L3EE 1NJ9A 2EKSB 1P4IH 1GGBL 5FUCC 1MCWW 2UVEA 4UU9A 3QR2A 4R96A 4ZS6C 5FDWA 3KPTA 2VABB 4NFBA 4M6ML 3VWJB 1OF2A 1DQQA 2MMXA 4P5TA 1XGRB 2VXUL 1IBGL 2AK1L 3KLHC 1C7SA 2JK5B 4JHBA 2EE9A 4M4PA 1GIGH 4APQB 4CMHB 5FM8A 1ORQA 4NQEA 1XIWB 1WTLA 4N90E 3VCLA 4I0PA 1QTYT 4XBGA 5GRVK 3Q6GH 2OI9B 2XY1A 4EN3C 3MXVH 4U1JA 4XCFH 3E1F1 3X3FH 1MF2L 1ZKAA 3MGAA 4AG4L 2EDYA 5ANMB 5KSUA 1KOAA 5HYJD 2WINA 1R24B 1H15B 4QOKD 3QZWB 3ZHDA 4D2NA 4HFUL 1KCRH 4PLOB 4L4VD 4ZNEE 4QO1A 3MBEA 2HVKA 1XH3B 4RGMC 5EIIA 3WNOA 3QNYB 5DQ9B 1CDGA 4ZS6D 3HI1A 3ZDZE 1IGCL 4AK1A 1Z0MA 4LK4A 4PPTA 5CD3A 4HXAH 5DUML 3ULUF 3LQZA 1AXSA 1RUPL 3KYMA 2IBZX 1EJOH 4XNQB 1A64A 5INCB 3QPXL 5BVPL 3QDJD 5L2KD 3HG1A 1JZ3A 4ELME 5IB4A 3R4DA 2VYRE 3AS3A 1YC8A 2WAHA 5DJYB 1HZHL 2OJEB 2X4QA 3OXRA 2PCPA 1GXEA 1GIGL 1WZLA 3VFWA 4KI1A 1I9IL 2XT1B 1HXYB 5GGQL 1FBIL 3MMEB 3S4SG 3BIBX 5GISH 4D9QE 1A1OB 5I76B 3JTTB 4OCYL 3RPIB 4RFOH 4NDMB 3RBSA 1CQKA 3ZE0F 4WWKB 4WFFE 1U93B 3IXTA 3BD4A 4XPBL 3P77B 1D5IL 1Q9WB 3QNXB 3BGMB 4QRUB 4OZFA 1AIFA 1F42A 4M48H 4BM7A 4M1DH 2F53B 2APBA 1NH6A 4U2ZA 2CLVB 5F1OB 5I8EB 1LNUB 3HE7A 2L0DA 1KCRL 2FL5A 5LGHH 1G6VK 3AS2A 2AV1A 4U6VL 1LEKA 5DD3H 4P46B 4H0GA 3BEWA 4NKIH 3LKPA 4MA1B 4LCCA 1J1PH 5F3HB 4HZAA 3WL9B 1FNEB 3T3ME 3BZFA 3FO9B 4QNPE 3O8XC 3GHBL 4P2RA 1KNOA 3HPLB 1SJVA 5FO7A 5D7LE 4PLJD 1VGEL 5A2JH 1WCBB 5HHQA 1I4FA 3VMPA 5DD5H 2HLAB 1PEZA 1IEBB 4KVCH 1QFUL 1JRHH 1RJCA 5JXEA 5DD0H 4D9LH 1E28B 4OGAC 4JM2D 4DGVL 3O6FC 3QIWA 1OQXA 2Z91B 5IWLA 4YHPB 4ZO7A 1P9MC 4MNHB 2BNRA 1MRDH 3TN0A 4XNZB 5JA8B 2P44B 3IT8D 4HGMA 3IDMB 4LLAA 3S3PA 3RX7A 5HI4C 2LQRA 2V5RA 1T5WB 3HE6D 5E9DB 1C12B 5F89B 1U8IA 5GXBB 5J1AA 2OTWB 4X6BB 5D6CB 3UTPD 2XQYG 2FEEL 5CLTA 1HOCA 3LKOA 2PTVA 2XPGA 4ZD3L 5HGAB 2AQ1A 5K9KB 5CD3B 1AHWA 3O6LL 3EJYD 2DQJL 3QYCA 1YY9D 4F57H 3C60B 1WQVT 3QHFH 3DNKA 1BD2A 4TULH 2NX5D 4Q2ZA 3SDCA 1HHJB 4X8XA 3MV8B 1RUML 2E27L 2FJGA 2HT4D 4YDIL 5JLZB 4MAYA 5GRVL 4L3CB 1NMCC 3PL6A 3MJ8B 2Z91A 5GRJH 3ZKMD 4RZCA 3GBLA 5AWNH 1GSMA 2K7QA 3B2VH 5F8RC 5C0CD 4RDQF 2EO1A 1G6RH 1MREL 2ICEB 5LQBH 2FLRT 1U8QA 4M48L 1TITA 4PLKC 4PLNC 4UI2A 4OIAA 3WDJA 4U7KA 3T0EE 3VWKB 3OZ9L 4UNUA 1IAOA 1DUYB 1MIML 4HIHA 2X09A 1XGPA 1AO7B 1NSNL 3S35L 2Y36H 3WJLA 5I1JL 4WI3A 5DRZB 2AEIT 2BHZA 1FVCA 2Z92B 4ZSOA 2BOBA 1HEZB 1A3LH 1MCNA 3CFJA 2VABA 3FB7B 4FFVC 4L8BB 3HE6C 2NY4C 4KMTL 1RZKH 2CIIA 1JPTL 2CDEA 5J6GA 2FEDC 5AZEH 3H9SE 4M8VA 4XGZA 5EZIL 5I1EL 3DMMD 4PUBH 5GS3A 1FDLH 1BZ7B 1MRFH 1UVQA 4PB0L 1KV3A 4ZAKC 4P3CH 1DBBL 5DK3A 4QRPE 3WIHA 3D5OF 1AJ7L 1BIIA 2IG2H 2QQNL 3U9PL 3PNWA 1WBXA 4QHLA 5KOMC 1PBYA 4U6TA 4OCMC 4XT1C 5FM4A 5KW9H 2GUOB 3QEHB 4P9ML 4YHPA 5HD8D 1HDMB 2D3VA 3UTSE 3L7FA 1H8SA 2J5LB 1T1YB 3WHE1 1ZA6B 4OQ1A 1MSPA 1NCBH 3AM8A 1IQWL 3LEVL 4NQEE 2HFFA 5DDHB 3T4AB 3V5DB 4XCFL 3KJ4B 2V2WB 1MAMH 3HZVA 4N0CD 1IM3A 1OAZL 4P4KB 2A6KB 2ZG1A 4NZUL 4PBXA 3RBGA 2HT2D 4WU5B 1CK0L 1RUAH 3BIKB 1YEEL 3NA9L 3QIBA 4GRMB 3ULVF 3DMMC 3OKMA 2FHCA 5CJOH 2VXQH 1EV2E 3MQIA 2Q20A 1YY9C 3C8KB 1N5AB 5C2BL 1AD0A 2VDNH 1UKSA 5D1QA 1RU9H 1QSZA 2GT9A 1RUPH 2PW1A 2ZKHL 1UCBH 5HVFB 5DWUH 1PZ5A 4R26L 2QQQA 3V6ZB 5TE4L 3L3JA 5EU5A 1SQ2N 1OAXL 2AJYL 3IJHB 3CLEH 4FZEH 5I8CA 1TZGL 1QRND 1XF4B 2B7DT 