1NFDB

An alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
239
structure length
239
Chain Sequence
DSGVVQSPRHIIKEKGGRSVLTCIPISGHSNVVWYQQTLGKELKFLIQHYEKVERDKGFLPSRFSVQQFDDYHSEMNMSALELEDSAMYFCASSLRWGDEQYFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYSLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (immunoreceptor/immunoglobulin)
molecule keywords N15 ALPHA-BETA T-CELL RECEPTOR
publication title Atomic structure of an alphabeta T cell receptor (TCR) heterodimer in complex with an anti-TCR fab fragment derived from a mitogenic antibody.
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 239
sequence length 239
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nfdB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nfdB02
3TYGH 4EI6A 1N64H 3RDTB 4L8SA 1JN6A 2QLVB 4KU1A 3FN0H 5DJAA 1RJLA 1PZ5B 2F53A 3ZKNC 3N1PC 3IF1B 3VGHA 3UO1L 1FRGL 5E8PA 4OGAD 5EN2A 4LAQL 1G7QA 4LSSL 4RMQA 1L7IL 5HDBE 3VGFA 3QUXC 5CEZH 5FO7B 2XTJC 2ZSWB 2QSQA 5E4EC 3W39A 1CG9A 4PUBL 5ID0A 2QADB 4K9EC 1YYMH 4JPVH 3K46A 3QCVH 5IESH 3JSSA 4J8RA 3QA3B 1OQXA 1GPOH 2VZ1A 1JWSB 1E6JL 4P2CG 3MACL 4OCMC 3FAXA 3L6FA 1KBGH 1CCZA 4G9FD 1EVTC 4R4ND 4LLYA 3CXHK 5D8JH 2R0LL 4PJ8A 3T2QA 1BMGA 1WC7A 3O2DA 3W11C 4Y2OA 5INCB 1F11A 1QD0A 3DRQA 4BQBA 3HRZA 5L2KD 2LTQB 1JUFA 3C6SA 4POYA 3PV7A 3VWJB 1DBML 2BX5A 5DJXB 4GUPB 5BS0B 1ZK9A 3VFPB 5IROA 2IH3A 5I0ZA 3QJHB 3VFRB 5I1DB 3P9LA 3RUGE 1RZ7L 5BCAA 5KSAB 5J89A 3OZ9L 4NN6C 5EUKB 2X70B 4LRNH 4A2MA 1FE8H 2ARWA 3MJ9L 2AXJA 3HAEH 4WCYL 4DAGL 1M7DA 3G9AB 3MRJA 3QR2A 4BH8A 3RX5A 1W0WA 1TZIA 1FO0A 3UJTL 2R23A 2M26A 1YEDA 3S4SG 4Z78B 2V5YA 5F7YC 4P23D 2F15A 1NBQA 2DYPB 1MVFA 1TETL 2XKUA 2D7NA 4G80A 5KVMC 1A6UH 1KCVL 1I1AA 2H6PB 2YRZA 3QEQD 1U8LA 4CADB 1GGYA 3QO1B 2JF1A 4LHUG 1CL7L 4QRPD 4HUNB 3KPSA 5EU5B 3QDME 4NO0A 5ISZD 3KLAB 1W8NA 2GTZA 3RP1A 4R3SB 1SJEB 1G7HA 1YNTB 3CVHH 4TSCL 1QLFB 2PW1A 1YNLH 3ARFC 5DS8A 4NQUA 4FQQA 1T22A 2X4QA 4AEHH 4LGSB 5C0RH 3V4PH 1J0ZA 1CLCA 3QEHA 3HZYA 5JOFA 2ATPB 1I8IA 4YPGB 2AXFB 1YEEL 5EO1A 4PJ5D 3VXOB 2OR9L 1DQMH 3PHOA 1Q9OB 5IVZB 2IADA 4F8QA 1PG7H 3WO3B 4YGVB 2VXQH 4KK5C 4OFPA 1CT8B 1XH3A 3EJZC 2HFGH 3MLSL 5E2TL 3FT2A 1NC4B 1KJ2H 4GAGH 1JHLL 3FOMB 5I76B 4JFDD 2I60L 2VR4A 3QQ3A 4DZBB 2WIMA 3E6FA 4M8QB 4KJPD 1A6TA 2X1OA 5D96B 3FT3B 3WFZA 2Q86A 5C0BD 2FWOB 3CIQA 1A7NL 3FN3A 2PYFA 5A16A 2I07B 1UXSA 5JW4M 3G6JA 3I6LD 3BDBA 1MCFA 4JM2A 2VQ1A 4L8CA 4GS7C 3QCTL 4D9RD 2M1KA 2BP3A 4GAYA 1HQ4B 1UJ3A 3JV5A 4L4VD 1JPTL 5IGXH 5HDQH 2BDNH 1N6QH 2CLZA 3VCLA 4JZNA 1A4JB 35C8H 3OJMB 3C6LB 3ZMRA 5SV3A 1AHWB 1VACA 5KANI 2PR4H 3K8MA 4FXGA 3J7HA 5BS0E 2H1PL 1SY6H 3DURB 4XNXH 1EO8H 2ADGB 2IG2H 3KWWA 1IKNA 1QFUH 2GITA 3UJIL 3SJVA 5H2BA 4NUJA 2OL3H 3D0LA 2YD8A 4D3CL 1UZ6F 4NRZB 5B3NA 1HI6B 4UI2A 5CILH 4IOFC 4LPVA 2JTDA 5FB8A 1WTLA 1JPGB 3K7UA 4YR6B 2YS4A 1QKZL 1XGQA 4L5FL 4KV5F 5KW9L 3C60B 2EEAA 4XAKE 1UJTA 4I3RH 5I6XC 1YEIL 1AR2A 1EX0A 4KFZC 4WFHE 1NDMB 3PP4L 1BZ9A 3GSNL 3SDAD 3WE6A 1FYTA 3CH1B 3THMH 2LE9A 4HUUA 3BIKB 5LGJB 4MZ2A 4K23H 2YA1A 3PXHA 4HUWB 5GRVL 1FSKB 4GRLC 2VN7A 2D3VA 1OPGH 2D7TL 2EYRB 1AR1D 3RBSA 1PG7W 5E1AB 3WLBB 4JN1L 1IC5L 4OB5H 2NMSA 5IR1A 1L0YA 5L7XH 3UTTB 4LPCA 1FIGL 3IETA 3I9GH 5DC4B 2OJZL 5AZEL 2GY7B 1P4LA 4LHQB 3H3PL 3VGEA 1F8TH 1Z3GL 4BSWB 1QUNA 4TVPH 3TO4B 3P11H 3QDJB 1B6DA 3P0VL 1MI5D 4FNLH 3TT3L 4XI5D 5CSGA 4ZMAT 1GC1L 2R2EA 5I71C 3X17A 4CDGC 2QHRH 1MFBL 1SJVA 3O3EA 3GSWA 5IMOB 2IPTH 3V0VB 2OK0H 5IW1A 3WD5L 2XNAA 3Q6FB 3DUHA 2WSKA 3FMGL 2ZCKH 3PGCB 4YBHA 3OV6A 2EEBA 5I8CA 2BVQB 1U8IB 4HHAB 1Z0MA 5B22A 2APBA 4OZFG 3MNVA 3NABH 4K3JH 5TGBB 1YUHA 4EQ3A 1MLBB 3TYGL 5LCVH 1N64L 4M7ZC 4ELMA 4F7MA 1FNFA 5J4MA 3TF7C 2X7LB 5IQ7H 3FN0L 4MJ2A 4PIRF 3VW3L 3R06A 3VXNA 1T4KA 1T0NA 1W0VB 3CSGA 1TJHH 5MERB 3EUUA 2Z92A 1OGAD 4LCWA 3RZCD 5CEZL 5FYLD 1G7PA 4PREA 3QAZC 3C8KB 1IAMA 5DK3A 3FOLB 4PP2A 4XMKH 3QUKB 2NZ9D 5F21B 1YYML 4JPVL 3D3VD 2PETA 3QCVL 3JUZA 5IESL 1GPOL 4G7VH 4BJLA 2B7DT 3EOTH 4OLVH 3H9HA 1KBGL 1XR8B 4XCNB 4NQEA 3QCUH 4J4PC 3HHRB 5D8JL 3AY4C 1CD1B 1GZPB 5K9QG 4IM8A 3QNXB 5CSBA 1N3NB 3K1DA 1G7IB 1IGTB 2VTFA 2K9UA 4PB9H 3BYYA 4R96A 1OOAA 1DDHB 1U8MB 1OP9A 2Q7YA 4FFWC 4G9FB 2DLIA 4QTHB 4LRNL 3WJLC 4JCMA 1FE8L 4RRPA 3FFCD 4LKCB 5T33H 3TZVC 1A6WH 2ICWB 3T3ME 5L2KB 3DMMA 3F5WB 4GQ9L 1FG2A 3UTTE 3VRLF 1QHOA 4NFDA 1CLYH 1RZIA 3CJJA 4XB7A 4WJ5B 1LVEA 2BNUB 5C0FB 1A6UL 1NFDF 4QEGA 1CXFA 3QDJE 4M4PA 3BN9D 4U7SA 4PBXA 1I85C 5B21A 2FECL 1DZBA 2Q6WA 5D1XA 2Z91A 1MJJA 5DMIL 1E28B 1P7QA 1SJHB 1QVOA 4IDJH 3GGWB 3CVHL 1WFNA 5IWLA 3HE6C 1YNLL 5I18H 2Z93A 4P23B 4AZ8A 3IFLH 4HGMA 4AEHL 4YK4C 1Q1JH 3EYUH 4UB0H 5C0RL 3UPAA 4XPBH 3CAFA 4HIIB 3WNOA 2JJTA 3QEQB 4Z18A 5DD6A 3ARED 1AXSB 4JFEA 4MDIB 1D5MB 5ISZB 3MCLH 1DQML 3CZJA 4PGBA 1JGEA 4I2XB 4MJ5A 5I16B 3G04B 3MROB 2D2OA 1PG7L 4HUKB 1BVLB 2VXQL 5L2JA 1P6AB 4Z7UF 2HFGL 4ZPVA 1EHLH 1AC6A 4YNYB 1Y18B 4KZDH 4DKEH 4NCC1 1I3RA 3WDHA 2V5SA 1KJ2L 2X4SB 2CMRH 4GAGL 3L95A 3NZHL 4FQXD 3QI9C 2EYSB 4S1DD 1J1XH 2VUOA 3REWA 4MCZB 4LCCC 5E6IA 3B6SB 4ZSOA 4GXUN 3KAAA 1FLRH 1MSPA 1I1CA 5F6HI 