2X28A

Cadmium bound structure of sporosag
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
235
structure length
219
Chain Sequence
TSCETEGSSISFTVEKAGHVVRFNCPSTLEEIKPAYEAGDSTKVCTTADCSNEAALKDVLKSASLAQAEGSSGGNDFTLTVDALPEAETSVFFLCQRTGADKCGVHILVKAAPQAPVCSAQDHTLELQITAANSDTSFVCGGTFNVIKPANAAKVLQDSCETEVDLVSLVPHASRSALEQSGLIKLSVTDLPQQQQKLCYRCEDSSQKACKVLVTVSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of Sporosag: A Sag2 Related Surface Antigen from Toxoplasma Gondii.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Membrane protein
molecule keywords SPOROZOITE-SPECIFIC SAG PROTEIN
total genus 47
structure length 219
sequence length 235
ec nomenclature
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04092 SAG SRS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1320 Mainly Beta Sandwich Immunoglobulin-like SRS domain 2x28A01
2.60.40.1320 Mainly Beta Sandwich Immunoglobulin-like SRS domain 2x28A02
1KZQA 2JKSA 1YNTF 2X28A 2WNKA
chains in the Genus database with same CATH superfamily
3FT4B 4YBLB 3VH8G 5I8CB 3SJVB 1WBXA 5EU3A 2WJ5A 5D5MF 3GTTA 1M6UA 3TYFB 4ZG1A 3ILPA 2RCSH 2FWLB 5AWNH 1AD0B 5EORL 1OB0A 2HZHA 4QD2E 1A6TB 5TPWL 3ZE2E 5KSAB 4L3AA 4E9TA 1O6SA 4FA6A 3KVQA 3U46A 4Z6AT 4RZKA 5ITBL 2B3IA 3T0EB 1S7VB 4DTGL 4DGWC 1TZIA 3BP7A 2G9KA 4X98A 4S10A 5HHMB 4LIQL 1F00I 2ERJC 3GRWA 2FX9H 3BE1H 1HKFA 3MOQA 1KXVC 1F4AA 4M7JL 1LXMA 1R1CA 3FUJA 2P5WD 1VLXA 3D3VD 4XCEA 5KTEH 3DO4A 4XB8A 2AK4D 1H0DB 2CCWA 3REVA 1FZMB 5LVEA 1NBZA 5IJKC 4WK2B 3TZVC 1SNRA 4X7SH 4BZ2H 4NQDB 3BXNA 3Q5OA 3BO8A 2W07B 2XTSA 6CGTA 1ZS2A 4P5TC 2EIJB 2OL3L 3HFMH 1MCQA 4HCGA 4W81A 5HD8C 3IWUA 4HUWB 5DJ2B 4U33A 4V1DE 4N0RA 3ZMEA 4LF3B 3QUMH 1BX2A 4NUJA 5KYYB 2MTAA 4UBDC 5E8EA 3L3KA 4X5PA 4WUUD 4XXWC 4IEFA 4D0DA 3HB3C 4KY2A 4P2RD 4HPOH 4JRFA 4KZCA 4HEPG 3AM8A 4OI9A 3GBNL 4WW2A 3ME0A 1QEXA 4CA4A 5AVZB 3QZPA 2X38A 4DCQA 1W6WA 3SB3A 3PP3H 4MXWL 1P7KA 4N0CD 2AXJA 2LVCA 5IVXA 1OGAE 1R3JB 4FJYA 4DK3A 1H3GA 3MV9A 3PU7A 5T1KD 1KYUA 4K5LA 3L5JA 3KWXA 4QHNA 3AT0A 3AC0A 3HIZA 1ED3B 1L3WA 4EDWH 4P2RE 4M1DH 1FJ1B 2NY5L 3CN3A 3C08L 2WVVA 4TQEL 4J3XA 4UMGA 5ID0A 1NCCH 4P9HH 1XGUA 4HSQA 4OV5A 3A21A 3O6ML 4LK4A 2BHYA 5L8JB 5HVFB 3B9KC 5E6IC 1LYQA 5L2KE 1FFPA 5CCGE 4DEWA 1ACXA 3DGCR 2HKHL 3VJ6A 1KYFA 3A0OA 3AQZA 1N64H 4JN1H 2AEPL 3NQKA 4NNYB 3V4PH 4AE1A 4NEHB 5D7JD 4Y16D 2X6AA 4QHUA 4BEIA 3HZ3A 1JE6A 1RULL 2R2EA 4JFOB 3IFLL 5EO9B 4AXWB 2YGPA 1H5BC 3CLWA 2VAAA 3EJZC 4LRIC 2CALA 3JWDH 3UIYA 4H20L 3SOBH 3VTTA 4FFVC 4HMDA 1JGVL 2L7EA 3TZVD 2BSTB 3FOLA 3D2TA 3OLIA 2ZTBA 4W68A 4ELME 3SE8H 3ZDXB 2AVGA 3L4WA 3LX9A 3D69B 3EJZD 3NGBB 4NO2A 4QRFA 4ANWA 1T7ZA 2I27N 3NH7L 2XIDA 4MGXA 5KVFE 3S35X 5GQBA 3DUSA 3P77A 4BM7A 1C1EL 1EGJA 1BQHA 3AXLB 1T5XB 1VACA 2W80C 4GRMA 5HI5C 4OLZL 1INQA 3C60D 4Z3FA 4PJHB 4AW7A 3TM6A 3C2AH 5D71H 5IMKA 1CICB 3GQFA 1RUPL 3D0VA 5TE4H 2H0EA 1BD2B 3MLRL 5D2LB 3B2VH 2DWTA 4NQED 1QPXA 1FUNA 1ZSHA 1PEWA 2VH5L 3K6SA 2XKNB 2WUBH 1TJMA 1XHHA 4GBXA 3K1DA 2W8CA 3PPEA 4QRPA 1BF2A 4RAUA 3VVVA 3PWPA 1GHFH 4PD4J 5AB2A 3OF6A 4B5EA 4P5MB 4XODA 1VFUA 5SWZE 4LEXH 2BMKA 1ZHNB 2ZX5A 4YDJA 4NX0A 3HHSA 4Z9KB 3TBWB 2NR6C 2ZG2A 3MODH 3IEAA 1MFBL 2RALA 4KMTL 4L4TD 3KD4A 1B0RB 1ZPLA 2CJTA 4C83A 4P3CH 1F6FB 1ZDQA 3D85B 2FCBA 3D85D 3L54A 1MCLA 4LLVA 4XNAA 2WQVA 1NBVL 4XB3A 3U36B 3LEYL 3QFJE 3GB7B 3GZOA 5HHVH 1L6XA 1XSIA 1MAML 1LDPL 2VM9A 3ARTA 5KBDA 3OPZL 3G5YB 4L1DA 2HFEB 5KUKA 5D7HA 5DCCA 4U0RC 4KHTL 1P7HL 3V6OE 4R8WH 1O6TA 4TPRL 3VXRB 3O4LA 4AG4H 4WWKC 5D93C 4KOCA 4JBSA 1MNUL 4XNDA 1FYHB 3QORD 5TDNB 1CI3M 4WNQA 2PETA 4TSAH 4FZ8L 4OD3H 5K9QI 4N25A 5CLXA 4EZLA 3F7YB 5FEBA 4TOYH 5I8OL 1ZA3B 3HMWH 3QHZL 4ZFZA 1Z5HA 2O5XH 4IOSD 1EANA 2AQSA 1FNFA 1SYVB 1S7VA 4RGMC 3I74A 4RDBA 1IFGA 4QKXB 5FHBH 3SDAB 3UC0H 4APXB 3NG5A 3WNLA 2E7LA 2QV2A 3N9GH 3UZQB 5I73C 1CFVL 1GGYA 4M9PA 2WPGA 2Z31A 1H3WM 3F58L 3RTQD 2IVFC 3ARBA 5E4AA 5I23A 3BKJL 4IMKC 4LCYA 4WJ5A 5IESL 1A3QA 4PGDB 4ZW6A 4F7EA 4QWWD 2V5YA 4Y4KB 2P4AB 4A1RA 4GKOA 3HUJE 3MA9L 2L0DA 3VFRB 2VDML 1H15B 3AS0A 3GLZA 5A6LA 4Z7VF 5DXWA 1SJHA 4ACTA 1YEEH 2WSPA 3CSPA 4KO5A 4WFGD 1NGQH 3LAFA 3MRQA 3JTTA 3PGCA 2O26U 4CC0A 5HGHB 1ORSB 5F96L 5CIPB 3HS9A 5BNXD 1NAMB 4NWUL 3X11A 1KLFB 3QDGA 4Z76B 2YD2A 2CLVA 2R1WB 5C8JA 2QKIA 4L4TA 2ZF9A 3Q5TA 3QJUB 1T7VA 2VZ3A 3ZZQA 4A63A 2I32A 4EZJA 3OQRA 3H4FA 5BRZE 1T04B 1TZHA 4MA3A 2Z7YA 3EDJA 3C09C 3KXFE 3L3OC 1YN7B 3ETSA 3M07A 4NO5B 1D2PA 3NJNA 3QDGE 3U1SH 4JO2H 1F8TH 4UT9L 2AAVA 2PWFA 3LZPA 5J6HA 1M1XA 3EYQD 5C07A 2VMJA 3RNKB 1ZE3H 4X8CA 1S9WA 1WBYB 2F5BL 2KLRA 4HH9B 4OB5L 4FX5A 4CDGC 1CQYA 4YE4L 2FR4B 1FO0H 3IXTB 5I19L 3G5XB 5E51A 5CBEB 2COVD 3V9EA 4AIOA 2YPKA 2BP8A 2ZXGA 2HG0A 1UOVA 3SODB 3MJ7A 1YJDL 3CN1A 3A4EA 4FFWC 4UF7C 4Y1SA 2D7TH 2Q8AH 1RUAL 3B34A 3HNSH 4LEOB 4PRHB 3FMGH 4MVBC 4QRPE 5D2NE 4NP4L 4PAZA 3OX8B 2MOVA 2DTML 3ATAA 2E59A 2X6MA 5H2BB 1A8JH 1AKJA 4PRBA 3CWGA 1LP9E 2IADA 4IOSA 4KBPA 4MZRA 4GKZB 2C7UA 1XX9C 3UACA 1BQSA 4IBSA 3HG1A 1TSRA 2X1OA 4RNRA 3LKQA 3I3EA 3IKCA 1VZGA 1OAQL 4QOKA 2HT3C 4R5TA 1TOXA 3MQIA 3CHQA 4JFQA 1UOWA 2IOIA 2Y6SD 2CRIA 1HXMA 1TETH 