1Y0LB

Catalytic elimination antibody 34e4 in complex with hapten
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
226
structure length
226
Chain Sequence
EVKLLESGGGLAQPGGSLKLSCAASGFDFRRYWMTWVRQAPGKGLEWIGEINPDSRTINYMPSLKDKFIISRDNAKNSLYLQLSRLRSEDSALYYCVRLDFDVYNHYYVLDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Catalytic Antibody Fab 34E4 Light chain
publication title Structural origins of efficient proton abstraction from carbon by a catalytic antibody
pubmed doi rcsb
source organism Mus musculus, homo sapiens
total genus 40
structure length 226
sequence length 226
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2004-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1y0lB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1y0lB01
5GS0C 1FNEB 4X7DC 3DMMD 5MEQA 3O9WB 4GS7C 3FO0L 4Y1AE 2AXFA 5CMAA 3NCMA 2YPLB 3D3VE 2J8OA 4LQFH 3VFGH 3MNVB 4YGAB 3MUJA 3R8BB 1OB1B 1T6WA 5IVZB 4QWWD 3PIQB 2AJVL 2Y1VA 4PGJA 5ESQA 2R0LL 3LEXB 5B3JF 5GGQH 4DUWA 4YHYB 3TF7C 1QVOB 3EYFA 3SN6N 1QYGH 2F53D 4LCYB 4QRPE 2OL3B 5GRJL 4M5ZL 4P23B 3ZLQC 1PY4A 3TIDB 3B5TA 1DLFH 2LU3A 1Q9KA 4X4ME 15C8L 4RIRA 5GGVH 1I1AC 1MAML 4HXBH 1PQZB 3JWOL 3RU8L 3T0EE 1EGJL 1DBAL 2Y5EA 4YIQA 2VXQH 5IEKA 4U1HA 1V3JA 3E2HC 5DSCB 4FFYL 4YDLC 4JPIB 3TT3L 4N0UA 1UJ3C 5I1JL 4MJ5A 3UX9B 1DUZB 5A2LH 4APQA 3VGAB 1X5AA 3UTSA 4OKDA 4DGYL 5IEHA 2JIXB 4ZS7L 5EC2B 4IIQC 1FNSL 4GRWB 3SDDA 5E9DB 1DN2A 5DJXB 5GGTA 3NOIA 3OKKA 4PJDA 5L2KA 2R0ZL 3QUML 1JPSL 1ZLUK 1UWGH 4HIEA 3IDYB 2IAMA 2VAAA 4MNGE 4P9HC 4O9HL 3ZSSA 3H8NA 1LP9B 2N56A 1DQMH 4TVPL 1OT1A 1DLHB 4MJ6B 3MGAA 4U1IB 3FRUA 2LTQB 4U6YA 3VW3L 5L2JA 3O8XD 1VFUA 1RIUH 4H5SA 4AH2A 1MCOL 4Y2DB 5ACZA 4ZNCD 2IH1B 1AXIB 2LVEA 5E8OB 1S8DB 5FF6B 2BHYA 1B0WA 4ZAKC 4KMQA 3PABA 2J8UF 4OB5H 1ZVSB 3LQAC 1DANT 1Q1JL 4CJ0A 3O0RH 4QTIH 3FB5A 4ZPVB 5I6XB 4KDVA 4ZD3L 2JTDA 4YNYA 3PP3K 1KLUB 1I85A 3MLXH 4YBQC 3ZTNL 2WZPD 4RAVB 3MBEA 4I0KA 2BMKA 4XNXH 2VDKH 4PJEE 2FEDC 1UVQB 3MRIB 2YS4A 3BP6A 1FVEA 2BOCA 2WUBL 4OTXH 4MAYB 3V5KB 4K9EL 3E8UL 2NY4B 3QQ9D 5GS2D 3GSNL 4MXVE 2C7UA 3EHBD 1I1CA 2Q87A 1DVFC 3DPBA 5ETUB 3D9AH 4JO3L 1EMTH 5B4MC 3QIWD 4GG6F 4HUWA 1HKLH 1DBKL 5ID0B 1J5OL 3GO1H 2CRZA 4NRXB 4HPYL 5JW4M 5ITBH 2Z93B 2HKFL 2C3XA 2NY5C 4HFWB 1E6JH 5F9WC 3MJ9L 5ESQB 5HJ3B 4Z0XB 1H5BA 1MCPH 4PJ9B 2OTWA 2DQDL 4YK4C 1GC1C 1QBML 5C0CA 2DD8H 1FFPB 5IESL 3F5WB 5HDQH 3BUYB 5EO9A 4H20H 1UB5A 4YX2H 5DWUH 1A7QL 4DK6A 2HFTA 4R2GC 3M8OH 3PGFH 5TE4L 1ORSB 1R3HA 4M5YH 4WWKB 4YJZL 1D9KB 4I48A 4RMTA 3MOAH 1CGWA 3ZT5A 3L95A 3SKOA 4YDJA 2XOTA 4KAQH 1DEEB 4JM4H 2ICWA 3OX8A 4RSVA 1CDJA 3BZFB 1JHKH 5GGTH 1XGUA 3VXQA 5I66A 3HC0B 3OAYH 1S3KL 4HUUA 1ZS8A 1ZSDB 5SWQA 4GQ9H 4NO5A 3MGTA 2Z4QB 2XWJA 2VWEE 2ICEA 4YXKH 2VB5A 2RFXA 4NM4H 5D1QD 3U4BH 1FNFA 4APQB 1BQHA 3UTSB 1UZ8B 4WDIB 4NBZB 2DTSA 2K7QA 1TLKA 4XCFL 5D2NA 1YQVH 2LFGA 3FQRB 3MZGB 2GAZA 3VJ6A 4DGIH 3BW9A 3OGCA 2VAAB 1NCDH 1NGWA 5DK0A 1U3HB 5C92A 5BV7C 1CGYA 2DTMH 5I1KL 1LO0H 2QSVA 3AAZB 5C3TA 3FRUB 2W1NA 1BWMA 3U83A 1FPTL 1W2KT 5JPNA 5EO1A 3SDAC 2H6PA 5ITFB 3RA7H 5CJ5A 2P48B 5GRXG 5ICZB 1OQXA 2XXCB 5HGDA 2DBLL 1DBBL 1RUMH 3UBXI 1XGRB 3U36B 3FO1B 2ZUSA 1ZEAL 1OD9A 1OVZA 5BJTA 4MNHA 3WIHL 2Z91A 4O02H 4I9WE 2GYSA 4LSTH 4U1MA 1WWBX 2MCPL 4FXGB 1JZ7A 2R9HC 2PO6C 1SJHA 3O2DA 2BOCB 4ONGL 1K5NA 4YQXH 3P0VL 1T7VA 4Z7UF 4ZO7A 2VZ3A 2BY0A 1ZHNB 1AXSB 4NBYB 1C5BH 4PJFF 2PTUA 4QXGL 1DZBA 3WO4B 3PJSB 4HDIB 4NUJB 2DQFB 3QSKB 2BY2A 2VLJA 3HRPA 5D7SL 3TT1H 1OWRM 3SDXE 5DO2D 4BZ2L 5F1KC 4PJXF 4LGRB 3FO2A 3I6GB 4OLXL 1YMMD 5DJAA 3IU3A 2WLYA 3GMRB 1OCWH 3QCUL 2F15A 2FO1A 4NNPH 4JRWA 1EFXB 1J05A 4O5LL 1RZJL 3TBVB 2VZSA 5CJQL 1WBZB 4XC1L 1RUPL 1T5WA 2X42A 4FXKB 4J8RB 3IETA 1OT2A 4NO3A 4RGOH 1P7QA 3C6LB 1B2WH 4BZ1H 1OARL 3BZEB 1AJ7H 1DQDL 1T7XA 2AW2A 4UZGA 4OCSH 4ZXBC 3RWEB 3MODH 1PKQB 5JO5A 2ICWB 1NCAH 3WHXA 2WUCH 1TQCC 2GUOB 2BP3A 1EBPA 3DUUA 3PQYA 4HUUB 3CAFA 1QSEE 4LHJB 1HHKB 1FFNB 4FNLL 1S7XA 4K3DL 3T8XB 4GKNA 3D2UA 3CDGB 4LQ1A 3TV3H 5EBWB 5FB8B 3CX2A 3I9GL 2FGWL 1BMGA 1NBYB 1D5ZB 1LDPH 4QF1A 5D96B 3ZDXF 2L7UA 3BMWA 3WYRA 1B4JH 3MRKB 3V0VA 5IJKC 2Q8BL 3FN0H 4KTDL 4HJ0D 1NMAL 2F8OA 2W65B 4OIIH 2BXYA 3KPNB 4TUKL 2V2XA 1UWEH 4AG4L 1NL0L 3IDUA 2KQMA 2JIXD 5F6HI 4V1DA 3RL2A 1FJ1A 1TIUA 5DD5H 5EPMB 2LE9A 5E9DD 4MD5A 3O2VL 4JRXB 3O2DH 1XIWC 1FAIH 1NANH 3EOTL 3TCLB 2GITA 1RJZA 4JCLA 1H3UA 2X4OA 4JQIL 4OLWH 1UKTA 3H9HA 4JGUA 4IRZL 3S3JA 2Y07H 2A77H 4MNHB 4DKFH 1CFVL 5E6IB 3TZVC 1WBYA 3CIQA 5C07A 1OY3B 3B9KB 1WZMA 5T1LD 2DF3A 4X99A 5D71H 4JZOB 1FZMA 4Y2DD 2BNRD 3NIFE 4XVUC 2EDNA 4XC3L 4IJ3C 1A6WL 1NCCL 3DBXB 2EH8L 2F5AH 3MCKB 3P0YL 1YEHH 1Q0XH 1YUHB 2FH6A 1T5XA 3WL9B 4R8WH 3V95A 5C9JA 4Q2ZA 4MXVF 3ALPA 2UYLA 4UU9B 4FFZL 3U82B 2HT3D 4ODXA 4L9LB 4WVRA 1QR4A 5T5FL 5I1DB 4YHIA 2NY2C 4YC2C 4C4KO 4F7MA 4MZ3A 4P2OA 4HEPG 3QUXC 4LSQL 4I4WB 4EKXA 2W92A 5EUOA 5D2LE 2NY0C 3ES6A 3EYOB 3EO0A 4N0CD 3SCMB 1I9IL 3MV7A 3G6AA 1KGCE 2H2PD 4CW1B 5C0NC 1KT2B 1FNLA 3V4VH 3GEWB 2BC4A 1E4WL 2H2SD 3MR9B 4JN1H 1OHQA 3RBSA 5L88L 2JJTC 1QEWA 3ARSA 2QR0A 3VGFA 5EIIB 1VEMA 5TGBB 1RJYA 4P2QA 