5BRZD 1U91A 4DEPC 2AXFA 5DJDA 1JPSL 3ARDA 1XFPA 3RWJB 1TVDA 4YHOL 3EIFA 3PQYD 2XV6B 1T2QH 3PABB 2BHYA 2F8VA 4G8FA 3IGAA 1PLGH 2AEPH 1EEUA 3FTGB 5JUEL 3EZJB 3T65A 2C3VA 2XZAH 2DIAA 4LPYA 4TUJA 4XPAL 1DFBH 4BK5A 2UZYB 5JZ7D 4BSVA 3GKWH 1EAPB 4LVOC 1Q1JH 5C0AE 3W2DL 3BX7C 5ID1A 4RISL 3MV8E 3VFOA 4J1UA 4LNRB 3VFRB 4U7SA 5J7CC 4NYLA 4GKNB 1G7IB 2DL9A 3MNZA 3T0BA 5IIEB 2YEZB 4U1HB 4ESKA 2OL3H 5C08E 4U1SB 4J3SA 2IEPA 4MQ7A 1PZ5B 2R0ZH 1CL7H 5T3ZD 4WO4D 3VGDA 2CDEB 4MNGA 5CGMA 2BRQA 5JQHC 2J3SA 5C70A 2CXKA 3LB6C 4M62H 3AVEA 1L7IH 3SKOB 4DKFH 1M7DA 3MV11 4G7VH 4E0RB 1MFNA 2YD4A 4U6HA 3QSKB 1MFDL 3GSXB 1VDGA 5D1QC 2HVJB 5E00B 2DKMA 4Z78A 3S97C 1KCSL 2E9IA 3TH3T 5KOVC 1M71B 1U8MB 4MA7L 3MRBA 2QHRL 3EFFA 3MLXL 3VXTB 3ULVL 1T5XB 3IAGC 3MRFB 2CRMA 4PGDB 1JF1B 2FD6L 3TH4T 2XQYK 2Y25A 3O11A 4XWGL 5DDHA 5HDQL 5D7JD 4LMQE 1I3RA 4UIMA 1CLZH 4ETQA 3GMOA 1G1YA 4Z7UB 3GIZL 4POYA 5C6PB 1H3PL 1TLKA 1A8JH 2D0GA 4QRRB 3W9DA 2Z8RA 1N4XH 4DCQB 4F33A 1GZQB 4HDIB 3SDXA 3LKSA 2BRRH 4R96B 5ITFB 2IBZY 5JPMB 5MHSD 4LKCB 2FYYA 2RGSA 3FRUB 3SQBA 4JPVH 1ZE3C 5F9OL 4HKBA 2DI8A 2OZ4L 2F58L 4JY6A 3RAJH 3P0GB 2GEEA 5HI4D 3VWJD 4XGZB 4JEGB 3BMWA 5F88B 3MRHA 3TT3H 4ZUTB 4H8WC 5F7MC 3MFGB 3IXAA 3OKDB 1FZJA 3CVHL 3ARBA 1IILE 4NWTL 3AY4A 1R3KB 3DYOA 4K7PL 5CD5C 3Q6FB 4P9HL 2EDBA 1UZ6F 2Z9TA 5T5FH 3TEUA 3MNWA 5D1XA 4ZUUA 4H0HB 1OARH 4HK3N 3ET9F 1XF1A 3MLZL 1MFDH 1QEWA 3AU1B 1M7IB 3MRKB 2HFEB 4ZFGL 3ARDB 3D85A 1B2WL 4NGHL 1W8OA 2DRUA 5CBEB 4N90D 3AREC 3WXWH 4S1RH 4I0PC 2OSLB 4PTUA 4F15C 4Q9CA 4GW4B 2C3HA 2BY1A 1MFAL 5E6IB 4OM1H 1OAKH 1PGRB 1X5ZA 2GK0B 4NNYA 4PS4H 1U41A 5ELIA 5ICXB 3TWCH 3MO1A 4FTVE 5L0QB 1OAQL 5ACZB 4BZ1H 4AIOA 2G9HA 1U92A 2ZUSA 4M5YH 5EOCJ 3QFJA 4NQSA 1DJSA 4XC3L 2XN9A 2HMID 3GBML 5C92A 3WNMA 1GGCL 1AD0B 5BS0B 5L2KB 3UTTD 2P5WA 3IKCB 5JMRA 1T7XA 1EHXA 3BGFB 4Z76B 5F7YC 4F7TB 1XT5A 1BGXL 4ODHH 5JORA 1HWHB 4ZFOA 1XF3B 1EHAA 3TNMB 5L8LB 3I02B 3EYUL 2IADA 3WE6B 3MODH 3HUJE 4Y16A 3AGVA 3NIDE 2X4PB 4Z0BL 3HZVB 4P4KA 3LEXB 4QHKI 1FC1A 4JHAL 2CLZB 3O2VL 2HFFB 4LCIH 4V2CB 1PYWA 1P84K 3IXTB 3VFTA 4BFBD 3E0GA 5FGRA 1DUZA 1AGFA 1BWWA 1M7IA 1NFKA 4Q7DA 3S37H 5I16B 1VKXB 5FA4B 5IBLC 4DZ8A 4R26H 1HH9A 1WBYB 3FQXB 3L1OL 5IB5B 4MJ5B 2EO9A 3JTSB 3CFIC 4HWBH 3IFPA 4N0RA 3WSQL 3KPOB 4LSUL 4D0CA 3RVTD 2XFXA 4F58L 2VXQL 3O2VH 3G6DH 4WNQB 3MOBH 3RWFB 1Q9OA 1FH5H 1VGKA 2HH0L 4JB9H 5C9JB 3BZFB 3PF2A 1T1WA 2P8MA 1ZWIA 1AXSB 1YEEH 3KYMB 1LO3L 3D6GA 4HF5L 3ZL4L 4F7TA 2EDLA 3FRUA 4WHCA 1ZGLA 3BEVB 3QI9A 4K7PH 4YO0A 1AGBB 2DLGA 5C07A 5JW5A 5IMKA 4EEEA 1N6QH 4XP9L 4NWTH 3X11B 3RZCD 1TNMA 2D31B 1WK0A 4NRXB 1RURL 4QHKJ 4HS3A 5SX5H 1T1ZA 3WXVL 1TCMA 4X6FB 3CDGB 4YHZH 1CFQB 5IB3B 1A9BA 3PWUA 4JGMA 1Q8MA 2PKDA 2X89D 4G43A 2GJZB 3MV9A 1NCDL 3TFKC 3EO1A 4MA3B 4P2QD 1N0LA 4IHOB 5IOPB 1GOGA 1H8NA 4IDJH 2HFEA 3RTQC 4X0KA 4PJ7E 3EYVB 3L3DB 4K3EH 5KSVA 4XP4H 2WIMA 5H37H 3LN4A 5E24E 4ZUVA 2PN5A 1FYTB 4LL9A 2ZCLH 2OXGA 3EUUA 4Y5YC 1FIGL 3P0VL 5MEOA 2XTJD 1X4YA 3FT4B 3OKNA 4G8IB 5ABDE 1LEKB 2FCBA 4G9FB 5C2UB 5IB2A 4JKLA 3C60D 2IFGA 3HMXH 4NKOA 3KPQA 3WFEH 1N26A 4N0YL 2Q1EA 2FSEA 3OX8B 3P0VH 4JZOB 1W72L 3QUZA 5KSAA 4ZSOE 3NFNA 2ADFH 2B2XL 4G7VL 5DFVD 4U1NB 4RWYH 3M1BB 5D5MF 4O2EB 