5EC2B 4JM0A 4Y4FC 1EZSA 5DUPH 1HYSD 5DJZA 1PS3A 1SYSB 3L1OH 4JRYE 1XGYL 1UASA 2PNDA 5M7QA 1B88A 5FS5A 4JFED 3T77B 3KWWB 1WICA 2NNAB 1AHMA 1BEXA 3HC4H 2GBVA 2OJEA 1BWWA 5ESAB 2CQVA 2EKSA 4ANXA 2CBQA 4JPKH 5LNEA 5EEXA 2V37A 3GPSA 3CDZA 3DX6A 3W1ZA 1MLBB 4H8WL 3QEQB 5LCVL 2R59A 5C0NC 3U7AA 1I1FB 3I9IA 4LLDB 2DMBA 4BH7B 3NFPB 4E5XA 3FMGL 2B39A 2F53A 4RMTA 2GFBA 3S5ZA 1KJ2B 2Y7QA 3IFPA 3QDMD 5DS2A 3A23A 3RGHA 4ZUSB 1RZFH 4G8GD 2PO6A 5HYEA 2AMGA 1IKFH 3FOMA 1QSVA 4JFFA 3EYFA 2FDBP 1CE6B 3LXAA 1FIGL 2D0GA 2G2NA 4EVNA 1SLXA 4XVSL 1ZOXA 2ZAGA 4RISH 2C9PA 4G72B 3W3BA 1EFQA 4KK5D 3MV9D 1MFVA 5AZEH 2AVFA 1F6LL 5C09A 5IHWA 2VERA 1SVCP 2XA8H 2O93L 4TUOA 4K23L 3A5VA 2OP4H 3CN0A 3VD0A 2PCPB 3MV8E 4JO3H 3VI3F 4G6AC 4OFPA 2CUMA 4GUCA 2VDKB 1XEDA 4JFUA 2VR6A 2BVTA 3CFKA 5BRZB 3NZ8B 1TO4A 4NQVA 4Z7OF 3RTQA 4PJ7E 1HILA 5AG9A 4ZOAA 1I1AC 4LPYA 4YSOA 1SLUA 5FOJA 1F3RB 1OSPH 1T4WA 1UB6B 2NY0B 4RIRB 2H45A 3SKMA 5A2AA 1ZVSA 2CUHA 6FABH 3ZR6A 4QHKI 2ZUQC 2ESVD 3GTVA 3HS0A 3QCTH 3EJYC 4JFZL 4J7RA 1JYNA 2YGOA 3CVCA 3K6IA 1S8DA 3KYOA 4NC1E 3UJTH 4CMMB 1PBYA 4MVBD 1G87A 3AG3B 1I9IL 2HKFH 1NFDE 1D9KD 4AITA 2VC2L 4XN2A 1HI6A 1E5AA 3DO3A 5E5LA 3ZKND 4PJEF 3V5HA 2IV9A 4LOUD 3F04A 4GW1A 1B4LA 1IL1A 5FHBL 1KCWA 2HCZX 3TBSB 1NM9A 2MQGA 4X6EB 4Y9CA 5ID0B 3JZYA 3T08A 2CGYA 1I8MA 1Q9WB 3F5WA 5ICUA 4GAYB 2B1OA 1A9EB 4X0NA 2HFTA 5D70L 3FN9A 5GS0C 1MNUH 3DDFA 5LXGH 4OBRA 4AG4L 3CVIL 4NNYA 4Q6IA 3JSSA 4ZFZB 1TFHA 5L2JA 2MJWA 3UG4A 4W6YB 3MNZB 4WJ5B 3VXRD 1VF5C 3WHE0 3LOWA 2X6VA 1DANU 5IM7A 1CFQA 2ICES 1RJLB 5FO7B 1NBVH 2G75A 3SPGA 4OZFB 1U3HC 5E95B 5CCKH 1FO0B 3O3BA 2BCKA 3H9SD 5I1GL 3VXSB 3F6IA 2IWGA 4N8VG 4KMTH 1IM3D 3BUDA 3QFDB 5MEND 2JCCF 1OT1A 4L4TB 2WZPA 4UIMA 1OM3L 1KCBA 2V5RA 3Q3GA 1R3JA 1WUZA 3T0EC 2ED8A 3ALWA 4Y2LA 3DLQR 4KMLB 1CL7I 3QG6B 4GUOA 4HCRA 1AFVH 2G0KA 3SDCA 5AG8A 5E94A 1RK1B 4BBWA 5DD1L 2G3XA 5TTRA 3U83A 1WO2A 1ZT1B 4ADIA 3GFUA 2WOBA 4TNEA 1OK8A 4HWZB 2RIKA 5CZVH 3QUKA 3ESUF 2XFXA 3ARED 5EZLB 4RVBA 3EFDL 1IC5L 5A6MA 3WEMA 3VWJA 3O8XD 4FQ2H 1K4DB 3R0MA 3WELA 2CD0A 3QJQB 2AJVH 2H3NA 1G7MB 1BOGA 4DP4X 4I88A 4PP2B 3ZTEA 5JUEH 2VIRB 3LH8A 2BMKB 2XI9A 4S11A 1O0VA 5AYQA 5ACLA 4A7SA 1A6TA 3WJLC 43C9A 2FBRA 3EJQA 5JXEC 1F13A 4CKVX 5DO8A 4PW3A 1OAYH 1GKOA 3X12A 3R18A 4JB9H 4N87A 4APQB 1HHHB 3O2DH 3SE8L 2BY2A 2WQRA 2XX0A 4IBVA 3QEHB 4TVPE 1YDPB 5CNHA 2EEDA 1JGVH 3G6DH 1OPGL 4L1LA 1A5FH 4F2MA 4ERSH 1CD0A 1P6FA 2C1OA 2CDFA 2YKLL 4S1SL 1D7CA 4PN6A 2R4SH 5KN5A 1TTUA 4APQC 4B7IA 2ZD0A 3OKLA 5DS8A 1WP6A 1KBPA 1P5UC 1SQ2N 3V4PL 1CLOH 5JMRA 3D9AL 5HI4D 4L0PB 2ZNXA 5BV7C 4E9WA 1USQA 3RWHA 3FQNB 4X50A 2VQ1B 2XQYK 1RPKA 3PFUA 1DQDH 3P3SA 5ESAA 4L9LA 3PGFL 3O41B 1LO2L 3CH1A 1Z9MA 1BPLB 4MQTB 1JGLH 5CJXA 1NCCL 1NMCC 1A4JB 2R23B 4FCHA 4RDQF 2ZWNA 4H5SA 3KPSD 5CEZH 1S9VB 4XPBH 4EDWL 3FTUA 5DHYA 5CAYB 4RAUB 1BG1A 2WXFA 3BYTA 4P8QA 3WE1A 3WNIA 4R90L 1KFAH 2ADFH 4J8QA 3A6BH 1OTSC 4EVNB 5CSZB 1R0AL 4MNGE 1EBAA 3IJSA 3S5YA 3P3TA 4EQ3A 5TDOB 2MMXA 5DWUL 1GY2A 1JNJA 5GGVL 4HWBH 1ET5A 4CSTA 2HTLD 1WVZA 4WUUB 3VI4F 4K9EH 2ZSWA 1D5ZB 4UQBA 3QDGB 1LK2B 4U2ZA 2F1AA 4ZTOL 3V0DA 3A47A 4G7RB 5IB3A 5JLZA 2B7DT 2C34A 1LK3L 3AUWB 2NNFA 4IRSA 5C7XL 1JXFA 4Z95H 4Y1AE 5MENA 3TU6A 1RJLA 3FSVA 4X6DE 4YN3A 2E6JA 2F74A 3GXIA 3OKOA 1QBAA 3AT9A 5HDQH 5C07B 2GC7C 1HEHC 2OL3H 4AQ1A 1LD9A 5DD6B 4O02L 3GSOA 2J21A 4L4TE 3FFDB 2A6IA 4X7SL 4E41D 3SPJA 3HJEA 4JY5L 1OD7A 2UY6A 4MDJB 2KZ1B 5C3LD 2OTUB 5F9WC 2DBJA 5I5JA 1JZ8A 3RX9A 4HZLA 2XWXA 3LN9A 4M7JH 3SGJC 4IBTA 3BE1L 1N8ZA 4XWOC 3COOA 3AQXA 4U6YA 2Q0ZX 3DMMD 5ALBL 1OARH 3ASOB 4M5SA 1U3YA 3CZGA 3QIUA 2A74A 4K0OA 1YEJL 4KVCL 2AJYL 1HL4A 4EDXA 4NNXB 5GS3A 3FO0H 4GW1B 1M05B 3KJ4C 4K2UL 1E9PA 1H15A 1QUPA 2ZCKH 1EBPA 4I87A 2J56A 1J8HD 2WMPB 1ECZA 2VWEC 4R9HA 5JYLA 5TDPA 1UG9A 2EZ0D 2VXQL 3LNIA 5FYKD 1E7UA 4OJCA 5TPWH 4WGVB 5KVFL 1MW2A 2LGNA 2WLHA 4RMWA 3VRIB 2MQCA 4Z7IA 4UM8B 1P0SE 1I75A 4J3OF 4JHWH 2VLJD 4CVUA 3K5RA 3ZMNA 1BF5A 5AW3B 4N2CA 3AS2A 3VNZA 1UH2A 5JIKA 2DWXA 1FFNA 2Q87A 5L2KA 1KB9J 1I8LC 3DVNA 1CTOA 5DWPA 2JMRA 3Q0HA 1E6OL 1A7OH 3FJTA 3UP6A 3IM1A 1WZ1H 3P2TA 1D5RA 1L7IL 2WQXA 4MA3B 2W9DH 5B4MC 4YDLC 4DZ8A 3FSAA 4FQJL 3P4MB 2VN5A 5C0AB 2HUEA 3GSQA 3V4VB 3ARDA 1WZKA 2QFRA 1JI2A 4HQQL 1EZUA 1CGSH 2N3JA 4UYPA 4J5VA 1FYTA 1A6UH 4TF4A 2D4FA 3O4LD 3MSPA 4J6RH 1XCTA 4Z0BH 4JDZA 5TGBA 3HUJB 1DO6A 1QFHA 2ZKHH 4PLOB 3MBEB 3MVSA 3DTXB 3CDYA 1FL5A 2Z35B 1X5LA 5HYJE 2B0SH 3QZWB 3IAQA 5DQ9B 4YVUA 1MCFA 1MJ7L 3T4YA 4YUEH 3C8KA 2Y7SA 3BZFA 1FNGB 5AVSB 1EO5A 4M6OL 4KXBA 1L0YA 3EDFA 1AY1L 4WV1B 5CSGA 5EOTA 2HG5B 3VFOA 3DBXA 4HXAL 4TMPA 3VTAA 3UTZA 2F7IA 2H5UA 3HMXA 1TTBA 4WW2C 1CXKA 5IGXL 3TIDA 1E5YA 12E8L 1QI5A 1JN6A 2DDQH 4QYOB 3ZHNA 3VX1A 4NPKA 4BA0A 4ELDA 3GMOA 2Z3FA 2CIIA 3DJZA 3ECQA 4NUPA 4DVBA 3KBEA 3DTXA 1ONQB 2YUXA 1MJ8H 1QNZL 1YEDB 1ZDSA 2JQAA 2VMCA 4NKQB 4U1HB 4WFED 1FH5L 4L48A 4XH2B 3WKQA 3SBQA 3VFTB 1FGNL 3JZ7A 4KQ4H 2NW2A 1FV1B 4DP8X 5DQ9A 5K93A 1F3JA 1GAFH 3L3JA 5IBTL 4ZMXA 1JZ3A 3BVTA 1QFWL 3GI8L 3V5HB 4BGDA 3QORB 4FQLL 2H2PD 3L17A 2QMJA 3A4AA 2FSEB 5BVJA 4P05A 2V9RA 2V8LA 2R0ZL 1AXIB 2UX6A 3Q1SH 4K9JA 