3RGHA 3RVUD 3ZKMD 3CLEH 2PYEA 4ODTH 2MCPH 5EU7E 4CMHB 5DGQA 4IRSD 3V8OA 3B9KD 3KYNB 4H20H 3L3KA 1R0AH 1BQUA 5M7QA 1NAMB 5ETUB 5HGDA 1IE5A 4HWZA 2GT9B 2DIBA 5IGXL 1GZQA 3LOWA 5HDQL 2BDNL 3OJ2C 2RHEA 1N6QL 2XFXA 1P2CA 1Q94B 35C8L 1QQDB 3O41B 4OZ4B 3QIUC 3WS3A 1C5BH 4I8DA 1V3JA 1ORSB 2PR4L 2GEEA 4YZFF 3GJFB 1SY6L 5C0BB 4XNXL 2VLLA 3GSQB 1EO8L 2IG2L 3MOQA 4I0PD 3G6AB 1QFUL 1JI1A 3L7FA 3SQOH 1HK6A 4G9FE 1F58H 2NY3C 2OL3L 2P8MA 3EO9H 2E3VA 4CW1A 4UQ2A 3WL9B 5CILL 1REIA 5L2KE 1ZA6A 5IMLA 4JM4H 4HDIA 1LP9B 3HI1A 2MKWA 4BFBD 2PW2A 4NKOB 1MCSA 3WXWH 1AP2A 2I25N 3U0PB 4I3RL 1CZ8H 4H0HB 1HHJB 2YEZA 1WBZA 1WT5A 5ERWB 4JAMA 3JWDH 2V5TA 2A83B 3X3FH 2ADIA 2GSIA 2V7NA 1S9YB 3THML 3CNKA 4K23L 4I9WE 3MCKA 1YN7A 3CCHA 5L8JB 5JIPA 1YMMB 5IJVA 4LIQE 3VH8B 1OPGL 4I18A 4LDLB 3C5SA 1HSBA 1PY9A 2VDPL 3CFKA 4ODUA 4OSUH 1JF6A 4OB5L 5I9QB 5D71H 2NTFA 5IVNA 5E5UB 2ZOKB 4ZG1A 5C2BH 1ZGLA 3JZ7A 3SDAB 1TTUA 3QEQE 3I9GL 5C0AA 3WNMA 1QO3A 3DUSA 2C5DC 3ARDB 1F8TL 3MRQA 1I7UA 4MNHA 3WN5C 4MZ3A 5DRZA 3WCYA 3WO4C 3ARBD 2VIRB 5ISZE 3OB0H 3AM8C 4TVPL 3VXPA 3P11L 1IGCH 1F90H 4S2SB 4I2XE 5GZND 1EEYA 4PG9B 4FNLL 3IDNB 4RGNC 4LU5H 5SWZA 5A2LH 1M6OB 3G08B 5T1KD 2NY1C 4PGEB 3MV8A 2GQHA 2QHRL 4PJ9B 4XCYA 3QXDB 2OK0L 3C5JB 4XH2A 4PRAA 3BD3A 1TITA 2ZCKL 5IB5B 5TE6H 2P5ED 1CXHA 4W4OC 5I17B 3NABL 3PNWB 2R0ZH 5JZ7C 1IAIH 1V3MA 2DWDB 2HJLB 3BQUA 4ZAKC 2CRYA 2IBZX 5LCVL 4QY8A 1MI5B 4P4RB 4Y5XA 3QUZA 1WUNT 4Y4KA 3MLRH 5IQ7L 4U0RB 3QZWG 3BD4A 3NIDE 3B2VH 2BMKB 1FVEB 3DX7A 3GFUA 2DL2A 3VRJB 5HYQA 1TJHL 4JY4A 5DHVB 4OZHA 3MMEA 4JJ5A 5ABDE 4H88L 1N8ZB 4MB5A 4FQ1H 5C0BE 1MFCL 3V6OC 5TPWH 4NFBA 2KDGA 3L5JA 1PLGH 1BQHG 2YUXA 4XMKL 1XGUB 1R5VB 4NO3A 2EXYD 3OKDA 2DTSA 4WUUD 5IB4A 4OUUA 4AMKH 4D9RE 4DFHA 4BUGA 3IDYC 4G7VL 4GW1B 4KKAD 3EOTL 2GJZB 4R9HA 4OLVL 1DVFA 4G42A 3GMQA 1AKJA 3V5DA 4RCAA 4YDVA 1LP9E 2J88H 1OGAB 4X6BB 3QCUL 3RZCB 4BK4A 5DF0A 1B0RB 1MHEA 1RULH 3GMPB 4IS6A 1I1YA 3GI8H 2QKIB 3C5ZC 3ZT7A 4EZMA 1CN4A 2D7MA 3MQIA 5H37G 3NPSB 1T03H 4HIEB 2X4RB 4PB9L 1BVKA 1BF2A 1RZKC 3FQUA 1YMME 5DFVD 5C0NC 3C09B 3RA7H 2VE6B 2XN9A 4JGJA 4XTRC 3P2TA 3VD9A 4JPKH 3QIWC 1U8JA 5T33L 5JQHC 3I75A 3BI9X 3ECBA 3QQ9D 4ENEC 4IIQA 4WFED 3SDCD 5FA3B 1IQWH 1HCVA 2G9HA 4JANA 4Y19D 5LAXB 2J5LB 2PNDA 1CLYL 1U8OB 1RHHA 5HI4D 3D48R 3QH3A 4JGUA 1MRCH 2HTKD 4LP5A 1WCBB 1FL5B 5BOPA 2W65B 3FFCB 3M45A 5IFHH 4K7FB 4C56D 3ZTJH 1ZT7A 4IDJL 3A6CH 2KH2B 4ZS6D 5I18L 4QRRB 4JHAH 1XIWC 4MAYA 3IFLL 4F7EB 2BVOB 1Q1JL 3EYUL 4UB0L 4WHDA 3TJHD 3FZUC 3LKRB 2AJUH 1MI5E 1I7RB 1VPOH 1OW0C 4IRZH 1CTOA 4HUVB 4MA8H 1WWAX 4OBSA 4Y2DC 5D2NB 3N85H 3M17B 4Z0XA 1T6VN 3MCLL 4LSRH 4FXKA 3V79C 5DO2D 4Z7WF 2X4NA 2K7PA 1OY3B 2DF3A 1IEHA 3MXVH 5E2UH 5FHBH 2VDNL 1BJ8A 1WIUA 3EFFB 3HPLA 4P46A 1EHLL 3GSVA 3O3AA 4KZDL 4DKEL 3HAEG 3WIIH 4PJIA 1X5XA 2CMRL 4U1SA 1L0QA 4L8DB 1KG0B 3JTTA 1QP1A 3KPPB 2EC8A 4IJ3C 3WHXB 3KNBB 1NC2A 5FDYA 1FLRL 4P2OA 3U9PH 1LEIB 2FL5A 3CLEL 4ODTL 2D7PA 5IEKB 2W0LA 2MCPL 2VR5A 3DETC 5KJRH 4M43H 5HVHC 3MJ7A 1FZMA 2C4FU 1KLGA 1TVHA 4U6YB 5F7EH 5HD8D 4H20L 1CFBA 5HHOD 4F7TA 1R0AL 1CF8L 5DMGC 5CJOH 1OGAE 2BRRH 2R2HA 5TF0A 5FYLE 1Q9KA 5F7LB 1ZV5A 3Q3GB 3ARPA 2R39A 4PJ8C 1C5BL 1WFOA 3K8KA 5BMFH 4PR5B 4EVNB 2EZ0C 5MEND 4K94H 5IMMA 3GMNA 4YAQB 3ZE2E 4HCRA 3N9GH 4PJBA 3SQOL 1JWMB 1C5DB 5EC1A 1F58L 4LHUA 3ARGD 3EO9L 3UTPD 1MCCA 3RWDA 4OZIB 4BFGA 5A3IC 3O81A 5CFHA 3IDJA 2DLGA 1QACA 4WO4A 2ADFH 4JM4L 4X0KA 3WFEH 3GMMB 3LIZH 2BOBB 2Y6SC 3DV4B 3P4OA 3BPCA 3TIEA 4P4KD 3HG1A 3WXWL 3MA9H 1CZ8L 3GJFK 1TQCB 2P7TA 5FK9A 4LIQH 4JDTH 1NGZB 2DQUH 3JWDL 3X3FL 3RX8A 3QXAB 4APQD 2WUCH 3NH7H 2W9DH 3FFCE 3GHBH 1A6ZA 5E8DH 3ROLA 1T66D 4P9MH 5J7CC 4GKSA 1PDKA 2B0SH 2E7LC 4YHPB 5I1IH 3VD7A 3RPIB 1JZ7A 5T1MB 4QRRE 3RFZC 5JUEL 1S78C 4G6KH 4S1SH 3WNKA 5D71L 5C2BL 3BUYA 2NY5L 2E8ZA 3DVNA 3LKQB 5DEFB 1WLHA 2CUMA 4OAWA 5FO8A 1URLA 4MQTB 5JPNB 2YC1B 5I74C 3WFDH 2FX7L 5D2NE 4PTUA 4Z7QF 3IAGC 1BD2B 5TQ2H 1IGCL 1F90L 2A6JB 5INDB 4PJ7B 1A14L 4UDUA 3U79A 2B39A 5DUBA 5E2WH 2C9AA 4P2QA 4RNRB 3QPXH 3NOIA 1NAMH 3EYVA 2XPGA 1RMFL 5F1NA 3ILQC 4X4XB 3QEUA 5TE6L 5DQJB 3ARBB 5FDWA 4ZFGH 2R0ZL 4WI3A 1IAIL 4FA8A 5JDSB 1U8QB 1X5YA 4BKLB 4DJMA 4QCIA 4HV8B 3GJFH 1B0WA 3AFLA 3EYFA 4LL9A 3MLRL 5C71A 3B2VL 1ZT4A 1FVDA 5T1KB 1NBZA 5IEHB 4TULL 5CJXC 3WNPA 5D2LB 5HPMB 4JEGB 1UJ3C 2P8PB 2O93L 1UM4L 3OPZH 5IK3A 1EUTA 2JCCA 2YD3A 5I75B 4TUOA 4FQ1L 3O3BA 3QG6B 5TPWL 1SMAA 3EDJA 4Q2ZB 5CGTA 1PLGL 2P8LA 4K8RC 1T3FB 3T2PA 2AXGA 3UZVB 4N5UA 1QFWL 2VXVH 1IEAB 1Q9LA 3QUXD 3P77A 4AMKL 5D7JA 5EZJB 3IDGB 1IKNC 2ID5A 4IRJA 1RJCA 1BLNB 5AZ2H 3CSPA 4OZIE 4WW2B 1A5FH 4X4ZA 2I5YH 5IB2A 1OWWA 4HAGA 4Z77B 2J88L 5HSFA 3FTGA 1L0XA 1BWWA 1RULL 2HA1A 4ONOA 2ZUWA 1KTLA 3O4OC 4YBLC 2ZNWA 4AEIH 4NO2B 4WUUB 1KJ3H 2IF7A 5ALBH 1J87A 1JRHI 1WICA 3W11D 1UXWA 3LDBB 3SKOB 4U1KA 4MCYA 3X14B 1T03L 1BWMA 2NY2C 2X89A 2V7HB 3KS0J 5TH2A 4LSQH 3S35H 3ZHDA 1LEKA 3RA7L 1VKXB 1U6AH 4NKDB 4Z95H 4ODWA 1OD7A 4JPKL 2O5ZH 2W0PA 2FX8H 1G9NH 1BQLH 2OTUB 3X11A 3S9DB 1IQWL 2VXUH 4G8EA 5DD5H 3IKCB 4IOIB 4L4JA 1MRCL 5BVPH 2ZG3A 4MXVE 1IM9D 4U3CA 1BD2E 2IALB 4PJ7E 