2X28A

Cadmium bound structure of sporosag
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
235
structure length
219
Chain Sequence
TSCETEGSSISFTVEKAGHVVRFNCPSTLEEIKPAYEAGDSTKVCTTADCSNEAALKDVLKSASLAQAEGSSGGNDFTLTVDALPEAETSVFFLCQRTGADKCGVHILVKAAPQAPVCSAQDHTLELQITAANSDTSFVCGGTFNVIKPANAAKVLQDSCETEVDLVSLVPHASRSALEQSGLIKLSVTDLPQQQQKLCYRCEDSSQKACKVLVTVSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords SPOROZOITE-SPECIFIC SAG PROTEIN
publication title Structural and Functional Characterization of Sporosag: A Sag2 Related Surface Antigen from Toxoplasma Gondii.
pubmed doi rcsb
source organism Toxoplasma gondii
total genus 47
structure length 219
sequence length 235
ec nomenclature
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04092 SAG SRS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1320 Mainly Beta Sandwich Immunoglobulin-like SRS domain 2x28A01
2.60.40.1320 Mainly Beta Sandwich Immunoglobulin-like SRS domain 2x28A02
2X28A 1YNTF 2JKSA 2WNKA 1KZQA
chains in the Genus database with same CATH superfamily
1KTDB 1NGYA 2HYMA 1TZHA 5E7BA 1FG2B 2HH0H 1U8QA 3KPLB 3MNVA 4PYHA 4NZ8A 3B9KC 5H94A 1AS6A 2CUHA 4CNIB 3QEUB 3LEYH 3NT0A 1NUFA 1QFPA 3UZEA 3TEUA 1TEGA 3M45A 1VHPA 1GKEA 3MDJA 5L7XL 4ZFZA 1OM3L 5IB5B 4ECNA 3BFQG 4IEFA 1AFVH 2XQYA 4L4VB 4PCTA 5AAWC 4PS4H 3IRPX 1GGBH 3B7RL 2B20A 3E6HB 1XGYL 2Z3FA 3LKQB 4R90L 4PJAB 4ABQA 5IREA 3VXRD 3LX9A 4NZTL 3ZZSA 1M7IB 4LKXA 4B3VA 4D9RD 1DN0A 2F9BT 4U1JB 5DQ9B 5I19H 4PJDF 5LQBH 1CGWA 3FB7B 4L8SB 2X42A 4P4KA 4FTVA 3K1KC 3O4LA 2A77L 4Y16A 5KSBA 5T1LA 1OTUC 4Y4KB 1WH0A 1YEFH 2IQ9L 1THAA 1WT5A 4QRPA 4P06A 4YZFE 3BFWA 2AJVL 3N0PB 3UTSA 4E9SA 2OMNA 1AY1H 1RUPH 5IFHL 3QHZH 2HFGL 2VQ1A 1T7YA 5TQ2H 2ZJSL 1KCUL 4UTAL 2EUXA 4PWJA 5GZNC 2VAJA 3MRLB 1UVQA 4JKPH 3FDWA 4RIRB 2EDOA 3EHBB 4UIMB 3G9VA 3KLDA 4D0CA 4XMKH 1KXTB 2AW2A 4ODTH 5D93B 2GY7B 4RISH 5ECGA 5TGBB 5DQJA 3L5WB 2XTLA 4M7JH 4LCCB 1AI1H 2Z91B 3S2AA 4I13B 3N42B 2J1KA 4AEIL 4MHHI 2DTSA 3U9WA 2AXHA 3SDYH 2WNXA 2QADC 2EYSA 5DSCA 4P3CL 4HGWA 3T09A 2NUPB 5C0DA 2NW2B 2BNQA 5FK9A 1NBYA 1IQWH 1NGXB 5K9OB 1SDYA 4TQPA 3U2SB 2G2RA 4NQDE 4RZCB 1Y7VA 2QFPA 4FZ8H 5FHAL 2XKNB 5ABDE 3VXMB 1AQHA 5DJZA 2DDQH 1P5UC 4XPFH 2GJRA 4QY8B 3V7MA 1V3LA 5I1DA 4OGXL 3S6CA 2NXYB 2WXIA 5IV2A 4LOUC 1RJYA 2IDFA 1VGEH 3U0TB 2HFTA 2LGNA 3GMRB 2YKKA 1MIEH 1LO3L 5C09A 2W0LA 3WUWB 4XC3L 4OLUH 5T3ZD 2Z4QA 1FZMA 1NMCB 4UMSA 5IQ9A 5E94B 5CN3A 2JKLA 4OFKA 2J43A 2YPVA 4HJGB 5L2KA 2J8UB 2AEQH 5ID1B 1IAIH 2OJZH 5H35B 4HFUL 1KG0B 3FTZA 2ITCA 2K3HA 3RZWA 4WV1B 4JREC 3MA7B 3KAAA 3AVEA 3B9AA 4Z77B 4A6YL 4DPCX 2J1ZA 2XIBA 4GKLA 2N56A 4F7MB 3ZE2E 3QUXA 3VRIA 4K7FB 2Z9TA 3HUJE 1O9WA 5KUKA 5F7AA 5EIQA 4P2QD 4ZFFB 1IEAA 1RIHL 4LVNB 2GEEA 3KH4A 1Q94A 1P4LB 2WV3A 2AEWA 3HE6D 4Z7WF 2Y7MA 3FUFA 3TEXA 3UAJA 2VXSH 4BGLA 2Y6TE 1SLXA 4MS8C 4OLYH 4G9DB 3I6LD 5FHBL 2Y07H 1BECA 3NJMA 1CF8L 2C4XA 2DD8L 5IHUH 1CIUA 3TASA 1A6AA 1PYWA 4S1SL 3NZHL 4L8BA 4IBLT 2VLMD 1SMDA 1UD2A 4H8VA 2IH1A 4Z7UA 2PCPB 1TTGA 1G9ML 2HMID 3VACA 1L0QA 1J0HA 2WANA 2Z31C 3Q44A 3TIDB 4Z3TA 5L2JA 2R23B 4P05A 4FA6A 4X6DF 4NQVA 1G5GA 2VDQB 1PTZA 4QHKI 5F89B 5IW6A 2RIKA 1N4XH 3GEFA 1A47A 2FO4B 4QRTA 3F5WB 3PXLA 4YMPA 3ULUD 3BN3B 2V7NA 4PJ7F 5H4ZA 1BZ9A 4W9LC 2G5BB 2VXVH 5HD8D 1SYSB 4P5MB 4KFZC 2C7UA 5AAWA 4GLRH 1FHGA 1FBIL 1BVKA 2C1PA 2NNCA 4AC4A 3AADB 3TZVB 3ZDYB 1KIPB 4GINA 2NMSA 1WP6A 3TU6A 1PZ2A 1G7LA 1YECH 4EDWH 2CZNA 4LSVL 4Z7VA 2F8VA 4LPTA 5FFLA 3NIDE 5IQNA 1MCCA 5IMOA 4PTTA 4QRQA 3WY3A 3ZRSA 3HCVA 3BKYH 3HNSL 5LNDA 4XP5H 3IWVA 2CO4A 1J1XL 3GNML 4GSDL 3EO1A 2Y25A 1LQSR 4HS8L 1HU8A 2GUOA 4MD0B 3P77B 3KPOB 3BVUA 5AL0A 2R7EB 4OCWL 3H85A 5JW5A 4XN4A 2FJSA 3DO3A 3P4NB 1YUHA 5GZNA 3DIFB 4ZW7A 1TVBB 5IBLC 3L6FA 1S7TA 2IWEA 4YLQT 1VJSA 3C6LC 5EU5B 4D8PA 5I16B 5I0DA 2DMHA 3MTRA 2QQKH 3F3HA 2VLKB 2XWBB 4FCAA 2CKNA 3K3QA 2XZCL 4MJ5B 4RDQG 1Y6NR 2NY6C 4YGAB 4L9DA 5E4OA 2JB5H 4OZGA 4JR9H 2VOTA 2GPZA 5GRJH 4N90D 1TZOA 2IO5A 1ZHKA 2CJTA 4JW3A 5EZJB 4OJYA 1ZEAL 5D7LE 5I23A 4BK4A 4G8FA 1DQQA 2EDJA 2LVEA 2MOVA 2DB8A 1TYJA 2AK4D 3HHMA 1UXMA 4N4YB 4NKIL 5K33A 4PJFA 5I1IH 1LEIA 1O7SA 3BQUB 3NABH 4N9GB 2OL3B 1P5UA 2EYTA 3DYMA 3NESA 4F1ZA 1NEZG 4NKDB 2BIHA 