5LBSA 2Y1ZA 1J8HE 1MQKL 2OCCB 4ZNEE 2WK2A 3ZSTA 4O2FA 1IQWL 1F2QA 4AZ8A 1KWGA 4Y4HC 4FXLA 2XV3A 3QG7H 1CXLA 3P4OA 3S4SA 4MJ2A 5BZDB 4BSVA 3HKFA 2OMNA 1FGVL 2VJ0A 4JDTH 5IQ7H 2OTUA 4I1PA 1D3CA 5C0GB 4IBZA 3LHPL 3E8UH 3QCVH 4L8SC 3O6KL 1BFOA 4LCUB 3MO1B 4BK4A 5L2JB 4M1GL 3K71A 1A02N 1KJ2L 1RLBA 5B38G 5IFAH 2V7NA 3OLEA 1I1AD 3IJYB 3OGCA 1A4AA 4TVUA 2KZBA 2AK1H 4JFYB 4LVEA 5D7JA 5D7SL 5CIPH 1MNNA 2OJZL 2YRPA 2FH6A 2MPAL 4P4KB 1YYCA 5IHUL 2MNWA 2FLRT 4P9HC 4KK9C 3FCUB 5LG6A 3OZKA 4P2OC 4YEEA 3NJXA 3HC3H 1LO3L 1NL0L 4IJ3C 4TS6A 5JPMA 5IFJA 2JTDA 3L1FA 1BX2B 1VCBC 4NQEB 4OGXL 2WXLA 3DMMB 4MXQC 5K9JL 4WY7H 3QQ9D 4YQXH 3MBED 3SD5A 1NGYB 2A6KA 3EGDA 3AABA 2MKWA 3B8SA 3C5ZC 3PCYA 4NN6B 3V52L 4BFFA 3E7JA 1LEIA 4QMEA 3MKGA 2FAUA 1AE6H 4WV1C 5J4MA 4ZBJA 1P7KB 3KGTA 1UWEL 4E9QA 4PBWD 2XNAB 4ZUTA 3SKNA 2WWNA 4ZI8A 2R27A 2F58L 3S5LG 2J4WH 3ME0B 1D5BA 4MB5A 3WSQH 3BPLC 3C5ZD 5CBAA 3MV8D 5EO1B 4H8QA 3OKEA 3ESMA 3FFDA 3M7OA 1WYJA 2X42A 3RZCD 3CZNA 4NSKB 4X7DC 2DI7A 3MJWA 1OAZH 2QELA 1Z0NA 2ZYIA 2ALAA 4WI3A 4C56E 5I1EH 5JYMA 1BREA 5GHWL 4ZFGL 5DRXB 2Q3ZA 3QIUB 4DO4A 3ZQ9A 1ZGLA 1EGJL 1IC7H 3LPOA 3AY4A 3JXAA 5FDWA 1Z9NA 1FI8C 5DD5L 1M7IA 2W9LA 3DIVA 4GB9A 5ABDE 4HBCL 1OGTA 1U8IB 3QUZA 4FG0A 5IBLD 2LT9A 1IM9A 4QRUB 1ND0A 4HWEL 4NJ9H 5FWRA 2FJFB 1TU2B 4HIJB 4BFIA 3IDXH 4DOHB 5DTFB 3S35H 5IVZA 1VADB 3IGAA 2WNWA 3OXSB 2O5NA 3PWNB 3GRWH 2ZG3A 3WL9A 3P40A 4NKOB 4P4KC 5IB1A 5IQLA 4K15A 2ZX7A 1SGKA 3DXAB 1XF3B 1DBAH 2QSCL 1IAOA 3AMLA 3LH2H 5IVNA 3NAAL 4KXAA 2E7LC 3APMA 3KPNA 4XCNB 3BVUA 4GRWB 5ISZB 4Z3TA 1W6LA 3TS8A 5B1KA 1GOHA 4M8VA 2XQBL 1JGIA 1P69B 4JANA 1ZT1A 2H1PL 3L7FB 3VXTA 2EH7H 3LIUA 1RCYA 1U8JA 4JFDB 4M3JA 3SE4C 4OD1H 4V1DA 5C0BB 4GP4B 1NWOA 3EO1A 3MRNB 2Y3AA 4HKZB 4Q58C 5DJ6B 1DSFH 4XPAL 3CC5A 5DTFA 4AL8C 3V7AG 5AZ2L 5LBSH 5MHSD 4WFFE 1JK8B 2OMUB 4Y4HB 3S96A 3UTQA 1JTPA 5EZIH 4Y2OA 3TPUA 5F3HA 3LJ3A 5JORB 5CSZA 1T0MB 4M4PA 1XWVA 5KYNA 3BEWB 3HVDA 5FLUA 4EUPH 3FO9A 4UB0H 1NBZB 4KUCD 1ADQL 4M61B 5IUCA 1B6UA 3TWCL 3QQ3B 2PXYC 4PY8J 3HZVB 3NCJH 5FK9B 1GZQA 1UWGL 3K2IA 1ZK5A 2MKLC 1KT2B 3EJPA 3FT3B 3H2PA 3SKOB 1ZLDA 1K4CA 4JHVA 4NYLB 2QPFA 3RWDB 1URIA 3TF4A 2JSFA 4XOAA 4L0ZA 5LWYL 2EXYC 5JW5A 2DQFA 1RJYA 5EZPA 4PB0H 1Y0LB 3QWQB 3KHQA 4HFUL 3IDIA 4FI8A 4RGOH 5CUSL 2X28A 3OPUA 1N4XL 4P0DA 1LEGA 2GHZA 1YG9A 1URLA 1CURA 3G7TA 5LN8A 2VAAB 4YLQT 2CKBA 4FXKB 2ATPA 2YSTA 2G3ZA 3O9WC 1A3LH 2A6IB 3Q2VA 2HSIA 2WXNA 4ZUVA 1OK0A 5AW9B 4YXHL 2XWBB 3MLTA 2EIEA 3BWZA 1X9RA 1I8LA 1MF2L 2AI0L 3U2JA 4JG1L 1U30A 1KIRB 4GRLC 4BDVB 3WMQA 5I9QC 3UBFA 1H3VA 3FRUA 4ZMTA 3VXUA 3W9DB 3QNXA 4FADA 5KBMA 3VXNA 4U6YB 3L9YA 5FO7A 3QRBA 4NQCB 2VDQL 1A2YA 2J55A 2HLEB 5IB4A 3WD5L 3MI6A 3GD1C 1UJ3C 2B20A 5CSBA 1KPVB 3SKMB 2JVUA 2ATPB 2G2RB 4P59H 1Z0MA 4PVNA 4YHLH 3RVWC 3UPCA 1R46A 1FZJA 4ODSH 5CN1A 3VNYA 3SEPA 4KH2A 1MCPH 4G6MH 2EE0A 4WI5A 1E8YA 1D9KC 1IC4L 5FYKL 2YN3A 4RFOL 2GJ6E 2IJ0C 4UINL 4HJ0D 3FH8A 2V17H 3O0RL 1UCTA 2NX5A 2WVSA 4Y5VA 4F2ME 4V11A 4UANA 4KXDA 4PJCB 1QBLL 1PD0A 1JHLL 2J1WA 3TBSA 3ZT5A 2QQLH 4E9YA 2WINB 4NZTH 2ICEA 1RLWA 4F1SA 3RX5A 3T71A 4XOBA 4OJDH 2BDNL 3TJHC 3VA6A 2UZXB 4KROC 4HS8H 5C09D 1OP4A 3BD5A 1JHTB 1ES0A 3BGMA 3VFWA 3DOSA 3MRKA 5F3BA 4EKJA 1R5IB 2NX5D 2C8NA 3LKSB 1U92B 2BP0A 3BHBA 4CVZB 5J11B 1BZ7B 1XB8A 2B08A 5GS0H 3Q05A 4PJAE 4FNTA 5I74C 3IPEA 1AGEB 2PN5A 3C60C 2GCYA 1GH7A 1DBBL 3DIFA 2X3BA 5I1JL 1BLNA 4Z3EA 4NWTL 3TO2A 5BOZG 2E7DA 4HUXA 4M6ML 3NIGF 4V1DB 3MDJA 3ZDZB 1YUHA 4V1DD 1SJMA 4LL9A 1OTTD 1I9RL 4WI4A 1UCBH 4AM0A 3K74B 4XI5C 3T8VA 3OM3B 4A7GF 5AOLA 1U8MB 5KVMC 4ZPTB 1PKQB 2VR5A 1CLZH 1ORQB 2AKRA 1KXVA 4H0GA 1Q1JL 1KCSH 4GXUM 1E4WL 5F7WC 3HKZA 2BXYA 2C7UB 3WKPA 5AVUB 2BO0A 1PDKB 4ODXB 5BW7C 2CRZA 2P80A 3OX8A 3QR0A 4GIOA 4PB9L 5DT1L 2XACC 3MLSL 4MQXD 4JFQB 1OGTB 3ARDD 5KBLA 1R24B 4X5LA 1WD9A 3ARDB 1PZCA 3IKCB 2B2XH 4PCKA 3LRLA 2NY3D 4R4NC 2JKRM 1F86A 4WI9A 3NCFB 4DZ8B 4AJ0A 1FE8L 3MX0B 3DJTA 3MRQB 1CXHA 2WN3A 1NMBL 2J8UE 1C5BL 3F7QA 5G4NA 3LQAC 1CL7L 3I3BA 5ICYB 1QOKA 3BWAA 3F12B 1N0XL 4KTEL 3KWWA 5HI4C 1J0YA 3NIFE 4WFHE 4YDMA 2X7LB 2MPVA 4PJFF 4JANB 3PNWA 2DICA 1F18A 4PRPE 5D7IF 3FCTA 5T3ZE 4A37A 2QHRH 5HGGS 5JHMA 1ZJBA 3J27A 3LKRB 2BRRL 4UTAL 3QDHA 2VLJE 5CO1A 2JQMA 1GYAA 3B3IA 5JIMA 4F7PB 3HBQA 1H3PL 4JFFB 5AKVA 1TQBB 1AXTL 1JGUL 1TXKA 2WZ0A 4R2GB 4Q14A 3Q8BA 5SWQB 1D9KB 2B1AH 4FJZA 4TTDC 3DHMA 2JJWA 5J9PA 1MRDH 1KN4L 4PJ8D 5JW3L 4LSTH 2NT0A 1FBIH 5L7XL 4XBEH 4QXGL 3FOLB 2RFXA 3I02B 3QWOA 4JHAL 1ORSA 9PCYA 3HZMB 1YEGL 4OM0L 5H2BA 3NRFA 4AYSA 5I66B 1QSFE 4ZTPL 1L0XA 1T5WA 2G0LA 2F18A 3MUZ1 4AMKH 3GJEB 3AREC 1HEZB 4YAQA 4XI5D 1WZMA 4U1IA 3QRLA 4P4RA 1ACZA 4GSRA 1ACYL 1EXUB 3JV6B 5HI3C 5EC2A 2XNAA 1A1OA 3VWKD 5C0EB 3I75B 3KPLB 4UT9A 3P9WB 4TULL 4D9RD 5GGQL 4F7CA 4XN1A 4KHXH 1OF0A 1NUFA 4H1LB 3EKCA 2I69A 1THCA 4MXVF 2Y7OA 1U8CA 3DK0A 3WG7B 3QJFA 4P2OA 1IL1B 3NFNA 3BP4A 3ATDA 1AHWB 2FJHA 4LP4A 4XN4A 3BWUC 2BLFA 1U3HD 3QUXA 3FU9A 3C8DA 1J5CA 2GTZB 3FYEB 3CZUB 3L6FA 3NABH 3WFBL 3VGHA 1SEQH 5KEZA 3IVKA 4DN4H 2K8MA 1E43A 1NCOA 1UC6A 3D39A 4MCMA 4UI2A 2YAHA 2R0KL 5GGTH 2WSDA 2AZAA 3TT3L 4PJ9B 1CE6A 