4HH9A 3ZDZF 4LARH 3D85A 3U46B 1YJDH 4F37F 2J8UA 1CYGA 5IFHL 2FJFB 5GSVB 4RQQB 4LFHG 3A6CL 4MWFB 5JTWA 5T1LD 5DJ8B 5EA0H 3T0AA 5HGHB 1QHPA 4NNXB 4JHAL 1QZ1A 1F3JB 2MTPA 3QQ4A 5JOPD 1S5HB 2Y36H 3DTXA 5DHVH 4P99A 3LQAC 3NFPB 5DJ6B 3EIFA 1TTGA 3ARFD 3KYOA 4Z7VF 5D7IB 1OQOA 3OKOA 1BJ1H 2AJUL 1IQDB 4K2UH 3PXJA 2FBJH 1VPOL 1MH5B 3BPLB 3GIVA 4IRZL 5BV7C 1D9KA 4MA8L 4E5XA 3MNWA 3N85L 4PJEA 3TBWA 1G9MH 2VH5H 4U1IB 1UB6B 3VA2C 5F8QC 4C56B 5D2LE 1DLHB 1OB1B 5ICYB 2EDTA 4E0RB 3MXVL 3ULSB 4QHLB 4RMRA 5J13B 2J3SA 5E2UL 3AMKA 5FHBL 4HKJA 3T09A 4QRSA 4ZQKB 4JFFA 1FFOA 4PYHA 1QBLH 3EYOA 3MUGB 3WIIL 5HGBA 4KK5D 1X9QA 3EJZD 5FYLH 2NXYC 5JDJA 3O11A 3CC5B 3D87B 1I7ZB 5KJRL 2CDFB 4M43L 1FV1A 1D5XA 4H0GA 3DRTB 3MYZA 4XWOC 5CJOL 5EO9A 2BRRL 2FCBA 1FDLH 4F15C 4WI5A 3H9SD 1AI1H 3P30H 4WUUE 2G2RB 4X7SH 5BMFL 4M48H 4FFYH 2GFBB 4P5TA 1HSAB 1NGWA 4X6CF 4XNYL 3RVVD 4X7TB 3PWJB 1SVCP 1VHPA 3FONA 5HHOB 1HKLH 2DMCA 2XICA 2H2SC 1AD0B 1DSFH 1SYSB 5D7KD 4EDXB 5IFJA 1NUNB 3BJLA 1H9VA 3L3OA 1AO7A 1EJOH 4EEEA 4OBRA 3HLAA 5DRWB 1R5IB 4OKVB 5TF1H 1GYAA 3VG9C 3SDYH 1R3HB 2ADFL 3SKMB 1KIPA 3WFEL 2UV3A 1D6EB 3LIZL 4M3JA 4R0LA 1OL0A 3W9DA 5MENB 4IOFD 3OJVC 4HZAA 3DMMC 3W82A 5I2IA 2P45B 3N0PB 4HUMB 3RWGB 2P44B 1QPPA 4LIQL 4JDTL 4C57C 4JREC 1NCCH 3ROOA 4LSUH 3U1SH 4HS3B 4OZGA 1CIUA 1PEZA 3ARGB 2WUCL 2W9DL 3GHBL 3HN3A 2ICCA 4IMLA 1H3TA 4P9ML 4XXDA 2B0SL 1WBXB 3LD8C 3OF6D 2AJSH 4NQDA 3B3IB 3DBXB 5D1XC 3MUJA 4GRLD 3MJ9A 2FECI 4GSDH 4G6KL 4S1SL 1DN0A 3V7MA 1NCNA 1PX3A 3VA6A 5D7IE 4OF7A 3IB4A 4WV1B 2APTA 1HWHB 5AD0B 2V5RA 3WFDL 4CVZA 2NY0D 4JQVA 1TZHA 2JJTC 4XZUB 3O4LA 4C56E 2VSDA 5C86A 5TQ2L 1CICB 4ZUSB 2AJ3B 5HHMD 5E2WL 5C07D 5KAQG 4TYUA 5FKPB 1NAML 3TCXA 3CH8A 3MODH 3MLTA 5MEPA 1KCRH 4YHZH 1KLUA 2R2CA 5F93C 4PJDA 3ZDYE 4C83A 3STBA 1QSFB 5GS0C 3OB8A 4E42B 4FOMA 2JELH 3HNTH 4ZFGL 1JNHA 1AIFA 3ZSSA 1A2YA 3EO1B 1MJ8H 2ZUXA 4JZOA 2IFGA 3U7AA 3I6KA 3VFVB 3ZKXB 4S0TD 3VXMB 2DLTA 2BOCA 3FRUB 1F3RB 2YWZA 4QYOB 5CZVH 4HZLA 1ITBB 2H26B 2DMBA 3W0WD 5KN5A 3VFNA 1IVLA 1F4AA 5DT1H 1FQ9C 5HHPA 2WWKO 5HHOE 3T8XA 1T5WB 3IU4H 2LQRA 1T1XA 2VZUA 1JFQH 5HDBF 3FB5A 1YMHB 3JV4A 3BH9B 1KACB 4LHJB 4F3FA 5AZ2L 1A5FL 3VD4A 2BNQA 2I5YL 4PV9A 5JORA 5GRXG 2H41A 4FQLL 2IPKA 1H3WM 1MCLA 2XQYK 2GUOB 2AEIT 4ZO7A 4RZCB 3RWFA 3CPLB 3ARTA 3O3DB 1Z9SA 4J4PD 3P9MB 3NFNA 3TNNB 2IEPA 3QUXB 1KJ3L 4LKXA 5ALBL 3H0TB 2J8HA 4PBWD 2XTJB 3UTZB 5E4EB 3UTPE 2V17H 3QXWA 2J2ZA 1WT5C 4JY6A 4LSQL 4Z9KB 4PRNA 4HD9A 3PV6B 4P3WA 2I9LA 3NA4A 1WBYB 1U6AL 3KHQA 4Z95L 1CFQB 5CGYC 4XNQA 4QF1B 4ZUVB 1KT2A 3PGFH 2FX8L 2GTWA 1G9NL 1BQLL 2P43B 4HJJH 4LOUC 5C0IA 3IXAB 4I18C 2AK4A 4RGOH 4Y16A 4HIHA 5JPMB 4OJFH 4X6FA 4NWUH 2VXUL 4KWUA 4F57H 4RX4D 5DD5L 3TZVD 4KRPC 4PY7B 1RI8A 1KCSH 4YHNB 5JA9A 1HHKB 4JPWH 5BVPL 1KV3A 4X7DC 4F9LA 1XAUA 2KZ1B 4NZTH 1Y0LA 3IYLW 5F1IB 2W91A 4PJGA 4LARL 4URTB 3VG0H 1YJDL 4KXZI 4P0DA 4FTVD 4NN6B 2JIXA 5H94B 1L7TH 1T83A 5EOQH 3RKPA 3BP4B 4N0YH 4LLDA 3MUZ1 4WIQA 1QSFE 4PJAB 2Y36L 2HKFH 1BQHA 3S5LA 1ED3A 4E41A 1KIQA 4ORGB 3BZEA 4N1CA 1IGYB 4K2UL 1I8MA 4MXQD 3SO3C 2FBJL 3JWOH 2OQJB 4JFPA 3H2WA 2VITB 3STZA 5C1MB 1G9ML 1QLEH 4JRYD 2VH5L 5FIEA 3VXME 1J18A 4LCYB 4PJFA 4Y4KC 3UTSA 5T5NF 1D5ZA 2BK8A 4BH7B 3LKNA 1KIUA 1ODAA 5T1LB 2VLRB 4UV7H 2E7CA 1Z6JT 4JKMA 2WP3T 5GGSY 1UH2A 2ILLA 4YHYC 3WUWA 1QBLL 2YN5A 3KS0H 4PY8J 1S9WA 2BY3A 4UILH 3ARFB 1XGRA 1UG9A 5FYLL 1MHHB 4GG6F 2QJDA 2FO4B 3MV9D 2VQTA 4XWGH 5CHNA 5ITFB 5M95B 3MRLB 2X6MA 4ZFZA 5T3ZD 3QI9D 3IGAA 4KUZH 5E03A 2WZPD 4NOBA 5LG1A 3ULVF 2H32A 4LPUA 2VUYA 5D93C 5EU6D 3WEXB 3IDMA 1W2KT 1DVFC 1FDLL 2E5EA 2IBBA 2HJFA 3T1WA 3B43A 15C8H 1S7VB 1AI1L 4PGDB 3ZTJG 3BO8B 5GRYA 5E7BA 1NLBH 3P30L 4G8IB 1U8HA 3HZVB 4JG0L 4X7SL 5F88A 4KRLB 4FFYL 2XTJE 4HWNA 1IILE 1KGCE 4D0CA 3QIUD 2EDEA 5DYOB 1CIDA 3OKNA 3BFOA 1HKLL 1MCHA 1OLZA 4L3EA 4PJCB 1KTDA 1DSFL 3BXNB 1N5YH 4UQ3B 3H9SB 5TF1L 1E4XH 4XPTL 1X7QA 2NY3D 3SDYL 1ULVA 1CGVA 1J11A 4NPYB 4PLJC 3K80A 4NZDA 3QHTC 3O6FC 3L9RA 2Z8SA 3MRKB 4KK8D 5J6HB 4GKZB 3KPQB 4IIQC 4ZOAA 1T04A 5D9SB 1CXKA 2I9TB 1NCCL 1I8LA 2EE3A 1ZHNA 4LSUL 3U1SL 1U8NB 3ARXA 3V7AE 3S3JA 2DIJA 4IMKA 5JW4N 5KAQF 4N8CH 3LSOA 5HY9B 2FDBP 5JXEA 2HT2C 2FR4B 2AJSL 4POZC 4X6EA 5FGCB 5SX4I 5AYQA 3ALPA 1C8PA 3NFSH 1QR4A 3AS3A 4GSDL 4PJAE 3PWPD 5KSBB 1XF3B 5BQ7B 2DJSA 1KN4H 3TGXA 4XPAH 5I6XB 1KIRB 3QRGH 3NCCB 4UIMA 4WNQB 5ACZB 3TNMA 4DZ8B 4QRTA 2GSGB 5CWSB 1MFNA 4Y4HA 1S8DA 3IS1X 5DJ2A 1U91B 3P40A 2C26A 4PJXB 4WDIA 1CD0A 2VLRE 1MIMH 2H9GA 4GRLB 1WWBX 1LE9A 3MV7D 3OAUH 1QPXA 3ULVC 4NKQB 4RGND 1T89C 1PQZA 5E8OA 2DI8A 3MODL 2NX5A 4EQ2A 1KCRL 5GGUA 1G7JA 4YHZL 1J8HA 4LNRA 2NY1D 4Z76A 4GOSA 1AGEA 5D1QA 2JELL 3HNTL 5HXMA 1W0YT 1C08B 1MJ8L 3CFDB 3VXQA 1IT9H 4L3CA 3INUH 3R1GH 5HHMB 1MFEH 3BGMB 1XF4A 4KTYA 4NQCD 5F6IC 2Q8AH 5JZ7D 1T80A 4HGWB 4ZAKD 2F9BT 1JMXA 5CSZB 5IVXB 5C8JA 3KJ4B 5CZVL 3T77A 1BJMA 3FL7A 5I71B 2FZ3B 1P9MC 2C3WA 5HJ3B 3U9UA 5I15L 5FYKU 1KJ2A 4BFIA 3PWLB 5ADOH 3KLDA 3E3QC 5DT1L 3U2SA 5FO9A 2A73A 3PJSB 4PJCE 3WJJA 3IU4L 1N26A 1JFQL 2R0KH 3EHBC 3RHWK 5BXFB 4LDOB 3H9SE 4XP6H 5I19L 5IKCA 1R5WA 4M7ZB 2WIIA 