3HRZB 1A6TB 4FE9A 1BLIA 5FECB 4IGBC 2E9IA 4E41D 1IU1A 2NYKA 4NJ9H 3MAWA 1SQMA 5IVZB 1O5DT 4OGAC 3HI1B 4ZMYA 2V17H 4R5TA 4PJ5A 3FUHA 1E4WL 4X83A 1ED3A 4DP9X 5I1JH 3IJ8A 2EDFA 1ZE3H 3OKLB 4DVBB 5FM5O 5FGCE 3VFOB 5JW4Q 2FWOA 4MNHA 1JGUL 1BWWA 3S36H 3ZY7A 3EFFA 3ME0B 2JKJA 4U6HA 4DK5A 4JFEA 3DX2A 3NSJA 3VE0B 1JSYA 5F97E 5CS7A 4OZIB 5EOCL 3CIAA 3FCSA 1KB5L 3PQYD 2ZYRA 2VQUA 1F6AB 1NOFA 4JHWL 2Y69B 3HNTL 4HWZA 4J3WA 4QHMB 1MJ8H 4XWGH 3HOGA 5TDNB 1FF5A 4X99A 3H9HA 5I71B 4TUKL 1AC0A 2WYHA 2YMXH 4MHHG 4KX7A 1MCOH 1ZV2A 3HN3A 4JDTH 4JPVH 4AK1A 4DVRL 1YMME 3GBNH 4DEPB 5I2IA 1LK2A 2P80A 4L8CB 2VXQL 3V2AR 1EA9C 1WFOA 2HJLB 2F19H 3OLGA 3ATFA 2LU5A 1IJ9A 3ESVF 4TRPL 4WSJA 2Y5TA 2WZ5A 1DQML 1FN4B 3G6JE 5ALCH 4DGWC 4DHLA 2EXYD 1WBZB 3UYOD 4OW6A 1YEGH 4KK8C 4ZFOB 4XN8A 5FV1L 3QJSB 2Y22A 4ZT1A 1HI6B 1JP5A 4R97C 1WEJL 5DMKA 4XNZB 3T2NH 2UV3A 5DO8A 1G1OA 2GC7C 5F72S 5JHAA 1F8TH 1JRHI 2NXZD 5A2JH 5IUSA 2Z31A 4CVZA 5LCVA 2DYPD 2APSA 3IDJA 3O45A 5A3IC 3PL6C 3DTXA 4MB3A 3NJHA 1B9KA 4ZMTA 4KX9A 2R8SH 3R0NA 4JM2F 1U42A 3P2DA 1T2JA 4UM9D 3JTTA 3W9EB 1R6VA 4N2KA 2CHNA 1KBGH 5LB1A 1KIUB 4YHOL 3CFQA 4S2SA 5L6YH 4H5SB 3KH3A 3WD5H 3QQ3B 2IXQA 4MDRA 3OZLA 5ACZB 3VXRB 1OLLA 1AHMA 5F0LB 2DJ4A 1G1KA 1NUNB 3FU7A 5DJXB 4KQ4H 2E76C 1A6PA 2V9UA 2CCLA 3V4PL 4MQTB 3O81A 3ARBD 2NSXA 1PIFA 1TMCB 4HV8B 1MHEB 4RETB 2OYMA 3BVNA 4YXKL 1JCVA 3O3AB 4S0HA 1N5YH 2F7RA 4M7ZC 1D5IL 3QW9A 3LZFL 1YEDB 5SWZD 5GSRA 4DW2L 4KK6D 2WXLA 1TVDA 5E51A 4NCC1 2E74C 4MA7H 1DQIA 2CNYA 2F54E 1B0RA 3HNVH 1JGEB 4NZRH 4TOYL 5J06A 1CBVL 1S3KL 3VMOA 5IG7A 4JZOA 4UTBL 2UY6A 3WO3B 2A6IA 4JE4B 3WSQH 1EGJL 5AZ2H 2J6WA 1SYVB 3HBGA 5C0IA 3C6LA 3PIQA 1JF1A 2YC1B 3KBEA 5DEFA 3O4OC 5HHME 3FB6B 1YY9D 2B16A 1Q9LB 4BWTA 5HPOA 4M9OA 4MSWA 2X41A 1FC1A 3IRZA 5HYEA 4IRZA 3Q9QA 2R2BA 1YZZA 3RWCA 5H37H 1KXQA 3B6SA 3MLXH 1HCVA 3DX8B 3TN0D 2NQDA 1EEZA 2F5BL 3VD7A 1M9WA 1SY6H 1EZSA 2XKUA 3QNXA 3NCWA 1TU2A 4N1HB 1EHAA 5J9PA 2DQFB 2ZOKA 3UBHA 3TBYA 4JPIA 3IAQA 4OCSH 4WFHD 2D7TL 4WWKA 1H0DB 4RFNC 1MWAL 3LH8A 4WTXA 2OP4H 4G72B 5I1HL 5IB1B 3IMUA 4Y1TA 2BNRE 5DYOA 5C2BH 1AGEB 2P44B 2GTZA 4ZDHA 2X6CA 5EZLB 3QT2A 3K5SA 4NQCE 2WAQA 3MJWA 4IGBA 5KVEL 1E6OL 4PJEB 2IDQA 4U7KA 3AQDA 5EUOF 3KLLA 1F45A 1WJ3A 3BKCH 2EH7L 1JVKA 3QEQD 4EDXB 2JKNA 5IQ7L 5D5MA 1I3GH 5CHNB 4G7VL 4GXVH 4IBQA 3MN8A 4K2UH 3Q3GB 4PI0A 2K6WA 5I8CB 4LMQE 1DFBH 1M7DB 5HGHA 1N7ML 1LP9E 2UXTA 1PLAA 3D39E 3DPDA 3BSGA 5FYJE 1HZKA 1CPUA 1DE4A 4G6KL 4MZ2A 1U6AH 1V55B 3CV5A 1A14H 3MOBL 3NFSH 3QDJE 4FFWD 4OCYH 4HIEB 3MJ7A 2HG5A 3VD5A 1RURL 4PS8A 5ESQB 3PGDA 3CUPA 3ZXAC 2NLJB 2ED8A 2O6PA 2WB1A 5ABZA 4CVXA 1PG7L 3ZE2F 1GS8A 4NOBA 4HU2A 4HWBA 1KT2A 5CKAA 1UQSA 1FORL 2APBA 3SKNB 5IKCB 5BNXD 3EOTL 3CFKB 3QXUA 3GS4A 3G08B 5GIRB 1M05B 35C8H 1NSNL 1MF2H 1Z9SB 4QHLA 1K8IA 2HA1A 3WHXA 2OQJB 4MCZA 4P2QB 2YAPA 2WXHA 4NLHA 1HQRB 3B1TA 3PHQB 2DWDB 1LO4L 4UDUA 3HE6B 4BH8A 1V7MH 4WI0A 3UTZA 2XLLA 3B5GA 4P57A 4FNLL 1FLTX 5SWQB 4TVPL 2MRYA 2DMCA 2M83A 2BOCA 3RWGA 3KXFD 3UC2A 3AWEA 4F8PA 1LWJA 2IPTL 3QXAA 4UT9A 4HJ0D 1HL9A 4ZMVA 2H1LM 4TNGA 1N2RA 5D4IA 3IDGB 2AV1A 3BPNB 3P02A 2XIIA 1MREH 1NAMH 5AYQA 1W72L 3TO4D 2OSXA 3SD2A 4KDWA 3I9GH 5E6UB 1RUMH 3PL6A 2FECL 1UENA 2E3VA 1MQ8A 1T5KA 2YFOA 4DUWA 3Q2CA 3VWJC 3GMLA 2W9DL 3QZWB 3OC8A 5TE6H 4HS6A 3RB7A 1ZTXH 1GZPB 5E99H 5DJ6B 5FKAA 1JPTH 1P2CB 4Z95L 2XWTA 1HXMA 2VDNH 3CHRA 5HI4C 2OYPA 1ZHLB 2NY7H 1RUAL 4Y1AE 2BVPA 4UNUA 5B39G 2JCCE 5JDSA 1UZ8A 1VGKB 4WSKA 5JNYA 2UZPA 4X5PA 2AERT 2X2UA 5CMAB 9CGTA 4D3CL 1SHSA 4MJID 4ODSH 4MQXD 2VL5A 2GJPA 3GS0A 2ZP9A 1EHNA 4AEEA 5T3XH 1JZ2A 4X6BB 5CJ8A 1XAKA 1LE9A 3CBKB 3BVTA 4PJDA 4Q6IB 4XVTH 2A73B 3SZKC 5CD3A 1MI5E 4Y5YB 2J57A 1OM9A 2KQMA 3LQMA 2VO8A 4KWUA 4XOBA 5DLML 3UC0H 1OAQH 3DXAD 5G4MA 1DVXA 2XPGB 1F90L 3AUWB 4XNDA 3EUDA 4P9HL 5HHNB 2X6VA 3GMQA 3MLWL 1R4XA 1U91A 2ESVA 3REVA 4DGUA 4M8QA 5FO7A 5J4MA 5BW7C 5HVHB 1OGSA 1JZJA 3MLSH 2VR8A 1RCYA 1TQTA 2HAZA 2I07B 4S1DD 3FOLB 5I28A 5DS8B 5J6HB 3P30L 5I66A 1HEJC 4PQXA 3T3ME 2CDGA 3DV4B 1A7RL 2G30A 4G59C 5TDOB 4JQIA 1P84K 4J7RA 1QFUL 2APTA 3ZDZB 4DOHB 2XVLA 4XI5C 3D85A 4BKLB 4H2CA 3WEMA 4H1LG 4JJ5A 5HYQA 2AK4B 3C8KB 2FQDA 4NXSA 4PLOB 4GY4A 3BWSA 2DQCL 5F96H 4PJGB 3K4AA 2Z8RA 