1EA9C 2J5LB 1EV2E 2R0KH 4HF5L 5EO0A 3ASWA 4GQZA 5AW4B 5GGTL 3T4AB 1BZQK 1SZNA 1G4MA 3CPLB 3U36A 4S0SD 1FZJB 4X0KB 4KFMA 3FZUC 4DJMA 5GS0D 4KV5E 3QQDB 4BK5C 1HU8A 1MEXH 3NABL 4HX1B 1FLRL 1KGIA 2PCXA 3ECVA 4KKNA 2HJKB 2A9CA 5JHDB 1U8HB 1V55B 3FQRA 3FTWA 4B60A 1GTNA 3NZ8A 4P5SA 3OMZA 5MEQA 3TNMA 2F1BA 5ECJE 1FL3A 4OCXL 1Q94B 1KTDB 3PWPB 3WUZA 1KBGL 5CGBA 5GGQH 3KPRA 1T2QL 2EE9A 5E8DH 2ZOKB 4Y5YB 5E00B 4U6VL 4OGQC 4B9YA 4D2NA 3FO1B 3NPZB 3Q9PA 1JD7A 2IWEA 3ZGHA 1Q90A 2D4DA 1JNNL 2GY5A 4RFEB 3TV8A 1S3RA 4MLIA 3ZVVA 1YMHB 2O4EA 3QK0A 5MEQB 1WPCA 3NSDA 3MLYL 1D7BA 2IDTA 4R4ND 1YEGH 1AKJB 4OM0H 4U3XA 5DO2C 1FZOA 3RWDA 1U8MA 2V3DA 4JHAH 1Q0YL 2ITCA 1BQHG 4JHUA 3DV6B 2OJ1A 3VW3H 3RVTC 2Y2TA 3K0WA 4G6AD 3UMTA 4NRXA 2J2ZB 1KN4H 4PS7A 3UAFA 3K91A 2B4CH 4PG9B 1VADA 3GHPA 3IGAB 3OXSA 3PWNA 4QTIH 3ILQD 4C56D 4XAKE 2ZX8A 1EO8L 4ONGL 1CICA 1X7QA 4FFZA 4NP9A 4C4BA 3QR2A 3S2CA 2CO7A 4TL5A 5AVXB 4RGMB 3BH9A 3CQQA 4FQXC 4QXTA 3BLPX 4NC2B 5FYKU 3N0AA 1MOEA 1IGJB 4J3UA 1EHAA 4G43B 5T5FH 4R2GD 5EOCH 2FGZA 4CJ1A 2X4PB 4S2SA 1N0XH 2DQDH 3JYCA 4IOIA 4OZHB 4QO1B 2X9WA 4IRJC 5DFVC 1TVHB 1N7MH 2Z91A 2XWCA 3HAEB 5A2IH 4OGYL 1NCAH 4U1LB 3U2SB 4H2AA 4RMRA 2XV0A 5A2LH 1I4FA 4POYA 3L5IA 4DUWA 1AACA 3P9MA 1XF4B 4Y9EA 1G1CA 4X4YA 2HRHA 3UAEA 2DJSA 1AQKL 5TQ2L 4PMFA 4PU2A 1HHGB 4K7FA 1YECL 3ZPDA 5C92A 3O41A 2GSGB 3EOTH 3SKUD 4FNQA 4ZT1A 4BINA 5I0XA 1FAIL 1ZTXE 3IDGA 3BP7B 2OXGA 3RA7H 1PG7X 2Q7AA 1HESA 4Y5XB 1NCDL 4LE8A 4P4KD 4TLTA 1J87A 1JNHA 3CHOA 4XBGA 3IFOA 5HYIA 3GBML 1N19A 3N1MC 4IJ3B 5KW9H 1JD9A 4UU9B 3I6GA 3GKZA 1FWXA 4IDLA 4TQIA 3DO7A 1G1KA 3QC6X 3DSNB 2FQGA 4RMSA 4ZMVA 4TQPA 4TVPL 4RETB 1D9KA 3WO4B 1OIOA 2CJUL 2G60H 3ROLA 5IMLA 3BEVA 3OBAA 3U1PA 2EDLA 4YBQC 4X7CC 2YPVA 3U82B 1XGRB 3BQVA 2YXVA 1XV8A 3BGAA 4GRWF 2WO2B 2XWDA 1GJUA 3EH1A 4G8GE 4L8DB 4UCFA 2V9UA 3MLTB 1G7LA 4WEUD 1MCSA 3VD7A 4LCUA 1F11A 1CF8H 3TCXA 4YZFE 3BSZL 3KW7A 1JNHB 1KYDA 2IXQA 2P5WA 2J88H 1V5JA 4JO1L 3V6ZA 4FNLH 1EEUA 25C8H 1MI5D 4G8EA 4NLHA 3ESNA 4FXGC 3RKDD 5CGYC 1ZPUA 4H26A 1AXSB 2P5PA 3RWFB 4QGTA 3CTTA 4LAQH 4NS0A 1O9VA 1BJ1J 3RHWF 5DVOA 1J11A 2E86A 1FORH 4HS8L 2VRKA 3DIDA 5T3XH 1PCXA 1VFAA 3BKCH 4ICWA 4KKCD 5MI0C 4BSWB 1KPVA 1FORL 4HEMA 3ZDYB 3MRMB 1VGEH 5JPMB 5IFJB 3FQWB 4TVPD 2A38A 2WIIB 3EG9B 3WFHA 2HLFD 1QLFA 4WI6A 3UIZA 3VXME 4BFOA 5JW4Q 2N0MA 4ZZKA 3B9KA 1UZ6F 2E9JA 3KPPA 5IG7B 3K7UA 1RZJL 4GG8A 1JPGA 1S6NA 3O0RH 3HUJF 5CS7A 3CVHB 1WZAA 4HKBB 1J5DA 4I85A 1HHHA 1QSZA 3OJVC 4LVOB 3S5LB 2V3FA 4HIHA 4HUUA 4CVXB 4IRJB 3MRJB 1AI1L 3UYRH 1I85A 3X1FA 4Z5RB 1LLAA 3DV4A 3EDDA 3HTLX 3L2NA 1JF1B 3QAQA 1QBML 2BOCB 1JPFA 1WG3A 4KMQA 3QJXA 4J23A 1QEWB 3T3ME 5KSBB 2SEBB 4R4BA 1I1YA 2VDPH 1WFNA 3V0WL 2GW5A 3Q8EA 3T0BA 1N3NB 2D03L 4XN5A 5AD0B 1E4XI 2H6OA 2WANA 3GBMH 4OVUA 3DX7B 2W60B 2H3KA 2O72A 4FMVA 5HP5A 3D5OF 4H8PA 4N3TA 1KFGA 1RXLA 2E56A 5EN2B 4C59B 2IH1A 3OC8A 5D7LA 1U91A 2V4LA 4LQ1A 5ITFB 5IF0A 2ICCA 4HIQA 2F8XC 3WY4A 2BHFA 5DA4A 4ZAKC 3UYOD 4DKTA 1A3LL 2O6FA 2FEDD 4B7LA 4FMFA 4BK8A 3OWRA 4MD5B 4MNQE 3QISA 3FO1A 2X6CA 1WBZA 3U30B 5CUSH 1RD6A 2XG4A 3D4YA 2FGWH 2ZKMX 4D3CH 4P04A 4AKOA 1A7QH 4HUVA 4X9HA 5IROD 1AR1C 4P2YA 5I18L 5JXEA 3SQBB 5DEFA 5EC1A 3O6FD 1FL6A 4HPYH 3RGVC 4CGTA 4Y7MA 3MRNA 1J1PL 1X5HA 4EPSA 4N1HB 1OP5H 2RD0A 3UH8A 3QRFM 4MMXC 1ADQH 2BS9A 4FRWA 4KY1L 1EH9A 5AKTA 3LVTA 3P4NA 4DPRA 4C57C 3L3GB 2NNXA 4MQ7B 2Y2YA 1S7RA 5GZOC 1ZJAA 1KZYA 4G9FD 5AB9A 3K72B 4HCRL 4EMZA 2N01B 2H3XC 3NP4A 3OAZK 1AR1B 5AUMA 1MIML 2X9YA 1G7JB 1S7TA 2DQ6A 2WTRB 4LOVA 4RCAA 2ZZUT 5ABAA 4YSUA 1I9JL 1S5HB 5BV7H 1QRNB 1X4ZA 2X2YA 3D34A 1VGKA 1U8CB 4CC1A 1ZLUK 4L5FH 3LY6A 1BBJB 4B96A 1E40A 2XTJB 4QXWA 1SQMA 1QSFA 3WY3A 4P46A 1ZWIB 4E9LA 4E9RA 1G7LB 4NM8H 1L5GB 3FTZA 3QFJA 3QZLA 1EK3A 1YNKH 2DIAA 3Q6GH 1BM3L 1CXIA 3ZDZF 1COBA 2PO6C 4DUVA 3E9UA 2A74B 3DXAD 1GGUA 4W9FC 1F58L 3BQUC 5JR1L 4JJHA 3U6RB 2NY5C 5C0FB 2OMVA 3WTSA 1Y6MR 3CX5J 3W0WB 5BJTB 5EO0B 3SGDI 4GUPA 3FQ4A 5E9DA 4MXQD 3DOHA 3PV6A 2VYRE 2BS71 5CLTA 5AOJA 3ZKSD 2FB4H 1XF4A 4WU5B 3FHQA 1KBGH 2IPKA 3MA7B 3UAAA 5L9DH 1AYRA 2Z7WA 3E2HB 4QNPE 5T3XE 5LO7A 2APSA 2IQ9L 1AO7E 2O6EA 2IAMC 2P49B 2QVIA 4KK9D 2R9HD 1MHHB 35C8H 1YY9C 4D0BB 3MNDA 2EYSB 1HEZA 4UNUA 4DPAX 2A2QT 3F3HA 2ENQA 2H1LM 1JFQL 2Q3AA 3LV3A 2PP7A 3HMXL 5E6ID 3OKOB 1TZ8A 3B2UC 1G7IB 5EBMB 5EUKA 5FUCE 1FLRH 4DNLA 1XBDA 3N41F 5KAQF 3QUYB 3F7RA 1ZLVH 3M8OL 2CHWA 2HB0A 3GIVB 5T3XD 4EN3D 3DSNA 3KE0A 1KPUA 1OSEA 4OCSL 4X6EA 3ZT7A 4YXLL 3NJIA 1A1MB 5DK2A 5ESVB 5EIIA 1FVDA 3MCKA 5FYLH 2ZXDA 2ZCZA 3DMMC 3TBYB 2BSBA 5INCA 4X8XA 4NPJA 2E9BA 4FQCH 4H4NA 4KKRA 4M3HA 5BMFH 3VXUE 3F84A 2L3BA 4QHNB 1P5UA 1AQDB 1RL1A 4N0CC 1AE6L 2H41A 4JFHD 1RI8A 3OAWA 1G6RB 4Q74A 4U1KB 4WSKA 1A6VL 3KNBA 2ORBH 4PVLA 1OQOA 1GGBL 5I30H 4U6XA 4G3YH 4I7ZC 1J05A 4XAKD 3W56A 1PG7W 3SO3B 5K9JH 1Y18B 2YARA 2EDEA 4FQXA 5T5NG 3Q2NA 3GSVB 2E3VA 4XBMA 4R2GC 1M4KA 2YPLD 3DYOA 3VFOB 1DUYB 2TRYA 5BS0B 4YFLF 1M2VB 1CF1A 5DS8B 4FZEH 4WUUA 2HJLA 3FAXA 4EIZC 4OZ4B 3C12A 5FYJU 2WIMA 3QUMA 4J39A 2F6AA 3CPLA 4UOW1 4RAHA 4ABQA 3WIAA 1U8IA 1E4KC 3K3QA 1HVXA 5IFAL 3AS3A 3MXVH 2HX7A 2A9NH 4KI5C 5A7BA 