1D5BA 3GHEL 5C0CB 1JWMA 5IMLA 5DHYA 4QHUB 2C1OB 1A4KA 3JV4B 5DJ6A 2AERT 1A3QA 4K23H 4MQXD 2C3VB 4QRRA 1DLHB 4UT6L 3VWKD 5I16A 1VKXA 2H9GA 4R0LB 3GHEH 1GOHA 5ECJE 3EYOA 3FT2B 3L3KB 4M7JL 1PG7H 5DRXB 3ETBF 3RWIB 2VH5H 1JPST 4PD4K 5K9QG 4GBXB 4S10A 3IS1X 4XNQA 3OG6B 4I4WA 4NHCH 3ZL4H 3TZVB 2FWOB 4PJ9B 1BECA 3LHPH 2P5EE 5EU4B 4JO2L 3MCKA 4O2CA 2GY5A 3LKNB 4X6DF 4P46A 5C0JB 4RQQA 5DO2D 3C6LB 4U6YB 1F6FB 2W92A 4ENEC 1JI1A 5B8CA 4ORGB 4PGCB 1KB5L 4NNXA 2PYEE 4K7PX 4KGLA 2ICWA 1IGFH 3RVWC 1TCRB 5DVKA 2P8LB 2WSKA 3SDYL 2QQKL 2D03H 3ARYA 4HBQA 4EXPX 1RZFH 3VFPB 3QXAB 5ESVB 4MB4A 1NCDH 4XBGB 2VDNL 5DEFA 5C0BB 5D6DA 3RZCC 5E08L 3OAYH 1I9JH 2EXWD 1QFOA 3V9FA 4L3AA 4GG6B 3VXSB 3R06A 3SDDB 3O3UN 1MCDA 1CE6B 1G7JA 4Y2DB 1Z5LA 3IFLH 1A6WL 4AL8H 3QZWG 4G8FB 1V7NH 1YUHB 1MLBB 2GK2A 4EUPH 3GJEA 4LCCC 1KF9B 4QRPB 3NCJH 4F7CA 5F44A 3RVVD 1TZHB 4NM4H 2CK2A 1SYSA 4MAUL 2W0LA 2XZQH 1SY6L 4XCYB 1RHHA 1BQUA 1CZ8H 3C60C 1LO4H 4S1DC 3OB0K 4LSPL 4NZTH 4OI7A 1JGUH 1YNKL 3KPQB 3GRWA 1KIUA 3GMQA 1QP1A 5C0GB 2X9WA 2FB4H 2XA8H 3MC0A 1RFDH 4HS6A 5IT2H 4Y4HD 3RY6A 3VMNA 5I1DA 5BJTB 2PTUA 4KHXH 3CX5K 4MA8L 3WFDH 1CLOL 3BKJH 3TN0C 2VSCA 4OCYH 5SV3A 3WIFB 1NANI 1OVZA 1UH2A 3VWKC 3T0EC 4XMPL 3PQYB 3PABA 4JFFA 1KSRA 3TJHD 4R90H 4JFYB 3HR6A 5CEZD 2V5MA 3FB8A 5E2WH 3LQAL 3QH3B 5HVGB 2V2WA 3LEYH 4G8GD 3K4DA 4AH2B 4OZIA 3KXFA 4YE4H 1H5BC 1V8HA 5DUBA 4FQQA 4WIQA 5KVDL 3JVGC 1RZIB 3EYOB 4ONGL 2ED9A 3BWAA 5FYKH 3PGDA 4Q74A 4O00A 5EU6B 4GAJH 4LHUG 3MFFA 1XCTA 2OL3A 1HXMB 3FRPA 5DUMH 3AROA 5DEGB 1HKFA 5L7XL 3SY0B 2I5YH 1I3VA 4P5TB 5HI3D 5C9KA 3GBMH 4UQ2B 4FQXD 5JOFA 2XXMB 4HBCL 4GFTB 2QSCH 2X1PA 1TPXC 4JQVA 1IGTA 4H1LG 5C07B 2YD7A 4RBPK 1A21A 4QY8A 1C5BH 4KTEH 5FYKD 5DQJA 4UV4H 5JXAL 4N68A 3GK8L 5CZXD 5KZCB 1MHHB 4OM0L 5CUSL 1T83A 4RGND 4OAWA 2ZCHL 5GS2D 4GRWE 3V4PL 4KY1L 1XF5B 3RGVC 3C09B 4U4BA 5D2NB 3GI9H 3AAZA 1FNSL 3H42H 4CU6A 3FQRB 5IBUB 1QA9B 1PEWA 2QTEA 3EGSA 3S34L 2ZOKA 1U8HB 1U8LB 5HPMA 4Q6YA 2BNRB 4HC1A 3MLXH 3ULVH 4UT7L 3BXNB 4QWWD 5EBWA 4R4FH 3MJ9H 5DJ0B 2IANE 4I9WD 1OTUC 1B0RB 2YK1L 1OY3B 1T4KA 1N59A 4N0UE 4O2FB 3QA3B 4WI4A 2NXYD 2DLFL 3Q0HA 4OQTH 3UJIH 1AHWC 1MCWM 2FSEB 1AD9B 2FR4A 1QNZL 3WBDA 2EDJA 4YQXL 4JM2F 5CZXC 4IRZH 4ZFFA 5IB2B 1X7QB 1SJHB 3EYQD 5TQ2H 4FP8L 4KVCL 1LEGA 3SDCB 1Q0YL 5EU4A 4ZQKA 5KN5A 1GGUA 1FZKA 1JI2A 1ZGLP 5D2LE 5BV7C 1JJUA 4X98A 4L8DA 4I18C 1EEYA 2YOCA 1FO0H 2A0LC 5IVXA 4YDLC 3ILQC 1DBKH 2RCSH 4OLVL 3QUXA 5FO9A 1BX2A 6CGTA 5I71C 3H42L 4L1DA 4OZFB 1H0DA 4LARL 1OD7A 3VU2A 2OSLA 2B0SH 1U8QB 4MA7H 1AQKH 4PTUB 1BREA 4PRPD 5DMJB 1LO2H 5DVLA 1II4E 5JW3H 3WDIA 2HKHL 3VXQA 3JWDH 3FB6A 1RUQL 1PKQA 1QSFA 4B7LA 5JXEC 4WEBL 3BH8A 3F7RA 3SKNA 4F8TA 3BDYH 1JFQL 3QFJD 3EJJX 3MRIA 4I2XB 3H9ZA 4L9LC 4ELMB 5ITBL 1INEL 3JV6A 5GZND 4L4VA 1RK1B 5DMKA 4JY5H 3QP3A 1NAMB 3G08B 2EICA 4YHML 3HPLA 4X6CB 1A7RH 4WRLA 3MPCA 5F7HA 2JB6B 2P43B 3UTQB 4J7RA 4TVPH 3QEQE 4DGIH 1HIML 1QBLH 3QFDA 5IVXB 1WV7T 4RISH 2DYPD 1HQ4B 4Z7VE 1JNHB 1Q1JL 4RFNB 2J4WH 3RDTB 4IMKA 4F37K 5EC2B 1CDBA 1DVFD 1SYVA 1IRAY 4JKWA 3VGGA 3N9GL 2GITA 4PJGA 1T20A 5T1KB 3EO0A 4F9LC 2CSPA 1U95B 4BK4A 1QVOA 3P4NB 3WJJA 5FA3B 4D3CH 3OKKA 2RQ8A 3AS1A 1FO0B 3ZYOA 4POZD 1D5XA 4FMKA 1S9YB 