1Z5LB 3VXRA 3G5ZB 3L3IB 1RJYA 1RUPH 3Q0HA 4JZJA 2XWBA 3W0WB 2APVA 4OV5B 3MGAA 4Q6IA 2V6HA 3CSYB 4LCUA 5C0GA 2XKNB 3OR7B 1MUJB 1X4YA 43CAA 3QAZB 3X13A 2MMXA 1TCRA 5F9JB 3S97C 3C5ZD 2V17L 3VRIA 1BIIB 1JZ3A 2OXHA 2W60B 3AUVA 3TFKC 3SE3A 1A4KA 2XZAH 2CD0A 1T5XB 1QRNA 4YHOH 1B2WH 2OL3A 3GHEH 1UVQB 3PGFL 5FGCE 5B4MC 2N4IA 2NCMA 3UDWA 4HJJL 5D6CA 1QSVA 2AJYL 2XIDA 5C0ND 5C08B 3VI3F 4RGOL 5KSBE 4OJFL 2MFNA 4GAFB 4NWUL 2O61B 3QIWD 4F57L 1W72A 4ZNCD 4CN4A 3IRZA 1KCSL 4ENED 3BDYH 4HQQH 4JPWL 3OGCA 1QFHA 3T3MF 4NZTL 3BMVA 1UH4A 3BKML 3T65A 2C3XA 4UT9H 5KSVA 4PJXE 2JK5A 3VG0L 3GMOA 5CBEB 1H5BA 5FOBB 2DRUA 5EC2B 1FZOA 1L7TL 2FLBT 5HYJD 4HKZA 2VISA 4MHHG 5EOQL 2A9MH 3TZVB 4N0YL 3TWCH 3KPNB 1LHZA 3RVWD 3BP7A 2HKFL 1TNNA 5DI8B 1VFMA 3OSKA 4ZO6A 1T21A 3VH8G 5TDPA 3FO1B 1WISA 2XT1B 1U8PB 3NCEB 5D7SH 1LK2A 4QTIH 1L6XA 1XIWD 1BIHA 3JWOL 1T0MB 5HHME 4I3GA 1CDHA 1EFXA 2ZWLT 1KPRA 4D8PA 2YHGA 3IXTA 4BQ8A 1ZVHA 4FTVB 2Y5TA 4M8VA 3FZUD 4X4YB 5IVXE 4CKVX 4D0BB 3C8DA 5I1AA 5I8EB 1ZWIA 1Y6MR 3X12A 4Y2DD 4TSBL 2HG5B 3QXTA 4UV7L 1BPVA 5IMKB 1V7MH 3VD5A 2IC2A 1FC1A 3ILPB 3HE6B 4UILL 4O2CB 1Z0NA 1DE4B 4PRID 4PJEF 3VFOA 4XNMA 3O45B 4XWGL 4YK4B 1CGSH 4FZEL 2ZUVA 2D4FA 4KVCH 1S9XB 4JRYB 3FHAA 3FQRA 4KUZL 5D7JC 1CFTB 3P4LA 1MHCB 5A40E 4ZXBB 1FAKT 4IRJC 3O6MH 1YC8A 1A7OH 4K9EH 3W0WE 5GGRA 4JFHD 4MQSB 3S37H 3FB8B 15C8L 1B4RA 5EOTA 3LN9A 5DMGD 1NLBL 4XP9H 4UAOC 3B8SA 3T0XA 5IIEB 2FIKA 2HTLC 2F8VA 1UEMA 3DV6B 3K2MC 3T1FA 3EDEA 3QI9B 4JCLA 4LCCB 3T08A 2EZ0D 1JI2A 1HHIB 2CDEA 2EC9U 5EU6B 4ZUUB 3QNYA 1X6NA 1HINH 1N5YL 1WIPA 3MLWH 5C0JA 1WZKA 3T04D 2CH8A 5C08E 1CS6A 1E4XL 1Z9MA 1HILA 1YQVH 5JW5A 3UZQA 2KUTA 1DUZA 1KCLA 3QO0B 3DIFB 3RVTC 2ADJB 4HT1H 5EUOA 3QIUB 3RUGA 1E4JA 3BRDA 1I1RA 4PV8A 5ICXA 1CE6A 1KNOA 1K4CB 4ODBD 3TO2A 2C3VA 2P49B 4KQ3L 1UA6H 2IAMA 2OI9C 1FZJA 4OFDA 4N8CL 3Q5TA 2NY3B 7CGTA 1CK0H 5H35A 4J2XA 2E7BA 4Z7NF 2FRGP 1BP3B 3LV3B 4RIRB 3ELAT 5J6GA 4CU8A 1NFDB 3J8F7 3NFSL 3QDHA 1RZGB 1C12A 2VAAA 3QFDA 5TDNA 5DXWA 4M1CC 3SY0A 2ZUSA 1KN4L 1IM3A 4YIQB 1S78D 4XPAL 2JB5H 3QRGL 2Y7QA 4ZTPH 3FO2A 4M61B 3QJFA 4FTVE 2BSRB 4CN1A 3KPMA 4MQ7A 3NZ8A 4R26H 1OM3H 3B2UD 5JQ6H 1BVZA 5BW7C 3EO0B 1MIML 4ZUTB 3BW9B 3DX8B 3OAUL 3IJYB 4O02H 3JUYA 3PWPB 3DO3A 2YZ8A 1EH9A 2ED8A 1JYNA 5FF6B 3TESA 4MSWA 2CRIA 5MP6H 1JTTA 5C7XL 1KB9J 3ALWA 1PAMA 3K4ZA 3VXSD 3LS4H 3TEUA 4JRYE 4J6RH 4ZYKA 3ILQD 5ADPH 4MD5A 3TH4T 5FM4A 2C1PB 4Z7UB 1QLRB 3WN5B 1JGLH 3INUL 3R1GL 1MFEL 3WO4B 4PLNC 1BQSA 2Q8AL 3MV7B 4DVBB 5J56B 3L1OH 1S9KC 1K8DA 2VLJD 2RJMA 4RGNB 3QA3A 1JWSA 3UBXI 2NY1B 3NIDF 1PKQB 1EZVX 1DANU 3CX5K 4HIXH 4JO4H 5T3ZE 5ADOL 3P0GB 1OTTD 3D69B 1RK1B 3IDIB 1I9IH 3Q5OA 5HYEA 3O2VH 3JTSA 5EU6E 2R0KL 2W9LA 1UM5H 3LN4B 5HYSB 1FAIH 2E27H 1UKQA 4XP6L 3RAJL 3VWJA 4K94C 4GUPA 4RFOH 5BS0A 1OAUH 4U6XA 1HH6B 1RUPL 1EAPB 4JFYB 4P5KB 4D9LH 3KPRD 1EBAA 4JDZA 5E9DD 1QR1A 5FXCH 2X70A 1BFOA 2VNCA 3ULUF 3SKUD 1LP9F 1ZHKB 5CBAB 3DSNA 3BEWB 3C9NA 4XVTL 1PY4A 3M1BB 3GM0A 2XZAL 4YHOL 3IDYB 1HOCB 3GHEL 2NY2D 4HGKC 1JNJA 3CU1A 3GZKA 1CGWA 1RZ8A 4NRXB 1NFDE 2VC2H 2H6PA 2YD7A 1Z9OA 3QO1A 1S7RB 1N59A 3BHBB 3AAZA 5ID1A 3ZZ1A 2V2TA 1EIBA 3C5ZB 3FB6B 3BDYL 4HQQL 5SWSD 4AIOA 2NY7H 3OR6B 5D6DA 1CDIA 1XZ0B 1QSED 3FQWB 2D9CA 4LPWA 1DQDH 4UT9L 4JQVC 3FO9B 1JV5B 4YO0A 4TUJB 4BZ2L 3QFJA 4GBXB 5GZOC 3K8LA 4HW6A 3D39D 3PWPE 2YPLD 4XPFH 4R4FH 2ATPA 4ETYA 4YPGA 3QIWB 2AXFA 2A9ML 5E5MA 2R1XB 3TWCL 1ETZA 4AQOA 1HXMB 1Q9OA 2K3TA 5IVZA 2G75A 2YN3A 2AEPH 1OAQH 5E94A 4UZGA 4YGVA 1NCUA 4Y1AD 3NA9L 4JPIB 4H1LB 5D7SL 4Z7UE 4QTIL 2YA2A 2WBJD 2XZZA 2WWMC 3SCMA 1U58A 3BP5A 3FOMA 3MV7E 5HI5D 1RZJC 4L9DA 4UT7H 1J1PH 4PTTB 4DZBA 4X5WA 5HYJB 4RGNE 4ODHH 3FT3A 4AG4H 3JV6B 3VFTA 2Z9TA 2DIAA 1LWRA 1YPZA 3OKMB 1TPXC 4Y0GA 3DOSA 1DL7H 1V7ML 1HNFA 1PKQE 3MLYH 3OX8B 3OBAA 4HWUA 4NJAH 3KR3H 1M05A 3KJ6L 1CVSC 5K59E 4AT6B 1XF1A 4OI8A 2GJ6A 1XIWB 5JO5A 2YPKB 3DLQR 1CGSL 2YBRB 4CMMB 1A4JA 5HYIA 3C6LA 4I48A 1OAXH 1AHWA 4UOJA 3ZHLA 2VYRE 1U2HA 2EDLA 5HHQB 2NXYD 4UUJB 3H7BA 3ULUC 1QA9A 3DURA 4Y2DB 5KS9A 2ICEB 3O6ML 4B7LA 4EI6B 1A7OL 4K9EL 3O8XC 2Z31D 5C09D 3CMGA 3S37L 3S7GA 5IW3A 2NZIA 4XWOD 1RJLB 4OF0A 3UYOD 1EHXA 3OXRA 4XP9L 1OTSD 4PRIB 1DQJA 1AGCA 5E8PB 3TM6A 4YEFA 5C3TA 5EN2B 1G7QB 2FJGB 3U0WH 3KGRA 2XQYG 5E2VH 3W39B 4M6OH 5ID0B 2XXMB 5FGRA 2AS5M 3C60A 3TIDB 5HVHB 3MLWL 4LLVA 1ND0A 2H2SD 1SBSL 1YQVL 3BIKA 5LGJA 3L6FB 2ORBH 3ARDC 4Y16C 2X9YA 4HT1L 2R4SH 3B83A 4PJ8B 4EN3A 1X4ZA 1OF2A 4P3CH 3HRZB 1JUFB 5IUSA 3DMMD 1XMWA 3WLBA 2H8PB 4F9LC 1B9ZA 1UA6L 3EFDH 1JNLH 3BKYH 4NHUB 5I73C 4X83A 1IBGH 2IH3B 2ICES 4PJ9C 1CK0L 5B38A 3P9LB 2H45A 4G9DA 4PD4K 4HAFA 3V4UH 3EAKA 1XF2A 4BSWA 1NCDH 5FUZL 2LU3A 1GOFA 2ZUQB 3ZT5A 4XC1H 2VL5B 3ZO0A 5D1XD 3MJ8A 1OARH 5CP3A 4C4KO 4JRXD 1WZ1H 1P7QD 3MRJB 2JB5L 1W0WB 4ZTPL 1TZIB 1MPAH 2IQ9H 2R23B 1YEDB 4KKNA 2F54A 4DKFH 5HYJE 5DRNA 4R26L 1OM3L 4G80B 5JQ6L 2BVQA 1I1AB 4HBCH 4HHAA 1U8LB 5IW6A 4O02L 1MLBA 1SJXA 1ZOXA 1A7QH 4JFED 1PYWA 3KPSB 2FB4H 2OP4H 5ICZB 5MP6L 3PHQA 4IHOA 2GTZB 3WNNA 4XP4H 1G7HB 2EIZA 1PFCA 2PW1B 4Z7WB 5DS8B 4J6RL 1VESA 1KB9K 5MERA 2FEDC 