3T4YB 4OAWB 1K4DA 3QNYA 3MTRA 1JP5A 3ALWA 2VNCA 3VXRE 5HHXH 4XXDB 2C1OA 5TDPB 3DV6B 1YEKL 4LLUA 3EJZC 5AZEH 2W0PA 4OI9A 2R0KL 1IC1A 12E8H 2Y06H 5MENA 4Q9QL 1DE4A 4UT7L 2NW3B 2AJYL 3BGAA 3KYKH 3U0TB 1P84K 3SKNB 5JXAL 4P4RB 2ATKA 5JDSB 4ERSH 2NX5B 5JHDA 3HE7C 2OR9H 5DJYA 2YRLA 3MLYH 4APQD 3UTSD 4J3UA 1FYTE 4H8WC 3C09B 4L4TA 1KB5L 4I0CC 2NNAA 4LVNC 4GXVL 2EZ0D 3D25B 1Z9SA 4XVJH 3SDDD 1INEL 3I2CL 4O58L 3WS6A 4PREB 3SOBH 3D0LA 1HHJA 4TSCL 3S36H 4F9LC 2CIKA 3CDCA 4FQLH 2XQYK 2G9HA 1U3HD 4HKXA 4PGDB 5I1IL 4NT6B 4FG6C 4NC1C 3EOBB 1UKQA 1F8TH 2VXVH 4YHML 3MXWH 1JVKA 1P4IL 3CVHB 1IAKB 4PJ7E 1K85A 2J8UA 2P8MA 2YR3A 2JB6A 1I3VA 2HVJA 1X3DA 4LLAA 2E9WA 3E1F1 5EU7E 1JPTH 4PJGA 4ORZC 5JIKA 3RTQC 3RWHB 1I7UA 5DF0A 5JLZA 2DYPB 1XGPB 3DMMC 1LK3L 1T5XB 4QGTA 3BQUA 3VWJB 3MLVL 5FKAA 3CMOL 2IFFH 1IM3A 5LCVL 1LILA 1TJIH 2QKIA 5KAQF 3GDBA 3I84A 3DTXA 1NBZA 1A7NH 4QWWC 4X9FA 2HKHL 3D87B 2VXTH 3VRJA 4DN3H 2VDML 4G8EB 1ZV5A 1G6RA 4YDVA 1JZ5A 4OZFH 3J8F7 1I8MA 2NXYB 5FK9B 3WSQH 4LSVL 5CP7B 2P5EE 4YWGL 3WMSA 1QFUH 1N26A 5F88A 3OKEA 1VPOL 4HUXA 4XNMA 4YR6A 1NMBH 1F58L 3SQOL 2ZOLA 1I1YB 4J3OC 2A9MH 5GJTH 5IR1A 1E28B 2BC4B 1I1FB 3QPXL 1YZZA 4I18A 4ZODA 3H7LA 4J4PC 5C0CD 3C5ZA 3OMZA 4WU7A 4KKAD 2A73A 3QXAA 1KLFA 4Y4KA 4XP5H 2PYEB 1CBVH 1RHHB 4QRQA 3EYQD 1CQKA 3EJYC 3IDGA 4W4NA 4HJGB 4PFEA 3GI9L 3WHE1 4N1EA 1A5FH 1T04A 3UPAA 4W68A 5KN5A 2I60H 5BS0A 3RWDB 4ZFFB 4OCYH 3IU4L 5BZDA 4RZCA 3LKQA 5DC9B 1FH5H 2ZCKH 5J8OA 3D18A 5I1CL 1RZ7L 1IL1B 1EXUA 5GZOC 1W0VB 3MRNB 3LIZL 5HPMA 2B1HH 3NTCL 4K23L 3MOBL 3VG9C 4XRCA 3O8XC 2R1XA 1JZ6A 3SJVE 3RUGE 5GIRB 5C8JB 2UVEA 4W6XB 1FV1A 2FWOA 2AKRA 3E6FA 3DHJA 2D2OA 4U2YA 1A6ZB 1IZJA 5TDOB 4M4PA 1XF3A 1PZ5A 5D1ZA 5LWYL 1RZGA 4HIIA 2VC2H 5ISZE 5JIHA 4TVPE 1BPVA 1I75A 4OLEA 3W0WB 3NZ8A 3VFOB 5EBLA 5F1IA 4YHLL 1FFOB 2OXHA 3MLTA 3VGGA 3L1OL 3WFDH 2BDNL 5IT2H 4OQTL 1MJ7L 5HHMB 3C60C 3ULSA 4JRXD 4DQOH 3VFVA 1NAKL 2JB6B 3G6JF 1A1NB 1MIML 4KVNL 2JLLA 1CD1A 4PGEA 1E4KA 1HINL 1KIRB 1YECH 5GRYA 1JNNH 4I3RL 1FIGL 3OR7A 3QDMA 4AEEA 3F7PC 1A3LL 3RY5A 4CL7A 1DQLL 4MNQE 4QRSB 1IAIH 4WFFE 4TTDD 2J5LB 4JREB 3BQUB 5CGYD 5BRZA 4BYHA 2PXYC 3HS0B 5TQ2H 3UTTA 1H15B 4DEPB 4F7PB 3QZWG 1RK1B 4QGYA 4G8FB 1XCTB 4HIJA 4PJFA 5I2IB 4GBXB 3O3BA 1MJJB 2HLFC 4MAUL 3SGJC 4GSDL 1G6RB 2HFFA 1ACYL 1MHPL 4M6AA 5GGSA 5IMKA 1Z6JT 5KSAC 5I19H 3LS5H 5JQHC 4HEME 5CD5D 4LARH 4X83A 2E9BA 2AEQH 4Y1AA 5IMOB 1WK0A 4XVTH 3D3VA 2QHLA 4XNMB 2K9UA 4XCEA 5FYLL 1LNUB 3U7YH 4EOWH 2VO5A 4NZTH 3NABH 2H8PA 3QNZA 2ZOLB 5FIEA 1OGAB 1U8IA 3DI3B 4LVOB 5D5MB 5CWSB 2O61A 5HI5C 5K9QG 5I15L 2V5MA 1T2JA 4M02A 1JPST 4TULL 5F7LB 3HAEG 4QRPA 4EBQH 2DQGH 3DROA 1PX4A 1MNUH 2DMKA 5EU5A 1KCKA 3MA7A 1G7IA 4L3EB 4LCIL 2DQUL 4XCCL 4QRQB 1M71B 4G5ZL 4LSSH 5EBMA 4HK3N 4HV8B 4IMKA 4X4MA 4CADA 1P7QD 1DQTA 2FHFA 4UT6H 3RWCB 4GRLA 4M3JA 1SEQL 3VWKB 4P59L 5ENWA 5B21A 3T0EA 1TVBB 2N4IA 1HI6B 3R1GH 2DJ4A 3PQYD 4OFPA 1KUMA 1BQLL 4GAYB 1SYVA 4WFGD 1JTOA 3NZHH 1OGTA 5KZCB 3WE6A 3NFSL 4MMZC 4HMDA 1DBJL 4XPHL 1WSST 1AGBB 2ZCLH 2YBRA 4PRIB 2EDKA 5F97E 3SE8L 3TIEA 2VISA 3ZDZF 4AEHL 1IEHA 2HWZL 4NBXB 3GIZH 4WO4A 5HGAA 2Y9RT 4CVZB 3UXFA 1FO0A 2E7MA 1KELH 4M7JL 4M7KL 3C2AH 3C5SB 2OQJB 1C7TA 2DWDA 4V1DD 1NBVH 3NCJL 4M43L 4PR5A 4PB0H 5LAXB 3UTZA 1NGZB 5I1AA 4R0LA 4ETYA 1J1PH 3S88H 4QHNB 5DD3L 1KEMH 4XWOC 5JW3H 3S7GA 1VSCA 2BY1A 4HK0B 4PJ7F 1YY8B 4G6JL 3OKOB 1BIIB 2KDGA 3E6HA 1CXIA 2QQLH 1ZXQA 1SQ2N 3FT2A 3HNSL 5IW1B 1KULA 2CUHA 1ZWIB 3DSNA 3LAFA 2DKMA 4NKOA 3CDYA 3SY0B 5I75B 5C07D 3MUHL 1BECA 4D9RE 1ZMYA 5DO2C 4PJEA 4Z95L 1MCBA 3BE1H 3KR3H 4HKZA 5AYUH 3FMGL 3WXVH 2FYYB 3C8HA 1HH9A 1CD0A 4NYLA 5IVXF 5GGSB 3V8CA 4Z7OF 4F58H 1LD9A 3KPOA 1E4XH 1SM3H 1GOHA 2R1YA 1XEDA 4UUJA 1L9MA 2X4TA 3X14A 5IBLC 4OLYL 4EN3A 5KVGL 4LLYB 2WBJB 4Z76A 4XPAH 5E4EB 4KK5D 2H8PB 1IT9L 3HI1A 3SDYL 3PP3H 4BQ8A 3VI4F 1A3QA 2GT9B 1KTDA 3G08A 3J7HA 5L6YL 3DUSB 3O3AA 3AREA 5TDNA 2RCSH 4Z7VB 4YGVB 1NANI 3V52H 4OSUL 4U1JA 4NHUA 3ULVE 3E3QE 3WNOA 3VFPA 3LRSA 2YN3A 2CD0A 4M8VA 1AY1L 4NKIL 2VRAA 3MV7D 3DHMA 1YEJL 4X6BB 5EBMB 2FB4H 4GKZB 1YJDH 3PGCB 2FHBA 2D3VA 4OGXH 5DD1H 1S7QB 3P9WB 4KFZC 1MCSA 4RISL 4L5FL 1OSPH 2B0SL 5DQDL 3MRQB 1ZTXL 3EO9L 5EWIH 3S97C 1FG9C 1QO3B 1SYVB 3NPSC 3S37H 4IOFC 1JGUL 4V2CB 3SE4C 3RDTC 4L8DA 1KJ2A 4I8DA 2FEEL 4K94L 4U1GB 1KJVB 5F9JA 1KNOA 3EFDH 3D85A 2HT2D 5MEND 1OAZL 4IMLB 4TSAH 5KVFH 5JOFA 3UP1A 4E41B 3DYPA 5JHDD 4HKBA 1A3RL 2EYSB 4I77H 4MNGB 3KNBA 3H0TA 4HWZA 4JDTH 4PRAB 3LN5B 1ZT7A 3ILPB 3X3FH 5EDXA 4OBRA 4QNPE 4HS6B 3GHEH 4L4TD 4EIZC 3PGDA 2E27H 5TJWK 2QTEA 4A2LA 4JG0L 5E2WL 3BGFB 4GW1A 5F7EL 2XV6B 4FQXA 1B88A 5HVFB 5KTEL 3W0WD 3VRIA 1IKNC 3ARUA 1EEUA 5IFAH 2Q20A 1PW3A 1R5WB 1IM9A 4X5XB 1XF1A 1FVDB 1BGXL 1S9WA 3PWNB 5J12B 2HT3C 5J1AA 1IC7H 5I8EA 2F8VA 4PJEB 2JJUA 4NIKB 4A6YA 1T2QH 3DVNB 3MC0A 2GTWB 5EOCH 2XNAB 4KQ4H 1W8OA 5F9AC 3IJSA 4ZYKB 2G5BA 4JQVC 3RGVA 1TZGL 1OW0A 3OV6A 3BDXA 5GPRA 3MROB 1HCFX 1OF2A 3BQUD 4N0CC 1J1XH 3DSFH 3KXFE 4N8VA 1N5YH 4D9QE 3SDXA 4YHZL 3VFUB 3DXAB 1T7YA 2H2SC 5E8DL 5MHSD 2HJLA 4HAFA 4LEOA 5M94B 1C12B 1UM5L 32C2B 3HUJE 3NGBB 3VG0L 