1G0DA 4IRSC 4NQEA 3V6FB 4BSVA 4Z0BH 3OAUL 3C5JB 1E9PA 2J44A 1XGQB 4UF7C 3ZUCA 1GL4B 3PAYA 2BO0A 3GI8H 4K94C 2X28A 3BUTA 4U6XB 4DCQA 1X5FA 1PJWA 3BO8A 2V33A 2Q6WB 4E41B 3I2CH 3KJ6L 1FJ1B 2G75A 3K72A 4JKMA 2UYLB 1IC4H 4OUUA 3MRHA 5F9OL 5AAMC 1EDHA 3RGBA 5HGDB 3FSAA 3PAZA 4WAFA 1WCBB 3WEOA 1ZAGA 5DI8A 5I1GL 4KH9A 3RWDB 4J3OH 2TRYA 4LESA 1DBAH 1F58L 2KPWA 1TEFA 2NNAA 5K1JA 5IMMB 3ILPA 1ZDSA 2IG2H 4EKXA 4B7LA 1NJ9B 4G42B 3X11B 4XRCB 1VADA 4PS4L 1VFBB 1H8SA 1RH8A 2DYSB 3N43F 1H3GA 2IADB 4LLMA 3UYRH 1IAKA 3CHXA 4WGKA 4EI5D 3VX1A 3LIZL 3PQYB 4ZS7L 5A2AA 4C4BA 3LHAA 5K1NA 1OZUA 4LSPL 2G3NA 1MWOA 2OJEA 4GG6E 1ZPUA 2VQ4A 2WVVB 2XJLA 2H3NA 3IU3A 2CKBB 4WI3A 3ZIYA 1QFOA 4OD2B 2WLNA 4N2IA 3MRBA 2YRZA 2R2HB 4QR7A 2VDLL 4OKDA 3ZKQD 3DK2A 3EF7A 3G6JF 4GAGH 3ARRA 4YSCA 2XTJC 3P73B 2FGWL 1NANH 3QWRD 4WW2B 4DN3H 3SYCA 2QVMA 4UAOC 3O8XC 4E5XA 2WD0A 5KS9B 4PP1D 4XCEA 1CXLA 4PIRF 1OPGH 1G1YA 1TZIB 4Z7WA 2HVJB 3GXMA 5ITFB 3CFCL 2ZT9C 2B15A 3NK4A 5L9DH 2BHZA 1PKQA 3ZKXB 3DETC 3L5XL 1XT5A 2F53A 5C0EB 5HHPA 1AG0A 1KJ2B 5MHSD 3BP4A 1NCBH 4ZUVB 4XX1G 2NXZB 2FJUB 3C09C 3N55A 3O3UN 2IAMD 3PHAA 3FZUC 1A3LL 2CDEB 4RMWA 2DYPB 5T33H 2AMGA 2XA3A 2XFXA 4QNPF 4OLVH 2G0KA 2HLAB 2W60B 3VWJA 2OMTB 4PJBB 1MNUH 3HB3D 1CFSB 3DRQA 3W11C 4X6DA 5E4EB 4UM9B 1NBZA 5PCYA 1Z1WA 4NCDA 2OTPA 2EEXA 5TF1H 4JM2C 4N8CL 3UBXI 3M1OA 5F3HA 3QZBA 5D1ZD 4ZO6A 4PJ7A 1C7SA 2L7EA 2WGNB 4YO0A 2CSPA 3LZLA 1PIGA 4JE0A 4R0LC 5DGRA 1F11A 5LWYH 3AFLA 4FQCL 3SHSA 3T6ZA 4ZMWA 2M8XA 2P5WA 3MGOB 3MUZ1 3P3UA 5DDHA 4F2MA 2AXJA 2IMMA 4JY4B 3LN4A 2OLDA 3L9EA 2H45A 4TXVB 5I9QC 3ARBB 1EDQA 4M56A 4F58L 4QDGA 4C4UA 4HISA 1MFDL 4U6VH 1OK0A 3ZHNA 1D5MA 2PF6A 2BXZA 3Q8AA 4FP8L 4JB9L 4JCLA 2WOYA 1D6VL 5SWZB 3FRPG 2Q0ZX 1REIA 1IJNA 1ID2A 2H8PA 4KKCC 4X5LA 3QG7L 3L5HA 2P7TB 2MHAA 3FOMA 4N2CA 2BRQA 5D55A 1IGML 2YAOA 4OJCA 4PUBL 3GXFA 2Q87A 3V9FA 4FG0A 4F2EA 3HPJA 3S36X 3BAWA 1E4JA 4U1GB 4AZ8B 2EH8H 5BW7A 3D4GA 1EJFA 1CGSH 4H0HB 4OBSA 2HKAA 3VXPB 1L5GA 3GC3A 1KCSL 3Q6GL 2ENYA 2IWGA 4PJHF 1EPFA 4WKZB 3D4CA 4ILDA 4XO8A 3A67L 3VU1A 3TN0B 2ZX6A 3NN8A 3MROB 1BBJB 1CYWA 4BFNA 2YUXA 3BUYB 3BGFC 1E7UA 3SCMD 2EE0A 3ABZA 2X89D 5BRQA 2VGLM 3IU4H 3ZSTA 5AOKA 4IRSA 3D06A 1WICA 3NSXA 4ZAKA 5FM8A 4HW6A 3DIVA 3SBWC 2Q8BL 4AYDC 4NN5C 1HHIB 1WZLA 2X4RB 1FNSL 1CDIA 3D3VA 3MNZB 1WZKA 2P49B 1NQBA 4JO4L 3D1MC 3L3GB 3MC0A 3OKEA 4PVMA 4ADGA 2KH2B 3MV9A 1G9NL 1K4DA 1KB9K 3QEQB 2KYIA 4BELD 4CUCA 4ERSL 1LP9F 4ZTOH 4Y2NA 5B21A 3UGEA 4UOZA 5F7KC 4UZUA 5KYNA 2GTWA 1GYVA 1PZ5A 3QIWD 4UNIA 1HIMH 5GGVH 2W9LA 4GQ9H 1EANA 2APVA 2YAEA 3KPQB 4MFHA 5IHBA 1FCGA 3JV5A 1JI2A 4IU3B 4P23C 1RK0A 4HU8A 4UOW0 5DK2B 1IL1A 3X3FH 3PPSA 5AW4B 1A0QH 2DMBA 2X70A 4OJAA 4LRNL 3VFPB 2XDHA 3L4UA 2X4TB 2VW6A 2QQNH 3KPMB 5MEND 5DLLA 3UIYA 2ZWYA 3BZ4B 3L45A 1MJ7L 4LQFL 2BIMA 4I9WD 1X44A 5KEZA 2NZ9D 5AVQB 1LHZA 2LFGA 4QF1B 5KJ4A 1NCGA 4FYTA 1I9IL 2OR9L 4R4ND 4AQAB 4UBDD 4MXWL 2I24N 2OX5B 2ICWI 1HNFA 5LGYA 3E1ZA 1W2KT 2O93L 2AGJL 2Z34A 4AVHA 3T8VA 3FCBA 1HHJA 3KXFB 2CUAA 3QJOA 4KTYA 3QFJE 3US1A 3VH8B 1KTCA 4KTDL 5ALBH 1INEL 3QO0B 4TULH 4YDKH 2P5PA 3NBNA 3IJHB 3ALWA 4Z5RA 3TO4B 3BLPX 1CN4A 4L8DA 3SDCD 3QJRB 1AZCA 4TPRH 5JQHC 2CO3A 2WUCL 5F9DC 2WLLA 1JZFA 1QWHA 4XMXA 4I0PD 1U8IB 1QLEB 2PPCA 2PUQT 3KPPA 3CX2A 2YN5A 1VZIA 2AJYH 1T0NB 5CKGA 2WQUA 4MWFB 3SDDD 4JM2A 2XX0A 1NEUA 1JTOA 4ZQKB 3EGXA 4R0LA 4RLDA 2YPVL 4CC4C 2XWJB 5FCSH 1P4IL 4AIZA 3QUXD 4HIIB 1H15A 1WLHA 3IDYB 4HSCX 4MJIB 2P8MB 3N9GH 4ZTPL 3VFTA 2LVCA 3UH8A 4N24A 4QTHA 5GISH 4S11A 4BD4A 4W68A 1YEIL 1U8CB 1LMIA 3F58H 2H47C 5DO2C 4A2LA 1QFWM 1GPOH 2K7QA 4WCYH 3UZQA 3VGFA 3GSUA 4ONHA 3GZOA 1Q9OA 4JFXB 3TPUA 1FAIL 4XE0A 3GGWB 3DXAB 3RL1B 5D4QA 3LKPA 1NZRA 3U4EA 5IFJA 4DP1X 2CHZA 3CHSA 5E2VL 2AKRA 4W9ZA 1LK3H 4XWOC 1FFNB 3A22A 3DROA 4BQ8A 3IGKA 4AX3A 3T3MF 4J8RA 3QULA 1Z2KA 3U4KA 2VC2B 2AJSL 2A9NL 4P04A 2C9XA 5E5MB 1E27B 3QQ4B 3ATDA 4L18A 2H32A 4O00A 3PFUA 4BZ1A 1BYPA 1S6NA 2FX7H 5BMFH 4XPGL 5AAPA 3JYCA 1ZLEA 4NDMA 1A9EB 1INDL 3UBXG 4JDEA 3FQUB 1WFIA 3ARVA 1H8OA 2P4AB 3G6DL 4NQDA 1QA9B 3MLYL 5IQOA 1XGRB 3UJIL 4QJ3B 3FF8A 3SBWA 4L1BA 3SPCA 4AIOA 4WFFD 1IGTA 5IJBC 1MAMH 5GQBA 1SXAA 3G6AB 5CO1A 5ESVA 2B1OA 3VFGH 3IDMB 2AV7A 1JNNH 3V0VA 3UADA 