2FO4A 4NKMB 3O6KH 1XT5A 4Z8FL 1NGXA 5DJ0A 4L2YA 1OTTC 1ADQA 2IADB 3EZJB 3H9ZA 4P23C 1KF9B 1U3JA 1W8EA 2FT7A 3VFMB 2H6PA 1IGYA 4NBZB 3BLBA 4N26A 3WENA 4LSDA 5F1SA 2NUPA 4AIXA 4NO0A 4DGIL 2VUKA 1BOGB 4YFLI 1FFOB 1ZK9A 4LSTL 3IMWA 4JY6B 1JMZA 2WV3A 4BD4A 4BQ9A 4UZGA 3NK4A 3WN5C 5EPMA 5AYUL 2R0ZH 3STLA 3ECBA 4GEJA 1OOAA 2NCEA 1RFDH 1DVYA 1QP1A 1DDTA 3T6XA 3WLWD 3ARFC 5C0AE 4LARH 4MHHI 5JDJA 1OQXA 1QFWH 2R0WL 2VXVH 4I3SL 1UXSA 1DL7L 1IMHC 1OF2B 3OVUB 5FKPB 2BERA 2BRRH 4GW5B 4B5ZA 3GM8A 2XPZA 2BW4A 1T03H 6PAZA 3G5ZA 4IDJH 4HALA 4P2RB 3L9BA 2GYSA 3EOAB 3BISA 3NPSB 3WNJA 3QEHA 4G42B 1QNZH 3DRTA 3WE6A 2DQMA 2FT6A 4B27A 4WFHD 3IGKA 4MMYA 1CL7H 1ILUA 4O51B 4ONOA 2YPKB 5E2WL 5BV7B 1GCFA 1D5XA 1ODAA 12E8H 1IILE 3G08B 2YQ2A 3NIDE 5DRWA 2F5AL 3CC1A 3MREB 3RZCA 2CA3A 2Y2WA 1V8HA 3GSXA 3RVWD 2X4UB 4AEIH 4HZLB 3FQUB 3W81A 4TNGA 5FO9A 2AZUA 2NRDA 4D8OA 2CR0A 4JG0L 1S9XB 4XNUH 1DJHA 5IWLA 4IJTA 3SYAA 2B9BA 2Y23A 1CGUA 2F7QA 3K4DA 3L95A 3MPCA 3O8XC 4IK6A 4JE4B 3IDIB 4DFHA 5DHMC 1FFRA 3BKMH 3LB6C 2QKSA 3IT8D 1RJYB 1HQRA 3OAYH 1OAXL 2ZSVB 4V33A 3O3AB 4WCYH 3AACA 3S36X 3TVMD 4PGBA 3VYNA 1UB6A 3EADA 1CZ8L 5JQ6H 4YPJA 3LRKA 3NN8A 1KV7A 3SGDH 4FTVB 5HJGA 1OO2A 1I85C 2WXRA 3O3DA 4HUWA 4BDVA 4M8UA 4XB7A 5IY5B 3K6SB 1XTLA 1QLRB 1YAZA 3MFGB 1UA6L 1THAA 5I66A 2VDLB 4Z7WF 3V5KA 1M57B 2QADC 2GTWB 3QDAA 1KB3A 1DBBH 3W9DA 2WLKA 3IMVA 4A2FA 4FNUA 3LNHA 3MNMA 5GS0L 1DBJH 2AITA 4G7QB 3I6GB 4U49A 2YSSA 2ZICA 3P0YL 1HQRB 4R6UA 1AQ8A 1IGMH 1U58B 2CNYA 3CJJA 4JHWL 1MDAA 2ENPA 5H37H 2HFFB 2ADJA 3D51A 3OKNA 3D85A 4XP1H 3R06A 4XP6H 4AV0A 4KH9A 4X6DF 1RZQA 4ORGA 4R3SA 2DQEH 2AERT 1DBJL 1YNTB 1UB5A 3FO0L 1E3XA 1EMTL 1TLKA 2JKIS 4EIBA 3O2WL 1O5DT 1VPOH 4XNQB 4ZFFA 1Z3RA 2DJ4A 3O81A 1SJEA 3HE7B 4OFDA 4NYLA 5MP6H 1C8PA 1TKWB 3VQLA 5C0IB 1XF1A 1CUOA 4F33A 4TTGA 4KI5E 3AZUA 3IFNH 4UINH 5DJXA 4ZXBA 2B77A 3WEOA 1YO4A 3I6LE 3R06B 5JQ6L 3QVAA 4OIAA 1FFPB 3BDXA 1IE4A 1SEBB 2CLRA 4HEME 1BZ7A 4IRZH 3FUDA 4O02H 1RZKC 2RMNA 3J07A 1A8ZA 1MCEA 3WN5B 1FHGA 1U4FA 4F1ZA 4KO9A 1VEPA 4PEEA 2O5YH 3HE7C 4YL4A 5GS1C 1SJEB 3HE7A 3U79A 4JFPA 4R5VA 1J05B 3IJYA 5DQDH 4ZTOH 4AM0B 1F45A 2MQ0A 2NY6C 1I7UB 3BFWA 1OPOA 2YUWA 5DJXB 2I5YH 4K9EL 5DC4B 2APTA 1MF2H 2AI0H 3NCCB 3VFSA 5F6HJ 4GKLA 1JRHL 3ASNB 3N44B 4ENED 1ORQA 3FB7B 4YXHH 2VZTA 1CT8B 2HMIC 2A3TA 3BCFA 4H8VA 4LCWD 1R5WB 5F6IB 3N1GC 1N4XH 4UV4H 2WLZA 5T1LD 1RMFH 4QOKE 4A2EA 1EJ6A 3WXVL 4DGYL 4CSZA 3ZOAA 1OW0C 1MCKA 1YA5A 3EGDB 3RDTA 3RPIB 2DLEA 3MFFA 2ZYRA 3MUJA 3WS6A 4FQQA 1U8KA 4XMTA 4F8NA 3ATBA 3J7HA 2Q6WA 3B6SB 3MRDB 3SDXA 3ZR5A 1DL7H 1N8OE 2VISB 2X09A 3LIZH 1FNSL 1LO2H 3QFJB 1S7XA 1KNOB 2VZVA 3TVMA 4JKLA 1GYVA 4F5CE 5B3JE 3O3BB 2A6JA 4UAHA 4S1RH 4R4FL 5E2JA 3GXUB 4UB0L 3DVGB 3D6GA 2X1QA 3MNWA 2ZSVA 2VO5A 2R2EB 4JFOA 3BI9X 1Z32X 3QXDA 4IGBC 3RP1A 1LO5B 2OMVB 3VXSE 2IH3B 3ALPA 3MCLL 1ASPA 5SX4I 2ZUTA 5AZ2H 2E0PA 1A5FL 2IPKB 1I3GH 3DA0A 1UXSB 3MA7A 4QRUA 2NW3B 4OD1L 2X4RA 4G6FD 4BFJA 4QJ4B 4U4BA 5C08E 5C09E 3OHMB 4LSPH 3QARA 2NZ9C 2WQSA 2E6PA 2VSMB 1KN2L 4NZDA 3ZO0A 3C5SB 2V7HB 1LO0H 2DIEA 3SQOH 4DVRL 4A68A 3D39E 1NJ9A 5AOKA 5KZCD 2DWYA 4NSKA 1A3ZA 1IQDB 5EU4A 3UEQA 2GAZA 5BXFA 4YO0B 3S35L 3HI1B 2YJQA 3GXNA 5A2FA 1CLYL 3ARZA 1AGFB 2AK4A 3CDGA 4W9CC 2ORBL 4HXBL 2Q10A 1SXAA 3H3BC 1T0PB 2OLDA 3C6LD 5AB0A 1DSYA 2AJ3B 4PTUA 1TT6A 4LOUC 1UEYA 1C08B 3OD3A 4LCYB 5DZVA 4KVNH 1J9CT 4NCDA 3ARGA 3NA9L 2DKUA 4MMXB 5KOMC 1OM3H 1PJWA 1EAPA 1T66D 1OAZL 3GJFK 3HN8A 4TRPH 2NT1A 2J3SA 3VD2A 1I8IA 1UGNA 3L16A 3T0VA 4J4PA 3BUQA 4WI7A 5I1GH 3X11B 1AIZA 2ESVB 2ZWZA 4PIRF 7TAAA 3MNVA 3RVVD 5E1HB 1DO5A 4FI7A 2FZ3B 2DI9A 4U1SB 5F0JB 4L9LC 4FXTA 3FDWA 3DJ9A 2W92A 4K4KA 1GS8A 1JYVA 3I50H 3D0LB 5DVMA 3FTSA 2IQ9H 3VFMA 1KG0A 5DLML 3WHXB 4IBUA 2AJSL 5ISZE 1D6EB 4BFGA 4LBAA 2IV8A 3CZJA 5L9DL 3KYAA 2JK5A 2LE9A 3JUZA 4DO5A 4UOZA 2BVOA 1UUNA 1RK7A 5F3HB 5DUBB 1T6WA 1N59B 3RFZB 1FCGA 4KK5C 4DVRH 1LO0L 3AGWA 1NC2A 3GO1L 1SFHA 3UX9B 4B9PA 3CX2A 5EO9A 2QL1A 3VM7A 5CEXB 5BZWB 3L5XH 3MLZL 1QWHA 4PI2A 2DOCA 3GHBH 5KSVA 3BOVA 3KNBB 3NQIA 4X9BA 3OG6B 4PLNC 1ZVYA 1PLBA 3CVHA 4PWHA 1A14L 5E94B 5EUOA 1M6OB 4M1GH 4AQEA 4XPTH 3LHPH 3QCVL 1ND0B 1E9OB 2F53D 1Q9KB 4U6XB 2H8PA 5B4MD 3MRJA 3R7QA 4CVXA 2QVTA 3QDJD 3QG7L 2Z8WC 3QNYA 3LZQA 1X9LA 2CLRB 6FABL 5IIEA 1XCTB 1SHXA 1O9ZA 3QUMB 3D06A 1A4KA 3MRIB 1BMZA 4Y8DC 5JNYA 2MOGA 4S1RL 3E6FA 5B39A 1HOCA 2A77L 4JUSA 3LKPB 4K9EC 4G1EA 1CFQB 4NZJA 4K8RD 5EH1A 3VXTB 4QRQB 1FNAA 2DAVA 3ZE0E 3ZBMA 3NEOA 3T4YB 3IMRA 2XA8L 1U2CA 3OB0H 4LO9A 5J7CC 2NZIA 4QRPB 4NBYB 4NQEE 1WISA 1ZTMA 3HS8A 4Q9BA 4QHLA 4PJGE 1FIGH 4GP8B 2G5BB 4XHJC 1X4XA 3GZPA 2UXGA 15C8H 2NY7L 5ENWB 3RB7A 3IYLW 4UZUA 2HJFB 4LBEA 3MR9B 5E1AB 2OBGA 4OJYA 4ZX3A 5HHPB 2K4AA 5FV2A 4AJYV 4LNRA 5C6TH 1JRHH 4Z23A 4OLXH 4HXAH 5D1ZB 2I5YL 4CN4A 4QTHA 2C4FU 3VFNB 4HIPA 3H3KA 4IOFD 2IWKA 3PFQA 4FKKA 4L23A 3VGAC 4B9JA 3BKYH 1MJJA 4K7PH 4YJZL 3SDDD 1H3UA 2BNQE 3GEFA 2O5YL 4UILL 5F1NB 4BWUA 3IPFA 3GJFH 1UD3A 1U93B 2O61B 3KG5A 1XGYH 3IDNB 1JSYA 3V0EA 1J5IA 5BOJA 3ZYIA 1UWXK 1JG9A 3PJNA 3OB8A 1HL5A 2HRGA 3EUUA 3AAZB 3WNMA 3CFNA 3IDGB 4OZIE 1JPST 1OAQH 1OALA 4FL4C 