4UBDC 2X4QB 3V4VH 4X7FC 4WU7A 1J0JA 5I74B 1JGLL 5GS0D 5ESVA 5T3ZH 4ELKA 2WW8A 3HZYB 1KULA 3O6KH 4ODVH 5HDLA 3L1OL 1I8IB 1XCQA 1EHAA 4HULB 2PYED 5EO1B 2WUBL 4OFKA 3PHOB 1K4DB 4PRIE 3NPSC 2P42B 1NFIB 2IADB 3TBVB 5DHXB 3I85A 4HIXL 4JO4L 4UNTA 1FFPA 1XH3B 4W4NA 4XCNA 1I9IL 5A43C 5JW4R 3C09C 3O2VL 3BMWA 5K9KA 3GB7A 3QQ3B 3E6FB 1UM5L 1FAIL 1A6TB 1UYWL 3VFWB 4G8FA 1Z9LA 2E27L 1AD9A 4ERSH 1VFUA 4RFOL 2ZKHH 3MBED 1F3DJ 5A16B 1OAUL 1TZGL 2IQAA 5EOCH 1HEZA 3ZT6A 1R24B 2VQ1B 4UU9B 5TFSH 4JFOB 2BFVH 4D9LL 3NIFE 4NWTH 4KHTH 4OZIF 2ENSA 2N56A 1A1OB 1UJ3B 4R4BB 4M7KH 4F8TA 5IBTH 1HQRA 2W59A 2CLZB 3VCLB 4G8GA 4G43B 1NUFA 4LKCA 1VACB 3QB7C 5FM8A 4NGHH 1I8LC 3OTTA 2AVGA 3MV11 5E56A 4D0DA 5FM5O 2PCPA 3PDOA 4NDMA 5F3BA 2GITB 5F7MC 5H2BB 4NUJB 3D0LB 2BNUA 1RQ5A 4RAHA 3MLPA 4Q58C 1A6AB 4U6VH 3DXAA 4IDLA 1D7FA 5ESQA 3IJSA 2UYLA 3S36X 3O4OB 1I3UA 1XGQB 5J06A 2NY7L 4YBLB 1SJHA 3NGBC 3N06B 3GGWA 5GGTH 4KRPD 2QR0A 4LK4A 1T0PB 1MRFH 1OTUD 5IBLC 3IS0X 1DQDL 3VMPA 2NY2B 2L4OA 2EIDA 1BZ9B 1KXVC 4O9HH 3WE6B 1FYTB 3C2AH 3HMXH 3VXUD 3QEQA 2OCFD 4X99B 4MXVF 2FBOJ 4R4FL 4XPFL 3KPSE 4QRPA 4L8BB 4MDIA 2YZ1A 4QOKD 1D5MA 4RMWA 5SV4A 5SWSB 3RRQA 3HFMH 4Z7WE 5SWZD 5I16A 2AEPL 1OAQL 1QSEB 3MROA 1LE5B 5IR1B 2MNUA 3HI6H 4YNYA 2X4SA 5LKNA 2E7HA 3D39B 2EYSA 4UT7L 1J1PL 4MCZA 1D6VH 5FYJD 4AG4L 1XR9A 2PTTA 1FCCA 4PJ5A 1N4XH 2LVCA 1DL7L 3MLYL 4NJAL 4Y4KD 3KR3L 1MHPH 2R2EB 3GSUA 5D2LF 4Y1AB 3AS2A 1FNSH 5EU4B 5DDHA 1KYOJ 1BZ7A 3O3EB 4KK9D 3S3PA 1ACZA 4Y7MA 2QL1A 1FCGA 3JXAA 2XNAB 5IW1B 4DW2H 1GRWA 3HZMA 1MCBA 1OAXL 1A7PH 4JFDA 4OZ4A 5I8CB 4H0IA 2EH7H 1MREH 3WJJC 1FVCA 5BV7B 1YUHB 4WHTB 3GSQA 1AQDA 3FT4A 4F7MB 1X5ZA 2Y23A 2X4OA 3G6AA 3GSRA 4ONHA 4WW2F 1TQCC 2X4UB 1GHFH 4DGIH 4EJ1C 3R06B 3VXNB 4A6YA 5DVKA 3GRWH 1T4KB 1T0NB 4L4VA 1TJIH 1DVFD 1JL8A 2HAZA 3Q1SH 4PRDA 4Y4FA 5D5MA 1JHTA 2Z92B 4LCWB 1OSPH 4X8JB 1F4YH 4PREB 3U0WL 3PG2A 5E2VL 2NXYB 5CP7B 3WS6A 3SDXA 1S7XA 4M6OL 5CEXA 3SE3C 5KVGH 2FEEI 5DJ0A 1HHGA 4MD0A 1X5JA 5F7WC 5F9OH 1S9YA 4N8PA 2L7UA 3H9HB 5DFTA 2IBZY 1RZKH 3O9WA 3RGVA 4F15B 1M7IA 2XN9D 1KN2H 2ORBL 4NQEB 4FXLA 2VDOH 5KTEL 4KI5C 2OX5A 25C8H 2R4SL 5CIPA 4ZUWA 3HPJA 1Q72H 4PLJD 1DBBL 4P3CL 3O6FD 3CDYA 3L3HA 3SOBH 3NCMA 1IL1B 5FHAH 3EFDL 4N9OB 4ETQB 1FYTE 1JNLL 3BKYL 3SDAA 4EI5C 5ESAA 1U2CA 4H1LH 3T4AA 1H5BC 4R96B 5LWYH 3I3EA 3LY6A 3MO1A 5EUOF 3V4UL 5JMOC 2Q7YB 3QDMD 1TLKA 4CU7A 1NCDL 1WSST 2VIRA 4Z7QE 1ZA3A 1NGYA 5SWSE 3VG9B 4HBQA 2HT2D 4XC1L 3GBMH 4POZD 4TNVK 4OLWH 1QSEE 3IDNA 5IHBA 3C08H 1OARL 2OZ4L 1JZ8A 3BVNA 1WZ1L 3DMMB 3HKFA 1M6OA 1FG2B 4PGEA 1MPAL 2IQ9L 2EDYA 1Q8MA 2CDGA 3RTQC 3D39E 4K55A 3SDDA 1RZIB 4LVEA 1AE6H 3DHMA 1ZTXH 1JPST 4CVXA 4QHMA 4DKFL 3DECA 5D7IF 1JF1A 1I75A 1MCRA 4HWEH 1FBIH 1F2XK 4HBCL 1NH6A 1F6FB 2YD2A 3GSOB 3PNWA 5I75C 5J57B 3LD8B 3HCVB 3U4AA 2RFXA 4G6JH 2Q6WB 1A7QL 5D1XB 3V7AG 1YN6A 2Z91B 1MJJB 4Y1AE 2FB4L 4JRXB 2OP4L 1P7QB 4NNYA 1NBVH 4KGJA 4JR9H 4XP4L 4P3DA 3VRJA 1GJIA 2QADD 2Z93B 3ULVD 1TNMA 4MNGA 2K1MA 3SGEH 5DZLA 3V4VL 1U3HA 1N8ZA 1G7MA 4L3AA 3LRSA 1NQBA 2Q76A 5T3ZL 3ZDYF 4ODVL 1XGUA 1NC2D 3W5NA 5DD6B 1AXTL 3HS0A 4LEXH 1T1WA 4JFEB 2XWJB 4MA7H 1IGFH 4P49A 4PGBB 5E2JA 2DTMH 1JGEB 4MJ5B 1MAMH 4GW1A 2X10A 3MRCA 1F6AB 5JNYA 5L2JB 3KYMA 3RWHB 4LCWE 4EXPX 4C58B 4ZPVB 2RQ8A 4J1UA 5CMAA 1I3RB 1OGAA 2Q7NA 1B0RA 3L95B 6CGTA 1ZMYA 3REWB 3O2DH 2IAND 3BAEH 4ZSOB 3RWEA 1N7MH 3D3VA 5KSAD 1NLDH 2PYEB 4ERSL 1CDJA 2ZKHL 1WWWX 5EOCL 4TTGA 3EHBD 1KEMH 5TFSL 4EDWH 4NWTL 5HGDB 4KHTL 4NQEE 3NCYP 5GSRB 4HWZB 4QHUA 4M7KL 5DK0B 1GZQB 3L3JB 5H8DA 1UCBH 1YQ2A 5FOJA 1RFDH 3MFGB 5IBTL 4PS4H 1P2CB 2GY5A 1JHKH 1LILA 2DYPD 3WS3B 3UEZA 1INDH 4NGHL 4KH2A 2APFA 3SGDI 1I9RH 2VLLB 3NCBB 2E9BA 5LAXA 3DYPA 4NKMB 1U8OA 2WINA 5TDOB 3UCRA 2IAMC 3L7FB 4G6FB 1X5HA 3TFKD 4C55A 1LDPH 2RAMA 2P8MB 4HK0B 4K3GA 4P2RD 4WGWB 4CW1B 4U6VL 4UQ2B 2H3NA 2W65A 2VZSA 3FFCA 4JHZA 4WI6A 5B4MD 1ZA6B 5IMLB 4DQOH 2K7QA 4OM0H 5HGAA 4KK6C 3MRFA 2Q3ZA 4O58H 3HI1B 4HUXB 2PW2B 5F1OB 5DRXA 5A2KH 1AP2B 4KQ4H 3WDJA 4AJ0A 1MRFL 3I2CH 4MVBC 2YEZB 4LSPH 4DUWA 1WBZB 5IQ9B 5BJTB 2BHZA 4JAMB 4O9HL 3JVGA 3C2AL 3H9YA 4Y5VA 5A1AA 3MCKB 1S9VB 1A3RH 1YN7B 4JRXE 1V3KA 3LH2H 3UTQB 4MS8C 4BYHA 5IJVB 3GK8H 4FQIH 3M17A 2IPUK 3E0GA 4I18B 3HFML 1HSBB 3QDAA 4ODUB 4KRPB 1SEQH 2NTFB 3EFFA 3HI6L 1XCTB 1NGPH 3T4YA 1CWVA 1FN4A 2ZP0T 5C0AB 5EZIH 3R0NA 3DUSB 4Y89A 5F1KC 3VXUB 5J9PA 3MRQB 2DQFB 1I7UB 4XX1E 4JFEE 1E0OB 5DRZB 1D6VL 1Z2KA 3AREA 1NDGA 4KI1A 3VXPB 4QOKB 1N4XL 1EEYB 1BGXH 4ODXA 5SWZB 1MHPL 4TSAH 1HXYB 5ITBH 1EEQA 4HG4J 1FNSL 5DWUH 4TNWF 4XCYB 1QEWB 4DW2L 4PRAB 2VJXA 2HLFC 4FQXA 1A7PL 4ZSOE 1MF2H 2EH7L 1MREL 1KYOK 3FJTA 43C9B 3SO3B 2AXHA 2PYEE 2QTEA 1YPZF 3EOBA 2HWZL 2DM3A 5DUMH 2ZJSH 4JFXA 3BGAA 4K8RH 1A9BA 2QQNH 3QIBA 4IRSA 4Y4KB 2YD1A 3B9KA 5D7JD 5AUMA 5IHZA 1JWMA 3REVA 1GHFL 4IRJD 2E6QA 3ZYOA 4DGIL 2NW3A 1J05A 3GRWL 5DFWH 5HI3D 5HYQB 3BEVA 5A2FA 1NCAH 4RDQF 3Q1SL 4YHYB 4OZHB 5IM7B 4JJ5B 1NANI 1OSPL 1F4YL 4S11A 4M3KB 3GMMA 4KRNA 1ITCA 3PIQA 4NO3B 3OKDB 5IB4B 4I0PA 3SKNA 4OUUB 8FABB 3HZKB 5E70A 4ZPTA 5KVGL 4GW4B 5CAYB 5D93B 2PO6C 2X89D 4OQTH 5F9OL 