1GGBL 4Y4HA 4OCMC 3KJ4B 2XTJE 3HPJA 3UJIH 4MQ7A 1T22A 4NQEE 5IB1A 4DVRH 3QIBC 1LE9A 3QQ3B 4BFIA 3FQWB 1A4KA 4UT9H 1YYLL 3HMWL 1CCZA 1KJ2H 1PKOA 1X5YA 2ZPKL 4HIXL 1KIPA 3TJEL 2R8SH 4EEEA 4I0PB 4XPBH 1XFPA 4WI8A 5C0IA 4LLMA 5GHWH 1JYXA 5E5UB 1D6VH 2IGFH 1MFAL 3C5ZD 3LQZA 4Y4KD 1QSEA 4P2RE 3S3SA 1FAKT 2VAJA 2O5XH 1HHHB 4HZLB 3GRWL 3V0WL 4OIBA 4S1SH 3FB8A 3OXRB 4LIQE 3KAAA 9CGTA 4Y5XA 2JF1A 1I3RB 2VTFA 3SDDC 2CKNA 3SO3B 3VWKD 3ZTJG 1ZE3C 4AL8H 2OMNA 5BS0D 3O2WL 3X3GL 5A3ID 4O2CA 3Q0HA 4KMLB 2IAMC 3OKMA 2A0LC 4Q0XL 5CZVL 1RJLB 2HTLC 3RAJL 3FONB 3MCLL 3B9AA 4Y4FA 5KSUA 5KZCD 1OOAA 2VL4A 3QPQD 1QHPA 1KCRL 1JV5B 1MCLA 3QUZA 5DRNA 4ESKA 3LSOB 1ZT7B 3TH3T 1AKJA 4LL9A 4S1QH 3QUYB 1K8DB 4X4XB 3MV8E 5DQJA 4A6YH 3ESUF 3W9DA 3DURA 3UAJC 4ELKA 4OM1H 1DFBH 2PR4L 5D1ZD 3HCVB 3L5JA 3INUH 1ZT1A 4XP4H 1NAMB 3BP7A 1XH3B 2FO4B 3O6MH 3T0AA 1F4XL 2RHEA 3G6JA 3OHXB 4YO0A 4P0DA 4U0RC 3ZKMD 1U8HB 3CFCL 3MBEC 8FABA 1AGCA 3L7EB 5DZNA 4RWYL 1WZ1L 5IQ7H 5TE7H 2VDLH 3LHPH 2A38A 3VRLF 1BJMA 3BDYL 4YFEA 2XWTA 3QDMD 1DN0B 1BJ1J 5EA0L 5FKPB 5FEBA 3ABZA 1ORQA 2Y25A 4DKEL 5BRZD 1AE6L 4IDJL 4DAGH 3BPOC 1CK0H 3C9NA 5FO8A 1KTKE 3BWAB 4AMKH 3DX8B 2AJZA 5H37H 1QLFA 1HHIA 4M6MH 1MQKL 1JWUA 3QEGL 1H5BC 1S7TA 4X80H 1F6AB 2YUWA 4Y88A 4ALAH 5F70A 5ECJE 4WGVB 5D2LA 1YYMH 4HS8L 1MEXH 1OTUD 4P3DB 3S34L 2PKDA 3TA3A 2X4NA 4Y1AD 2VYRE 5E8EB 1A4KB 3D3VD 3BRDA 1A0QH 1AGEA 3EYQC 4AIOA 1VKXB 2VMFA 4P46B 3Q6FB 4ODVH 1WF5A 4LSUH 1HSBA 4BFGA 5I8OL 3VA6A 1SBBA 4RGNB 4HWBL 4NHCH 1GL4B 5HI3D 4XX1G 3VXRA 5CKAA 5F7KC 1PG7X 2DL9A 5EULV 3CZFB 3NA4A 5I30L 4Y7MA 4GRLD 5HYQB 2MJWA 2ZG1A 3F8UB 3T0ED 4MD0A 1OM3L 2R2CA 1A7RH 4G6AD 4ONHA 1SY6A 4PRPE 1V5JA 2CXKA 3H3KA 3V6OC 1TNMA 4KJWD 2PUQT 4EI5A 1NQBA 3L9RA 2VL5B 2FIRT 4CN6A 5FV1L 1FYTA 1F00I 1U36A 1NC2A 3BKCH 1T1YA 2APVA 4UV4H 3K81A 5J89A 3PHQA 4LSRH 4JQXC 2Z31B 1VA9A 4Q9BA 5DFWH 2HN7A 4QNPF 3TVMB 4IRJA 4WO4D 2AK1H 2IANB 4G80B 4WI2A 4YXHL 1EVUA 2VXUH 3HMXA 1PBYA 1P9MC 3OAUH 4NZDA 4ONFL 4LHUG 5CGYC 5D8JL 4TOYH 4PJ7A 4PGBA 4J2XA 2KPNA 4JM2A 2HFGH 4JPKL 3BRFA 1OAYH 4UIMA 1NCWH 5GGRY 4NN6B 5LGHL 4JRYB 3U1SL 2EO1A 4I3SL 4JFQB 4EUPA 2EDFA 1CU4H 1ROWA 5HPOA 4X6EB 2AJXL 4OLZL 1UM6H 3WUWA 5IVXA 5SX5K 1CLYH 3LB6D 1QLFB 4EDXA 3QAZB 1KENL 4N0YL 2OI9C 4U1LB 3QHZH 4U1KA 4PYGA 4L8SB 1NUFA 4CKVX 4PV8B 5D2LB 3MJGX 1S5IH 3KPMA 4U0QB 5ADPL 2P5EA 4WWID 5DFTA 5J1SC 4X0KB 4RWHA 3HUJF 4Y5YA 5EZOH 4EN3D 2OS7A 3MRRA 4RRPG 2IADA 3EGSB 3O3DB 3C8DA 1Q9OA 4B5EA 2J2ZA 2BVYA 1OAQH 3W11C 4GW4B 3I85A 4WUKH 2H1PH 4HUVA 3M45A 4LLDB 2CJUH 2GI7A 3WFEL 1N6QL 1SY6H 2J4WL 3QULA 2AV1A 3BISA 3P4LA 5C09A 3QXDB 3ZSTA 4BSWA 4QY8A 3SGEI 1BP3B 3GBNH 3PWLA 2MKLC 1X6NA 4R7NA 2I5YL 3N1MC 5E2JA 3LKSA 4ZSOE 1ZGLB 3HZMA 3NCBB 5BOPA 1Q38A 5T3ZL 4JO4H 4YE4L 5IUSA 2YD6A 5GSVA 1EGJA 2VABA 2VITA 1WIUA 4PJCB 4IOIB 4FA8A 1N3NB 2YSSB 3MBXL 3AC0A 4NGHH 1ADQA 2Q6WA 4EI5B 1W0YT 4P5KA 3IVKB 3S3PA 4F2MB 1FYTB 3S4SB 5C0RH 3T2NL 4H1LG 3D85D 4Z77B 3RUGA 2CRIA 2APBA 1B6UA 1VEPA 1WEJH 3ULUL 4Z8FH 5E2UH 1YEDB 5IWLA 4NN7C 3F58L 1LEGB 3DO7A 5MERA 3QUMA 4FQ1L 1YPZF 4Y16B 1FG2B 5ISZA 2ADIA 4EUPH 3RWGA 3X12A 2V6HA 4B0MM 1RULH 3RQ3A 4HIHA 1AGFB 1JGEB 3IFNL 4OCXH 4PGBB 3QUYD 4RFNC 5DZOA 4BH8A 5BO1H 5HYIA 5J6GB 1JHLH 2PTTB 3M07A 2NTSP 3HNTH 3BAEH 1LEKB 3AS1A 3IRPX 4Z5RA 3MSPA 4MNQA 4OZ4A 2YN5A 2X4QA 3VI3E 4WGWB 3Q6GL 1IM9D 4XPTL 4NKMB 4I9WD 2RR3A 1FZJB 2GEEA 3HZYA 3TBYA 4WU5B 2FJHB 5IB4B 5F6HJ 1DDHB 43C9B 5HHNB 2AJVH 5SWSE 2R0LH 3ET9F 1FNAA 4P2OC 1P7KB 1QR1A 3RGVD 2QV2A 2I07B 3GSNA 4MDJA 2MWCA 5I1LB 1UYWL 1DUYB 3KJ6L 4GUPA 4Z7VF 1AIFA 1HSAB 4WI7A 1OAUL 2IPUG 2P5EB 3OBAA 1G7LB 4DWHA 5GRJH 2NMSA 2P5WE 2EXWD 4M5ZH 5GS1A 1VGEH 2RGSA 2C5DC 3P40A 3WDIA 2NXZC 4I1NB 1QQDA 5JIIA 15C8H 3ZE2E 5DFVC 4FMFA 3MJ9A 3BSZL 4QTHA 4OD2B 1RZFL 4GJTB 5BVJA 1MAMH 3JWOH 3M1BA 3RU8H 3JTTB 1DBAH 4Y4HD 4KJYB 1CFBA 1YN7A 1EJOL 5DUBA 5DD0L 1QSVA 4TPRL 1PG7W 4WI5A 4FFYH 4AIZB 5JTWA 3TT3H 1CFNA 2WAHA 5I1JH 3VXSE 3QHFL 4DGYH 1EV2E 2DIJA 1TZIA 4ZS7H 3LKSB 2FL5A 2HT2C 4P46D 1FNSH 5C7XL 5I71B 1BREA 1MCRA 3IFOA 4JHWL 1FLRH 2R0ZH 3ARGA 1JPSH 3QUMH 1NLBL 1B3JA 4XZUA 4M7LL 5AAMA 4O9HH 3ROLB 3WKNA 4OUOA 4XCYB 2XG4A 2YA0A 5C2UB 1HXMA 3IRZA 4TVPH 4F33A 4PY7A 1KSRA 1U8JB 3VW3H 3GMMA 3SJVB 3RUGB 5DHVA 4ZUSA 1XCQA 1MCOH 2C1PB 5D7JA 3GSQB 1JZ2A 4LDOB 3VCLA 1IGTA 2WP3T 4FABL 1N8ZB 4UNVA 2P8PA 1Q1JH 2YKLL 4WV1B 4ZD3H 3WFHA 1JHTA 4WW2A 1V05A 1AKJD 1AO7B 1RUQL 4CU7A 3L3IA 3KLAA 1A7OL 3IXTA 3FZUC 5LBSL 2ZCHL 5HHQB 1U58A 4JFEB 1WWAX 1YEFL 2DWEB 2WUBH 3AB0B 3DRQB 4DN4L 3ARBA 4TNVK 2IAND 1CR9L 4K9EH 3E8UH 2DMCA 5DK2B 4Y2OA 3GSNH 4WUUB 1R3KB 1RFDL 1C1EL 1DQML 2Q7YA 1S7RA 4ZQKA 4JO3H 1YMHB 4X8XA 2E7LA 5F6IB 3WNNA 3GHBL 1HCVA 1X5ZA 3HG1B 3WIHA 2NPLX 1DBKH 1NGXB 1G9MC 1J5OH 3QEQA 5HTSA 4HPYH 3TESA 4JZNA 4M6OL 1NJ9A 1PGRB 3A67L 4M61B 1F02I 3MJ9H 3QCTL 4QRRB 1XGQB 5CZXD 1KCSL 2YWZA 3LV3A 2UZIL 4OZIB 1W72L 4NFDA 2DQDH 1IKFL 1QBMH 3SGDH 3L3JA 5IESH 1A2YA 1AIFB 4CJ1A 4MS8D 5ADOL 2VLKE 2UV3A 2QQKL 3OKNA 1HK6A 1A7QH 4F37K 5GS1B 5CEZD 4HSQA 5TE4H 5GSRA 1ETZA 4L1DA 1QQDB 2VERN 3FL7A 2A6JB 4OFVA 3AFLA 4HBCL 3RWJB 