2QR0A 1K2DB 2W0KA 2UUDH 5I17A 2I9LA 1OWWA 3ENEA 5MERA 1LE9A 4PJ9D 3MO1A 2W9DL 1AQDA 5D7JC 3N40F 3K8MA 1XXDC 4BQCA 5DI8A 1EZVY 2AK4E 4MTMA 1EMTH 5EA0L 5IFHH 3FONB 1YJDH 3QSKB 2DQEL 4E2OA 4UU9A 4NLAA 5BRPA 5FF6A 5KSAA 4LDEB 5CMAB 5GGUA 1CFTB 3T8XB 1CQKA 1WT5C 3PAVA 1AD9A 4XNXH 2UY6B 1FO0L 4MDJA 2F5BH 3ATEA 3HFFA 4L8BA 4LAQL 2Z4QB 1ZEAH 1N5AB 1E4KA 4Y7OC 1IGML 3RVVC 4PBXA 3QIBB 4OQTA 4PVMA 3KBFA 3P0YH 4FA8A 2HH0L 2K6WA 4IU2B 25C8L 4HJ1A 1PTZA 2DWDB 3AT8A 3U1SL 1MHHA 1RPQA 2AJYH 4N1EA 5CEXA 3HE6D 3QIWA 4FG6D 4OUUB 4AVHA 2JE8A 1T66C 2D2CC 1YJDC 2CU9A 1Z9OA 1J7VR 1CYGA 5EUOB 1S9YB 4AUJA 4G8GB 4MS6A 3VFSB 3N44F 4HG4K 5IJKA 2VQTA 3OMNB 1I7UA 3IRCA 2WXHA 5F96H 4WI8A 2G60L 2CJUH 2ID5A 2Z1PA 4CNIB 5JO5B 2A4ZA 2HFFA 5TDOA 3WNNA 2FHCA 3NTCH 4JE0A 4NFBA 3VA2C 5I0WA 4E41B 2VRQA 3HLAB 3BUYB 3WKML 2QKIC 5F0PB 3HR6A 3BGMB 3VFWB 3E6FB 3ISYA 1FSKC 1TPXC 3RJDA 3R1GL 1KG0B 2X1WL 3WHXA 3F58H 4DQAA 4N24A 4PLKD 5F7DB 1SVBA 1BFVL 2AXWA 3FU7B 4HUUB 1BPVA 4N5ED 4F7MA 1RIVL 5D9SA 5J12C 4AEIL 4S1DD 1KPRA 4YFDB 3SYCA 4QUOA 3EH5B 4J8RB 3T65A 5C0IA 3HMWL 3O4OB 3QHZH 3DK2A 4KK6C 3ZTDC 3ARFD 5DWUH 2Y7MA 2Z0BA 2G4EA 4DPCX 4ZS7H 2HKAA 4A7VA 1N3NA 2E8ZA 4P2CG 4ZNEA 3LRGA 5I2IA 4KKLD 3PWJA 4PJCF 5GRVK 1I1YB 3NZHH 4PP2A 1MRFH 2H2SC 5C08D 4Y5YC 2JI3A 1YMME 4LLUB 1G7HA 4XPBL 4S0HA 1E42A 2CAKA 1X4YA 2OXHB 1DLFL 3KPOB 5GGVY 4N8VA 2IH3A 2YD1A 1XH3B 1CJYA 5IB5A 1BDYA 1Z9SB 3ELQA 4PJFE 2R0WH 2VXVL 4I3SH 5HHVL 5KSUB 1AXSA 2C3HA 3P3YA 4LARL 4Y9FA 3WUWA 4EI6A 1M05A 3POHA 1A6AB 3CFEA 4Z77A 5JZ7C 3IF1A 2X88A 2CPUA 4UZSA 2NYZA 5E23A 4G5ZH 4JRYA 1TR7A 1EO8H 3WJJA 2IANA 4M00A 4MD5A 1Y6NR 1HDMA 2CZNA 3TPKA 1A25A 1NDMB 3ARYA 5DD0L 1JP5A 4PJIB 2WQWA 1H5BA 5ANMA 2WQAA 5IJVB 5I0DA 1MUJB 3DTUB 1I8AA 4M8RA 4DGIH 4QF1A 2XVLA 5C6PB 3WGUB 2VNCA 2YKLH 1UADC 3W38A 3L45A 4R97C 3SYOA 3DVNB 2WKGA 4Z8FH 2XZCH 3PIQA 2D31A 2A9NL 4I13B 2VN4A 3ULVH 1HK6A 5IEKB 4GKNB 1XB6A 3AU1B 1JVOA 1ZXKA 1IZKA 3WIHA 4WO0A 2JNZA 3T0XA 4H5SB 5D71L 1RERA 5E1QA 4M9OA 4N2GA 5KOVC 1CO1A 2QVKA 1ADWA 2AJ3A 3J8F7 3L3OA 4PTUB 4EI5B 2OYMA 1LO5A 3AQYA 3AY2A 3T77A 4XO8A 3CD4A 3IU3B 4YGVA 5F1IA 5GSVA 3DRQB 4FQ2L 4L8BB 3OL2A 1NMCB 5E9AA 2M2DA 1A4CA 4Y9GA 3ZTJG 2XWTA 3UTSB 3NH7H 3NBNA 2ZIDA 4G3YL 3UTSD 3RUGA 2ETWA 4QTHB 1LWHA 4PRAA 4EN3B 4MAYB 4A6YB 2R0LL 1QNIA 4ZSOB 4CC4C 5ID1A 3TT1L 1AFVL 2OMUA 4Y4HA 1V3MA 2YXMA 2QZQA 4PJBF 3UYPA 2Z31D 1XZWA 2H4EA 5KANI 1H8OA 1J8RA 4NQUA 3BFQG 2Q7YA 3FU3A 4HF5H 5D7IB 1G1OA 5FYLL 2LR4A 3TT3H 2QR0B 4YXLH 5DJDA 4H0LC 4GG6A 5DZPA 2XV2A 1JZGA 1FVEB 2KDGA 3M8OH 1RKRA 2DD8H 3BP6B 4BKLB 1WDAA 4MCNA 1XO8A 1NCHA 3G04A 2HPTA 3CBJB 1ZRUA 5KVDE 4AGNA 1CWVA 2Y06H 1PZBA 3CN4A 4MRCA 3ARGD 5LXVA 3CFJA 1YMHA 4P9HL 3BAYA 1OZUA 3MOBH 1Y6KR 2HLAB 4FFYA 4BUQA 1PKOA 1E3FA 3HJ0A 4FG2A 2KQNA 2W0PA 1YN7A 2DYPD 1YC7A 2OSWA 5B7FA 1KPRB 4KHXL 1LVEA 5PAZA 4XO5A 3TBYA 4LRNH 2YJLA 1YY8B 5EU5A 5C0ND 5HDBB 5LXGL 3ABLB 2K8QA 3NUKA 4P5RA 5T1KB 1DVFA 4U3SB 5D70H 1WTGT 2OSLA 3IN0A 3IVKB 3C8HA 1AS6A 4H8UA 5JDSB 4HA1A 1DJIA 2Z92A 4M5TA 2CG9X 2IALA 2WKLA 1BXXA 3ZN6A 2C5DC 2EABA 4UAOC 2YOAA 3HG1E 4B50A 2FUQA 3UTPD 2OMZA 4ZTPH 4HLZG 4WEBL 1QTSA 4WK4B 5CU9A 2R2HB 2D7MA 5DUML 4GEIA 1U95B 1EEQA 3QUKB 4LQFL 1P4LA 4APQD 4P3DB 5KANG 2H26A 1MPAH 1I9JH 1G9MH 4LMQE 4BZ1H 4B97A 3RY6C 1DVFB 2FT8A 3CXHK 4OF8A 3IS0X 2TSBA 3HHMA 3QCTL 4I18A 4X9GA 5FPIA 5J13C 1AGCA 2WLNA 2WZ6A 4FNPA 2Y5TA 2DJUA 1QHOA 1SYSA 2DM2A 3W9EB 5EEYA 4H88L 5JIIA 2WGXA 4JFEA 3RNQB 4EUPA 4QF1B 4WO4C 5JHLH 4LVHC 1N68A 4K07A 5J13B 2VLJB 2BRQA 4RFNB 4EO5A 4ACPA 2B4CC 2VZ1A 5J5EA 1YQVL 5L4FA 4HIEA 4PJCA 5E8PA 1AGDA 3NYKA 1Q9KA 1AZNA 4HPYL 1G0YR 1DJXA 2OP4L 3JVGC 3VWKA 4K23H 4DTGH 3FUKA 3HI5L 3UJJL 1XR9A 3AXIA 3RUGE 5KAQG 5ITBH 1VIWA 1S7SB 1J0IA 2D9QB 2ZXBA 3L9RA 4RISL 4L37B 2NXYC 4KKZA 3QFDA 4D3CL 1VFBB 4F15C 1QFUH 3F64A 5HVHC 2FQFA 3ERXA 4MKTA 5EORH 1C5BH 4UQ2A 3EHBD 4AQ8C 4UT6H 1HXKA 4M4RA 4R96B 4LLUA 5CEYB 1FA4A 5F9AC 1FE8H 2Y07H 3M17A 4KJPD 1MAKA 3CGTA 5IMOB 4G7YL 4XMZA 2DQUH 5A16A 4UIKH 3SE6A 1HXYB 3GTNA 1SBSH 3AAZA 4TSBH 4OZFH 3SCMC 4EE2A 3MMEB 2EDKA 3B7UX 4KGLA 2NOYA 2R39A 4JFDD 4JZOA 2BINA 3QI9D 1E4WH 3H9HB 3SCMB 4Z7WB 4QPEA 4I0KA 1MWAH 5D1QC 1HDMB 3CHRA 3DUUA 4CL7A 1KTRL 3ZHLA 4BXVA 1D5XB 1TETL 3O4LE 4HLJA 2NYYD 5GGRY 3N3EA 4WI0B 4LVNB 5FXCH 3TN0D 1G7JA 2WTRA 4X4ZA 3APNA 4G6KL 3WDHA 3V7AE 1JZJA 1OD9A 1S2EA 4LNRB 2IH1B 2Y7LA 1EJFA 3L95B 5G55A 3UGXA 5EU6B 2A9AA 2CO3A 2VZUA 3QP3A 4YXKH 3VUAA 2LFEA 3EO1B 1JERA 1QUNA 3N1PC 8FABA 2DQCL 5E5MB 2Z31B 4UTBL 1JV2B 2OYKA 1TFPA 2CHNA 2UY7A 2QJDA 4OLUL 3L81A 2EXWC 1VGEL 2DYSB 3BPLB 4S1QH 5D6DC 1ZLSL 2YD4A 3WUWG 4GAYA 3ZKNC 2NLJA 4L1SA 1TG8A 3Q2CA 4YE4H 1ASOA 3RAJH 3KPTA 3QEGL 5ES4B 3BWUF 4PJGB 2VMDA 4NB7A 1SOQA 3FQTB 4HJJH 4ODHH 1JHLH 3QUXC 3CFKB 1X3DA 3NIDF 4WFEE 5EN3A 1F8TL 4UT9H 4ZUWA 5A3IC 4FEMA 5HTSA 3UYPB 1WA1X 3G5ZB 4N28A 5DEZA 2MHAA 3U25A 4YSTA 2ATKA 1T22A 3AG1B 4LPTA 1NEPA 1IC4H 1JVKA 1DVQA 3S3JA 2BSEA 3GSNA 1ZS8B 3IDMA 3OR7B 2WO4A 2ZT9C 3INUL 2E46A 3ZU8A 4RIRA 3BP6A 4ZD3H 4AYMC 3QS3A 1SY6H 3T6WA 3QJHB 3ZIMA 2AJXH 2RACA 4GG6B 1TTAA 2J8UA 4IIZA 3WD5H 1AGCB 2N56A 2Z0UA 2YA1A 1FFOA 