2OMBA 2X5PA 1DVFB 4G42B 1RZKL 3GMQB 3V5DB 1KN2L 1BBJA 2X1QA 4YDVB 2VDOL 3LKPB 25C8L 2YXFA 2GIYA 2JJSA 3CD4A 1Q72L 4HIJA 4M4RA 1I1YB 1IJ9A 3KPOA 3NAAL 3RVTD 3SOBL 4P59L 3PABB 5FHAL 4X5XB 5BOZG 1IC4L 3QDJD 3SE8H 1G6RB 2F19H 4MA1C 3LMJH 5LWYL 3FQUB 3QUYA 3Q5YA 2XN9B 4XP1H 3DROA 4LBEB 5CEYB 1EFQA 1EGJA 4PJ7A 1U8JB 3GBML 2WV3A 2ED9A 3C08L 2UVFA 3UX9B 4IIQB 5C70A 1SQ2N 1UQSB 4M1DH 4JANB 1JZ6A 3BZFB 5C0AE 5AAWA 2UWEF 3VXUE 3QH3B 3RJDA 1ZTXL 2MSPA 4X4XA 4HWEL 1FBIL 3SCMC 3BUTA 2BZDA 4JKPH 4QOKE 2D0HA 3LQAH 2J1KA 2EO1A 2KPNA 5JDSA 4G6JL 5SWZE 4HV8A 5BV7H 5K33A 3VD3A 3MRHB 1G0DA 1OAKH 4QRUA 2EE6A 4JR9L 4F7PA 3D25B 4KDVA 5FYJE 4BA8A 3UMTA 2P5EA 2CUIA 1B0GA 1QOKA 4Z6AT 4Q2ZA 1T1YB 1F4XH 2YPVH 3T0WA 4L9LA 4LEXL 4MA7L 4GG6B 1IGFL 2NLJB 4Z0XB 4FXKB 2X4TA 3QG7H 2X4NB 1MAML 4OZHE 2WANA 1WQVT 1S3KH 4HC1A 2XACC 3HPLB 3NCYS 3DPBA 3GSVB 3O3AB 3LN5A 5LQBH 5MEOA 4PJIB 4YEEA 3JTTB 1NEUA 4LEOB 1WV7T 4LPYA 3MRIA 1NC2B 3BAEL 3O2DL 1GXEA 1N7ML 4WEUD 4NO2A 1NLDL 4P2OB 4J3XA 2ARJQ 2E9JA 2BJMH 4LLWA 1MELA 4NNPH 1UH3A 4RMVA 3MJ7B 4ZFOA 4PJCF 1KLGB 1TVHB 5F6IB 2VLKD 1KEML 1ZHBB 4F7TB 4EDWL 5DLMH 1NEZA 2R2HB 4NQVA 4NQXA 1FZKA 1TVBB 4GLRI 4LLMA 1UCBL 1RFDL 4NC2B 1QBML 1VFAA 4PS4L 5EZOH 3A6BH 3BPNB 1JHKL 2XZQL 4EN3C 1INDL 2IANB 2OTUA 1I9RL 3DVGA 3GMNB 5BZWA 4DKDC 4HF5H 2GAZA 5DA0B 3IKCA 4PJBB 3GMRB 3WFHA 2Z35A 4I9WD 5EC1B 3GSXB 2XN9E 1LDPL 5GRJH 4YXKH 4GJTB 2NY4C 2IALA 3RWDB 2ITDA 5F6HJ 3IDJB 1EA9C 4WI4A 4KROC 4WO4B 4PY8I 4MQXC 4WTZA 4DQOL 2YOCA 4OM0L 2V5MA 4X0KB 1V7NH 5GSVA 4NQDD 4O58L 1N6UA 1K3IA 2QSCH 5T1DH 4BK5A 3SDCA 2FATH 1C7SA 3P4OB 3BPCB 4EKXA 3TIEB 1X5GA 4Y19A 5KSBF 4MWFA 4KQ4L 2H2PC 3HB3C 3I2CL 5FK9B 4YWGL 2VDRH 4X6DA 4LSPL 5DQDH 1F3JA 4MX7A 3KXFD 3NPZB 1S5HA 1YYLH 3QWOA 4HX1A 4P2RB 1NGXB 2XG5A 1A6ZB 4U1HB 1IQDA 2I26N 1A3RL 4L29B 4GKSB 3LH2L 4PJXF 5GZOD 4ZNEE 3GK8L 2EXWC 2CO6B 4FQIL 1P69B 1NGQH 4U1IA 4YDLC 1A1MA 1DLHA 2EDDA 5ICYA 4E0RA 3D0VA 1SEQL 4JY5H 2V2XA 1NGPL 2NTSP 4UTBH 3BUYB 4ZQKA 5A2IH 5SWQB 4HPYH 5EZIL 2ESVD 4YDJB 4OAWB 2VKXA 4PTUB 4GG6E 3DVIA 5GS0H 3O2WH 5F1SA 2WWMD 4QXUH 4UDUB 1CE1H 1BGXL 4TVSa 3ULVE 4TSAL 5ITBL 5IVXF 3EOYG 2YMXH 1S7UA 5DWUL 4PJIE 2C7UA 3EDFA 3ARYA 3W9EA 3EYVB 2XPGB 4MJ4A 5F1NB 7FABH 4XCFH 1BFVL 4FQJH 3LAFA 4LPXA 4HG4K 3QEUB 1MF2L 4JJHA 1IEBA 5FDWB 4HJGA 4PFEA 5DUML 1HSAA 2ZJSL 4K8RL 2XQBH 3EYFB 2QQNL 5IV2B 3G5XA 3GBNH 3ULUD 3HR5B 1ZT4B 3DYOA 3OKLA 5TE4H 5I1GH 1SYSA 1NBZB 1R3KA 4PLOB 4WVRA 3O8XD 2IBGA 4MB3A 5DRWA 3E3QE 5HBBA 2IANE 5DMJB 2JCCB 3F7YB 3U0TA 4TUOB 2ZNXA 3O3BB 2GHWB 1D6EA 5IFAH 5MENA 1J8KA 4KKCC 4PJBE 2AXGB 3QNZA 4TUKH 3RWGA 4KKBC 4QNPE 3QULA 4HS8L 3N1QC 5D7JB 1OP3K 1YMMD 4IRJB 4OQTL 3BP6B 2A2QT 3ARGA 3BH8A 4JLRB 5ANMA 3T2OA 4KRMB 5HYSG 2BSED 1A7RL 3FTGB 4JE4B 5EBMB 1WBXA 3SDXF 1U9KA 4K7PY 4UAOB 2FX9H 1XT5A 3B3IA 1KTLB 2F8OA 3H9ZA 2AK4D 3ARDD 4Y16D 4P4KA 1GVIA 1UXWB 4PJHF 1IMHC 1ORQB 4MCYB 3BD5A 4P2RE 3SE8L 5TQ0H 1WFTA 2F19L 3B8YA 2WWKT 2CKNA 4OD1H 4WV1A 5TH2B 4APQA 4POUB 3WKNA 5AD0A 1FNLA 5KBNC 1JZ4A 2AJVH 3LMJL 1LEKB 4TQEH 3P4NA 4N68A 4XP1L 1NJ9A 4GXUM 4ODWB 4PJ9D 4U1LB 5C6PB 1TFHA 2Z4QA 2PUQT 4J3TA 3E6HA 2B4CC 3CFIC 1MCWW 3ZDXF 3T0EC 5E8EA 3X11B 5GGQH 1RJZA 3FCTA 3CDFA 4M1DL 2MCG1 5FKPA 3LVEA 3KJ4C 4JKPL 2OYPA 1WVZA 2BXZA 2OI9B 4OLZH 5DC0A 3LQAL 4HH9B 3D85B 2FSEB 1J0YA 4UV4H 1DQQB 4YDKH 5FYJH 3HUJF 1K5NA 5E5RB 5BV7L 4OD3H 4NN5C 1Y6KR 3VFVA 1OAKL 1JVKA 1OP3H 4F2MB 3UTSD 5IP4A 1WZLA 2XA8H 3FQTA 4WY7H 3GMLB 3RX7A 2NYYC 5FCUH 3SBWA 1CD9B 3QQ4B 4DEPB 3DTXB 3W5MA 3KYOB 1FJ1A 4OTXH 3OKOB 1F4XL 2FEDD 2YPVL 4UBDD 5BZDA 4KJWC 4U2YA 5E95B 3GIVB 4O2FA 1YEHH 5HVWA 4H1LG 3MNWB 4PJEB 3TBWB 5JLZA 1YMHA 3QG7L 4HFUH 4HMEA 3ZE0F 4I4WA 4DN3H 2AJZA 2AEQH 4WUKH 4PRBA 3UROR 3QUMA 1S3KL 4QRSB 2JCCE 2WNGA 3ES6A 4JFFB 4YHKH 1FFOB 1I9JH 4Y4FC 4HH8A 4TTDC 3EYOB 4MA3A 5HGBB 4BFEA 4QXGH 3GJEA 3RZWA 1YZZA 1FGVH 2UY7A 5DA4A 4XBGB 4H8WC 2L0DA 3H0TA 2BJML 2MJWA 4NNPL 5ENWA 1FV1B 1D5XB 3OHXA 3UTZA 1E6OH 2DQEH 4RAUB 1CQYA 4L3ED 4M5ZH 2B2XH 1C1EH 2W1NA 1G6RH 5EO9B 1JYXA 1R3LB 3O9WC 3RGVC 1RAMA 3VGDA 5EZOL 3A6BL 4Y8DC 2R69H 5CKGA 4U4BA 4OD2B 3VI3E 2C4XA 4OCYH 4PY7A 4HF5L 1CQKA 2VLKB 4YHNA 1HHKA 3FONB 5GRJL 4YXKL 3L5XH 1MQKH 5IFJB 5F1IA 3L3OB 2M8XA 4S0SD 2YD5A 4N9GA 4QRRD 5FKAA 1N2RA 1KIPB 1V7NL 4AEFA 2Z0BA 5T1DL 2QSCL 3W9DB 2FATL 2D4DA 3MRDA 5I2IB 1XF5B 4ALAH 1YEKH 4ZOCA 2ITCB 1KCKA 2Z8VC 2VDRL 2ICWJ 3ROOB 5DQDL 4PJAA 3MFFB 3SDDC 2DQCH 4OZGB 1YYLL 1IM9A 1JGDA 4ORGA 1QNZH 2RGSA 1IGYA 4JDVB 2OM5A 3PWUA 4M6MH 3MOBH 2NPLX 4NQDB 1NGQL 2VXTH 3RIFK 5HYFA 3V4PL 4BH7A 5AG8A 3U48A 2EIEA 1I3GH 2F8XC 4ZXBC 1DN0B 4JY5L 1P4IH 4UTBL 3EGSB 1ZLWK 3KXFB 4QO1A 1KENH 4HPYL 1WIOA 2NX5D 3ULVH 4O5LH 3TVMA 1J8HD 4XPHH 4B41A 1U3HC 5FYKD 4CVZB 1LEGA 1TZHB 4PJEE 5GS0L 3O2WL 2VZ3A 2EYTB 5HDOA 4O2EA 1KJVA 4QXUL 3MJGX 5C0EA 4IOSD 1INQA 5GRUH 4F80A 5HHXH 5GXBB 3SPVA 2YMXL 4JFFE 4FQHB 4N0CD 3VWKC 1S7TA 7FABL 4FFVC 1I4FB 3MLTB 5MEPB 4XCFL 2ESVB 1KLUB 3MJ6A 4FQJL 3BO8A 4LSTH 4PJDB 4G8IA 3TYFA 5K59F 3HZVA 5C0DB 1SHMA 1AIFB 4X9FA 2NZ9C 1A2YB 1G7LB 4CNIA 4ZOEA 2XQBL 3UAJC 3ET9F 3T2NH 3LQZA 3GBNL 4CGTA 