1A14L 4QOKE 4I18C 3NACL 1WC7A 4RFEB 4JVUA 3V6FA 2NY3D 3D9AL 1S3KH 1T89A 4KXZI 2R2BA 1N6VA 1T21A 4X4YA 1LDSA 5EU4A 3UTOA 4F8TA 1ZHLA 1OQOA 2ADJB 5F7DA 4P3CL 3QEUA 4XCFH 3MRBA 5E8PA 3IFOB 3WKML 1BF2A 4QT5A 5HDQL 1K3ZA 5SV4A 5HYFA 5IB5A 1JK8B 4GG8A 1Q72L 4MJIE 2LAGB 3QPQC 5GRVL 1HXMB 1ZANL 1G7QA 3OJDB 1LK2B 4FQJL 5EU3B 2ZUUA 1QOKA 2VDQL 3P77B 3CK0L 4RFOL 1FPTH 4ZUSB 4FFWD 3VFTA 1U91B 3I02A 5D1ZC 2DBLH 1DBBH 3WXWL 1RAMA 4EI5D 1ZEAH 4DVBB 4OGYL 3WFHB 1FYTD 3TH2T 3WIHH 3ZKMC 1NC2D 2VXSL 3IAQA 2IPKB 2MCPH 3IDMA 4X9GA 3H42L 3KPRE 1MCFA 4PRNB 4QRTA 5FUCC 1U58B 4ONGH 1PVHA 3P0VH 3O6KL 1P1ZA 4IRJD 1NCDL 1T1XA 3BIKA 3H2WA 1UQSB 4O4YL 1KLGA 4PB9L 2DTML 4QXGH 1X5LA 4ZUTA 5BVPL 4YLQT 4NC1E 1SJEA 4RAUA 4PUBL 5I0DA 5GGUB 1UENA 1FNGA 1R5VA 3CFDB 4NQVA 3FB6A 5D7SH 1JWSB 4KUCD 3S5LG 1NJ9B 1A02N 4JM2D 1EUUA 4BZ2H 3RA7L 3P11L 4OLXH 4Q6IB 3FB7B 3BX7C 3QCUH 3LQMA 5GS0L 1C08A 5DEFA 4O5LH 1RZJH 2PW2A 5CJQH 1S9VA 4XC1H 5IHUL 1RUPH 5KSBE 1JGDB 2Y23A 3OKNB 5D72L 3KXFA 1HZHL 3P3YA 1U2HA 2VLLB 5J57B 3BEWA 4PV9A 1HNFA 1OARH 1DQDH 1CXEA 4LCUB 1D3CA 1E4JA 3HUJA 2YXMA 3KS0J 4KZEL 3WJLA 4JY5L 1IARB 4NQEA 2P5ED 4FNLH 2YA2A 5IROA 5C0BB 4JLRA 4Q74A 4K3DH 2C3HA 1KPRA 3K80A 4KY1H 1KPVA 4KK8D 1LQSR 4IMKC 3I9GH 2BVPB 2FGWH 4JY6A 4TNVF 3V6BR 5C6TL 2M1KA 2BERA 2J1KA 1QD0A 5MEPB 3T77A 4UAOC 4HUNB 3KPSE 2D7TL 2Q8BH 4JZJA 4KTDH 4LHUB 3T0EC 5I9QC 1GZPA 2NLJB 1TVHA 4F7TA 1G9EA 4KJWC 4P2RA 4GG8B 2UWEE 4TUKH 2P44B 2ZUXA 3IJYA 4IRSB 1S5HA 4ODSL 4AG4H 1GGIH 1NL0H 3TN0A 1YJDC 2R1WB 5FYJE 3B6SA 2NCMA 4ISVA 2G5RA 2Y5TA 1CE1L 5GS3A 1HH6B 3C2SA 1MFEL 1QFPA 5ERWA 3RL1A 1VACA 4WO4C 1PSKH 1PYWB 4WJ5B 4NO2A 4F37F 1U93B 1YNKL 4NQXB 4JQIH 2MQ0A 2QHRL 1VADB 3TC9A 2HTKD 2ZUTA 4IRZH 4L4VB 4KJQD 3L3DA 1CFVH 1NDMA 1QLEH 3SJVD 1IBGL 1YPZA 1I7TA 1KB5A 4WW1A 4R0LC 4XC3H 2R4RL 2H41A 3K1DA 1A6WH 1NCCH 3RWFA 1D6EA 1S7WB 3QJFA 1R0AL 5ISZD 3P0YH 5FYKE 4TVPD 1MCNA 4RAUB 3FCTA 4N9OB 1BBDL 4NNYB 1VGKB 3FB6B 4XB7A 4M48L 4FFZH 3O4LE 2B4CL 2HFEB 4B41A 5HHOE 1MHCB 4WUUD 3HHRB 2PCPB 4MA7L 4QYOB 3TYFA 4LSQH 5EO0B 5DDHA 4MNQD 2EXYD 2Y07L 4M62L 3T2QA 2R2EA 4WFFD 3HG1D 4X6DF 5D1XB 2R56L 4EN3C 3FFDB 5I73B 2D0GA 2H26B 1I9IH 5D71L 2VDNL 1RUAL 2GK2A 3NH7L 5IIEA 5DMIL 4NO0B 3AREC 3MPCA 4U33A 4GAJH 1E4WH 5MI0C 2Z92A 5L88H 1RSFA 4KI5F 3AS3A 1ZHBB 1QPXA 1KYOJ 2GCYA 5FO7B 4CRPA 1UGNA 2X70A 2XTJB 5TH2A 1HKFA 5LVEA 1MAKA 5IKCB 3FQNA 3RVWD 3THML 2OJEB 1FZKA 2DM3A 4N90E 1KPRB 5BXFB 3MRLB 2NY1D 4HWEL 4LBEB 1DL7L 4JY6B 4HCRL 2R0KH 1YY9D 5FCSH 4OF6A 2ADFL 4YXLL 4Q9QH 4ZUWB 4UT7H 2H3NB 2AJYH 4QHMB 1UC6A 3OKLB 5JXAH 1Q8MA 2XA8H 5IFHL 5F89B 4KROB 1R3LA 2VWEC 3HLAB 1JF5A 3G04B 3IJYB 4X7EC 4CMMB 1C8PA 1NFDE 1I1RA 3PL6B 4JJ5A 4PTTB 1BM3L 3WLWD 3B6SB 1QKZL 2Y5TB 4GXVH 2YC1A 3H9SE 2G2RA 3LKPA 5T3ZE 5EORL 2ICWI 1INEH 4O58H 3ARGD 4JFHE 1MY7A 2V5RA 2XPGB 4TSCH 5D9SB 5J11C 2CDGB 4NO2B 3ECBA 3WJJA 3KYAA 4XP6L 1JMZA 1D5XB 2AV7B 1UXWB 3GSOA 3L3DB 2DB8A 1P4IH 1NDMB 1X4YA 5CSBA 2ARWA 2ZUQC 1Q9WA 1TMCB 1U8QA 4WW1B 3MV8B 5D70L 5D7JD 3D69A 5T3XL 3BKML 4PBVC 4FQXC 1K4CA 4KRPC 5C0EB 5JR1L 4NQDE 5CBAA 4G9FE 1LK3H 3QO0A 4WRLA 4LKCB 4GQPH 2P7TB 1NLDH 4OZHB 3EFFA 3MLVH 1SYSB 3CMOH 2XY2A 2D7PA 5LCVH 4EVNA 4OQTA 3SGKC 4ZUUB 4X6CB 2HKHH 3RZCA 2VDMH 4N9GA 3S36L 3B8YA 1U3ZA 3TBWA 3KPPB 2GSIB 4HT1L 3ARBD 3RVTC 5IMMA 2X41A 2G75B 4ZAKA 3RGVC 1U0QA 5T1MB 4L8CB 1H0DA 3STZA 1D7FA 5EU6E 1LE5B 3NPZB 2R2EB 4LSVH 2XKNA 1NMCC 2KQNA 4YWGH 1J8HA 1U8LA 1VPOH 4U05A 1F58H 4D9RD 1LVEA 3SQOH 1G7PB 3BHBB 2OMBA 2F58L 4ODWB 3N1PC 1GRWA 1AD9B 5KSBF 1AXTL 2W0FB 2BK8A 2RAMA 2IALB 3MRHB 1HN1A 3HC3L 4RNRB 3QPXH 2ADGA 5HHVL 4BA8A 4Y4HC 3VDAA 3QG6A 3W9EA 1BZ9B 4GS7B 4P23C 3FQNB 2I9TB 1IQDA 4PGZA 1BFOA 3WNKA 1WZLA 3X17A 4U4BA 2Q86A 3HC4L 3GI9H 4KPHL 3MGOA 5DEZA 3GGWA 5A16B 5BZWB 4X5LA 3FFCB 1CQYA 1O5DT 3IU4H 4AYFA 1MLCA 4JFDB 3WSQL 3ULVD 1MH5A 2PYFA 2ZOKB 3MLWH 3QXTA 2X7LA 5I1CH 3BP4B 5JW5B 1RZ7H 4TRPL 5C0BD 1BD2B 3LIZH 3Q5YA 3NTCH 4K23H 4LLVA 4LF3B 5CIPH 3ZO0A 3MOBH 1GAFL 4ZSOA 2GSGA 4Y5XC 2UWEF 3L3GA 1IGJA 3RKPA 5HYEA 1HQ4A 4JVPA 1I1AB 5IW6A 1LO3L 4NRZA 3IDYC 4NOBA 1Z5LB 2R4SL 4P5TA 2X05A 2BSRA 3RX5A 4G42A 4PRPB 4Y4FC 3D39E 3E2HB 4PLKD 3IF1B 1HQRA 2XN9B 1UJ3B 3QUZC 4X7SH 3O3EA 2L4OA 1HEZB 1ODAA 4NKDB 4JE4B 4YHLH 1FVCB 4H88L 4HBQA 1EERB 4IIQB 3RZWA 2M8XA 4P5MB 4FRWA 5DJDB 2H32B 3L1OH 4OQTH 1MJ7H 2X4SA 2Z8WC 1VERA 5K9OA 3GJFB 3P9MB 1AD0A 1NAKH 1FH5L 1MIMH 4KVNH 3WFZA 1HINH 5DJZA 4C54A 4MVBC 4I3RH 4OUUB 1A3LH 3W5NA 1MHEB 1DQLH 5CBAB 3RY6A 2C3VB 4L4VD 3RVXD 1HOCB 3Q3GA 3BN9C 5JQ6H 4U1SB 5FYJU 3WIFB 1T3FA 3MYZA 3SDAA 1L4IA 2AGJL 3BPCB 2I9LB 3T65B 2NY4C 4MAUH 5CZXC 4GSDH 4TNWK 4ZAKB 5ICXB 1ACYH 1MHPH 3CCHA 5BOZG 4ZO6A 4MS8C 4OI7A 2Q76B 2YZ8A 2VSDA 7CGTA 1FL3B 5FYLH 5K33A 1X7QA 3M17A 4PIRF 5L0QC 1D5IL 5SWSA 3I50L 5I15H 3ARFA 2IBBA 3E0GA 3GMOB 5BCAA 3SBWC 1DVFB 2ZUWA 4TULH 1IGCL 2HG5A 4JFXB 3ZHDA 3TA3C 5C08E 2FJFB 2DQUH 4WWKC 4XCCH 1I8KA 3KXFD 1CICB 2P5WA 4G5ZH 2BCKA 4D9QD 2V7HB 3EO1B 5F9WB 2BVQB 4FQCL 4K7FA 5FDWA 1SEQH 2PF6A 3GUTA 3QO1A 4P59H 4R4FL 4C58B 3FOMB 4YK4B 3VFSA 5KG9B 3TFKC 2FH8A 2MHAA 2XTJD 5C0DB 1BQLH 1I8IA 