43CAA 1JYNA 1Y6KR 3O3DB 4PJEE 5GGSA 1VPOH 3I85A 2KBGA 3OBAA 2VC2L 5F21B 4X5WA 5IT2L 4EXKA 3Q5OA 5EG6C 1IC4H 3ZE1F 1C5BL 4KTEL 4P2OA 2ADIB 2D7TL 3CLEL 4K7FA 1Q9WA 1PG7X 4DGYL 5JQ6H 1A7QH 1EBAA 4HK0A 1ONQB 5GGSB 1BFTA 4K9EC 5HGHB 2NY3B 2EZ0C 4GUPB 1FL3B 4MQTB 1ZLUK 2D0FA 2J88H 3GUTB 4TUKL 3F7VA 4Y4FC 3IDIB 1MHCA 1SY6H 5C2BH 3KR3L 1OGTB 4Q2ZB 5DVOA 5TFSH 1AGBA 2A77H 1I9IH 4Y7MA 1I1AA 2WLYA 4KI5E 3SCMB 2WBJB 4NQSB 4TPRL 1HCFX 3INUH 3OMZA 4YE4L 3GSQA 3PWPA 2X4NB 3GMQB 1KLUB 4JANB 4M1GH 4L8SC 1UM4H 4JY6B 5AUMB 1IGIL 4TQEH 3ARDC 4KHTH 1H3WM 1CXFA 2FJFA 3MGTB 1GAFL 4EI6B 1NCBL 2Q8AH 3IJSB 4LLWA 1OSZA 5ESAA 3SKJH 2Y5EA 2I9TB 1A6UH 3ILPA 4ELMF 3MGOA 3KWWB 3GMLB 3PP3K 3N1GC 1UB6B 4TUOA 3ZT5A 2APVA 4W81A 1KN2H 4WEBH 2MCPL 2VC2H 1MOEA 4JDTH 5CP3A 3KYNA 3VDBA 4HKZA 2Y06L 3D3VA 2VLJD 3MRQB 3QQ9D 4YHKH 5T3XH 1KJ2A 1P69B 4WTZA 3DROA 4Y5VB 2PETA 3TLRA 2JIXA 4PJGF 5C0DB 3V8OA 3QXWA 4MJIE 1VFAB 4G9FD 4F57L 4FFWD 4JFEE 5F9DC 1TJIH 2AK4A 2UYLB 2R2EA 4PGCA 4XVUC 2KUTA 4L9LB 4I0KA 4M8QB 4E0RA 1DQQB 2I24N 3RA7L 5BJTA 5L2KA 5FDWB 3B5GA 4PJ9C 4V2BA 1IBGH 3OXSA 3FO1A 3TFKD 4G6AC 4M8QA 4EDWL 4C55A 4ZFFB 5FYLE 3X12A 1LP9E 1YECH 5FCSH 4B7IA 3CZFA 5F7UA 2W60B 3MRNA 1QSED 5KSUB 3W81A 1FQ9C 2VZVA 2AXJA 2VOTA 5E1AB 5HI5D 5L8JB 1S9KC 2C3XA 4QRUA 4R4BA 3O11B 3QDME 3ULUE 4RWYL 3L3KA 1B0RA 1XIWC 3MRFA 3EJZC 4RAUA 3B8YA 4LASL 4WJ5B 2EDRA 2HTLD 5IV2B 2F8XC 1UWXH 3LY6A 5CIPH 4Q9RL 5CEXA 2VL5A 3HE7D 1YEHH 3WNLA 1T3FB 3VFVB 2H1PL 2B4CH 2H8PB 2Z93B 1FSKC 1PG7W 3KS0J 4QHNB 5EUOE 3C6LC 3QG6B 3VFMA 1OB1A 2AP2A 1WC7A 4N8VB 4PJ9D 2GTWA 2YN5A 5TE6L 4NSKA 1T03H 3BD3A 3L3JB 4P23A 5EU5B 1KLGA 1F97A 4J6RH 4NKOB 2B1HH 4NSKB 3PWPB 3H7LA 5JXAH 4HHAA 1IC1A 1HNGA 4G9FA 4M61A 3DVNA 3P9LA 4LSVL 3TPUA 2AJVH 2YPLA 3AXLB 3G6JA 3VD7A 1KBGL 1L6XA 5L9DL 1MLCA 4L4TE 5B39A 2JJTA 5ISZB 1WZ1H 5C0BD 3AMKA 3GMMB 5I15H 3QUZC 3PHOA 5KSAC 4C4KT 3F58L 1T0PB 2HT3D 3BSZL 2UV3A 1DZBA 1P1ZA 2EDNA 3I6GA 2UZXB 3NIGF 1B6UA 4MD5B 5JW4R 1RK0A 1QHOA 3BAEL 5JW4Q 4TRPL 5GHWL 3BWUC 3BJ91 3O3AB 3BP5A 4NO2A 4AM0A 3PWJB 3PE9A 5KVFH 3INUL 3PXHA 4MHHI 2X10A 2R2BA 3VH8A 4JREC 4LFHD 2AI0L 3KYAA 3OAYK 3RGHA 2CKBA 3QJFB 1AR2A 2HJLB 2K3TA 3TM6A 1NC4D 4NRYA 2FDBP 5DT1H 2Y72A 1YQ2A 5K9KA 4Y16C 5HYIA 4IS6A 5CIPA 4OZ4A 4YDJB 1KLUA 1HE7A 1T7ZA 3RUGB 4K94H 4WUUB 4HBCH 2FX8H 4GKOA 3DX7A 4XRCB 1JV5A 3VJ6B 4Z0BH 3SJVB 1GC1L 1F13A 1ACYH 1VSCA 4MS8C 5K9OA 3WHE0 1QYGH 3WLWC 4XCNB 2EE2A 4HUXA 4D3CL 1ADQH 2Q8BH 1T1YA 2DM2A 4GS7C 3G5ZA 1G7JB 1HH9B 1WBYA 2GUOA 2LVCA 2PYEB 1DQML 3FQXA 4TUOB 4UTAL 2WZPD 2ZUQB 3VXSA 5E2WL 1MHEB 3SBWA 3VXQB 4WJ5A 2JJTC 1I75A 2OQJB 5C0BA 5D7IB 5DD1L 4MMZC 4JPKL 4LAQL 4Z7NF 4UOW1 2JIXD 3ROOA 3FOLA 1S7SB 4XP1L 3MRMB 3QDAA 4CMHC 3PDGA 2ZUVA 1ZANL 1UZ6E 2GFBB 1NCCL 1FE8L 1RZFL 2HLFC 5EOQL 5I8OL 4OV6F 1IGJB 5A16A 3JWNC 2JELL 3VXRA 2WQ8A 5F9AC 2GITB 3E6FB 3X11A 2OM5A 1UKTA 5JW5B 1ERNA 4HKXB 4GXVH 1CFTB 12E8L 3BT2L 3CU1A 2GTZA 2H3NB 2V7NB 2PXYA 1P7QD 3A6BL 3W11C 1BZ9B 3LHPL 2AJ3B 2BVQB 1K85A 5E6IC 2HT3C 1X5HA 1IE5A 2PR4L 3V0VB 3RWGA 1QSEA 3EKCA 4G7YH 4PJFA 3Q6GL 2BNRD 5I75C 4WHYH 1SM3H 4P57B 5IK3A 4KPHL 1QR4A 3CMOH 5HDLA 5GJSL 1FYHB 3MLPA 5J1SC 25C8L 2HJKA 1WUNT 1OTSD 1IARB 4NUJB 3H0TA 4XNYL 1KCUL 