2CJUH 1EEZA 4HCRH 5TE4L 2BVPA 5I1GL 1I1FA 5KOVC 3BXNA 5BVJA 1U95A 1TPXB 3PF2A 4WI7A 3AXLB 4UQ3A 3VXRD 4J3WA 5JW3H 3PDGA 3U30C 1NAKH 5D7LD 5KN5B 3VFNB 1LK3H 5IFAL 1AJ7H 3MRKA 4XBEH 5HHPB 2VLKE 1MLCA 4HKBB 3VFUA 3T8XB 1N5AB 3BIBX 1T1XB 3MRGB 3MREA 3JV4B 3OKYA 1ZLWH 4KTDH 3B9EA 1EERB 4F3FB 2HMID 4GKNA 3O8XB 4XT1C 2BNQB 4PV9B 5JORB 3UPRA 4J23A 5BRZD 2IPKB 2QQKH 2FX9L 2ZSVA 3EYQC 4XAWH 3NN8A 4Z7NE 1H8OA 3RWFB 3TH3T 4EIZC 1GGUA 3TN0A 4OZGE 4XNZC 4KJYA 1BD2D 3MGTA 5TQ0L 1INEH 2CRMA 4OD1L 4JY6B 3RL2A 1KIRA 4PRNB 2AJVL 3MLZH 4TQEL 4DZ8A 2I9LB 1R3IH 5I1LA 5CJ5A 5CWSA 5FA4A 4NQDE 4EI5D 5L7XL 3OF6A 5IG7A 5IF0A 1KT2B 4GRMA 3WXVH 2GTWB 4F33A 5C0IB 3T0DA 2KQMA 2AK4B 4GRLA 4Y16B 5GGQL 3KXFE 4LLAA 5CZKA 2W07A 3ARVA 2IPUG 3N1MC 3MRPB 1T6WA 4XCEB 1Y0LB 4XHQA 2GJJA 5I66A 4OLZL 2ENYA 5I73B 3RTQD 2D31A 4PJGB 2Y72A 3BZDA 2IPTL 4UV4L 3AREC 5EO0A 1EFXD 4YDKL 5FYJL 3CFJB 3CFDA 4OD3L 4CRPA 2YUZA 5EFIB 1AGDB 3BGMA 5C07A 2JIXB 1A21A 3SHSA 4P57B 4S1QH 3KPLA 2D0FA 2XA8L 4S10A 4K3JL 5CSZA 5FUOH 2BC4B 4LLDB 2ESVE 4WY7L 3A6OA 4PJDE 1GH7A 5FCUL 1RK0B 1XGTA 2B20A 2FZ3A 1MRDH 3LCYA 3L3GA 5HJ3A 1A7BA 3S5LB 1ED3B 4E41B 4FQXC 1KIQB 1DP0A 2XZCH 4S1DC 4NP4H 4OTXL 3F7QA 1D5BB 2O5YH 1LO4H 5DEZA 2HKHH 1YEHL 3ZKMC 3NMEA 4Q74A 4HJ0D 2CUHA 2DQJH 4IRSC 1M1SA 2CIKA 3QIBC 3B9KC 4PJFB 4WU5B 3UTSB 1D5ZB 5L88H 3LB6C 4R7DA 4DN3L 1CDGA 1M71B 2AEQL 4WUKL 2W38A 4CL7A 4MGXA 4HPOH 3SQBA 3G5ZA 2X4PA 3L3IA 1VERA 4YHKL 5DTFA 1I9JL 2V9QA 3WUWB 2ZG2A 3RNKB 1S9WB 4QXGL 4MJIA 4Y5YC 1XGRB 3CSYA 2XKNA 1JPSH 3OR7A 2ATKB 4LMQI 1BFSA 3BIAX 4S1RH 5CHNB 1BJ1J 3U4BH 5EBGA 3VFGH 3ULUE 4ZFZB 1UZ8B 3IGAB 4I0PC 1MOEA 1E6OL 1N6VA 2DQEL 2X44D 2BNQE 2H32B 2GCYA 3PUCA 4G5ZH 3OXSB 4JN2A 4M5ZL 1J88A 2B2XL 4JO1H 1C1EL 1G6RL 2FNBA 3IDMB 5GJSH 1LO0H 2HJFB 2LAGB 1FL6A 4QWWC 1UVQA 4OCRH 2FYYA 1BFTA 1U8HB 5DGRA 3NIFF 5F88B 4TNVF 2R69L 4GBXC 2PTUA 3CXDH 5IBUB 2Y9RT 3VDBA 3AY4A 4GMSH 4NSKA 3SGJA 4KMTH 4OCYL 4D0CB 1VENA 3OKNB 2J6EA 1DBKH 1PGRB 3VDCA 1Q9WB 4L3EB 1A6WL 1KTDB 3L5XL 3I3DA 1MQKL 1ZKAA 4EIGB 2FHFA 4OGXH 2YA0A 4YBQC 1FIEA 1MEXH 3QUYC 1YDPA 1IAKB 5CBEA 2VB5A 1X7QB 2AK4E 3OAYK 3B9VA 2CLVA 4HLJA 5SX5K 4RA3A 4RWYH 3L9RB 4O4YH 2VRAA 1P7HL 3TZVA 4ALAL 1YEKL 3I50H 4JFQB 1NMAH 2BHYA 4KK6D 4BQ9A 1X44A 1ZHNB 2JLLA 4AM0A 2DQCL 5DI8A 1OD9A 3PE9A 4PJGE 3BKJH 1QNZL 4GT7A 4NT6A 4MVBD 1A47A 1T0MA 3I02A 4P9HC 3LSOB 3FQXA 4M6ML 4UOW0 5JHDD 3MOBL 2HN7A 3BYTA 4FTVA 4NYLA 4X4MA 5GZNC 4NQSB 2VXTL 2F58H 4EXKA 4XGZA 3KLSA 4D0BA 4XPBL 1AGBA 4X6DF 5K9QI 4MS8D 2A1WH 1SVZA 2HG5A 2OZ4A 1I3GL 3EDKA 1P4IL 3IAQA 4QHKI 4E41E 3NGBB 1KENL 4OLYH 3ULVL 4O5LL 4RRPG 3Q6GH 4XPHL 4ZFFA 4L8SC 4LASH 3DX6A 1T2QH 1F42A 2E6JA 4Y4HB 4YHMH 1S8DB 5DJ2B 1JP5A 1CDUA 4ORZC 4PJFE 4L9LC 4V1DA 3UTSE 1GIGH 1RY7B 4JRYA 5GRUL 4WDIB 1MHCA 1RPQA 3QXVA 1VDGA 2H9GB 1J1XL 5HHXL 3RWJB 1LE9B 3OJDA 2XI9A 1GAFH 2DI7A 3DVFA 1CGTA 3AC0A 1BX2B 4X98A 1PQZB 4DWHA 2NX5B 3FB8A 5GGUB 1G7JB 1J8HB 5IB3A 4LNRB 3T0VA 3OAYH 4LSTL 4Z76B 5SX5H 1MIEH 5IIEA 2PXYA 5D1QB 5EWIH 3MV9A 4RFNC 2EDOA 3QI9A 4PGCA 3VXQB 1S7SA 4L3CB 5EPMB 3GDBA 4LCCA 3T2NL 1RUMH 2BY1A 4NN7C 1NCBH 2CJUL 4LCIH 4HLZH 5ACMA 4ZUUA 4JKKA 3S4SA 1QBAA 3G6JF 5C8JB 4JM2F 1SM3H 3MCG1 4HMCA 5JW3L 1KB5A 4XX1G 3OG6B 1NAKL 4OI7A 1B90A 5IROC 2DKMA 5DMKA 4BFIB 1FPTH 1LK3L 1J9CT 1AJ7L 3U2SB 5FO9B 4OV6F 2A73B 3V5HA 4L3EE 5DQ9A 2CR3A 1CVRA 2ZUQC 5IB1A 5B39B 4XRCB 4KTDL 3OG4B 1K4CA 1GOHA 1SYVA 3OKKA 4B53A 2CSPA 3VXRB 1SEBB 5C9KA 2PO6D 3MA7A 5D7LB 2QQKL 2YD4A 1VCAA 4Q6IB 5C0GB 4LCUB 5E08H 3B5GA 5GIRA 3SDCC 1I1AC 1NFDA 2MKLC 3H42H 3X13B 1TCRB 1EZVY 4I3SH 5HI4C 1CICD 1INEL 4DAGH 4BSVA 4CU6A 5B8CA 3ARWA 3MLZL 1A4KB 4OSUL 1QRNB 4AQ1B 2OJEA 1CL7I 2BSRA 5BRZB 3STLA 2AERT 4N1HB 2WQRA 1UADC 2A6KA 3DWTA 1FP5A 5E8NA 3WXVL 4EUPB 5D6CB 1F13A 3BW9A 3K0WA 1QSFD 2DQTH 3CX2A 3PWPA 1W72B 1V5JA 5KANG 2LV4A 2EKJA 1G1YA 4LU5L 1VB9A 1VEPA 5DJYB 2ZG1A 3QXUA 3T65B 4EI5B 3VXMD 3PP3K 5KSVB 2EDXA 2OS7A 1ZVSB 2JK5B 3GMOB 1H5BB 4X9HA 5F89A 1QLRA 2HVKA 3SCMD 3WN5A 1Q38A 5E1HB 1RZJH 3QWRA 4KDTA 3MV7A 5JIKA 4S1QL 1IARB 2V2WB 5FUOL 2NX5E 3TPUB 1T7YA 1J8HE 2OTWA 4CUCA 2VABB 4W6XB 2VKWA 1CTNA 5FYKE 1J10A 3BP7B 1MRDL 5EULV 2EDWA 1PKQA 3HTLX 3N1FC 1WGOA 2XZCL 4JM2C 4H26A 5TDPB 5EU3A 3OMZA 3RTQB 4DKAA 4R7NB 1LK2B 2O5YL 3UZEA 4XVJH 1EFXB 4PP1C 3KHOA 3V6ZA 1KPRB 1HCFX 2Y5TB 2I60H 5DJCB 4W4OA 3ZKND 2DQJL 1E27B 4NQCA 2RR3A 3LN4A 4N0UB 5HD8C 1ZXQA 4OI9A 5I1AB 1ZWIB 4ZAKA 3G5VA 5L88L 3X12B 4ELMF 3ULUH 4HPOL 1A7NH 5E00A 4M62H 3DO7A 3EKCA 3DSFH 1EAPA 3BSZH 4J3OC 2XTJD 1KCUH 3SO5A 3IKKA 1KGCD 1JPSL 1WJ3A 2PN5A 1JPTH 4XNMB 1FNHA 1HHHB 3U4BL 3VFGL 1BHGA 5I1CH 1ZHKA 3V6OA 5CBAA 1A3QA 5F7KC 3FQRB 3BEWA 4G5ZL 4MDJB 3VXRE 3GI8L 4JO1L 5D7LE 4XP5H 5GJSL 3CMOH 3TCLB 1LO0L 3PP3H 5EBWA 4M00A 5DHYA 2C1OB 4RAVA 5EOTB 4OCRL 5LBSH 3MV01 5GGSA 2E9IA 2FIKB 4W6YB 3CXDL 4U1NA 3T1FB 1JRHH 4P4KC 5IVOA 4ZO9A 3TBYB 4EN3D 3MTRA 2BSSB 1DBKL 3C5ZA 4EOWH 1MVUA 1QRNE 1RUKH 1YECH 1F02I 1XZ0A 2CDEB 2A6DB 5BRZE 3FQWA 3QNYB 4APQC 5CD3A 4OGXL 3DI2B 5C0JB 1MEXL 1CFNA 1JV5A 4TUJA 1HH9A 4LNVA 1HILB 4KI5E 4OZFA 2NY4D 5JW5B 3RY6A 3F7VA 2WK2A 