5EZIL 4NQED 1JPGB 1EHLL 1KXTB 1LHZA 4X8JA 2CLVA 3U7YL 3NFSH 4UQ3A 2D4DA 1RZKL 1DBJH 1KIQB 4FQHB 4JANB 4XPHH 3FT4B 3VXSA 5A2KH 4UOW1 4M4RA 4GW5A 3CC5B 1HYSD 2XWBA 4ZXBA 3SE8H 4I5BA 3GKWL 2NW2B 1N2RB 1WVZA 1EAPB 2ESVB 4NRZB 4XBPA 4DOHE 4AEHH 4TQEL 3GIVB 2A6DA 4KROD 4ZPTB 3S5LB 4P2RD 5B39G 3HZVB 3IXAB 4KHTL 1PX3A 4KJPD 4ZTPL 3HB3D 4N0UE 4M7JH 4XH2A 2FBJL 4M7KH 4LSSL 4R3SA 3TN0D 3RNKA 1ED3B 2BNQE 2W38A 3GJEA 1LO5B 4PJBB 3LY6A 2DOCA 3LKNA 1G9NC 1CFTB 1S7SB 3NCJH 5IJKA 2DDQL 3R4DA 4M7ZB 2X4SB 1NDGB 2OK0H 5L2KE 2QSTA 1JZ8A 5DD3H 1F11B 3OL2A 4JFZL 2VQUA 4G6JH 3ULUF 1WUNT 1RZIA 5BV7B 1Z9MA 3W39B 5KVDL 3HNSH 3PNWA 4Q58C 4M8QB 1G0YR 4N1HB 5INCA 3Q3GB 3BZDA 3OG4B 5HGHA 4XNQB 1G0XA 1ERNA 3ZMRA 3HAEA 3F62A 3MV8D 4Z95H 1T3FB 3F12A 1XIWA 4MB5A 4Q6YA 3VXME 3FMGH 5EU7C 1HILA 1N0LA 3WO4C 4PLOB 2YEZA 4PRHE 4UI2A 5I74C 3AXLB 3RKDD 2DL2A 5DURB 4H25A 2CRYA 1WT5C 1CLZL 5GISL 5C0JA 1GIGL 4OLYH 4MD4B 5KVGH 4PB0L 3BEVB 5K9JL 5ANMA 1JWMB 1MUJB 4BFBD 1YEEL 3IJHA 5J13C 1IT9H 5SWZA 5KSVB 2PO6B 1KEML 3SDYH 3CLEL 3L7FB 5H35B 3KPLB 3V4UH 5L6YH 3NBNA 1JI1A 5SWSB 2W59A 4KK9C 5TF1L 4X6DA 2QQLL 2ZUYA 4OSUH 4IHOB 3JV6A 5GRVK 3SPVB 3VGDA 2X89D 4J3XA 1U41A 1T20A 3K8LA 4ORGA 2CLZB 4C4KT 4Y8DC 4Y5YC 1GYAA 2VLKA 2EO9A 5IBTL 5TQ0H 1UXSA 2LVCA 3BVNB 4LP4A 4W4OA 4NKIH 1P6AB 2IPUK 3OB0K 3QNXA 4KK8C 3FRPA 2BCKB 3B9DA 3OAYK 1II4E 1PFCA 2KKQA 3U2SA 3LKOA 3CSPA 3ILQD 5EZJA 5ID1A 4L3AA 2HVKA 1AR1D 1NCBL 4RISH 43CAB 4L5FH 4MQTB 2B0SH 5DQDH 4J1UA 3LKRA 3QUXA 4UOW0 2CO6B 1ZTXH 3EO9H 5F9DC 5ABDE 4UDUA 4LPTA 2MFNA 2YUZA 5DMKB 5ICYA 1JGUH 4UQ3B 4P4KB 1Z9LA 4AM0B 4HFUL 3F7VB 1NSNL 2EDXA 1S7VB 4K94H 5J9PA 4JFYA 4AT6B 5F3HA 3EYVA 5E2TL 1OAZH 3JWOC 3MJ7A 1BZ7A 1TQCB 2CH8A 3RJQB 1CG9A 2XFXA 3DX9B 5FO9B 1M4KA 4NZUL 4E0RB 4PG2A 4JN2A 4MJIA 1MLBA 5IJVB 1BBJA 3CFEB 3F7QA 3GRWA 4P57B 1PAMA 3ZKNC 3HAEH 3T0WA 5JORB 3B2VL 5D7IE 4QHUB 1I1AD 2CSPA 4HC1L 3L6FA 4F7EB 5IWLC 4U1NA 2E6PA 5CILL 4JG0H 5EWIL 3TPKA 5E2WH 1DQQB 5F7EH 4PRPD 4XHJC 3DV4A 1JYNA 3V6OE 3BXNB 1ZT4A 5E6IC 5KTEH 1MFNA 5I76A 2YPKB 3EFDL 4MQXC 1VDGA 3QWOB 1BGXH 3PXHA 4LKXA 2DAVA 2DQHL 1TZHB 1U8PB 3H7BB 4ZDHB 1MWAB 4YFLF 2AJSL 1UG9A 4LLWB 4F80A 4WEUD 4F9LA 3P9LA 1EEYB 1RMFL 3C5JB 2H45A 1U6AL 2WSKA 3EAKA 4L3CB 1TZGH 2FIKB 2F54E 3O45A 3O4OC 3I75A 1JPFA 1X5XA 3GM8A 3TPUA 1U3YA 3TZVB 3MYJB 4XNYL 4LSPL 1A6UL 4MSWA 1R5IB 4PJ5E 2F8XC 1U8NA 4AY0A 4YHZH 4PBXA 3RZCD 5FM4A 4OZGB 5E8DH 5GRZA 1TCMA 4IJ3B 4M1GH 3RTQA 4K9EC 4ZAKD 3GI8L 3MRGB 4WY7L 1CGSL 2MNUA 3FOLB 3FQXA 1UM5H 1YQ2A 3VG0H 1GGBH 2BOBA 2C4FT 3F7YB 2A9NL 4ORGB 5KSBA 4YBQD 2CKBL 3OGOE 4LGPB 1YYLH 3HMWH 3QNXB 5E00B 2ZPKH 4HIXH 1VFAA 1BVLA 1ZHKB 3TJEH 3WNPA 3N85L 1OP9A 3UO1L 1YY9C 1H3PL 1XMWA 5ID1B 2NY2B 2HVKB 3EOAB 4YC2B 4LCWB 3SKJL 4QOKB 2EKSB 3L5WA 4WHTB 3LKRB 1DVFD 1MFAH 4P99A 1TCRB 3T3MF 3RJDA 1GGYA 2NY0B 5B4MD 4DK3A 1MELA 4WEBL 4XI5D 3ROOA 3VFWB 3D1MC 4F9PC 2WINA 5DRZA 1GVIA 5CSZA 3GRWH 3V0WH 3CSGA 4HX1B 3O11A 5FOBB 2IQAA 4NJ9H 3EYVB 1WCQA 5F96L 4F3FA 3KPSA 4NQCE 2EDEA 2IJ0C 3BT2H 3O2WH 4HWBA 3X3GH 4GXUN 2EIDA 2XFXB 3KLDA 4Q0XH 1FZOB 5CZVH 2BSTA 3RAJH 3OJ2C 3MCLH 1JYVA 1U92A 2UWEA 4FS0A 3T4AA 3FTGB 3UJJH 1MLBB 3DIFB 4R2GD 1KCRH 2IG2L 4NPYA 4XPBL 4LRNH 1G7HA 1XR9B 3UTQA 1EEZB 5D93C 5D7JC 3U7AA 3RWIA 3UBXA 3HE6C 1NUNB 4P5TD 2A6KA 3MREB 4PGCA 3HE7B 3QI9A 2XACC 2PR4H 1C5DA 4PYHA 2Q3AA 2CLRA 3TO2A 3IGAA 1F4XH 1MAJA 1WICA 3QCVH 5SX4I 2V2TB 4FOMA 1CDYA 3CFCH 4LVNB 3KPRB 1TTFA 2X4UB 2QSCH 4RWYH 3U0PA 1FBIL 3ARBC 5IF0B 1AFVL 3TO4C 2GK0A 3QUKB 3VGEA 3BDYH 3U7WL 2WBWB 2AI0H 5L8JB 5EA0H 4OKVA 4DZBA 3EKCA 4PJAE 4M3KB 3S35L 1JPFB 3G5XB 4M1DL 4DKEH 4IDJH 3UDWA 3DWTA 1J12A 2IBZX 3KYOB 4MSWB 4NRYA 5T1KB 3O4LA 4OT1L 3C60A 3SDAD 1SEBA 1MQKH 3QEGH 1DFBL 4AEIL 2NXYC 3ZDYF 1JYWA 3S9DB 4KKLC 3QDJE 1BFTA 4J3SA 3O6ML 3DMMB 1WIOA 4J7RA 3S34H 1IFHL 5F1SA 4H26A 2JJVA 2W0KA 3OXSA 1JNHA 2EDYA 4G9DB 4QO1A 4MCZB 3HNVL 1XF2B 2FNBA 2R9HD 2CDFA 3PWUA 3K4AA 5F1NB 1YDPA 5SWSD 4FQQB 3SGJA 1L9NA 2HJFA 5EOQL 3B9VA 3QWRA 2BRQA 5D6CB 1Y0LA 1JZ4A 5I8OH 1KEGL 4HH9A 4HWBH 5KSAA 2F53B 3A6CL 3E3QC 3K8KA 2M26A 1RZJC 2OL3L 4C59B 1EZVY 1A6AA 2XRAL 4CDHA 1OTSC 1P2CB 5CD3B 4FTVE 5FA3B 5B3JE 2OP4L 2P5WD 3GZKA 4MA3B 3VXNB 3QXVA 5DRXA 1GH7A 5DHYA 3MACL 5JOEA 3O11B 5HDBF 4LMQE 2IQAB 3P4MA 5IHZA 5I30H 4GRMA 3WS3A 1U95A 1M05A 3IDIA 5CLTA 2W60B 1OM3H 3ZKSD 3NCCB 4DGVL 1D5BB 5IOPB 4UMGA 5CEXA 1NFDA 1DCLA 4PJHB 1DP0A 3VXSD 1AHWA 4TVSa 3V79C 2WNGA 1KOAA 1TVDA 5IB3A 4LSUL 4ZXBD 4YPJA 1I9JL 5K9KB 5F7FA 3RWIB 1YNTA 1TJHL 3PV7A 3KHOA 1KN4H 5ILTL 4L9DA 4XAWL 4YXHH 5E6YA 4U2ZA 2LU7A 3RVXC 4GKSB 4RBPK 4ONFH 3R0MA 3VD9A 5D8JH 1K2DB 3VG9B 2DQIL 1GGCL 3O8XB 1F42A 4QRUB 5HYJA 3GSWA 3WN5C 5FGCE 3ORJA 4W6WB 5E1AA 4Y5VB 1KF9B 1AC6A 3KYMB 3KPTA 4R97C 2P1YA 4K2UL 3MUGA 3TBSA 1A64A 1J86A 3I6KB 5LGHH 2ZZUT 4CVXA 2JK5A 4OFKA 1F3DH 3U1SH 4ZTOL 2HJKA 1NUDA 5E6ZA 4JREC 4NQDA 1UCTA 3ZTJH 4G9FA 2C4FU 5AZ2L 5DI8A 4R96B 4DEPC 5AG9A 1X5HA 1KN2L 3ISWA 4RMUA 4GBXC 3TGXA 5IGXL 4OLZH 3LRHA 4CNIA 3QDGE 2CIIA 1MCWM 1XIWD 3WEXA 1RZ8B 4JAMB 1KENH 2ZSVB 4Y19E 4KUZL 5HHOB 4N0YH 2EDQA 1I7ZA 4UB0L 1IGFL 4UOJA 