4OT1H 5L8JB 1X7QA 3NDZE 3P9LB 5CSGA 3CFBA 4D0BA 3DVGA 3DSFH 2BVYA 1V3MA 2FQFA 3IJSB 4IIZA 5FYKH 3EFOA 1KUMA 4HPOL 4UU9A 1G6RB 4WTZG 5IHHA 5CD5C 3LS5L 4M62H 4LEXH 2V7HA 4TSAH 4P48A 1OKEA 4C83A 4W9HC 5E5LA 5JPMB 5DRWB 4F7EB 5DUMH 3GK8L 4P23A 3PHOB 4GG6F 3MOAL 1XX9C 4OFIA 1FFRA 4EI5B 3CCHA 3IGAB 2EEAA 3QWNA 3L2MA 4UOQA 3T9WA 1YN7B 1U95A 4ALAC 1X7SA 3STLB 3QCUL 2EVGA 1SHMA 3LRLA 4NZJA 4XCFH 1NCWL 2BDNH 3D07A 5IMLA 2PO6D 4IRJD 3ZE0F 3BQVA 1TJHL 4J2XA 2HRPH 1PD0A 4HBCH 4EPSA 3HUJA 1OAXH 4TNEA 4PI2A 3PWUA 4N22A 1Y18A 4H8WC 4HUWB 3R1GH 3DI3B 1IVTA 3AJ7A 2ZOUA 4NRXA 4NKOB 3L4VA 1AGFA 4NT6A 4XODA 5ICZA 3U0PA 3FO2B 3W56A 5DZVA 4G8GD 4YX2H 4FQLL 1CI5A 1UYWL 4L4VE 3VFNB 2VQTA 4RCAA 4G83A 4P46D 3D6GA 3QUYC 3S98A 2J1YA 3FT2A 4LK4A 1CU4H 1QPPA 4PJ5D 5EEZA 4I89A 2YUZA 1DZ0A 1OCOB 4PJAE 4CMHB 3ULVH 4HIJA 5HBBA 5FA3A 3MACH 4ATTA 2IAMB 2QTEA 1LEGA 2YJQA 1ET5A 2R2EA 1T1YA 1H8LA 2WBWB 1LO5A 4EZJA 4XVUC 4EVNA 1R3HB 4N28A 2AEOA 2AK1H 2I7OA 4XAKD 4UT6A 4FI6A 1MY5A 2EIKB 4JFED 4HKBB 5DR5L 4CKVX 1FLRH 2DQUH 1SOQA 3K81A 3UABA 1A66A 2ATAA 4ZRGA 3HB3B 3BYYA 1JZ7A 4XO3A 2VLRA 3EDEA 4KI5E 1R5VB 1M2OA 1FIEA 1YNLH 4I3RH 1MVYA 1A6WH 4QWWC 5CBEB 3GB7A 2HN7A 3OD3A 1LLAA 5D1ZB 4N0FA 2LE9A 5C0FB 2PCFB 2NOYA 3F12A 4NM4L 2MPAL 4YHKL 4AM0A 4CC4A 2F61A 2F7IA 1J5CA 5KSUB 5FKPA 1DJWA 5BV7H 2P80D 4ABWA 1DEEB 3B2UD 2OMXB 1MPAL 4IS6A 4OQ1A 3U7WH 3L95A 1YEKL 1PVHA 3GMOA 2YN3A 1A6VH 1BOGB 5DURD 4JY5L 4KJQD 3GPEA 5DD6B 1EFQA 3ILDA 4H13C 2Q7YB 3N85L 3BGMA 1UWEH 2ZUXA 2ADYA 4OLXH 3DYOA 3SE4C 1G7PB 1NCIA 1J87A 4GI9A 1K3IA 4DAGH 5TE7H 3WMQA 4X4ZA 2CBOA 3V5KB 5I15L 2KDGA 2J25A 3Q01A 4O9HH 2Q86A 1V3KA 2R1YA 1NGYB 1RUQL 1HTYA 4G6AD 1N64L 3RGVD 4ZNEE 3MNVB 2EIZB 4M7KL 4POZD 3VXME 1VCAA 1V7NL 5C7XH 1HYSC 5GHWH 1RXLA 3C9NA 3ZT6A 3TT1H 1CFVL 1JHTB 1I7RA 5JIDA 4HIPA 2W91A 5JZ7C 4DO6A 4OFQA 2DQHL 5JIQA 2NY0C 2JKIS 5E2TL 2R83A 5JA8B 1YEEL 4WHTB 4N6RB 4HP5A 3BH4A 1GOGA 3TBBA 3UJTH 4IW4C 3F8UB 5D7LA 3BP7B 1L3NA 2ARJA 3SCMB 2ID5A 3U1SL 3V52H 1YJDH 3D69A 3O3EA 5LCVL 2Q8AH 1F5WA 4D9LL 3WYRA 2F2HA 2GSGB 4XP4L 4JRXB 1F3RB 2J8UE 4HK3J 3RVXD 3HHSB 5AOMA 5GGUB 5I26A 4X4YA 4IIQC 5I1LA 1T7XA 1MFVA 3EO9L 1OE1A 1MCFA 4LCIH 1U9KA 3L13A 3LDBB 5KTEH 1FVDA 4BZ2H 2OMWB 2H2SC 4N0UB 1SLWA 1I8IA 2ADIB 4NKMB 1KGYE 4JLRA 3NRFA 5IQLA 4HIXH 1PNDA 2HJKA 5E1AB 4UUJA 4U6YA 5AW7B 4RH4A 1KELH 1IC7L 1D2PA 2VQ1B 3EYVA 3DBXB 3U7YH 2XPZA 4BFJA 5FPIA 2O5YL 4WJKB 3RE0A 2HJFB 3BZEB 1JN6A 3QIWB 4WI9A 4UI2A 1AGDA 4DZ8B 3LMJL 2ZWZA 3CFJB 1EBAA 5D7HA 5JOPD 1J0IA 3JWDH 2I5YL 4PRHA 3QPQC 1WA2X 1YEWA 1EEQA 5EORL 3N44B 1AZUA 1IEBA 4XB3A 1UT1A 4IMKC 5I30L 3M17A 2VR6A 2WBKA 2JKWA 5MENB 4K8RH 5DSCB 2D7MA 3RJQB 3TFBA 1EERB 5CP7A 2E56A 1K6QL 1YMMA 1KC5H 3OXRB 3GQFA 1NBYB 1T80A 1GYUA 3GPSA 4NWTL 4PGBA 3BKJH 5HHQB 4AUUA 3BIBX 4GO6B 5T8IA 3U0WL 4NAJA 3OJDB 4WWKD 4F37K 4BFIA 3UCRA 5EMYA 3T8XB 2Q3XA 1YNKH 3CVCA 3G6JA 4IRZL 2EJ1A 2X4QB 1TTBA 2VMJA 2ZUUA 3CXHJ 4DP2X 1DHKA 1O6TA 4TNWF 1JZGA 4PJ8C 5DWUH 3JWNG 1HOCB 2AP2A 3CH1A 3RAJH 2QMKA 3D87B 5CUSL 4P59L 1LO0H 2VABB 4EOWL 3QUYA 5C6WH 1U33A 1T5WB 2BIOA 4R9HA 3F2LA 3ZDYE 3LXCA 2EXTA 3MZTA 5D1XB 4YBHA 1JOIA 4CC0A 3SDCB 5DRXB 4LNRA 4GNKB 4KTEL 2FECI 3ETSA 2E75C 2VXUH 2I27N 4PVLA 2DI8A 4I0PB 4J2QA 3SYQA 3WS3A 2JTDA 4DK3A 3SGEI 3IXTB 3DOSA 4J27A 2Y7QA 5LBSA 2OA9A 2VRAA 2W0KA 4XPBL 2Y72A 3TTYA 1Q9KB 1VEMA 2V2TB 3D09A 3RWHA 2XACC 1DJSA 2WXFA 3HMWH 5DRZB 3SDDB 1MCPH 3CDGA 3ATAA 3PRZA 4PWEA 4JZNB 1U0QA 4OLEA 5E8OB 5LGJA 4XHJC 3F83A 3KCPB 4L2YA 4YDNA 4UQDA 3SE8L 1IVLA 4JJOA 3QUXB 4K23L 4N2AA 5JHLH 5FA4A 3DX7B 2X53A 4YFLF 3NPSC 4RAHA 3TIEB 4ZPTA 1W91A 3NSFA 3EYFA 1INQB 2Q3AA 1GJIA 4BUQA 1HDMA 1SOKA 2DL9A 2GCYA 2GITA 2MOGA 2VDOL 3BW9A 3LJ3A 3SJVD 5C0NC 3H3BC 3VD9A 1ZMYA 2VLKE 2UXGA 1KWKA 5GSVB 2A6JB 4HWBL 1CGXA 1UKSA 2IG2L 1SGKA 5ICXA 4K3GA 2C9VA 3FULA 3SE4A 2QR0A 3OGOE 5KSAD 1JV5A 2BY3A 1OTSD 1A22B 2ZP8A 4JFZH 3DLQR 1BFOA 3ZO0A 3QARA 2F54A 3FL7A 4XXDB 3IJYA 4UB0L 5M95B 3ENEA 1RLBA 4M02A 4Z76A 2VMDA 5ICYA 4PD4J 4P2RD 4OZHB 2CLRA 1UOKA 1QMUA 4AIXA 2Y06H 1G43A 1SUHA 3TEWA 3MFFA 4ZUUA 3C87A 4B9YA 1PSKH 2OM5A 3CLFH 2YKLH 3HW7A 3K4DA 4UT9L 4AW7A 4KVCH 1X5HA 2HTLD 3MBWA 3O2VH 4J39A 1MRCL 2ODIA 1KGIA 1RJLA 4PJHA 4U6TA 4XNYL 4G8IB 