4GMSH 4UV7H 4ORZC 1L6ZA 3GUFA 3B9AA 2UZIH 1JXGA 3TIEA 1KSRA 2VDKL 2EDQA 3VU2A 1SRDA 1T1YB 3R8BB 3AM8C 4RMBA 1Z9PA 4YL9A 5HI5D 2FJGA 3N55A 1CDIA 1NCDH 4OCLC 2MCPL 3ES6B 3DX8A 4I48A 4OCRH 1B2WH 2WO3B 3BQUD 2YAOA 4X8GA 3EOTL 3MRPA 5E24E 1YECH 3LKNB 1Z6JT 3N43B 1GS6X 5C0FA 5I6KA 4Q9RH 1AQKH 5TQ2H 2WKOA 3KVPA 2N59A 3OC5A 4HCFA 4JRLA 2WAHA 4HHAB 1R6VA 1SXNA 4OFKA 4GXUN 3GMLA 3MU3A 5I71C 3L1GA 1W2KT 2L7UA 4Z3JA 4OIFA 3MYJB 4OT1L 4G6JL 4WWOA 5FGCE 2DQDL 4X8JA 3DSFL 5F3FA 1IVTA 1HJCA 4ZO7A 4TPRH 2IANE 2MSPA 4M48H 3W11D 1OCZB 3LQAH 4MAUH 5T5FL 4CU6A 4P2OD 1VAHA 4KHTH 4JGUA 4Y19B 3QNFA 5EU7C 2FEEI 2EKSB 5GZOD 3ORJA 4CC4A 4LLQB 4W1TA 3NCJL 3SGKA 3M86A 1CVSC 2X0VA 3BDBA 4L5FE 1GW0A 2VLMD 4U1JB 3IXTA 4DETA 4ONGH 4L1BA 5SX5K 4ELKB 2GIXA 4JGMA 1B4TA 3CNKA 2J1ZA 5ADPL 4CBZA 4NJAL 1KGXA 4QHUB 2OX5B 1PZAA 4WKZA 4X4KA 4JCLA 1X9QA 5EZIL 4AGQA 3O6FC 3SDCB 4AT6A 1EUUA 4NN6C 5SWZB 2MNJB 3QG6A 2XWTB 3UTSA 3QJVB 3F00A 3NRPA 1K5NA 1F42A 2XXMB 1DQQA 2EYRB 3CQPA 3DRQA 3HG4A 1DEEB 1EAQA 1T2JA 5C0BE 3D30A 5EEUA 1JBJA 3MLYH 4QXTB 4L3FA 4A2HA 4LRIA 3Q8AA 4M93C 4A6YA 5ALCL 2MEJB 2BNRE 2AV1B 5B8CB 2DYPB 3KR3L 3U0TB 2IANB 2P28B 3FUFA 3GRGA 1NCBH 4OSUL 4Y1AD 2F2HA 5F89A 3NAAH 5K39B 2YEVB 5I73B 1BVNP 1LQBC 4L3ED 2DQFB 3GRWL 4GXFA 1KGUA 2APXA 1D5IH 5H8DA 3FQ2A 2EJ1A 1NFDF 1B3JA 1DJZA 5BRZD 4N2HA 4P5TD 1OP9A 4XO4A 3RQ3A 3T1FB 4HWEH 1M3JA 2DQIL 4MDRA 3CBKB 4OFYD 4ZXBD 5DD5H 3GJEA 2EVFA 4JG5A 3ABKB 4RQQA 3PIQB 1CGXA 1DVXA 3O6LH 1Z9LA 4OCNC 4BUGA 1WIOA 1DQMH 5T1LB 3ZE1B 5B38A 3VXUB 3DUUB 1I1RA 4X5QA 3RPBA 3NACH 3RRQA 3TYFA 1JI1A 5D7JB 3SDAD 3BEWA 4MFHA 4YC2C 1BMGA 3STZB 2XN2A 4JPWL 3M46A 3MGAA 1B4RA 2V2WA 5AW0B 4PQXA 2WLIA 5DF0A 3RTQC 1CD1B 3WFEL 3B7RL 4KRPB 2AEPH 3T3PF 4JN1L 2J4WL 2F58H 1TZIB 4Q89A 4YFEA 1LJMA 1SEQL 3V4LA 4UQDA 1AC6A 2YAFA 4GW5A 3WFBH 3IRZA 3W39B 3HLAA 4JMXA 5D1ZC 4LKCA 4XX1E 3LQZA 1WEJL 2C9UA 3O6MH 5C08A 1HCYA 3V52H 2I60L 1KIUB 3ARVA 5HYSB 5E1IA 4FYRA 4PSRA 3QYMA 3VD4A 1GJWA 2NY4D 2PCFA 4CRPA 4HHWA 2Y72A 4NHCH 5CP7A 2NY5H 2NY4B 5CZRA 4WHTA 3RVUD 3BJLA 3S3DB 3MUUA 3ATFA 3RKDC 1DLHB 1W72H 4AIEA 4J8RA 4I1RA 1DJWA 3T65B 4RAVB 4Q6IC 2R83A 2IQAA 1NCWH 4FHKA 2TAAA 4WQOA 2Z4QA 3MRGA 4OF3A 4P57A 1WTLA 4U7MA 2DH2A 3WJLA 2I9TA 1AJ7H 4IS6A 4IHBA 4LLWB 5K9OB 4A7TA 2M8XA 1J18A 2DWDA 4AVKA 5DD3H 3MCKB 3D0LA 4HPOL 5DHXB 4PW4A 4G71B 1IBGH 1OGAD 3ZDXE 1WFJA 3DX2A 1J48A 3G6JA 5DHVA 3G6AB 3QDME 1NEZG 1AGBB 1NDGB 5EU6E 4LGSB 1PYWB 3GYRA 4YSSA 3QIWC 3HC0B 5AW7B 1T4KB 3EBHA 4XBEL 1U2YA 3JWNC 3HFML 1S3KL 3GSQB 5LBGA 4LDCA 4L05A 3D4CA 5D7EA 1A1OB 5C0EA 1BAGA 2XWZA 2GIYA 2B1AL 1LHZA 4HDIB 2D0FA 2HWZL 5F7AA 3ZKMC 4XXDB 3QIUD 3AADB 2RA1A 1AMXA 3HVNA 1C9SA 2CUIA 5EB9A 5D4HA 5D1XE 1NGWA 2PYEB 1KY7A 4N85A 2JCCE 3SQRA 2KC0A 4LIQH 3VMOA 5E7BA 2XKUA 1BV8A 2AEQL 5F7DA 2DWSA 2P8MB 2QHRL 3QI9A 3EYVA 1IGFL 4KQ4L 4POZD 1JWMA 5CJOL 5GIRA 5FA3A 2GTZA 1J0JA 1L0PA 1PEZA 3AU1A 4KX8A 2ZXWB 5HI3D 1HHIB 3QHFH 3H42H 2DQHH 3MYJA 2JV6A 3U6XA 4G1MB 2WXGA 4O2EA 4D94A 3SZ6A 3TEZA 5JNYB 1JHTA 3GMLB 5EEZA 3R7RA 2ICWB 1R3KA 2GJZB 1NMBH 4AKQA 1XIWA 1YPZB 3AMKA 1BZ8A 4ZAKA 5IK3B 4MBOA 1QA9A 2PF6A 3MFFB 5D96B 2LAGB 2HTLC 3TNNB 4HISA 3IAGC 3T3MF 4X99B 3SJVE 2Z93A 4Z1PA 2NX5E 3FK3A 1J1XH 2BSTA 2DI8A 1KB5A 1MHEB 1JXKA 5E8NA 2OMXA 4F3FA 3C5JA 3E1F1 3MLSH 2WTOA 1NPNA 5DT1H 4GSDL 5GZOA 1HE8A 3MRRB 5GGRB 4Z78A 3ZY7A 5LDUA 2A73B 4HH8A 2X0WA 4W9LC 4QHLB 3TJEH 1MJUL 1BAFH 1GSKA 4IOFC 3ARWA 5HHOD 2D8KA 2ED7A 5FA4A 5IVXB 2NPLX 3S0PA 1S7RB 1ILSA 2UWEB 3P4NB 3T0WA 1YPZA 3LZOA 4FTDA 2X89A 3EOBB 4HQQH 3DURB 3GKWH 5HYSG 1F56A 3IJSB 4KJWD 5EZOH 3MC0A 2WOYA 4LZKA 1KXHA 2WM0A 2WZPD 4HETA 4WLCA 3HPLA 4DQOL 4M6MH 1NC4B 5C70A 1MFAL 2ZOLA 3UCQA 1NPJA 1ZHLA 5HHOE 1BZEA 2NY0D 4XMLH 5A2JH 1PVHA 4CADB 3IFPB 4KUZL 5JXAL 4GQPH 3DO7B 4G9FA 3DV6A 1DVFC 2VLLA 4YWGL 1IKOP 5MENB 1JN6B 4A38A 4XPGH 2VXQH 4YBLC 1TYEB 3M1CA 5SV3A 2JKNA 3VFTA 4MB1A 3VI3E 1F2XK 1XCQA 2N7SA 4YSEA 5AZUA 2ZCKL 1QQDA 3CHXA 1WHOA 5DRNB 3O2DA 4Z7UA 1HSAA 1U8NB 1AHWC 5J6SA 3ARQA 3ULSB 5J11C 1WWCA 5JW4N 5CLWA 2DQTL 2ZP8A 3P3UA 3ESPA 4X5WA 2X4NB 2FSEA 3H56A 4ZX6A 5H37G 5BVJB 3JWOL 3DARA 4IRSD 5CR8A 3G6AA 5TFSH 4Y16A 5GSRA 4BCZA 1PLCA 3FUEA 2EH8L 3NIFF 5HYQA 2GY7B 4L4VE 1TQCC 1MCPL 1AVAA 5GGSB 2Q7NA 2Y1VA 2YRLA 5INDA 3RX7A 2ODHA 1C12A 1H0DA 4ZYKA 4LBEB 4Z7NE 2IPTH 1SMOA 5D1ZD 2W0FB 3IMBA 1DBMH 4KC3B 5IVXE 1HJBC 3EG9A 4JKKA 4GSQA 1Q8MA 3BDYH 1E9QA 4UQ3A 2VDQH 1R3IL 3BC9A 3MRMA 4Z7WE 2YR3A 3MKKA 2MQ3A 1GGIL 5I28A 5DMKB 2K45A 1WF5A 5ICXA 2IPUG 5CZXC 1UD5A 3WIFB 3AGVA 2Y24A 3QDMB 2CJSA 1E5UI 1FFNB 5HYSA 1EJOL 5IHBA 1QSEE 1JZDC 3ZHKA 2IFFH 4LHUB 4L1TA 4JG1H 1IBGL 3DNKA 1U8HA 3G5VA 3MYZA 2ATKB 4JRXA 1T83C 4OZIF 3I84A 2I24N 3SPCA 1QPKA 1D6EA 5MHSE 1Q72L 32C2B 1UM4L 2QPDB 3CHSA 3VCLA 2IDUA 4IRJA 5IBUG 2A1WL 2BOLA 4L8DA 2ADFL 1KFAL 1NCWL 4J28A 1IIKA 5F9WB 5FB8A 1R0AH 3FF7A 1C5DB 1W0VA 2OTWB 1SJVA 4MMZA 3KS0H 3C2SA 1O75A 4LGPB 5BZXA 4RFNC 4WIQA 3RTLA 2Q1EA 1WUNT 2P5WB 2XJLA 3IWVA 3L5WA 4ZMPA 5BUGA 4NHCL 4WO4B 4NBXB 2AV7A 4GT7A 1WC7B 3MGOB 1QTYT 1OE2A 4P9MH 1OHZA 1UWGH 5I24A 1MCCA 1DQDL 4KXZI 5D7LB 4J3OD 3VSUA 4MXVE 4QDGA 3VXSA 5J89A 