5C0AE 5DJ2A 3RIAF 2CDEA 2JCCE 3QIWB 4ZG1A 5EU6A 2C3GA 1I3GL 1BVKA 4LCCA 5CJOL 3GBML 5ADPH 3TZVD 2PXYB 3U30B 4LHQB 2RJMA 3IFPB 1GZQB 1IEBA 2M2DA 5B39B 3V6ZA 1U8OA 4XVUD 4GG6E 4CU6A 4HULB 1NFIA 4FZ8L 1CVRA 1JMXA 5CINL 5IMLA 2VE6B 4QKXB 4FQIL 5IB2A 5KSAB 3WFEH 4D0DA 3NFPA 4EIGB 5F7YC 2J4WH 4MCYA 3GMPA 3T08A 5IROC 2VLKD 4DZ8B 3DARA 5EN2A 2MMXA 1IGIH 4KKNA 4HPOL 3IKKA 1CLYL 4YFDB 4PP2A 2I5YH 2OTUB 4O51B 4X7TA 1T4KB 2BNUA 2NY2D 3HI6L 4GRMB 1U95B 1M05B 3G5YB 1QG3A 4QOKD 5T3ZH 4YE4H 4KH2A 3QUXD 6CGTA 3WNLA 5E94B 1MVFA 2NY0D 3MBXH 3K3QA 4PTUB 3KYNA 3TN0C 5EFIA 3STLA 2HYMA 5C0ND 4ACPA 1FGNL 2VZVA 1JF1A 1MF2L 2X9WA 3EDEA 3T2NH 4XBGB 3R0NA 3DX7B 3H9SB 3MJ8A 3ULUH 2QADC 4PG9A 4PJBF 4KV5F 3U4EB 5AYQA 4NNXB 1KJMB 3F58H 2AK4A 3JSSA 5J6HA 4OF7A 3D39A 4MJID 3SE4A 2ERJB 3TBTB 2DJSA 5DJ0B 4MMXC 5C0GB 3EJZD 3P4NA 4G8GE 4LNRA 3V5DA 3UPRA 3IFNH 2I24N 2DI9A 3CPLA 2GFBA 2A6IA 1QSFB 4X5WA 2FX9L 3HR6A 3T2OA 5HYSA 3HE7D 5C0FB 3CUPB 1U2CA 2HJKB 1FCCA 4K71C 3Q6GH 4NZJA 4XPTH 1XGTB 2A2QT 5DMGD 2FEEI 3KPRD 4MA1C 5E2UL 2EE6A 4HW6A 3O6FA 2ZSWA 5FUCE 1M6OA 5F72S 2DQEL 4S2SA 4Z7NF 5I0ZA 1NGYA 4UNUA 4JDVB 5FGRA 4ODUB 5DJ2B 3QQ4A 5DRWA 2CQVA 3CFJB 4WEMB 4RQQA 1UYWH 3KJ6H 3MMEA 4FG6D 3QA3A 5DTFA 2O5ZL 1U8MA 3MLZL 1OAUH 1GHFL 4Z7UE 3UTTE 5E4EC 3IKCB 2E7CA 3DECA 1B0GA 5T1KD 4U6HA 3REVA 4L29B 3T2PA 1B4RA 4ZUVB 5FA4B 4UIKL 3T3PF 3QFDA 4CMHB 2B39A 3RRQA 4KKCC 3BSZH 3HNTL 3RTQD 4LPYA 1MCQA 4FFVC 4H1LA 5A43C 5IB2B 3JWDL 3QJHA 3JTSB 1JBJA 4PJXE 4PLJC 5KS9B 1GXEA 1EJOH 5C08A 1WCBB 2EEDA 4G8IB 5DD0H 5E70A 1T1ZB 3B3IB 4TPRH 3PWJB 2XG5A 5GGRA 5I1EL 3S96B 2OYPA 4N8CL 4NC2B 3TYGH 3QHFH 2P46B 4PP2B 4YHKL 3HRZA 4PRBB 5GXBB 1K8IA 1CFSA 1MHHB 5C7XH 1IMHC 3ARQA 1YC8A 4JHWH 5DEGB 1XF4A 3NAAH 4FMKA 3TH4T 1LWRA 1NLBH 1WFNA 4AK1A 3IDJB 2JE8A 4K3JL 3QIBA 5FM8A 4M7LH 4IDLA 2X4RA 1VGEL 3VFRB 2V5TA 4JFOA 5I8CA 1MVUA 2YRPA 2VH5L 1KG0B 2V7NB 3ME0A 3DRTB 1KJ3H 1EUTA 3IT8D 3GMNA 2A74A 2UUDH 3BESR 1HDMA 3WIIH 1F5WA 1J0HA 2EYRB 3KPSD 3V7AG 4K8RH 1ONQB 1HWGB 4BH7A 3TWCL 1NCUA 2GTZB 4J4PD 2X9XA 1CYGA 1S9YB 1PEWA 5J6HB 5DJ6A 3MRPB 3ZDXE 4Z78B 3NPSB 3DX6B 3WJJC 1DJSA 4FABH 4DKDC 3RDTB 4ENED 2XKUA 2YKLH 1OSZA 3EJYD 4TN9A 2BNQA 5FOJA 2ITDA 1T0MB 5FYJD 4LLQA 1RUQH 1A7OH 2W9EL 4O2EB 1FLRL 3G6DH 3CPLB 2ZCHH 5LBSH 4ZFZB 2GFBB 2A6IB 1YEFH 4XVSL 4DN4H 3TP4A 3QI9D 5HYSB 1CR9H 1T0NA 3OR6A 1RFDH 4JKLA 5GZOD 1C1EH 4ETQB 2VN7A 3GHBH 4XGZB 2CMRL 3SKMA 5T1LB 4C83B 4LEXL 4M6OH 3IYLW 2BNRB 3A67H 3RZCC 1M6OB 3GSVB 1Q9LB 4NDMA 3VXMA 3QCTH 4YPGB 5FV2A 1KCSH 2UZIH 2ICWJ 4H1LH 3C6SB 4PRHA 1W72H 1IKFH 5FYKD 5HXMA 1Y18A 1NGPL 5ADOH 3RPIA 4U6VL 2QQKH 4BELD 3VE0A 2JCCF 4XTRC 3C60D 4J23A 3NN8A 4HBCH 4D8PA 5HHOD 4JDZA 3T1FA 1A14H 4FXLA 1A4JA 3NACH 5TPWL 8CGTA 1ACZA 5JMOC 5MEQB 3OJVC 5C08B 2AXFB 5CMAB 2E6JA 4XI5C 3JUZA 5DVOA 2PXYD 3IDXL 3QEHA 5KVEL 4U31A 1FRGL 1N64L 1E0OB 1UCBL 2V2WA 3LPGA 1YC7A 2VLRE 2HLFD 4P3CH 1AR2A 3QWRD 4NSKA 4BQCA 1KCVL 3WKMH 4M6NL 3EYFB 5KSAD 2YD2A 2VR5A 4TUOA 1FGVL 4KGJA 4NQSA 3KLHC 3O3UN 3MRFA 3QIBB 1Q72H 2WMPA 1MI5E 3QH3A 4N90D 4WTZG 1ZANH 4FQJH 5I8CB 1Q9KB 2VDQH 4ELME 4GOSA 4FZEL 4RIRB 4S11A 2C3WA 3CK0H 4NFBA 5HI5D 3KS0H 3MLUL 4RFOH 3OB0H 1R24A 3PHOA 5L8LB 4P5TC 3EZ8A 2GHWB 4YIQB 2X9YA 5JXEA 5IEKB 4U1HB 1A1OA 5EC1A 5DJ6B 3WXWH 4D94A 3K2UL 4N0UB 4MJ5B 1OSZB 4Q9CA 5IEHB 4OGYH 3C08L 3CLFL 4HHAA 2VXSH 1IGML 5J3HC 3H42H 3SDDB 5D7IA 3H9SD 5T3ZD 1P4LA 2O5YL 3OKKB 4PJDB 5L2KB 2B5IC 4HIEB 5IQ9A 4JFHD 3O6KH 2IAMB 4HXAL 1T0NB 4OF5A 3V6OA 5IBUG 3AM8A 4O4YH 3U46A 4PB9H 5BVPH 3RY6C 5FFLA 2I27N 3DVIA 4MWFA 5GGSY 3CVHL 1N5AA 4KRNA 4PUBH 4G7YL 3PP4L 2IMNA 4U6YB 4HQQL 4JFFA 4XNUL 3X13A 5L2JB 3G5ZA 4H5SB 4AH2B 4JGJA 4AQOA 3HR5A 4PJIF 2DQJL 5ACZB 4JQXA 3MLSL 1QSFD 3P11H 3VXMB 2F74A 3DVGA 3PABB 3OKDA 3MUZ1 5GS0H 3FB5B 1P9MA 5IP4A 1CF8L 2F54A 4G9FD 4YNYB 3S36X 5IHUH 2MKWA 1CT8A 1QFWM 5D72H 3VE0B 1RY7B 4WHYG 1HZHH 3MBEB 2BMKB 3PV6A 2QBWA 4PJ5A 5GQBA 4YHPA 3BP6B 1FVEB 1YMME 1G84A 3UC0L 4XWOD 3ARFC 3T1FB 1IEAA 4R4BA 2AS5M 2C7UB 2XIDA 1WJ3A 2AJUL 5LJYH 1UACL 4Z6AT 2H9GA 2YPLE 4HUWB 4WFHE 5EU6D 4KZEH 2DMBA 2XTLA 4JY5H 1PD6A 4I2XA 5HD8C 1F3RB 3QEHB 2QQNL 3BPOB 3GSXA 4XP1L 4FQ2L 5E95B 1WIPA 2CR6A 5C6TH 3P4OA 2R2HA 2D7TH 1H5BB 2OTWB 3BH9A 1BLNA 5I18L 5C0CB 4N1CA 4Z7WF 1RU9L 2FJGA 5DGQA 5EO9B 2D31A 3T0BA 1FYHB 1QBAA 1UB5B 2OSLA 2GJ6E 4D3CL 5IBLD 4QXWA 1QA9A 5DS8A 4XWGH 3QH3B 4ODSH 1R3HB 4J3WA 5K59E 5LXGL 4MHHG 4I48B 2H32H 3L95B 5I8KL 3SKOB 4YDJB 4HCRA 3MRJA 1CE1H 3GJFH 3OX8B 4LVHC 1MFEH 4NQCA 1A1MA 1FSKC 3P2TA 1XGUB 3PHOB 3VXQB 5I66B 3CJJA 5T1DL 4LVEA 4PJ8A 1U8KA 1ZS8B 4QHLA 5EG6C 5SWQB 4NO5B 3MGTB 2XWJB 1YNKH 2ICEB 4LDLB 2X4PA 2IH3A 2QHRH 1JIBA 2RFXB 3QXWA 4KY1L 5T5NG 4BFEA 2E6QA 1BQHB 2EYTA 5JA8B 4K94C 4OV5A 3LDBC 1QFHA 3BP5A 4GRWE 1IBGH 3HFML 5D6DA 5D2NB 3TVMC 2AJ3A 2J88L 4F57L 2GAZB 4XPGL 2R4RH 3VJ6B 3BW9B 2ORBL 3OGCB 3W82A 1NGWB 5DK0B 4YBHA 3D39D 4IOFD 1DANU 3RDTD 1R0AH 1GGIL 2Y7QA 5D4QA 3BD3A 3X11A 2BZDA 3HA0A 5GZNC 2R23A 3H3PL 4KHXL 1BBDH 3IS0X 4M48H 4HGMA 5JPNB 5EO1B 2B4CH 2H6PB 3CU7A 2E3VA 1WTLA 4NN6C 1PSKL 2PTVA 5HGDB 1CE6A 2Y36L 3W5MA 2X2YA 