4NN6B 1IKNA 1J8KA 4UDTA 4HJJH 3UCRA 3OKYA 4WFHD 3NA4A 1T21B 4OLZL 2P45B 1MFAH 4JFEB 1WCQA 3SE3A 1JNHA 3RDTA 2J2ZA 4Z7WA 3O6MH 5GGTL 2IAMB 2V17H 5DYOB 4EUPB 1R0AL 3HG1B 1UVQB 3P40A 3SDCD 3HE7C 4PV8B 3BP4A 3MLSL 5F88A 4CNIB 1IAIH 4ONFH 3RWFA 5JORB 5C6WH 3QIUC 3O45B 3BQUD 4M3KB 5HYQA 2C5DC 1OP3K 2HP4A 1G7MB 2FNBA 4M02A 15C8H 2VKXA 3GMRA 5EZLA 3SO3B 1Y18B 1KB5A 1MIEL 5T33L 5CP7A 3OKEB 1M1SA 2IPTH 2NNAB 2OTUB 5DFTA 3EOBB 1DEEA 1RULH 4QHMB 3EYSH 1T83C 2X70A 5D7SH 1G9NC 4Y8DC 2HG5A 5HGHA 1XGTA 3WNKA 3C9NA 5ANMA 4DKFL 1QFPA 2DTSA 2O5ZL 1FN4B 4U1IA 4BUGA 2ATKB 5EWIH 3UPRA 3N1QC 1LMKA 3L7EA 3SDAA 5EFIA 1G0XA 1T5XA 2WBKA 3PV7A 4O4YH 4ZS7L 4MYWB 4JAMB 3H8NA 3VGAB 1T0NA 1L7TH 4XX1E 4NWUL 2RB8A 3KLDA 3C2AH 3UDWC 4BZ2L 4L3CA 3R1GL 1IQDA 1RD6A 3LKPB 4NRXA 8FABB 2BNQE 1U42A 1SY6A 2ZJSH 1NCWL 4ZO8A 1JGLL 2R1XB 1B0GA 4OZFG 2LAAA 2JCCF 1JGVH 2C26A 2GJJA 3BESR 4YPGA 1MHHA 4UINH 1T89A 1NQBA 4XVTH 3UTZA 3S9DB 1FCCA 2GCYB 2P4AB 5IFJB 3ZO0A 2OXHA 4ELKA 1JPFB 2X4TA 4EN3D 2NZ9D 3QO1B 2EYRA 2PUQT 4ORZC 4EOWH 43C9A 4MDJB 1KG0B 1FFNB 3B6SB 1FFQA 5HVHC 1WIPA 3U9UA 1SVZA 3HC4L 2Y1VA 3G5ZB 2DLIA 3WJJC 3O2DA 1Y6MR 4ODXA 2OR7A 4KRLB 3GSRA 4ZDHB 1C8PA 3T09A 1QO3A 5IK3B 1FZOA 1UACH 4YXHH 1OQOA 1N5YL 2YS4A 4N0FB 2VQ1B 2UZIL 2CJUL 1JP5A 2OLDA 4WV1C 4OCNC 1FNGB 4XZUB 5BQ7A 1K4CB 1X6LA 1LO4L 1W0YT 3MUHL 4YFLI 4U3XA 1OL0A 2AJXH 4LEOA 5GQBA 2ARJB 4HLJA 4IS6B 3MODL 2BSSA 1CGWA 3NCEB 4Q9BA 1WAAE 1ES0A 5TGBB 5JTWA 2ZUXA 3G6JB 3N85L 1I1FA 4JRWA 3LEVH 2MHAA 3ZDXF 2P8PA 3MUY1 3U46B 1SJHA 2H2PD 1RJYA 5LGJB 4KU1A 3KGRA 3LS5L 1I9JL 2ID5A 1W0VB 4ZAKA 4M5YL 4XMKH 3ARFA 2XICA 1BQLL 5D7JC 3QJHA 3SPVB 4O51A 3DVGA 3RRQA 2C1PA 3U9PH 4EI5B 4PJXB 4J4PD 5EO1A 4JGJA 4OFYA 4KTYA 4ISVA 3FB8B 1UCBL 4XCEA 3FT2A 3VXTA 1J9CT 1EAPA 1RU9L 1NCAH 2NY6B 1LK2A 1ZT4A 2V2XA 4Y1AD 2VITB 5JA9A 4XXCA 4NJ9H 5DLML 1J12A 4IOIB 1LK2B 3T8XB 2XTJC 4OLXH 2E6QA 1AQDA 1CK0H 1T04A 4G42B 2NZIA 5IQ7L 4OI8A 4QTHA 2W65B 3R0MA 4PJEF 3UBXI 4YHIB 1BOYA 5BCAA 5DQJB 4WI7A 4QRRE 5E8DH 2AGJH 2BMKB 3DV6A 2NW2B 3NAAL 2R1XA 1Q94B 1LEIB 1S7VA 5IWLC 3NTCL 1I7TA 4NC1C 4KRMB 4NWUH 1MREH 3FL7A 4LLUA 2QQNH 5JHDB 5J12B 3MRJA 1EZVX 1QBML 3AY4C 4DWHA 1YUHA 3OJDA 4N5EC 4HFWB 3HC4H 1H15A 2VN7A 2W9LA 4ETQB 2YC1A 3B9EA 4NGHH 1FV1B 2XKNA 3DRTB 2OK0H 4KDTA 1DCLA 3RGVD 3VWKA 1WT5C 2GKIA 2MSPA 3VG9B 1YYML 4KMTH 1Z3GH 4XC1L 1CFSB 1FV1A 4TSBH 3G6JF 3IAPA 4KV5F 1MIEH 5T33H 4UINL 4ODXB 4DKAA 4W68A 4J3VA 1HYRC 1EAJA 2W0FA 1DE4A 4FNLH 4HWBA 5E5RB 4EDXB 3N1MC 2NY4D 4U6HB 4Y0GA 4MZ3A 2NX5B 1BQHG 2X44D 2BNUB 1MUJA 4RQQB 5MEND 3BSZH 3UO1L 5SX4H 1BJMA 3RVVC 4YFDB 5JR1L 3BP7A 1IJ9A 2WIIB 2YPKB 3PWPD 1ES0B 5TGBA 2BMKA 3CMGA 1MCJA 3DGGA 1FC2D 5JZ7C 3U6RB 2DJSA 3C2AL 1BOGB 1MJJA 1BZ7A 4AQOA 2VERN 4ZS7H 4ZUWB 5C09D 4HX1A 3VXUD 3U0TB 3T04D 4NQED 4NQDB 5HGGS 5A40E 1M6OB 1NL0L 4PJBF 4D9RD 2VB5A 3AS0A 5HHXL 3O0RL 1AO7D 5HYJA 4UB0H 4W6WB 2Y5TB 1RUMH 5TQ0L 5IEHB 2VDOH 3GSNH 1XGQB 1U8OA 4RMQA 3HRZA 4JM2C 5D7SL 3TN0B 4MA1C 3JTSA 1Q9LB 3D39B 5FHAH 1YEGL 1SBSL 4PG2A 3JXAA 1DLHA 4XH2B 5DJZB 3GUTA 4KJQD 2B4CL 1YZZA 5AZ2H 3ARGD 4HIHB 2AEPL 5CJ8A 4KVNL 4NQVB 3VD4A 1I9RH 5EBGA 2N1KA 5I1LB 3L3GB 4JB9L 1NFIB 3BT2H 4AY0A 3LRSA 1KTLB 3O8XB 4TNWF 4YBHA 4ZPVA 2AJSH 