4BFRA 4O4YH 4IOSA 1I1FB 2JIXA 4JFSA 4KHXL 3FUKA 4KMTH 4LHUG 4XZUA 3SPVB 5DTFA 4UV4L 1IAOA 3CSTA 3RNKB 5CILL 5GGRY 4AV4A 4R96B 4ENZA 2UZIL 4IIQA 5EBMA 1X5MA 2BNRA 5C0CD 2IALA 2BS9A 3HAEB 3LKSB 4ANWA 1MQKL 4OZIE 1D5XA 4HLZG 4M8RA 3S3BB 3WNPA 1KJMA 5B1BB 4NQCA 3CZFB 5CN1A 1JZ5A 4F7TA 3GJFH 1L7TH 2ZNXA 4G7YH 4KROC 4QRQB 1SJEB 2W59A 4MYPA 4OR1A 5DFWH 3KWUA 3QXVA 4JFHD 4AV5A 1PLCA 4KKPA 4L3ED 3S3JA 3BXNB 1A7OH 1CLZH 2RB8A 4AJ0A 2L7JA 3L8QA 5K9KA 4FFZH 3ZO9A 1E9QA 1VKXA 2EC8A 1G9HA 2ENJA 4OIBA 4NQUA 1EO8H 4AK2A 1LP9A 2HRLA 3D39A 4H40A 2EKJA 3T2LA 1ANUA 4GG8A 2D3NA 3DRTB 4JPSA 5MP6H 2WZ6A 1ACZA 3MRJA 3ARFA 4OB5H 2L3BA 5DZNA 1CK0L 4RWYH 1GGYA 2VR3A 4IMKA 4WY7H 4V33A 3VRJB 1IT9L 4K3JL 1UKQA 3I74A 2XC8A 3DGGA 2PO6B 4IRJB 4EZMA 4DQAA 4M9PA 4G8FB 1UH3A 2XYBA 4MMZB 1A7NH 5C0BD 1A3QA 1C08A 3HVNA 5CIPA 1QVOA 4N3TA 3ARDC 2RALA 1QNZH 3QORC 5FLVA 4Y2LA 4AE1A 2I9LB 4JCWA 1R5IB 2WLMA 4NLAA 3KVDD 4OTXH 5DEJA 2AQ1A 3WN6A 5BZDB 3IJEB 3QJUB 4JQIL 3PXHA 3ARYA 1Q0EA 4G8GB 4F37F 3AQZA 4M1DH 4PJ8A 5DHVA 4CKQA 1EZUA 3MU3A 4FN0A 4MA1C 1MCSA 3W81A 4PJAF 5HDRA 4AG4H 4P46B 4JRFA 1SXSA 5DD3L 1JK9B 1CGSL 4PJ5B 3CDZA 3QXWA 3KL0A 2E46A 2CA4A 3VXRE 4HX1A 1S9WA 4MDIA 3PE9A 1SN0A 4D9RE 2FWOB 3N1GC 2VDKL 3WNLA 4ZMAT 3CZEA 3LSOB 3CVBA 4P07A 4Q7DA 4B95C 2V37A 1CDUA 2FJGB 4KI5F 3PHSA 3TXAA 4TS6A 4XN7A 3V6OE 1DVZA 1ID5I 1S9VB 3EJTA 4M1GH 2P3YA 3SPGA 4I88A 4LLVB 3T2OA 3PAVA 5E56A 3KLHC 2DLFH 5I1CL 4LIQE 1PNCA 4JO2H 1NCAL 2JI1A 1AOZA 1XF2A 3ABGA 3CPLA 2G2PA 4HUXA 1WTGT 4Y1AA 3H9HB 3VMNA 4R7LA 1AH1A 4UDTA 4W70A 1SDDA 4WNQB 2DIBA 2EDQA 1EEYB 3INUL 1PY9A 3EG9B 3B34A 4QXGH 2X4OA 1CR9H 1KCBA 1M6UA 3N42F 3VJ6A 5J13C 2GSIA 5DURB 2CG9X 4LEOA 3CK0H 3OJVC 4EBQL 4JG0H 3IEAA 3NH7L 4N2OA 3QUMH 4ZO7A 3UP6A 4NHUB 5B1JC 1Z3RA 1EJOH 1VPOL 1EFXD 3D50A 4OFVA 1MI5A 3QQ9C 4LFHD 3RJOA 4CDGC 2V2XA 4BEIA 3B2MA 3JT0A 1S7RB 1HQ4A 3K71A 3X14A 1AQDA 3IDIA 4U1HA 1YAZA 4GSUA 5EC1A 1BQHG 2H26A 2BSRA 4PP2A 4O02H 3CDCA 3RGVB 3T2QA 3R7QA 1KLFB 4NUJB 3IDJB 3O45B 1A2YA 1HCZA 1NDGB 3MYZA 3V8OA 3OHXB 3D34A 4KNTA 4MB5A 4PJEE 1NEPA 2M26A 1FGVL 4L2LA 4E9XA 3NCJH 3ZKMC 1RI8A 1UJ3C 3UAFA 3GRGA 4YSEA 3ZYOA 3CSPA 4QXUL 5T3ZE 4FLQA 4XNAA 5IBUB 4S2SB 3DX6B 1OARL 3R8QA 5GGRA 1ET7A 1G7HA 2VLLB 1G94A 4LLUA 1KIQB 4BCZA 2BPBA 4BQCA 4NM8L 3FU7B 3FO1B 4N8UA 4Z7QF 3DJ9A 5KVDL 3N1FC 5FUOH 3K2KA 4W9KC 3MRRA 5EUKA 2VR5A 2QQLH 4MNGB 2PYFA 1MHPL 3KGSA 4P2YA 4U4IA 4UIKL 4HVBA 5BZWB 3ZE1B 4Y19D 5F3FA 1J0YA 3ECUA 3ILQD 4X5WB 1MCDA 1H3PH 1QABA 2Z35A 1I4FA 5CEZD 6FABL 3K1DA 5F88A 4JY6A 5GSRB 4EF3A 1KACB 1E6JH 1ZT7B 3Q8BA 1IBFA 2QVIA 3A4AA 4O2CA 4QRSB 3CVIL 4QRAA 5IFAH 1AD0A 1B0RB 1HC1A 4P2QE 3M1CA 4Z7NF 2IOIA 1CD1B 2WKOF 5F7MC 5TH2B 4J1UB 4YXLH 4APXA 4OLZH 3WLWD 4GLRI 5BQ7B 5AFAA 2ORBH 4XBGA 1SRDA 3L4XA 3TBVA 3MJGX 4JG9A 3FT4A 4UM8A 2PWFA 2JLPA 5CJQL 4NJAH 1WS7A 3I6LE 5EZOL 1EAQA 4YHMH 3HMXH 5JW3L 1FE8L 2FAUA 1T4KB 3BKMH 4JN1H 5CLXA 3RIFK 3RWCB 3LEVH 4GRMA 5FXCH 4GG6A 3GIVB 5FCUL 2GKIA 2VLME 4RGNB 4ZMQA 1ZS8A 3WE6B 4OSUL 5HDWA 2J1WA 1ODUA 4K0OA 2J5LB 2QV2A 4JX0A 4JO1L 4QHKJ 5FFOA 3RHWK 5J9PB 1J1PH 4YEEA 3F7QA 2UUDK 3ARDA 3MRKB 4I3SH 3QORA 4IRSD 4WWKB 4FHBD 4ZAKD 2EUZA 1RZQA 5DVNA 1YA5A 4S0TD 3KYKH 3ULUE 1CF1A 2Y7LA 2IGTA 4GBXD 3O2DA 1MFCL 2OMUA 2OSLA 2XETA 2AI0L 4RFEA 3ZDYF 2A9ML 3BP6A 3MV9D 4P8QA 1MFEL 1JVLA 5E8PA 4YSUA 4PRAA 1S7WA 2ZPKH 5D5MB 1QHOA 3OGCB 2GJJA 2D2CC 1ZSHA 2BSDA 3EGSA 4NFCA 1Z66A 2HX7A 2RACA 4K94L 2C3VA 4RVBA 4V2BA 3EO0B 4ZK8A 4F8LA 1UCBH 3CZUB 1CQYA 4W9EC 4LSSH 5SX4H 1OTTD 2Z8SA 5I0VA 1FYHB 1P7QA 2WCSA 3SDXB 4W9DC 2CAKA 3RY5A 2R1XB 4NZUL 4HQQH 1P7BA 1I82A 1Y0LB 2X1XR 1T03H 3GBEA 1UC6A 4S1RL 2J3SA 1WGVA 5A2CA 5GS0C 2ZKHL 1TCRB 4CDHA 2AQ3A 1MAML 2OTUB 2PCXA 5ERWB 2YBRB 4Q0XH 4ONFH 2YD6A 2EADA 1ONQB 3S88H 3GI9H 4LDEB 5E23A 4QHLB 1KN4H 3BDXA 3CQQA 1K8IB 1G7MA 3IETA 3ELQA 5E5UB 1MLBA 4XC1H 1JXJA 4EI6B 1HH9B 2A6KB 2YXVA 3SJVB 1MCWM 1I1AD 3FQTA 3GD1C 2CO6A 4NAQA 5AVSB 4P57B 4N90E 2BZ7A 5B1JA 3ZDZE 4R7XA 4DOHE 5KSAB 1BP3B 3NA9H 4U1NA 3JTSB 4Y4FC 3P0VH 3I02A 5KVGH 1G9EA 3CHPA 3QXAB 4XN9A 2AK4E 1HHGB 4PJGE 1A7PL 4LVOC 5A16B 2NYYD 3JV6A 1C16B 1CT8A 1KYOK 2NTSP 1MEXH 3CZLA 1F6FB 3C5XA 5LBVA 4M6NH 4P2RB 5AALA 3HC4L 4K3EL 3UO8B 3BISA 2E7CA 1CFTA 