4ZO6A 4Z0XB 1VFAB 3S3BB 3TEWA 3OKKA 2VLRD 3GBEA 3D3VA 4QT5B 3O6FA 1SXZA 2ZP0T 2Z4TA 4JFEE 3VI3A 3T4AA 2DQJH 3MLXH 1N6QH 5SWZD 1E28A 4JX0A 4P5KB 4N2OA 1ZA6A 4J2QA 5I6NA 3UPRA 5ISZD 3R4DA 1RURL 3BPOC 4WGWB 1R5WA 3NACL 3JWDC 1TJHH 4S1SH 2BVPA 4Z7QE 4ERSL 1EFXA 4WWPA 1T89A 4IM8A 1DSFL 3DGGB 2XC8A 4KJQC 1M7XA 1ITBB 5BUPA 2PYEA 1JZ2A 3WTTA 1OAYL 1EJ8A 5AOZA 3WXWH 3PAYA 1MCDA 3P9LA 3B6SA 2DQIH 2MCG1 3LEXA 2XQBH 4ADJA 1P9MC 1OY3B 4NN7B 3UBXI 3Q6FA 4DESA 3LH2L 5T1MB 3NT0A 1Y1UA 2FIRT 2JKTM 2AJUL 4P23D 1NKRA 4S2SB 4PM1A 5I15H 3V7MA 5IMOA 4NDMB 3WTWA 3WS6C 1V05A 1MG3C 1YEFL 2YD5A 3HG3A 4OSUH 4AI7A 3IDXL 3I6KA 4XMVA 2R2BB 2BNRB 4XGZA 4MYPA 1GYCA 4APQA 2YGQA 3T2OA 1U9KA 2YEZB 4WJKB 4I77L 1HHGA 4E5XB 4LVNC 3CFCH 3O2VL 4C55A 1IC7L 1EGJH 4P5MA 3ZYOA 4XR8C 3QA3B 4JFFD 4LCCA 5F89B 2AJZB 2F7PA 3DX9A 3N43F 4YX2L 4XWGL 1DTUA 3V6FB 4LFHG 4L3EA 4PJDB 3BUTA 3K4AA 2O1AA 2EO7A 1XH1A 2R1YA 4PG9A 1RP9A 3SDDC 4ZMAT 1BP3B 3E9TA 4HV8B 5E4EC 5E8OA 4PJEB 3RIAK 3VGBA 5B39B 1U8LB 3HZVA 4PWJA 3QPQD 2O6PA 2Z34A 3RWHB 5C9JA 1KBVA 3L3HB 5CCKL 4IYKA 2YN5A 2BSSA 3BEVB 2DMKA 1OM9A 1XL4A 1IAII 3F7VB 4JO4H 3Q48A 1LGVA 3H1ZA 3QIUC 2BVQB 3PWUB 4D9RE 4Q4EA 3TTSA 4YBQD 4EN3A 1HKLL 2GI7A 2DKMA 1DQKA 1QYGH 2OL3B 4KTDH 4N0UA 4MCYA 2JXMA 4LASL 1X5MA 1ZV9A 3DX8B 4I48B 3DUSB 4OKDA 2FX8L 1QHPA 1J5HA 4I3GA 3NFSH 3LQAL 1CGYA 3O3UN 2VLKB 4M48L 2F8IA 4EOWL 1G9NH 5EBMA 5EUKB 4ZTEA 4JPIA 4NCC1 3DSFH 4Q6YA 5ESQB 1K6QH 2BC4B 2OMWB 5HJ3B 5HVHB 1BEYL 5KS9B 5CWSA 4R5XA 3HC3L 5LB1A 1NCIA 4LDOB 1K8DB 4MA1C 3HG1D 3UO8B 1OKEA 2ESVA 5LCVA 3V95A 5D7SH 3CDZB 3DX6B 4QI3A 3MJGX 5F97E 5CXPA 2V8MA 1U92A 2BP0B 4C4KO 2MWCA 2NQ3A 3W39A 3IGLA 1F4XH 3BZEA 4OCRL 4G82A 2VC2H 4JR9L 4L4JA 4EI5D 2BNUA 1OP5K 1MI5B 3H9SE 1WFOA 1S9KC 2FJFA 2X5PA 2X4OA 3VSTA 3HR5B 3TLRA 4ZUSA 3QFJD 1GTFA 1P1VA 5IW3A 3QUZB 4UV7L 4OM1H 5GISH 5JOPD 2WWOA 2F7OA 3QUYD 2NY4C 3QQ4B 4P5TA 3RWCA 1IQWH 1SY6L 4FQXD 1K5WA 2F08A 3EH2A 3INUH 3JTTB 1U8OB 3TN0C 1A6WH 3QJOA 5IT2L 4BFKA 5C9KA 5DURB 4X42A 2HA1A 2EE2A 1Y07A 4FDWA 4M43H 1JWSB 5GRJH 2FWSA 3UZVA 3ILQC 2CIKB 2B5IB 3GIZL 4TLUA 5BZWA 1FG2B 3ZKXC 1MG2C 4E0RB 1X7SA 3ZRCC 1YN6B 2VLRE 1TQTA 1FGNH 3MJ9A 1BZ9A 4YHYC 2FHBA 4GKNA 1FVDB 5D5MA 3QEGH 4NXKA 2VJ8A 1M1XB 3FN0H 1KPUB 5F9DC 1BLIA 4OF5A 3Q6FB 1UOLA 3NSFA 3HBPA 1IKNA 1X5JA 4PS3A 2XHNA 1G7PB 4EQ2A 5KYWA 4XO9A 2GABA 2VXUH 4S1QL 5ACZB 3BYYA 3SQBA 5F88B 4PRHA 4NDMA 2EVJA 2XVGA 2N0KA 4GJTB 2VDPB 3EHBC 1P4BL 1BOYA 3TVMC 2P8PA 2YFNA 3LN5B 1WCBB 2EO1A 4QOKD 5HYFA 1TMQA 3NCMA 4Y4KA 4LSQH 4AQ1C 4YMPA 1F3JB 3O8XA 5GIRB 4H8WH 1PZ5B 3CBRA 1YPZF 2HFEA 5I1CH 4IRSC 2W95A 4RQQB 1T1XA 1KNOA 2J6EA 1QKZL 5DJCB 2X2JA 4OZIA 2ZKHL 2ZUQB 3RBGA 4GAFB 2VGLM 1WWWX 1R47A 4GFTB 4ELKA 1KJMA 1KB5L 5DUPL 1JV5A 1FYTE 2AMUA 2BS8A 4BWTA 2HJLB 4MD0B 3IETA 1CGSL 3VYPA 4R7NA 2AXFA 1QQDB 3QXDB 5DRNA 5GXBB 3QO0A 4BSVB 4HJGA 5HHQA 4YZWA 3FZUD 5I9QB 2BNRD 1LNUA 2YIHA 2CCLA 1XCQB 2F9BT 3LXBA 4R0LC 1SYVA 3ULUD 1R3LB 1I1FA 3EUDA 3LRMA 3H0TB 4LVOC 4O2CA 1LTXA 1AO7A 1MLBA 3TONA 2R2HA 4NAMA 3VXSD 4NKMA 1I7RA 3QGVA 2H32B 4PJGF 2Y9RT 2UYLB 2DQUL 3CXDH 3FT4A 5DR5L 1SM3H 1A2YB 4LAJH 1Z1WA 3ZDYE 2X12A 1EHXA 1JK8A 1IARB 2E4FA 2XG4B 5T3ZH 2Y1AA 1SN0A 3NN8B 2PO6B 4PJXE 3E8VA 1KXQE 2XETA 2Y5TB 3KL5A 5KVFH 4X4XB 1A7NH 1ZHKB 1FDLH 1B0RA 3E2HC 4LOEA 1QFUL 5HPOA 5PCYA 5C0CD 5T1KA 3TBWA 1TTRA 4E41A 3OKMA 4HC1H 5DYFA 1AZBA 3UJIL 2SODB 4GKZA 2QGDA 4J3WA 3MZTA 3ZE2F 3FCTB 4K71C 1BCIA 3EOAA 3PP4H 1JOIA 1K4CB 3CFQA 4FXGB 2FD6L 4QCIB 4WRLA 2YRBA 1WSST 5IHLB 5FYJD 4NQVB 1KCUH 2AGJL 4M02A 3O4LB 4PJDA 4TN9A 1BAWA 1VHPA 3KW8A 1ZHBB 3L9EA 4H88H 5I6XC 4D9LH 5A43C 1WBYA 4HH9A 2VT0A 1FVEA 1UT2A 2WXQA 3MV7A 4H8WC 4PJEE 3RWCB 2TSAA 1BIHA 2CM6A 1DQLH 2VDMH 4BZ1L 2PYFA 3P0VH 4FYSA 3JVGA 4LQFH 2ENYA 4AC2A 5DRXA 2E7MA 1UVQB 4GYBA 3RKPA 3VWJC 1Q9LA 1H6FA 1F4WH 1YDPA 1GS7A 4BKSC 3K5SA 4WEBH 2QV4A 4URKA 1MCOL 2BNQA 4FERA 4JM2C 4ZOEA 3BRFA 1Q0EA 3EW3B 5DC0A 5A2KH 4PVBA 3C09B 3L3OB 1OZTG 1U41A 2LLLA 3ILDA 4RNRB 5L88H 4NENB 4P4KA 2QLYA 3FT1A 3GSVA 4MJJA 3KDMA 3LMJH 1KTDA 4TOYL 4XC1L 4HWBL 5GGVH 1I31A 3A24A 4YC2B 3PHQB 1F0LA 1G4RA 1T20B 1F5WA 2IBZX 4JQXC 1S78D 3OQ3B 4BFRA 2H3NB 2KDYA 5BS0A 1MHPL 2IC2A 2BZ7A 2KBGA 3HG0A 4R8WL 3VGFA 1AGFA 2AK4B 3CDGB 4B95C 2IALB 2YD0A 3HN3A 3PRZA 3PHSA 2VKWA 4XZUB 1TYRA 4E36A 4A67A 1EHLH 3UROR 1LDPH 4YBHA 4L9DA 4E42B 3LEYH 1IAIM 3TO4C 4AK2A 3HC0A 4N9OB 1PZ5A 3B56A 1W72A 5GGTA 4PWKA 2ZUUA 5DZAA 3G9VA 4IRJD 5DFVD 5K33A 4NGHH 4X7EC 1N12A 4QJ3B 4K3EH 1ZSDB 4O9HH 2XVKA 4UIMB 5FA4B 3GSRB 2YUZA 2EEBA 1IRAY 3FUIA 5TD4A 5D5ME 4YSCA 3FU6A 1NEZA 3HW7A 4X6DB 1A21A 3KLAA 4FFYL 4YDVB 4WO4A 3KPMA 4DP1X 4HT1L 4DW2L 5ILTL 1QW8A 5CCHE 2NY3B 1MFMA 1HAUA 3G6DL 2WUBL 1J0ZA 2KYIA 1BZ9B 5G5DB 1D6VH 3VMNA 1OCWH 3SBPA 4LLQA 4R7VA 3B2VL 5LDSA 1OE1A 2VQUA 2JQZA 1YEKH 4GI8A 2JKXA 4J4PD 3MLUL 3TO2B 4BE6A 1ET8A 1B9KA 1BQLH 1FRGH 3H4HA 3D0AA 1AR2A 4I0PC 4O2EB 2PP8A 3RWJA 1N18A 2YBGA 4OLZH 5I76A 3PREA 5FO8A 5JUEL 3ZZSA 2PXYB 5KSBA 5ANMB 4A2LA 4YHPB 5CZKA 4E9SA 2BWIA 3T1WA 3RL1A 3TNNA 3MREA 2HTKD 1IC5H 1NOAA 2QSQA 3QWOB 4I9WE 2JIXB 4ICXA 3EFDH 3RPKA 3WOVA 1QRNA 2DQGL 2YK1L 1K85A