4ONFL 1V5JA 4YDKL 1BF8A 3PV6B 5IROA 3O9WA 1C5DB 4Z7QE 1UH3A 2FEEI 4TVSa 4PJBA 2GTZB 1AKJB 5DD6A 3TVMA 5I30H 1JBJA 4UNVA 2GT9B 1Y18A 4GOSA 2R0ZL 3MCKB 4O2CB 4U1LA 3WHXA 3QXTA 4Z8FH 4WUUD 4LVEA 5D2LF 3QDMA 5E56A 3D18A 1G7MA 4K8RC 3SO3C 1GGIH 3RWHB 1UA6H 4FQ1L 4R6UA 2A73A 4HJGB 3VXSE 4KHTL 1EFQA 1EDQA 3GI8L 3IETA 4WHDA 5GRUH 1YPZA 5HD8C 1AO7A 1FVEB 3RA7H 3T0ED 3O3BB 3S35X 5IJVB 4NNYB 3VFUA 1ONQA 5IFAL 3RHWK 3SDAB 1MFCH 4K7FB 3C08H 1PVHA 1U8PA 3TPKA 4TOYH 5CZVL 4PJCB 2F19H 3EHBC 4R0LA 4OSUH 5F7NC 3S5LG 1BQHA 4P59L 1U3JA 2RAMA 4HUWB 2BC4A 3D9AH 1XEDA 1KIQA 4NC2B 3G5YA 5F71A 5CWSA 1QLEH 4TVPD 4M1DL 3D3VE 3QUKB 5DMYA 4MJIB 4FFVD 1R3IL 3RIFK 4YFEA 1EGJL 2XPGB 1X5IA 3ARUA 4WEMB 4TN9A 5IEKB 2EIBA 5I19H 5IF0A 2BP3A 3T0VA 3GSQB 4JG1L 1B90A 4OCWH 2J8OA 3KPPB 1L4IA 3LRGA 2MKLC 3GSUB 3FONB 4FQ2H 4JLRB 4M3JA 4M7LT 5CJOL 4D9RE 1IC7H 5BO1H 1NLBH 4RMUA 2V5SA 3D0VB 3QI9C 3UJTH 1J0KA 3O41B 2ZP0T 4ZXBD 1DQMH 2ORBL 2DWDA 4OFIA 4HWUA 1MJUL 3FB6B 5BXFB 1SJEB 3WO4B 3L3DA 5KSVB 3KR3H 4JRXE 1FL5A 1IQWH 3PWPE 5C0NC 4X4YA 1ZHKA 1JYXA 5E6IA 2YPLE 1W0WA 3UJJH 2GYSA 1TTGA 4OZIB 1IGCH 1T4KB 4MD5A 5KG9A 1RZJL 1SMOA 3L9RA 2NY7L 5TDPB 5IQ9A 1KBGH 2YC1B 5EBLA 3K1KC 5CS7A 3BQUA 3LQMA 1AJ7H 1DTUA 1T1ZB 3F5WB 3T3PE 1T20B 4Z76A 1CG9B 5GS0C 4NFCA 4F7MA 5EUOA 1LEGB 4HWEL 3VI4E 4WVRA 3VG0H 1H3PH 4JZJA 4LLYA 5C0GA 3W5MA 1FAKT 3O6LH 3CVIL 4MS8D 3DUUA 4IMLB 2PTTA 4FXLA 1A3LL 5D7JB 4Z5RA 1UFUA 3H9HA 2F54A 1OM3H 5CJQH 4Y5XB 3BJLA 5ETUB 1LP9B 5DJ2A 5F6HJ 1GC1C 2HFGL 4CN1A 2FBJL 5IHUH 1C1EH 3AU1A 4QRRD 4ZOBA 4YX2H 2G75A 4OJFL 5D7LB 1U8NA 1PKQB 4IRZL 1NUDA 2EC8A 1U8HA 1WJ3A 4LLQA 3VW3H 3D85D 1U8OB 1ZT1A 2Z31C 4NZRH 3ARGA 4H8WL 1JMXA 1A6ZA 4KRPD 4YNYA 5IB1A 5L2KE 4M1CC 3WEXA 4PJDE 4MSWB 4PJBE 3U7WH 3TC9A 1A7OL 5FAAA 3DUSB 3ISWA 1DVFA 3HLAA 1U0QA 4R4FL 4OZ4B 4WUKL 3E8UH 1QSFE 3UP1A 4FHBD 4NOBA 3GZKA 3ALXA 2LAGB 2EDKA 4LSTH 2P5WB 3IKCA 4OGYH 3QG7L 2B39A 4ZD3H 3NPSB 2VWEE 3DI2B 3DX8A 5ALCL 2Q86A 4DQOL 4XP6L 1U58A 5HPOA 4Q9RH 2W9DL 3S4SB 3TCLA 4Y4KC 5F6HI 3ZTJG 1T2QL 1J18A 3BUYA 4A6YA 5H94A 1ED3A 5C6TH 3U4EA 1I3RB 2EXWC 4LDOB 4KZEL 4BFIA 1KJ2B 5DUBB 2HRLA 2YWZA 3EOAA 5I9QB 5IG7A 5GGRY 4P0DA 3CU7A 4JFHD 4I0CC 1U93A 4K07A 5E7BA 1WIUA 3GSRB 2M8XA 3VXMD 3CH1B 4BSVB 4WHTA 5DWUL 3VXNB 1ZA6A 4JHWH 4TUJB 3RU8H 3HR5B 1UJ3A 1KT2A 2DQIL 2Z8WC 3DSFL 3TBSA 4URTB 4YHNB 1A4JB 5IHUL 3DETC 1BVZA 3SDDA 5JHLL 4GAJL 5GS1B 5GPRA 5J9PB 3JWOL 3UAJC 2R4SH 4UV7L 2R8SL 3D1MC 2IQAA 4UT7H 1HHHA 4UILH 2GSIA 2KZWA 4N0CC 4I48A 2XG4A 3OKDA 1IAII 1G1CA 3DV6B 4X5LA 4MNGB 4ZUTA 4C57C 3ZYZA 2FX9L 4TPRH 3OX8A 3DYMA 4P23B 4M03A 2MKWA 2VXTH 4YHIA 4YPGB 2CKNA 5DD3L 3TNNB 1CU4H 5CUSH 5E8EB 2WUBL 4KFZC 4ODBD 2FIKB 3KPLA 5LGHL 4OB5L 3NIFE 4WW2F 2H2SC 2CLRB 3Q1SL 2O61A 4HH9A 1ZSDB 2QHLA 3GM8A 5D93B 2Z0BA 3O3EA 1VADA 4DKDC 2VZSA 1XGPB 4DVRL 5TE7L 5HXMA 3CH1A 3NBNA 4PJGE 3QIUB 3MXWH 4HC1L 5F9WB 4AH2A 3W39A 5CILH 4N8VG 1DBJH 3UZVB 3UPAA 1FFRA 3QIUA 3DPBA 3BZ4B 5IFHH 1MI5D 2VLLA 1EHNA 2IMMA 5T3XD 2XYCA 3RWCB 4PJDB 1QR1B 3MLWL 4L3EB 5TDNA 3UTTA 5D93C 4XNMA 5F9JB 4IBLT 4TSAH 1OGAE 3U0PB 4QRQA 2H32A 1ZHNB 2YPLB 3BRDA 4XMPH 2DTMH 1UM5H 1S78C 1S7VB 4RA0C 4OZIE 4OT1L 3DURA 5I1JH 5C0AD 1JK8A 5FM5O 3CSYA 2NTFB 5C0EA 