2YD9A 4D2NA 3V6FA 4RWYL 4O4YL 3QIWA 4KROD 4MQXD 5EUOB 3I50L 3QPQC 1ONQB 2B5IC 4PV8B 4QXTA 5ICXB 5J3HC 1CE6B 4Z5RA 1KNOB 2HVJB 1ADQA 3TO2B 3BKJL 2C3VB 4JPIA 3HB3D 4HS6A 4H1LA 1I8KB 1P7KA 2IAMB 1FZJB 3P73B 3MNZA 3QQNA 2VLRD 2OJZH 2VZTA 3RWIA 1KEGH 5H35B 3WIFA 2F58L 3I6GA 5J1AA 4NUGH 4L4TA 3JV6A 2A1WL 4JO3H 3JWNC 1U92B 2EXWD 2MPAH 2VAAB 5TDNB 3BT2H 3O6LH 4OLYL 1EXUA 4LSRL 3SBWC 3SY0B 1S7QA 3Q6GL 3WIHA 1IM3B 4LASL 1MQ8A 4AT6A 1T2QL 2Y7QB 4OGYH 5JHDB 2WBWB 4YHML 1BECA 1DBAH 4F7CB 3NZ8B 4CMMA 2A74A 1GIGL 4N0UE 4LLQA 1DN2A 3RL1A 5HHQA 2R9HC 3KG5A 1J0IA 5F7NC 2ICEA 1GAFL 4KC3B 5D4QA 2H32H 5KSUA 4QT5B 3U9PL 2A6IB 4MSWB 5CLTA 4MD4A 1MWAB 3VW3H 5F7EL 3QHZH 2EDNA 4C4KT 5EBLA 1K2DA 1MIEL 4PRIA 5EWIL 1QG3A 3OAZK 2CPCA 1FFNA 3BZ4B 4R2GC 4ZYKB 2FGZA 3BN3B 1P4BH 5DURD 1MCIA 2FJGA 4MD5B 5EDXA 5F3HA 4LVNC 1CGYA 1NKRA 4OCSH 5T5NG 2AV1B 1HN1A 2XWTA 5DEGB 5ELIA 4FHBD 1RUML 4OIIH 1NCBL 5FUCC 4LCIL 1KPVA 3TIDA 1K8DB 1LNUA 5F7DA 2AV7B 3CDGB 4K94L 1SM3L 1PJ9A 3IFOA 3N9GL 5I1KH 3O3UN 3HC0A 1UWGH 2ARJB 4J12A 2QBWA 3FFDA 5J1SC 1FPTL 1UCTA 1IAOB 1X5IA 2UY6A 4G8GD 3JTSB 4K3EH 5IOPB 2YR3A 3HRPA 4KKLC 4KKCD 5KVFH 3MRMB 2H8PA 4KKBD 4OLXH 1A6VH 1CR9H 1LDSA 3F58H 3MA9L 4U6XB 4NHUA 4PRPD 3L5HA 3UP1A 3PQYD 2JB6B 1A1NA 3U36A 2DQUL 4JDZB 1QR1B 5EUOE 2NW2B 5E08L 3NH7L 4O51A 5HHVH 1RIVH 1VEMA 2VDLH 3DXAD 1BFOB 5E8DL 1H15A 5IHLB 1I7TA 3H42L 4RMSA 2VL5A 1EO5A 3CVIH 5IJKA 4I3SL 1AY1H 1TXKA 4GQ9H 3BESR 5I1IL 3C9NB 5EIQA 3CUPA 2C3HA 1GGIH 5EIVA 3OAZH 4Q9RH 2MHAA 2PO6B 4WWID 5IWLC 1J7VR 1RZ8B 2Q3AA 3BWAA 4U6HA 1T20A 1JK8A 1JPFA 2DQTL 2E7LA 2WAHA 1N59B 4H25A 1Q0XH 4YLQT 5GISH 5J11C 2FH6A 3AAZB 3TBSB 4AL8H 3GBLA 5ID1B 2PF6A 2V2TB 5DMIH 4K7PH 5ICZA 1WTGT 3T0ED 5JHDE 3TVMC 4Y8AA 3F12A 3LKSB 4Z7WA 1LO5A 1XGPA 3QPXL 5FYKH 4MA1B 4YO0B 3QFJB 3W2DH 4Q9QH 2VMFA 1J1OH 4LVHC 3S96A 4E9LA 1RZJL 5JIHA 2DWEB 3VI4E 5E5MB 1ETZB 5E6IC 5K9OA 2E7MA 5D1ZA 1FC2D 2Y06H 1K4DA 5I8OH 2G75B 1NFIA 3TBVA 5E94B 1T1ZA 3VXSA 4YHIA 4NKIH 2UVEA 2NYYD 5F9WC 2FLRT 4XVJL 1G0YR 3SCMB 1U58B 2ZOLA 3BP5B 2OSLB 3OPZL 3NZHH 2G5BA 1ZS8A 1X5LA 1R3JA 1U42A 4X5WB 4FRWA 4KJWD 3VFWA 5I0DA 1ERNA 3VFTB 2F74B 2VLJA 1UFUA 3F62A 3ULUL 4LSDA 4TOYH 4G7YH 1YPZB 2OLDA 2VXVL 2MQ0A 4M62L 1R24A 3DSFL 1QTYT 1M05B 3BSZL 4UU9A 1KCUL 4JFOA 3SEPA 5CJXA 1U3JA 4OZHF 1A1OA 2GJ6B 4R4BA 1MCJA 5JO5B 1PG7X 4Y4FD 4TTDD 2QHLA 5E4IA 4WHYH 4LDEB 2N1KA 4G43A 4I48B 5I1CL 1U93B 3RVVC 3CFEB 4QHNB 3BKCH 3H7BB 1QA9B 5KS9B 4UINH 5C08D 3D2UD 3ZYZA 4AEIL 1AGFA 4XP5L 5JXAH 5DJDA 3CMOL 3CZFA 5J12C 3KPRA 3RNQB 4WWKA 4B50A 5LBSL 5E9DA 3OXRB 1DQJB 1AGCB 3TP4A 3EOAB 4DOHB 3S35L 1A6AA 3O9WD 1I3VA 3RGVD 3ABZA 4EUPH 1P1ZA 2GW5A 1JRHL 4RGMC 4M9PA 3TN0C 4NO5A 4RMUA 1A3LH 1DLFH 1GSMA 3L5WA 2O5ZL 1W72H 3F7RA 4AENA 4EOWL 1RUKL 3AU1A 1YECL 4FFWD 1DTUA 2QQLH 4WFGE 4OQTA 4GMTH 4M6AA 4LLVB 1H0DB 3X3GH 1AQKH 1IC7H 1ND0B 2IMNA 5CKAA 1KPUA 5MEQA 3RWCB 3HNVH 1C16A 8CGTA 4X99A 2P4AB 4U1JB 1I9EA 3ZSTA 3GSNA 4R97C 2P24A 1ZLVK 4L8BA 2HRLA 4EN3B 3QZWA 3L7EB 5SWSA 1OF2B 3ETBF 2BY0A 1BOYA 4WGVB 1QSEA 2VDPH 1LE5A 3ZTNH 1TENA 3QFJE 2NY0C 5EA0L 3SDDD 1DQLH 2DJ4A 4KXZH 1WAAA 3D18B 1KEGL 5B38B 2NY4B 3K4AA 5DR5H 2UWEB 3D39A 1S7WB 5C0CD 1O7SA 4G9DB 2YPLA 4NUGL 1XF2B 3HE6D 4KROB 4HKXB 4JO3L 3ESVF 4WI2A 3RJQB 5C9JA 4B0MM 2MPAL 3ZE1F 4JVUA 3BQUC 3MJ8B 3BT2L 3O6LL 4Y5XC 3QUZC 1A8JH 4Y1AA 5EU4A 4ZXBD 2EH8H 5F97E 4OGYL 2WBJA 4LP4A 2F54B 1DBAL 5DRNB 1U3HD 1CGXA 1UWEH 4R8WH 4N1EA 1DEEA 5HHNB 3OQ3B 1YPZE 3DI3B 2LABA 1RIHH 2XXCB 4WHTA 5IW6B 5F44A 3MRNA 1YA5A 1PYWB 2HFTA 4YDLB 3QDGA 3PHQB 4ONGH 2X4UA 2GJ6E 4IHOB 2Y07H 3QHZL 4U1MB 2EIZB 3ZHKA 3VWKD 4PJIF 4FFVD 1P4BL 4H88H 3VGBA 4I1NB 1ZLVH 2R4RH 4OCSL 4X8JA 4WU7B 2CKBB 3LPGA 5KS9E 1MFCH 1T2XA 3IFNH 5ESVB 4OIIL 5CP7A 4ELKB 3BRFA 3FQNA 1YY8A 4WI9A 4M48L 1XCQB 2Z31A 3H8NA 5C09A 3UAJD 4X80H 3WNLA 5I1KL 4DOHE 1UWGL 5KVEH 1FFPB 5DURB 1BAFH 2HT4C 1EJOL 3BRGC 1ES0A 2BNRD 3VJ6A 5FEBA 3FKUS 3SGJC 5K9KB 4K3EL 1FH5H 3GB7B 5F72S 2R8SH 1IRAY 2R1YA 2Z8RA 4G8FB 1AD9B 5KVFL 1IL1A 2EE9A 4OLXL 4PJBF 3UBXB 1A6VL 1CR9L 3U7YH 4ETQA 3F58L 5I1HH 2IQAB 1HEZB 2RCSH 1K3ZA 4QNPF 5DK2B 32C2B 1OSZB 2IH1A 1PBYA 2D0GA 1OLLA 2G60H 5HHVL 5JR1H 1RIVL 3RIFF 2VDLL 3O0RH 1HQRB 1BBDH 4G8GB 4NC1C 3IAPA 1OGTB 3EYQD 3CVIL 4G6AC 1AY1L 4KJQC 3HMWH 5LJYH 4GG8A 3V95A 4Q97A 3HR6A 1KXTB 4D0DB 2PCPB 2YSSA 3PDOB 5D72H 1CDBA 3HAEA 4NDMB 4PRPB 1GGIL 5F3BB 2UWEE 4Q9RL 3PQYB 1KJMA 4MNQD 1ZT1A 3U4EA 4HLZG 4QRQA 2ERJC 4MAYC 3GSOA 1YY9C 5ESQB 3DXAB 5SX4H 2R1WA 3IJSB 3HCVA 2UYLB 5GISL 1Q0XL 4Z7VA 3VGGA 4AL8L 2BXYA 1U8KA 4JRXA 4K7PL 1MCQA 5F8RC 3IJHA 1MWAH 4X5LA 2F54E 2QR0B 1DUYA 3LS5H 1J0KA 3V6BR 4MXQC 5FYKL 4P46C 3W2DL 3CVHA 3TA3A 4Q9QL 1J1OL 4MJ6B 3PGDA 4N0FA 1LO3H 3TH2T 1B6UA 4QRPB 2CIIA 1L9MA 2XWJA 4YHLH 1AXIB 3KYKH 4P2OC 2Y06L 3KDMA 2W0FA 3T0EB 5I8OL 1F6AA 5CJQH 1BEYH 5DJZA 3RWHA 2VDNH 4NKIL 2PXYC 5IHUH 3CX5J 4GW5A 4OCXH 4CAGA 1IFHH 2NXZC 2ZPKH 5MHSD 5GS1A 4I5BA 3BPNC 4ESKA 3MSPA 2AKRB 1XR9B 2PTTB 4P2YA 4TOYL 4NN5B 4G7YL 4PJ5B 1BM3H 3QIBD 2Y5EA 4X6CA 3LB6D 3ARSA 3GSUB 1ZSDA 5GJTH 1CF8H 2DAVA 2P5WA 4PGZA 2HLAA 5GSRA 4NBYB 5DDHB