3CX5J 5IK3B 4Z8FH 4E41E 3NGBC 1X5ZA 1XVSA 3IK2A 4I9XA 3G04A 3QJHA 4RAVA 1YQVL 4K7PY 1IC5H 1UJ3A 4NN6C 2IPUG 3OKOA 5AD0B 1OLZA 3GO1L 3WL9B 2WQVA 1KLUB 3GJEB 3A6BH 2YAQA 4WVRA 4M4RA 1RVFL 2D03L 5M94B 3L4CA 1BX2B 4KDTC 1S46A 5DJYA 2BP8A 1OO2A 3WO4C 1E9OA 5EA0L 3RIKA 1LO2L 5IF0A 2M2DA 5IROD 1UWGL 5C0CB 1KYAA 2LHAA 4GAFB 1YSOA 1ZCRA 4RA3A 3VB8A 5IEKB 5JXAL 3SDAC 2G9HA 3PDOA 2FGZA 2E8ZA 1AMXA 4K5OA 3EADA 1NC4A 2VDML 4NPYA 3PQYE 1BM3H 1A9BA 5BPPA 2CJUH 2JK5A 4L3EB 4QTIL 3H42H 4U1MB 4KVPA 1MDAA 1GSMA 1NFIB 1WWAX 3MNDA 3P0GB 1UHVA 1HJBC 1YDPB 2NR6C 4N2EA 3DHMA 2I7SA 3V0WL 4O58L 4P2AA 3REVB 1DQLH 1WZMA 2E7MA 5FO7B 5G4NA 2QHRH 4N25A 4F7KA 4KO5A 4E68A 5D1QD 4E9QA 5KS9E 2DI9A 4PRDA 1TQSA 2EZ0C 1OAZL 4RMTA 2DQTL 3GHBH 3K8LA 1I9RL 1JNLH 3AB0B 2XVKA 3D7PA 4KK5D 3W5MA 5IB3B 2BHUA 4LPWA 1JZDC 4ENED 5C0BB 1X5KA 8PAZA 1U8PA 4G6MH 3RIFF 3CVHA 4J3VA 2E6QA 3O11B 4PREA 4EUPB 3X2QB 5HVGB 2CWRA 4GUCA 1DYZA 4BSVB 2PR9A 3K6NA 3SY0B 4PJBE 6PCYA 4Q9QH 4ODUB 2PTTB 3UGUA 3WKMH 2EDYA 4Y88A 1XGPB 3EOAA 4OJFH 4DF9A 2XQYG 3MRFA 3UBGA 3THMH 1E4KC 2EVIA 3QFJA 3SD5A 4OV5A 4FZEL 2P47B 3LQZA 2P46B 4J3BA 4AI7A 3DK0A 5DI8B 1JGVH 3FT3B 4KGLA 1CQKA 2IAND 3QNYA 4K73A 4YOKA 2GJZA 3ZTEA 1N6VA 1F4XL 4P5KA 3MBXL 1JTPA 1OD7A 5DVPA 5FS5A 1FL5B 1PFOA 1VADB 4L8SC 3O3BB 4LGSB 4N85A 2PXYD 3QYNA 4Y4KC 4KI5C 4HJEA 5T1KD 5E03A 5SWZE 5GGTH 4GIPD 4ZPVA 2AXGA 3C2AL 1BAWA 3L3HA 4LU5L 3QIUD 4U3XA 3BSHA 2OJEB 1DDTA 3GS7A 2H3NB 2F08A 4YIQA 3GSNA 3T71A 4P9MH 4LLDA 3EYOA 2E6JA 5KYYA 1L0PA 1QTSA 3LB6D 3EHBC 5C9JA 3QR1A 3KNBA 5JO5A 1CZ8H 5ADPH 4ZQTA 5D93C 1WAAE 1XF5B 3K4ZA 4LCCC 1SQ2N 3EH4B 1ZGLB 4WO0A 1DLFL 1EFXB 3UPRB 3DV6A 3QAQA 5DC9B 1T89C 1J8RA 3D9AH 4Y4FA 3TO2A 4Z7WB 2X9ZA 3APFA 3RGHA 1PKQB 5FYLH 4WFHE 4JFOB 3IE9A 4AT6A 3MLVH 3GRBA 5IESH 4I87A 3RVWD 5DZPA 4JO3H 4GUQA 1H9DA 1U36A 2P8PA 2XFXB 1UCTA 4AM0Q 4CGUB 1J1OH 1GZQA 2NXYC 3WEXA 3WLBA 3DO4A 4FMVA 3ZT5A 3OAYK 1XZ0B 3DRQB 5KN5A 4X6DB 2R4RL 2VLRD 2Z6FA 3F7VA 1T3FA 1TJMA 3QEQE 4A2GA 1BZ7A 1KTLA 3QNZB 3BLBA 4JK0D 1A1NA 2EILB 4NYLB 1ACCA 1R46A 5LBGA 2D4DA 5MERB 1UA7A 1JWMB 1NMCC 4Q2ZA 5DHYB 3DX9B 4DKTA 1CVRA 1H8NA 2O1AA 5C71A 4H44C 3CIQA 4KDTA 4DGVL 1F11B 4NS0A 5FGBC 3Q48A 4UT6L 2BMKB 4G1MB 1BBDL 2N01B 1MLCA 3BCDA 4JRWA 4X0KA 5K9JH 1ZVSB 3LZOA 1K5NA 3ZT7A 4AL8H 4DGYL 2WWMC 2XA8L 4M6ML 2W8CA 3SDAA 4H7VA 1QLFA 3ERXA 1E4XL 1WC7B 1PW3A 2XXFA 5HDQH 3OX8A 3R8BB 3TBWB 3T4AB 4Y19B 4MA8H 3MGTB 4PGJA 2AXWA 2BC4B 4WV1C 1U58A 5DJ2B 1ETA1 2VXUL 4A2EA 4L4JA 1IM3D 3AQYA 2YGPA 2H5UA 3CLEL 3OM3B 1FO0B 3BAJA 3DSNB 3VDBA 4QOKD 2NR6A 3T2PA 1E2WA 2X4UB 2DN7A 4AITA 2DKSA 3HPJB 1OVZA 4UYQA 1AP2A 3KWXA 4KVNH 4LT7A 1Q1JH 2ARJQ 4RRPA 3FTGA 1BQLL 2PTVA 3V4UH 3V5DB 3DJSA 3VQ2C 5TE4H 4YSQA 1MAKA 1N0XL 5AYUL 4LP8A 3KXFE 2ITDA 1ICTA 3ISYA 4NQSA 3RWEA 2NY4D 2ADJA 4CMMA 1I7ZA 1L9SA 2XVGA 3IMWA 1MELA 5AOIA 4XXCC 3U4BL 1KTDA 1LDPH 1B2WL 2D31B 3KPLA 3MX0A 4A68A 1JFHA 2DEXX 4U0RB 3W2DH 3DDGA 4X7CC 4CNIA 3R4RA 4ZAKB 3QEUA 3ULUF 2DIAA 5E8NB 4FG6D 1BG9A 2FT7A 4QEGA 1K4CB 4GBXB 1N12A 3RKDC 4L4VA 3V6ZB 3MV9B 1H3UA 5IW3A 1E4KA 4HGKC 4TNVK 4KKBC 1KCKA 3WY4A 4YBLB 4PBXA 4PD4K 1OAKL 1PFCA 2CO2A 3LKQA 2H2PD 3TZVC 4PJAA 2A99A 4JGUA 4ZFGH 4QYOB 1M7IA 4MJIE 5FUZL 4GP8B 2VWEE 5CD5D 5EFIB 4HMDA 3ECWA 3FB7A 1UWXK 1WFNA 4L8SA 5TK4A 1XH2A 1IGIH 3OB8A 3ZN6A 1A4CA 1HCFX 3P4MB 5CGYC 4Y4KA 4PRHD 4PB9L 3FT0A 1IL1B 1W0WB 3SYOA 2ENQA 1I7UB 1NLBH 3BDYH 4XBEH 5JOFB 3KPSD 3OXSA 4H8UA 4IOFC 2ZKYA 3TYGH 3UG5A 4L29B 2FX9L 3DXAE 1OIOA 4YDLB 3HI6H 3B2DC 2VDRH 4ZOBA 5EV7A 5A6MA 5J56B 2DEYX 3HZKB 3VW3H 1B4JL 1K9TA 3MMEB 2R69H 3MRLA 4CSTA 3WIHH 4UIMA 1FDLH 4R7VA 1AE6H 2HFEB 4W6YB 2VM4A 5A2LH 3PABB 1P0SE 1KXTA 3ZDZF 5TGBA 1I1AB 4Y9GA 4ALAL 4CBZA 4FFZL 3L5WA 4NRZB 5K1VA 5C92A 4LCCA 4LCWD 2Z91A 2VLJD 1OB1B 4BFKA 1D5BB 5I8EB 5LAPA 1ZJAA 1QQDB 1KCRL 3FF7A 3FU0A 2B4CH 3D5OF 4PJGF 4ABUA 2OZNA 1T89A 4JANB 5DZOA 2NUPA 4NP4L 2NW2A 1JV2A 2KMWA 1EAPB 3IRCA 1NGXA 4H8WL 3HTLX 5K9OA 2FB4H 5E2JA 1JPSL 1HINL 4RBPH 4RZCA 3TV3L 3U2SA 4A37A 4ZNEA 1SXBA 4B60A 2XKNA 3VXMA 3BQUC 3BVDB 4OM1L 3HC3L 4XR8C 4QY8A 5I6LA 3NTCH 3WY1A 1RZKC 1RHFA 3QK0A 2ED9A 3HRZC 4JKLA 3BSZA 3SGDI 4DGIL 4KKAC 1AKJB 3VYOA 4W4OC 4LVEA 2UZYB 3VXOB 3U0TA 3RZCD 3OR7B 4B96A 