4RMVA 4MA7H 4C56A 2HT4C 4BKLA 5BJTB 4M62H 4PJAA 2DQCL 2Z91B 3G6JE 5LQBL 1QLEL 1B9ZA 2DLFL 2R56H 4U1MB 2BVOA 4HGWA 2VDNH 3V5HA 2NY5H 3QAZC 1RUAH 3NH7H 3O6FD 3NFNA 5DMIH 1SJHB 1G6RL 4EDWL 3PWVA 1C16A 1K5NB 2P24A 5TFSL 4UILL 5CZKA 3FN3A 4R4BB 5DJCA 3QDJA 1PLGL 5CBEA 1XAUA 3REWA 1XZ0A 3PDOA 5IV2A 4W4OC 3THMH 4EI6A 2VLJB 3P0GB 4OGAC 1R3JA 4Y89A 4KI5C 1BEYL 4IM8A 4QXTA 4HWEH 3FO2B 1DL7H 4ZOAA 4HCRH 5DJAB 3IU3B 2OI9B 2ADFH 4YXLH 2DJUA 3K2MC 4WIQA 5DD6A 3QIUA 5F7UA 6FABL 4M1CC 2OTPA 2Z9TA 1JI2A 3FAWA 1J05B 3V9FA 5IFHH 5C08D 1T5WB 2GY7B 4FTVA 4URTB 3O6LL 3IETB 1UA6L 3Q2CA 4NO3B 1AC0A 1BM3H 1P7QB 3VXTA 3ARYA 4GAJL 1QKZH 1T1WA 3ARRA 5JO5B 4OZFA 5A2JH 3WHXB 5H2BA 1KTLA 1A1MB 4NQCB 5EORH 3DUUB 3PQYB 4ELMF 1F90L 1KCUL 4PG2C 3SDCC 3QIBD 4KZDL 3BGMA 1S7XB 4GKNB 4OF0A 3D2UB 5CAYB 4XP6H 1MREL 4JY4A 1J1OL 4QF1B 3V0VB 5A1AA 3FT3A 5D7KE 2VQ1A 4DCQA 4LSDA 5D70H 1RIVL 5T3XH 2Y4SA 2XA8L 2FR4A 4Y16C 1BAFL 3BKMH 4JKPL 4AENA 3LMJL 2OLDA 1PEZA 2VDPL 2V2XB 5JR1H 1FL5A 3ZDZE 2HMIC 2BNQD 1B0RA 4V1DB 3RL2B 1FJ1B 3PG2A 5DMGC 1WISA 5JHLL 4NFCA 4MD5B 3TNNA 1PJ9A 5L2KD 1CI5A 4NN7B 5DR5L 2GITB 1RJZB 2IAMD 4HT1H 2A0LD 2HTLD 2X4OB 1DSFL 2RIKA 1SJXA 5DXWA 3H9HB 5E08L 1WBYB 5C07B 4X99B 3V5HB 1FZMB 3GSRA 4RFNB 1QBLL 3CNKA 3QDGA 1CGVA 3R06A 4RBPH 2F58H 2FSEA 3UAJD 1CXFA 4XMLL 1AXTH 5GJSL 4Y19A 3VXMD 1Z2KA 3AMLA 1I7RA 4N0FA 5DUPL 5EZLA 4KK6C 5JW4Q 5HGBA 3HC3H 4PRHD 5DJCB 5C0AA 5HHVH 5MEOA 2JCCA 1NLDL 2JJWA 5JIPA 4WCYL 5C9JB 1JZ3A 4Q2ZB 2UYLB 4RGMC 4POYA 3GMLA 3MBED 5KS9F 5F9OH 4ODXB 5IVXE 4YFLI 3C8KA 4Z7OE 3HC4H 3EYUH 4KPHH 4YHIB 4J12A 4GG6A 3H9YA 4F7MB 4P2OB 1HXYA 1J11A 5EUOB 1RPQA 4LRIA 3VI4E 3ES6B 3I3EA 1J0IA 3EO0B 5C2BL 4TRPH 3MV7B 3G6AB 1HNGA 3TM6A 3BFOA 1A6PA 3L3HA 3VXTB 1PKQE 1GAFH 3WCYA 1SJVA 5I71C 1QEWB 5H2BB 1NPUA 2QR0B 5K59F 1MCHA 1LO3H 5ALBL 1RJYB 2R4SH 3MFGB 4P2QB 1K4DB 3QNYB 4RA0C 5C09E 4ENEC 2C1OB 3ZE1F 1E27A 4LLUB 5INDA 2WIIA 4H88H 5MENB 1DE4B 1ZK9A 1G7MA 4DCQB 5B38A 4R6UA 1M7DA 2OXGA 2ATKB 1H8OA 1IQWL 5AD0A 3MLWL 4GRWF 1FO0L 5JHDB 3QI9C 2WQ8A 1D5MA 5DJYB 5DJ8A 1CFQA 3IAPA 1OAKL 1AP2A 4NZRL 1YN6A 3S37X 1LP9F 4L4TB 5F21B 2NNAB 4G8GA 3HN3A 2EDHA 2W07A 1V7ML 3TNNB 3ARDA 3D0LB 1HHJB 2AGJH 3S98A 4O2FA 1X5KA 2NTFA 2CIKB 1V3MA 1UH3A 2G9HB 4HKXB 1ES0A 3CFKA 5F6IC 2XKSA 1GSMA 4X7SL 5CP3A 2BRRL 4UV7L 3BIBX 4PJIA 5HGGS 4KRMB 3UDWC 3LD8B 3LPFA 2J8UB 3MCG1 3VXUE 5DYOA 2P8MB 2FCBA 2HVJB 2FSEB 1JN6A 1D5IH 1TQBC 3I50H 1JGVH 3NIDF 4PJGB 5FECA 1I7UB 5JLZB 2VLMD 1EDQA 1IGCH 4MJ2A 2F54D 4YBLC 5FHBL 5FKAB 2FECI 4Z7UA 1IM3B 1T2XA 1I4FA 2QKIB 2BJML 4TUJA 5JQ6L 4PJ5D 2ED9A 3DTXB 1NBZB 3CFBA 3VRJB 1S9XA 1G6VK 3BH8A 2D7NA 4FQCH 4YDVB 3P73A 4FQPA 1I8MB 4R4FH 4E5XA 4U3HA 2BX5A 4MB4A 2D7MA 2I25N 4PJXA 5EZIH 5E99L 5F88B 3OKEB 1EHLH 4HUXB 4YR6B 5F71A 2VLJD 1A6TA 5FXCH 3IFLL 4RA3A 1RZKH 3U9PL 5IBUB 5IR1B 4Z7WA 5IW3A 5DGRA 4LPXA 4OBSA 3VH8A 1F3JA 3GKWH 4I18B 4BQBA 3EOYG 3C5ZB 1TPXC 4WFGE 4WU7B 4TQEH 2A73B 3QXAB 4Y4KB 1RI8A 2BVEA 4KHTH 4WI9A 4ZTPH 2FBJH 3ARWA 4H8WH 3IDGB 1AHWC 1QUNA 5INDB 1T83C 4K3HA 4LPVA 5HDOA 5C9KA 1T04B 2DDQH 2W9DL 3W11D 1G7MB 4NQCD 5KN5B 2SEBA 5BS0B 2NX5E 5BZDB 4RZCB 3LKQB 3VGBA 4JFZH 3BMVA 3D18B 4PJDF 1EXUB 1F45A 4NP4L 1A47A 3D2UD 5CP3H 5HPMB 1CTOA 5KVDH 4AZ8A 1NC4A 2NY6D 4RAHA 4XRCB 1Z3GL 2R1XB 4JHBA 4YHNA 1ND0A 2NR6C 5F7HA 1FV1B 2FWOB 2AKRB 3E6FB 3ULUC 4NUGL 2XQYG 4HC1A 5E2VL 1XF3B 2HRPH 1PZ5B 5EOCJ 3QFJE 5D1ZB 1NAML 2VDOL 1RZGB 4HIIB 4B50A 1ES0B 1MRFL 3NZ8B 2PW1A 5EBLB 5F1IB 2ZWLT 1URLA 3DVFA 5GISH 1CLZH 4X9IA 3MLTB 3UYRL 1GIGH 1E6OL 2MOVA 5EIQA 3BZ4A 4M9PA 5K9JH 1CL7I 1J7VR 4F7CA 2OK0L 3ARXA 3BO8A 2B2XL 3ULSB 1YEEH 3GSUA 3VFVB 4BUHA 3CLEH 1N0XH 3MNZA 1CD1B 4PGEB 4R7DA 5TF1H 2HLAA 3OR7B 3QDMB 4KDTA 1FL6A 1IC5L 3RNQA 3V7AE 4LCCC 3SGEH 5BRZB 2XY1A 4S1DC 1P5UA 3QEQE 5IBTH 3UTTB 5TE6L 2BHUA 3VRLE 4XBEL 3MLRL 4KQ3L 4HIJB 4PJFB 3O3BB 1G1CA 3IDNA 2E7HA 3BH8B 5AWNL 3S4SG 2HFFB 1NCBH 3P73B 4HKJA 3ZYIA 3QDJD 5IMKB 1FORH 1UFUA 4GMTH 2GIYA 4BSVA 4Y1AB 3U6RA 3D3VB 2XZAL 4XCEB 2CKBA 2C26A 4P3WA 3MRDA 5LGJA 4HFUH 3QNZB 3KPQA 1NSNH 3EDJA 5BQ7A 1U8IB 1DQJA 1H3XA 3LN4A 3V4UL 2O61B 4HH8A 1EK3A 2VLRA 4P2OD 2X1XR 5E2TH 3QIUD 2ITCA 2PYEE 4QRPB 3DROB 4IRSC 4NZUH 5EU5B 5FCUL 5TQ0L 3VFNA 1G7IB 1WBXA 3MA7B 1ITBB 1WV7T 5H8DA 5J1TC 1MI5A 4FTVD 3UJTL 2IPTL 1BFSA 5ESAA 4UINL 4CADB 2NXZD 4ELMA 3U9UA 5DFVD 4OLUL 4POZD 4GRLB 2E5EA 4UAOB 3B2VH 4NN5C 5ENWB 4HC1H 3T0EB 4M9OA 1RK0A 5I9QB 5CILH 1ZLSL 4WHCA 4P2QD 3WUWG 5A40E 4G43A 3D0VA 4OCWL 1OGTB 3P30L 4XCNA 3WE6B 2EE2A 1N59A 2YBRB 4H0GA 2X40A 4YHNB 5JNYA 3TIEB 3KLSA 4X7CC 1S7UA 2DQHH 2VISB 4NJAL 4DUXA 2AXGA 4D0CA 2LQRA 2AJSH 3MFFA 5GS2H 4WO4B 5HGAB 4L8BA 1FO0B 1RMFH 3ZT7A 1U6AH 2YD5A 2G60L 1QLRA 2WQRA 2FGZA 4MDIA 4IS6A 2VSCA 1BQUA 1IVLA 1OWWA 2DWDB 5HHME 4OCRL 4PR5B 4XNYH 4LSPH 5EOTA 1A6UH 3O6FC 3UTZB 5I1AB 3BO8B 4R0LB 4RCAA 3MJ6A 1NEZA 3ZT6A 1J9CT 2GY5A 3E6HB 3GI8H 4WY7H 1IJ9A 1CGSH 3VXOA 3LH2L 3FT2B 5D1XC 1DBML 5I73C 1SMOA 2A9NH 2Y72A 4NKOB 3WV0A 5CEZL 1MJ8L 3UROR 2CKBH 4P9ML 2FZ3A 2LAAA 4YAQA 2XICA 5E8NA 3SGKA 3FZUD 3QDGD 4X6FA 4HKZB 3N85H 1YMMA 3UO1H 4D0BA 1H3PH 1FDLL 