1XF2A 3PHQB 4JY5L 4QT5A 1ND0A 2NTSP 5E70A 3EAKA 3SE4A 4N9GB 1GGBH 1B4JH 3FQUA 3O4OB 4X7CC 5FIEA 3OR6A 4OLYL 1IZJA 4K2UH 4G5ZH 1VFBA 2CDFA 3GSNB 3QQ4A 4TYUA 3U36B 3C6SB 3VFOB 2H6PA 3HA0A 2B1AH 1BD2E 1XIWD 5FOBA 1FYTD 1G9MC 2BOBB 4I2XA 5D2LB 5GZOC 2VDQL 5FYJU 3WDHA 5KS9E 3IDIA 5D1QD 1PKOA 4JFDA 4NUJA 4IRSD 1U8NB 3HE6A 5I1KH 1ZT4B 2V2XB 3G5VB 4G6JH 1AGEA 1UT9A 1V7NL 3QG7H 4YLQT 1Z9LA 4WFGE 1FFOA 1BBJB 1F8TL 2EDHA 1I1YA 3QCTH 1S9WA 1X5JA 4DGIL 1N3NA 2BY0A 3CFKB 3GI8H 5AUMA 3MNVB 4ZTOL 5HY9B 4QXTB 1UA6L 5D7IF 1OTSC 2QEJA 1A47A 3HUJF 4X98B 4V1DB 2A73B 1QVOB 1B0GB 4HJGA 1IAKB 2D03L 2WV3A 3EBAA 3OKEA 1NEZA 4LIQH 4ODUB 5C0JA 4HIJB 5I6XC 4I3RL 3WNNA 3GSUA 1G7PB 2PYFB 3TJHC 5HYQB 1IAKA 2F5BH 4Y4HA 1QBBA 5H35B 3KPRA 4DGVH 5GGRA 5DD0L 4D9LL 2ENSA 3D2UB 5EBMB 5FECB 1NAML 4Y88A 4KJYA 4K8RD 3D39D 3I3DA 4NNPL 4W4OA 4M9OA 4C56D 3L7EB 1CXEA 4JDVB 4NN7B 4XPHL 4KJWD 3D25A 3UPRB 2YD2A 1MCQA 4OF3A 2J6EA 4LLQB 1Y0LB 1CGUA 5KVGH 4NKIL 2HJKB 2ZOLB 2VDML 3WJLC 1J7VR 3JWOC 4HT1L 3RJQB 1ORSA 1MRCL 3FFCD 1QUNA 3NFPA 2KQNA 1NUFA 5J0BA 1Q38A 2D7PA 3C5SB 3V79C 1WBZA 5DVNA 4YZFE 1CGSL 4NO5B 1U9KA 2YA2A 3I02A 3WE6A 4X4MA 4JANA 1Q9OB 3VD9A 1HN1A 2CPCA 1UM6L 1BZ9A 1OD9A 2X4NA 4RMVA 3KJ4C 4JCMA 2ADGB 1VFUA 3LOWA 3CSYB 5F3HA 4JZJB 1W72H 2VISA 2WUCH 4BH8B 3GSOA 4GAGH 5BV7B 3T0EB 3VXSD 2IGFH 4LHQB 3B9KB 1TJHL 1G0YR 5IVZA 4DUXA 3FHQA 1FGNL 1FBIH 4NQDE 1X5KA 1N0XL 3PL6C 3DXAD 3HS0A 3DRQB 5C0CE 1XZ0B 3RVWD 4YXLH 1AC6A 5ICXA 2GJ6D 2CLVA 3RIFF 2Z8VC 2XIDA 5IOPA 4YC2B 2D4FA 2ZCLL 3MRMA 4LLVA 1XR9A 3HNSH 1QPXA 4X80H 4X5WB 5B39G 3U4BL 1FFOB 3JUZA 5ACMA 3ES6B 2EDDA 1CT8A 1QG3A 3K1DA 4YBQD 1YEKH 1MFEH 2ICWJ 3HE6B 5E9DD 4WTWA 3GMPA 4MDIB 1OAYH 4LCCB 5HYFA 1NGYA 3CCHA 1T1XB 4X99B 1KEGL 3EOTL 4U1LB 4TNVF 1YNLH 1E0OB 3RHWF 4HIJA 3T4YA 4HFUH 2E9WA 3IXAB 1AHWB 4HG4K 1VERA 1I3UA 3FO2B 1J5OH 1CFNA 1OHQA 3VFGH 4XCCL 4DTGH 1YQVH 2A6JA 3DBXB 1WEJL 1FJ1B 1H8OA 1GJIA 3VFNA 1IEAB 4RNRA 5DRNA 1IC5L 5TF0A 1R5VA 4MAYC 1NGXB 4HIIB 4JCLA 3LV3A 4F7CB 1RJLB 2VR4A 3P30H 4WWKA 4N1CA 1UJ3C 4FQ2L 2BVOA 2CJUH 4MJ5A 3D69A 3H9YA 3H0TB 1F4XH 4L3EA 4HUVB 2PYEA 4M6MH 1DE4B 3JV5A 1YYLL 3QWQB 4JFDB 4WFED 2OR8A 1K8IB 4OZHB 1NMAH 1R3JA 1GPOL 2EDQA 3X17A 3GJFB 3W9EA 4QKXB 5EOQH 4PJ8C 1V3MA 2E3VA 4DAGL 1C08A 1HSAA 3D0LB 5KZCD 3U4BH 3BDBA 3WFCL 3WFHA 3NABH 4D8PB 4RGNB 1F4AA 1JNNH 2IAMC 4KJPD 3V7AE 2DS4A 1VACB 2OP4H 5D5MA 1JCKA 3MOAH 4XNZC 4F3FA 1E4XI 2Y07L 2EEAA 4X4ZA 2F53E 4ERSH 1I9RL 4O5LL 3QNZB 4ZQKB 3WHXB 3QUZD 5KSAD 1NCUA 3SBWC 2BXYA 2XWBA 1Q94A 1LEIA 5C7XH 1TJHH 5DD6B 2NW2A 1J5OL 3IFLL 4AL8L 2R2HA 4NHUA 3T3MF 2R23A 5B38G 1NEUA 2BSTB 5C0RL 2I60L 1QQDA 4N5UA 4CW1B 5MEQA 2VR9A 4FG6C 4B53A 5I1GH 2CR3A 5HHNA 4IMKC 4HQQH 1RZIA 5TQ0H 4LVHC 3IVKB 2NLJA 2WM0A 4V1DE 5HHXH 2NXYB 4OTXH 5DRXA 1YMME 2VQ1A 1IM3B 4HKZB 4KUCD 2VZ1A 5CBAA 5KAQF 3D85B 4RCAA 2X9XA 4WW2B 1E6OL 3OSKA 3PIQB 3BDXA 1XGUA 3GJFA 4NUGH 4X9GA 3SDYH 5CLWA 5KSBE 3S36X 1IGFL 3TVMC 1X6NA 3T65B 2V5TA 1PFCA 3A67H 4ZFGH 3E6HB 3VXRD 3SKMB 3ZT7A 5BZDB 3GNMH 5CSZB 3GGWA 3SDDC 2AEWA 4IEFB 4MCYB 5EO0A 1F4YL 4IRJB 5H2BA 1FFPB 3MV9D 2C3GA 3W0WD 2IPTL 3TO4C 3DX7B 2E7HA 2V2TA 4KVNH 3U0TA 3T2NH 4JVPA 1RZGA 2PNDA 1JGVL 3KVQA 3QUYC 2QSTA 2VH5L 1G84A 