3GMRA 2G0LA 3DVFA 1L7IL 3WUWA 3ROOB 4XMZA 2HKFL 2B0SH 5E94A 3ZTCC 4DTGH 5FGBA 4PRPB 4HJGA 1BEYH 4QXVA 1MRDH 4J3SA 5ID1A 5LBSL 3WEBA 3VFTB 5F71A 4G43B 2W81C 3JVFC 5C3TA 2COVD 3K2UL 4C56D 1GHFL 5H35A 3DO7B 4AV0A 1KG0A 3EJZC 1GC1H 2VN5A 4WWID 4WV1A 4M6OL 1MKFA 1JRHH 2FX8H 3MA7A 2X0VA 3MLZL 5I71C 3A4EA 4QJ4B 4Z77A 1ACYL 4F7MA 1VEOA 4EEEA 4UQ3B 2A9AA 4K7FA 4DEPC 4WW2F 5F7WC 1DN2A 4UINH 3HBZA 5T1DH 4MGXA 1FVEB 4NQXB 1ADQA 4ZFFA 2YSSB 4NENB 1RSYA 3SOBL 1OGTB 4BFEA 5IHWA 2XRAH 1OQOA 1P4LA 2J8HA 3ZLQC 5SV4A 4H1LH 4ATWA 2BOLA 5D1QB 1NMBL 2YA0A 2O26U 5GRXG 2WKOA 5CZVL 5C0JA 1N59B 3DDFA 2AABH 1ZVYA 4G9DA 1TQCB 5D7SL 2OW7A 3FYIB 1HKLH 4P0DA 4U0QB 3OG4B 4LPCA 3QRLA 3RVVC 3HS0C 3MFGB 4ZUSB 4XNZC 4KZDL 4XXCA 4IMLB 5MHSE 2HPOA 2OPCA 2PCPA 4GRLB 1CS6A 3D0VB 4M3JA 5I24A 4HUVB 4LB8A 3TIDA 2R23A 3M1BB 2ZUSA 3O41B 2QFRA 2FO4A 1W0YT 2BNRD 3OVUB 4G6FD 3F5WA 4N2DA 2O72A 2A5UA 3FUJA 1TEYA 3C60C 3QS3A 5DHDA 3V55A 2XZQL 4APQD 4WI7A 3QPXL 2DQDL 3GIZL 2B1AL 2FNBA 5ECJE 2G5BA 3WI9A 2VR7A 1D3CA 5IZ7A 1SYSA 4P5MA 1ETZB 4AEHH 3ECBB 4H25B 3DVGB 2VW7A 5J11B 2AJUH 1KENH 3N1PC 5KWYC 3CAFA 4MAUH 1ZHNB 1AJ7L 1J86A 1FZKA 5EUOB 5GRZA 3TZVA 2IANB 1KIPA 3FSZA 1Q0XH 5CCKH 2EXWC 3ILEA 2MCPH 3D39D 5FYJD 4HJSA 3V6OC 4HMCA 4L5FH 2PXYB 2NY2B 4HXBL 3ARFD 4X7DC 5T1KB 2J6EH 1U8LA 1RMFL 1T66D 4DP6X 4NNPL 3K5RA 3QIUB 1OZTG 2FDBP 1KJVB 4MD0A 3P77A 4J3UA 2D8KA 3KPOA 5IMLB 1M2VB 5EN2B 3PPEA 1CURA 1GRWA 2R7EA 1SXCA 3H8NA 5FYJL 3KPNA 3P4NA 3DIFA 2BVOA 4X7SL 2YPLD 1TVBA 4G8EB 5DD0H 3AQXA 3CXDL 5EZIH 5F7EH 2PR4L 5EU5A 5I16A 2A74B 2ICES 2EIJB 1DEDA 2P1YA 3FU3A 6TAAA 5E08H 4HH8A 3BCFA 2VLKA 2XWBA 5FV2A 4MJ5A 3O2WH 3BH9B 2W80C 1HHHB 2CE6A 1RKRA 3FO0H 4NO3B 3MBED 12E8H 1RULH 3AU1B 1IAMA 3QH3B 1Z9NA 1KFAH 1PJ9A 2OKMA 4HIJB 3W0WD 5L88H 4IJ3B 4CL7A 2RGSA 4N2NA 4JRXE 2UXVA 3BQUA 2WLKA 4N9GA 2OL3A 4F20A 4NKDA 1BM7A 2ATPB 2R0ZH 2YD2A 3HRZA 3QE5A 4OCRH 1OK8A 1A6TA 2AEPL 5B38B 5FECA 3ASWA 4M7LH 1E8XA 2DV6A 2YJLA 3KGRA 4W4OA 3JUZA 1WF5A 4N0UE 4LVHB 4OLWH 2VLRB 1SXZA 5IVZA 3HI1A 1T22B 5HGAB 2J12B 3A4DA 1IFHL 3D8MA 4FLOA 3B9VA 2YGNA 1FP5A 1MIMH 3BUQA 3OKLA 2O5XL 2C5DC 4I2XA 4N0FB 4RDQF 4Y1AD 4DVBA 3VFOA 4K3DH 2YQBA 3UO1H 5I5MA 3MNMA 3I50H 4KMQA 4KQ0A 1UZGA 1VRSA 2BM3A 3ME0A 4UT7L 5FKPB 2Y36L 3ZTNL 2MSPA 4L1TA 2E4TA 4DO5A 9PCYA 3VE0A 2ATKB 2ZPKL 1KTKE 1Q4NX 2R1WB 3GMOB 1I8MB 1FH5H 2CUIA 4HUKB 5HHVH 3MLUL 1AR2A 5A2BA 4OZIA 5BZXA 3GBMH 2CXGA 1FPTH 4J3OG 2WB7A 5HHXL 3QIBB 1F6AA 4B5ZA 4QHMA 4BUGA 1TZ8A 1BXVA 1XTMA 4K9EH 2YK1L 1UCBL 1QD0A 1IGFL 2VZOA 5FW8A 5B3JF 1VEPA 4JM4H 5KG9B 5TDNA 1NICA 2YGQA 3ZL4H 2EVFA 2QPFA 1HT6A 4I9WE 1IM3B 4FD0A 5DUPL 4HJJL 5AKVA 5GRVL 5BVJB 5BUAA 3B37A 2ICWJ 4QOKB 1CDJA 1DQDH 1KTRL 1MRFH 1RPQA 3I85A 4L8CA 1IIKA 2VISB 1A64A 1ZA3B 2FHCA 3AS2A 1IARB 1P7KB 2IPUK 3EJPA 3N41B 4S1QH 1ZPLA 5DHMC 3BAEL 4GT0A 4BE5A 3WJLC 3HE6C 3R7RA 3ARED 4RSVA 1J5DA 1FN4A 4HDIB 1P6FA 3AMLA 4FQ2H 3EZJB 1WBZA 4YDIH 2X2JA 1X3DA 4DKFL 4ZFOA 1UB5A 1KBPA 3GI9L 1MVUB 1T04A 3LNGA 4EI0A 3AUVA 4XMPL 3RA7H 1ZRUA 5FWQA 4UQAA 1DSFL 3G3LA 2NY4B 2XVBA 3FHQA 1DSWA 4GRWH 2WTRB 4PVBA 3HS0A 1HESA 4Q14A 1HI6A 1E2ZA 3C6SB 1CFMA 5J6GB 1A3RL 1PD6A 3BPNC 5D1XE 1Z0NA 2HMIC 4DZBB 1BAFL 2AZUA 1OANA 3SBPA 3A47A 1P1ZB 4NRYB 2EDDA 4PG2C 1E7VA 4TUOB 4PRID 5FYJU 2E9BA 5HYSB 4GP4B 5CSBA 1YEHL 2AJZB 3C60A 3T65B 3ULUC 1MFBH 1HJCA 3DBSA 4URTB 5D70L 3LIUA 3TONA 4B9CA 3JXAA 5HD8C 5I1EH 3QI9D 4DKEL 4H5SA 3N5AA 3QQ3A 2UZXA 4R26H 3V0GA 2PPFA 4RQQB 3O0RH 5ACZA 3LPOA 4U6YB 3EYSH 5TK2A 4ZX3A 3U2JA 5DJXA 3CG8A 3K6DA 1SVZA 2FEEL 2HUEA 3NJJA 4HJTA 4AGMA 4M3KB 3FQNB 1IV8A 2W0FB 1JHKL 1LILA 5L4JA 4QHPA 3FFCA 4HV8A 1B3JA 4L9LB 3V6OA 1MHEA 3FQ2A 3SKMB 2W07B 5GJTL 2DPKA 4LSQH 3RKPA 3O3AA 5IOPB 2R4SH 3LN9A 4PRHB 4ZS6D 4Q6IC 3FXIC 4GW1B 4Y5YC 1YEDA 3DMMD 4NB7A 3KPSB 3WTVA 2O61A 5ANMA 2FD6L 3LHPH 3OMNB 3CMGA 2GC4C 3L7EA 3QRBA 1JGEA 3Q6FB 4FAAB 3VGAB 5CP7B 2WJ5A 4KUCF 3BX7C 1QASA 2YD3A 5LDUA 1SDAB 2XQYK 3IDNB 1YCSA 1SYVA 4JCMA 3ZMEA 2XQBL 4OZHE 5E6ZA 3QORD 5HVHC 1HEHC 1DUZB 3FB6A 3HA0A 1R1CA 3QUKB 1OSZA 2K4WA 1RIUL 4B9KC 4LCWB 1ASPA 2VLJB 1GGCL 2XXMB 3CD4A 3D33A 4L3AA 5DXWA 4B27A 3ML8A 2BK8A 2DZEA 4TTDD 1IC0A 4JQVC 3T0XA 4Q56A 3QJZA 3I9IA 4K15A 4KKQA 1IQDB 1OAYH 2DQFA 3GUTA 