1HH9B 3SKJH 4HKJB 1V7NH 4NYLB 4YZFF 5C0AD 1CXLA 3O9WA 4W81A 1LD9B 4PD4J 3KPOB 2R1YB 2YPLA 4UUJB 2X4TB 3X14B 3MNVA 2X10A 4EN3B 4WEBH 1OB1A 5IVZA 1OGAE 4Z76B 5D5ME 3PIQA 4JPVL 1XR8A 3HI1B 3LEXA 1KTDB 1DQJB 3G08B 3O3AB 3AREB 5TDNB 4M1GL 1JRHI 3H3BC 5F96H 2JKXA 1QVOA 3JWNC 4U1JB 3O81A 4NHUB 4LCYA 3H6JA 2ITCB 2VOTA 3VFPB 4NOFA 3LRSB 4L3EE 4P23A 2GJ6A 3TIDA 5ESAB 3SEPA 4ZFOA 4HZAA 2IG2H 3U9UB 4XP9L 2CO7B 1PQZA 3UZVB 5KJRL 3F7RA 4JG1H 3VFMA 2BFVL 1CTNA 1FC2D 5DSCA 1WLHA 4JR9L 1T03L 4JPIA 1DUZA 3ZYZA 4L8DB 1KJ2B 2JIXA 1VFMA 5TF0A 5EC2A 5DMJB 4PRIE 5F9JB 1KNOB 3D85B 4NJ9L 5E9DA 5DJXA 1J0KA 4KGLA 1S7UB 4X9BA 3BT2L 5JOFB 5E1HB 1FBIH 3WBDA 1AFVH 3HMXL 4HKBB 5J11B 5LG1A 5L9DL 1LP9A 5CSGA 5E7BA 3U7WH 3U0WH 3UJJL 1DLHA 3KNBB 4MJ6A 3H0TB 4HWZB 4AJ0A 4U1IA 2AABL 2Z8SA 1WAAE 3S35H 1BQSA 4M1DH 3UMTA 4LRNL 1YPZE 3PGDB 4Y2DA 2ENSA 2ZUQB 1PDKA 4OT1H 1S8DA 3ARDD 5FF6A 3Q5TA 4GW1B 4AEIH 1ZVSA 4FQXB 2RB8A 4KRPB 4KXZH 4ZPVA 3VRIB 3QCVL 1IFHH 4RAVA 1IM9B 5HVHB 1S9WB 1UVQA 3MRIA 5J1AB 4IOSD 5I8EB 3HNVH 4A6YB 2QSCL 5E24E 4MAYA 3V5KA 3N1QC 3IJSB 4HJJL 5EOQH 2G5BB 5ETUA 3RGVB 1KEGH 2AI0L 3A6CH 3Q1SL 2EIEA 2ARJA 2OL3H 4JVWA 3WO3B 5ID0A 1OF2B 2XRAH 4NRXA 3GKZA 1NMCB 2Z93A 3JXAA 3UTTD 5EUOF 2A83A 2OP4H 4HFWA 4N8VB 3SDXB 3ZKQD 1XR8B 2ZKHL 2Q3ZA 3MACH 5HJ3A 4Z7VE 4Z0XA 4PJ9A 2EH7L 2HJLB 4LEOB 5ACLA 1FFPA 1CDGA 3SBWA 3F5WA 3BUYA 4Y4HB 3NA9L 3S6CA 3HPJB 4MQ7B 1T22B 5IB1B 25C8L 1LE9B 4BFIB 4KI1A 4DGVH 2GJ6B 1ORSA 3ZHLA 4CBPA 4WWKA 1D9KA 5EB9A 3RX7A 1KIPB 4F15C 4ZFOB 2DN7A 4Q9RL 1DEEA 2EDRA 4GRWH 5C0IB 4LLMB 3BZFA 4GLRI 1YA5A 3HC0A 1I9JH 5ESVA 5JMRA 1PG7L 1ZSDA 3VFMB 1TJHH 4OI8A 1JFQL 5JXEC 5ILTH 3LQZB 1ADQL 2Z4QA 4QRPD 4XAWH 1QSEB 1EZVX 3OPZL 3L5XL 4I3GA 5GRUH 4JO1L 1QTYT 1UZ8A 4WDIA 3DGGA 3FB8B 3VD7A 3WUZA 2DQIH 1GGCH 3MV11 4Y5XB 3FQRA 2NZ9C 2DKUA 4E41E 4O2CB 4K2UH 3OKMB 1U3HA 5IFJA 1L0XA 1XGYL 3AM8C 4Y4FB 5KSUB 2IMMA 1J88A 2YXFA 4ZTOH 2XQBL 3AAZA 3QUZB 2DBJA 5DRNB 1NC4D 3B8SA 1EIBA 4YDIL 5AZ2H 1SVCP 1AKJB 1KN2H 5E7FA 1Y6KR 3ELAT 2B1AL 1I9RL 5IGXH 5DQJB 5ITFA 3KHQA 3W9DB 3DURB 5BMFL 5ICZA 1NCTA 1KN4L 4ELKB 1XGRA 3HI5L 4KUZH 3U36A 3FO1A 4UB0H 1S78C 1F4YL 1IGFH 1ZT1B 1R6VA 3BP7B 4BK5A 3N1FC 4PJGF 2GW5A 4NCDA 1I3GH 5CJOH 3G6JB 3GBMH 4FXGA 1H3TA 4YO0B 1CZ8L 1BOYA 8FABB 4Z9KB 3T1WA 2EEAA 2B4CC 1AGCB 3O41A 1ZHNA 1AXSA 1EX0A 4FZ8H 5CINH 4R90L 2WV3A 2XWTB 3PJSA 4HDIA 4FQIH 4NUJA 2DQFA 1ORQB 2W91A 1QFWI 4JO2L 2ARJB 4S10A 2W0LA 1CICC 1WT5A 1J8HE 1J18A 2WK2A 3MX0A 4OF8A 2A83B 2VR9A 3C9NB 3MZTA 5FO8B 1WITA 1RURL 3DXAE 4HPOH 2KZWA 2AJZB 3I6GA 1HHIB 1JWUB 1OTTC 1FLTX 3GMRA 5L0QB 1VHPA 3HI6H 1S7TB 3WFBH 5D5MF 1EFXA 2NY3B 3TBVA 1WBZA 5JZ7C 4FXKA 3TA3B 2X4NB 4J8RA 1X5GA 5DK3A 1AGEB 5FYLE 1IAIM 3C6LA 1H9VA 2DKSA 3ZL4L 3QHTC 3BZEA 3RWEA 1PKQA 3ARED 1FGNH 1MF2H 2VLRD 2GUOA 1ZA3A 4XXCA 1HSBB 4LAQL 5ESVB 4J3VA 4PJ8C 1HHKA 1FFNA 3T8XA 1YEGL 2JELL 3CDGA 3DO3A 5EBWA 1IGIL 1MI5D 3VXRB 5FB8A 2Q8AL 2NY6C 5SV3A 1NBYA 1D5ZA 3ZKXC 5I1GH 3DGGB 3DGCR 3MRKA 3KVQA 5DVLA 4M7ZC 1EO8L 5D6DC 4WNQA 3I6LE 3JVGC 3WD5L 2VZTA 2GQHA 2R69L 2CK0L 4MD0B 2W65A 5J56B 2FX9H 4ONHB 3KPNA 2YK1L 2EEBA 5IFJB 4ODHL 3L9RB 3ALXA 2QLVB 1OPGL 2EE9A 4TYUA 1NC2B 5EPMA 1T1YB 2Y6SD 2PNDA 4JRXA 3PHQB 4HD9A 1WAAF 3TCLA 2HN7B 3BPNB 2DQEH 2R15A 2GJJA 4IRJB 3AS2A 3BKJL 3ARZA 5DC4B 4EXPX 5E6IA 2O5ZH 3B9KA 1ZGLP 3MLZH 5IM7A 1H3VA 1GHFH 5JW4N 4JZOA 4PJ7B 3JZ7A 3SKUD 4JM2B 1L7IL 3VXUA 1BFVL 1MIEL 3O41B 4UIKH 4UIMB 4CN4A 3DBXA 4HF5L 3N0PB 2NQCA 3MCKA 3BKYL 4FQXD 4G6FD 4KRPD 1QBBA 1YUHA 3V2AR 4R26H 3CGTA 5I74B 4NWTL 4EUPB 3JWDH 4OF3A 5T5NF 3WL9A 5IHLB 3VDBA 4UU9A 3BYYA 2NYYC 4L9LA 5HSFA 4D9LH 3WUWB 5I1EH 5IVXB 4N8CH 5I1DA 4EDXB 5J13B 2DQTL 4YHKH 1WFOA 1NGQL 3MV9E 1FC1A 2HP4A 2OJZL 3RVTD 4U1KB 4I4WA 3QIUC 3ULVL 4KTYA 4RDQG 3O9WD 2QQQA 3EYOA 1C5CL 3KPMB 3SCMA 2YPLD 4WFHD 4K3JH 4P4KC 4Y5YB 4CW1A 3MRRB 3ARTA 5ALCL 1KT2A 5DVMA 1MCIA 2IADB 2VH5H 2Z8RA 3MR9A 1UJTA 1Q9OB 4POZC 4UBDD 4RGNE 1OAXL 1ZA3B 1TJGL 5EIIA 5TGBA 4HUVB 1B6DA 2P8LA 3T4YA 3TWCH 4OAWA 3CSBA 4BQ9A 1CIDA 1RIHL 3QULB 2AV1B 2HRLA 4P23D 5C09B 4XXDA 2GJ6D 5TDPA 1IZKA 3DV6A 3VDCA 4HG4J 4BSWB 4QY8B 1MRDL 3TYGL 4F9PA 2V9QA 3PWLB 5DC0A 4R7NB 2QJDA 2ZNWA 1H8SA 3T0VA 3AU1A 3HZMB 2NW3A 3T0XA 3U0TA 4WNQB 2Z35A 3SKNA 4P4RA 3QR2A 5JDSA 2W9EH 5GSVB 3NAAL 2NX5A 2VABB 2AQ2A 2VITB 1AI1L 5J7CC 4XVSH 1QSED 3Q48A 3MXVL 1MQ8A 2A1WL 2WWMC 2Q6WB 5J4MA 2FX7L 4P5KB 4KVCL 1KJ3L 2FRGP 3MQIA 1RVFL 3D25A 4K7PY 3WIIL 2CMRH 3K1KC 4K8RL 4LEXH 3DETC 4PREA 4HLZG 3DO7B 3HE6A 2IANE 3QUMB 5MERB 4OD3L 4YUEL 3QFJA 4PGDA 4NT6A 4Y4FD 4OLVL 5ISZB 3EOBA 3CX5J 2ADIB 3RWGB 3QUZD 3X12B 1GPOL 3CVHA 1IAKA 1NGPH 1M1SA 5IM7B 4U6VH 1Y6MR 4HIHB 4BH8B 3G6DL 3VXUB 7FABL 3KDMA 3RWHA 35C8L 3EYSH 4JRYE 3PWPE 4PJEF 3TO4A 3TJHC 2DYPA 5C71A 1XGPA 4KC3B 4MVBD 5TPWH 1MY5A 4Z5RB 4JKKA 4OZ4B 4MNQB 3VWJA 2X4QB 3O4OB 3VD4A 2VDRL 2FX8H 3OAZH 5CEZE 1BF8A 4Q7DA 3W81A 5ANME 3IDXH 3DNKA 3BN9D 5KVEH 4PD4K 3HZYB 5LKNA 3TBYB 5SWZE 4G8EA 1FRGH 1QRKA 1N64H 1UCBH 4MAYD 3F6LA 2ZG2A 3L5HA 2NY4D 1R3IL 1OP3K 4X6DE 5FK9A 1QR1B 3SQBA 3U48A 2K3TA 3GSNB 4MDJB 1KCVH 4M6NH 5CP7A 4GUPB 3G9AB