4H25B 1MJJB 5K59F 1ZLWK 3PDOA 2EDXA 4OGZA 4YIQA 1FG2A 2A6DA 4XAKD 1F6AB 4R8WL 3DXAA 1JYVA 3C8DA 4MAYD 3Q3GB 2V17L 4AMKL 3KG5A 2CRZA 4K3EL 4IDJL 4UT6H 1CGSH 2CXGA 2WWMD 4K55A 4K7PY 4RX4A 5E2UL 3WMSA 4K23L 1P4BL 3K8KA 3B2UD 3G6JE 4MHHG 1RK0B 2APTA 3MRDA 5EB9A 5J56B 3QH3A 5I1GL 3QUMH 1N7ML 5E8NB 3ESUF 1YN7A 1JWSA 3IDYB 1F8TH 3BO8B 1J8HB 4LEXH 2DKUA 5D1ZD 4P5KB 1KIPB 5AEAA 1U3ZA 4DOHE 4B41A 2DYPB 4WHYG 2P8LA 5E4EB 1NC4A 2BVUA 3C5ZD 4OCRH 4OF6A 2EDFA 3VXPB 4OCSL 4X6FA 3IU3B 3FO1B 2CKBH 3C6LA 1LP9F 4U6YA 2YMXH 4I5BA 4TSBL 4MXQC 4HLZH 3EDFA 1F4YH 2HAZA 5E8EA 1XR8A 3D48R 4U1NA 4UBDC 5H8DA 1JHTA 1FNFA 4KKLD 4ZXBC 3UX9B 4LSUH 3AUVA 2E7MA 3DUUB 5CSBA 3RVXD 4K3JH 4XPTH 1KB9K 4FQHB 4NCC2 4Q6IA 4RMTA 3I6KA 4ZUSB 2A1WL 3L5HA 1E6OH 4WDIA 3LN5B 5E99L 1QBMH 3CFDA 2NR6C 2NY3D 3HN3A 1NDGB 2L7JA 4OD2B 3NTCH 4HAFA 3BQUC 4KAQH 4ZTOH 4RAVB 4MNGE 1CDJA 4XVSH 3QCTL 3OKOA 3IYLW 1BQHB 3QQ9C 4HH8A 1JYWA 4KDVA 2E7LC 4WW2A 5C7XL 4FQJL 4PG2C 5CINH 4LF3B 1TIUA 4LLDB 4K9EH 1ZLWH 5IFHL 4FTVB 2XN9E 5EN2B 1BGXH 3QFJE 4GH7B 2HTKC 4WW2C 1HHKB 3OHXA 3TIEA 3IJHA 2ZUUA 1SEQH 1FZMB 3A6BH 4P49A 2HH0H 3EOYG 2DQTL 4RZCB 3RZCA 1UQSB 3GFUA 3PWUB 4GXVL 5JXED 5C0AB 4F58H 3OKKB 1D9KD 3KPSD 2DBLL 4KROB 5H35A 2M26A 1OAXH 4MCZB 4YWGL 1EFXD 1NCAL 4MNQE 5GGUB 1I1FB 1AI1H 5EZLB 4OF7A 3E6FA 3SGEH 5DT1L 3FCTB 1B88A 3GSOB 3Q1SH 3B9KC 3V6OC 5I8OH 1DBAH 1GGTA 2E9JA 2J12B 1N64L 1DBBH 3REVA 2F54D 1BJ8A 4HUNB 4JN2A 3RWIA 4F2MA 1OLZA 4GO6B 1P7KA 1MY5A 4KGJA 5E9DA 2O26U 4KC3B 3ROOB 3LD8B 1IC5H 4R97C 3RIAF 3OGCB 5T5FL 3NFPB 1F6LL 5D1ZC 3MRKA 4U0QB 2VUOA 4P9HH 2Y4SA 1ADQL 3Q48A 5TH2B 3W82A 2BZDA 4GAYB 3V95A 4NQTA 2ESVB 3FT3B 4CVWA 2AKRB 5HVHB 4Q0XL 1I8LC 2ZJSL 4Y19B 5BOZG 3TT1H 3ALPA 4PGEA 4O02H 5IMKB 3WKML 2QLVB 2UZIH 5DR5L 4JFFD 3EOTH 1QD0A 3MGTA 4V1DD 1P6FA 2QQLH 3STLB 1HQ4A 1VFOA 1O5DT 3QFDB 2AJVL 4JFXB 3QUXB 5FO9B 1T0MA 4ZFOB 5CGTA 5SWSD 5D6DC 2NZ9C 3FO9A 4K71C 4YHLH 4PV8A 1Y6NR 1OAKL 4HPOH 1FNEA 5JPNB 4LLYB 1NGQH 3I3EA 3M8OH 4ZFOL 2X5PA 4K8RH 3BPCA 3TA3C 2EYSA 4X80L 2NR6D 2P24B 4IRSA 4GRLC 1T03L 1NPUA 2WWKO 4PJEA 1LGVA 1SJXA 2R2CA 4OUOA 1FGVL 3WN5A 3HI5L 4JAMA 1EO8L 1AGFB 1WZKA 2NXZD 1HIMH 5F7DA 3O2DL 4NO0B 1AE6H 3PDDA 1A7OH 1NAMH 2ADIA 3RX8A 1NC2B 1OAUL 2ATKA 3W39B 3QO0B 1QFHA 4LASH 2WUCL 5E0QA 2DMBA 4JHWL 2VZTA 3NCMA 4MXWL 4X6EB 5DJCA 3C5JB 3JSSA 1H9VA 1ZXQA 4UUJA 5C08A 1N8ZB 4X9HA 1EEYB 5J13C 3BDYL 4OD3H 2DQEH 3M17A 5DJAB 2W38A 4HKXA 1HHJA 2APWA 3CVHB 4PRHD 3T0EA 2CLRA 5DJYA 2DB8A 4Y4FB 2AK4D 4ODUA 4EDWH 1KGCD 3PDOB 1A6VH 4GRLB 3ORJA 3GM0A 5EIVA 3TNNA 2O5XL 2IPUG 5GJTL 3CFBA 2QSQA 3RZCB 1RSFA 4YXKH 2XWTB 5C0RH 3MRCB 1ND0B 3HFMH 1KTDA 2F53A 2DQJH 2CIKB 2QR0A 4OLVH 2PW2A 4L4TB 1DQLH 4Z77B 1SM3L 3WYRA 5B3NA 2CRYA 4NBZB 2FZ3B 2GJ6B 1T21A 5CBEA 5DJ0A 3E8UL 1T66C 2ARJQ 1QRKA 5EBWB 5J57B 3QCUH 5D4QA 5ICZA 1CICC 2VLKB 4J3WA 4XH2A 5DJZA 1M4KA 2R56L 4PJFF 1J0ZA 3CDFA 3I3BA 1T7VA 5D2LA 2PF6A 2QADD 3BP5B 3BZ4A 3OV6A 4PJHA 4AM0B 1MRDL 3OGCA 1XGUB 2FHFA 5LBSL 3WFZA 3OF6D 3RY5A 3KJ6L 1V7ML 3HPJB 2NY7H 5I1AB 3DMMA 1V3LA 3ECBB 3ARGC 4OCLC 3L6FA 4GLRH 4Y8AA 2NW3A 2FBJH 4APQA 2CUHA 3BYYA 3MJ9L 1ZTXL 1BJ1H 2MFNA 3ZDZF 2A74A 5B39B 4N5ED 3PL6D 1GHFH 4ZTPH 1N6UA 3QDMB 4LAQH 1W72A 2WWMC