2VJ0A 4WU5B 2R0LL 3S5ZA 2QPUA 4GS7B 4TSBL 2B2XL 4GKNA 4UQIM 1XF3B 1C5BL 2FRGP 1AGEA 4WFFE 3GRWH 3SE3C 2IWKA 1FH2A 5EZLA 3O2DL 2CXKA 3WS3B 4PJEA 4ODXA 3UGXA 5TPWH 1J05B 1YLBB 5F21B 3RZCB 1MCRA 2WC7A 4JG1L 1CL7L 4PRNB 4WTQA 3SKJH 5T3XD 4EDXA 1EZVX 1TLMA 1U8OB 5CHNA 1N5AA 4K4KA 4JMNA 3Q3GA 1R0AL 4G5ZH 3ZR5A 4LOFA 3Q13A 5I8CA 2W9EH 3MXWH 4L0YA 1M7DA 1UM5H 7FABL 4NPJA 3C08L 4KXDA 3E8UH 2JSFA 3QHTC 3FPXA 5ISZA 2I32A 5I5IA 2KLSA 3KW8A 1FL6B 4HIEA 5JLZB 2G5RA 5D8JL 4W6XB 2VDPL 5ESQA 5IGXH 1AD9B 4C56B 4J3XA 2NLJA 3OB0K 4PBVC 4A2MA 1JV5B 3EH5B 1Q38A 3GXTA 3FQWB 3SKNA 5IKCA 1JGLH 3CFKA 1TOXA 4LPYA 3G08A 5GIRA 1M05A 2GJ6D 1Z9SA 2FO8A 3CFMA 1CG9A 1AS7A 4Y4HD 2OQJA 4P2QA 15C8L 1OM3H 5MEPB 1D7FA 3PHQA 2DWDA 3JSSA 1VB9A 4HKJB 5LO7A 4WW2C 4H8PA 4IHOB 3WJLA 3WFBL 4E5XG 2EXYC 2E9WA 4GW4B 4HPYH 4G8GE 1U8JB 4ZUWA 1XGYH 2ADFL 5SWQA 4R90H 4UQBA 3CZNA 4NZTH 5HP5A 4WUKL 3QG6B 1Z9LA 5EDSA 4P5TA 4OKVB 1FZJB 5FO2A 4PJ5E 1DR9A 3ZKXC 3OTTA 1VCBC 3WNKA 4PJHB 3OQ3B 2YD4A 3IDGA 1V8HA 3B8SA 2NXZC 2E7LC 2A77H 3LQAC 3WNOA 5B1AB 2IQ9H 1BZOA 2ED7A 4YPJA 5KW9L 4XAKE 1G4RA 2AJVH 2BINA 4J3OD 5CSZB 3LS4L 3I6KB 4PG2A 2EDRA 7CGTA 3US9A 4G6FB 1M1XB 3QZWA 5IFHH 5EEWA 1YEJL 4ORGB 4APQB 2HFGH 2J4WL 5E4EC 1GZPA 5I8KL 1F2QA 3FSOA 2ZJSH 1SM3L 5DJ6A 1YNTF 1KCUH 4UTAH 1P2CA 4M6AA 2QGBA 1J0ZA 1WYJA 2EEDA 4X4KA 1ZHLA 4DFHA 3FB5B 5C9KA 1J1OL 3WENA 1VGKA 3ZDXF 5FO9B 5CMAA 1XH0A 3F62A 4DN4L 1UFUA 2NNFA 4AEIH 1KGCD 3KLSA 3D39B 3ARBC 3V4VL 3U6RB 1ZGLM 5C07A 1AIFB 3B4NA 4HWUA 4P3CH 5HDBB 4ZD3L 1SZNA 1BOYA 1USQA 3ARFB 4Q6IA 2NRDA 3TYFB 1AYOA 1D7DA 4Y5YA 1UTDA 4KK6C 2PW2B 4OVVA 3WHE0 5FHAH 2UWEF 1LYQA 3GSWB 2QELA 3VAEA 4UQCA 1OP3H 3NJLA 3L9RB 2X1OA 3G9AB 2XPGA 3AT0A 4OGXH 2HVKB 3LKNB 3UX9B 4J28A 4E36A 4UANA 5GS3A 2YPLB 4HUUB 5HHNA 2ZXWB 2ZAGA 1T7VA 4U1GC 1RP8A 1D9KB 5GXBB 4AKPA 1A21A 1LO3H 1YY9C 2I07A 1YMHB 5C6PB 4XC3H 5DS8A 1IO4C 5J6HA 2B9AA 2C9QA 4G9FD 2MJWA 3ARUA 3DV4A 2DLEA 5TDOA 3N0AA 4YSOA 3KW7A 3TN0C 3MBEB 1R75A 5B7FA 5B8CB 4JQVA 2ARWA 3LTVA 4BKLA 2ALWA 3CVHL 3WFDL 2AK4A 3C8KA 2A83A 4PJGA 5BJTA 4LAQL 3W0WB 1M4KA 1N6UA 1R17A 3V6FA 4HFUH 3C5JA 3FUEA 1QHPA 1UB6B 1XGQA 2A6DB 3PNRB 2Q5BA 1BIHA 4M1CC 2L8AA 5CBAA 1VSCA 4U6XA 3FQ4A 3FU5A 4MNGE 4TVSa 3SE3A 1S7QB 2CMRL 1ROCA 2GSMB 2Q6WA 4E41A 4FL4B 1FJ1A 1BG1A 1CTNA 3ZE1E 4NIKB 2WTPA 5I6KA 5HGDA 1RIHH 1SJXA 3GMPB 1QSVA 4FS0A 3WIIL 1TG8A 4ZUTB 3H0TB 3RWDA 3QCVL 4HH9A 4PY8I 2HLFD 4UQ2B 5IMMA 3TH4T 5FHBH 1DBJL 1NJ9A 4G42A 5LAXB 2V5TA 1CF8H 2ZOTA 2DD8H 3HZYB 4IBTA 4XRCA 4KFMA 1AHWA 4LPXA 5JOPE 4FFWC 1I85C 4Z6AT 3CBJB 4PGDB 1VFBA 3FAXA 4S1SH 4JDZB 3NZHH 2EE6A 3TLRA 1E4XI 1HEZB 2IADA 2YD9A 4OCNC 5GS0L 1G9MH 4W81A 3GSNL 2FJHB 2WVVA 3FUMA 3WE1A 4RGNE 2CKBA 3HMXA 4OD2A 5I1KL 4Y4FD 1U8KB 2AAAA 4IBZA 5D72L 1JPEA 2R2HA 3HLKA 4BJLA 3IDIB 3TL5A 1KGXA 2VXTL 3OSKA 4Q52A 2ZYHA 3FKUS 3SPJA 4WW2A 2RJMA 3AREB 3ZZLA 4FQHB 4AUJA 4KOBA 1GY2A 5KS9A 4FQIL 1FBIH 1BQUA 1BF8A 2VSMB 2EO9A 3Q5YA 2QKSA 5E1IA 2ZUTA 2DLTA 4ZOCA 4HJ0C 2CRYA 2ZXGA 4LSVH 4OGQC 3H56A 1IFRA 1NLDL 3HLAB 4KXCA 5C0EA 2GEQA 1KJ2A 4XNUL 1ZT1B 3BPOB 4ZUVA 3CNKA 2E7LA 2RAMA 3TO4C 1FIGL 1YC8A 2CDEA 4HG4K 2DYPA 3DX3A 2CM5A 3OLIA 3NACL 3W9DB 3HNSH 4K7PL 2LAGB 3O9WD 1UXSB 3MLRL 4KHTL 4YEFA 2ERJB 1J1XH 2HLAA 3GNMH 4PRIB 4GSDH 4U49A 2W60A 4H0GA 3SDXE 2OMTA 4HS8H 4PJBA 4IDJL 2CD0A 5JMRA 1CFSA 3HHRB 3SDAD 3SE9L 4I3GA 1T0PB 1R33A 4OCWH 1QI3A 4UM9A 4K5PA 2IJ0C 1KJ3L 2LW3A 4JRYA 1G84A 3QI9B 4UQEA 3EJYD 1UXLA 3T6VA 1M53A 1I4FB 5IIEB 3WXWL 1MH5B 2ZOOA 2ODHA 3DVNB 1T4WA 1WFJA 3MGOA 5FM5M 3IDYC 4C54A 1B0GB 2XZCH 1OXYA 2NR6D 4JY4A 3TOPA 2VWEC 4KXZI 1J9QA 4MQXC 4RWHA 3V8CA 4POYA 2N7BA 2EIMB 1MW3A 3ARBA 3SJVE 4APXB 3H9YA 1ZEAH 4IKKA 3ULAB 3D51A 3PU7A 4C47A 1Q90A 3LY6A 3UDWC 5KVMC 4NKIH 3AS3A 2EZ0D 3DMMB 4JUSA 2YZ1A 5SWZA 5D7JD 5IEHB 43C9B 1IC1A 3G5XA 3PP3K 4JKKA 2QV4A 4HXAL 2P7TA 4F7PB 3MKKA 1DZBA 1K3ZA 3OKKB 4FG4A 1ZS8B 1CVSC 5DFTA 2YQ3A 5I76B 1LWRA 1AVAA 1WITA 3GEWB 4OZHF 5DWPA 3JWNH 2VZSA 2Z7ZA 2IH3B 1RY7B 3KLKA 3FTXA 3WKPA 3ZK0A 4XMLL 3VI4F 3ZE0B 4P2RE 3QORB 1B0WA 2EDLA 4AZ8A 1F3DJ 4JBSA 3K91A 4S1DC 1E4WH 4UOW1 1NAMB 3O6FD 4KKLD 3D4ZA 4OF0A 3VXPA 3B2XA 2E6PA 3L81A 1KY7A 1XR8B 2NNRA 4WKZA 1HK6A 2ZZUT 1UJTA 3KYNB 2IIJA 3ARWA 4FERA 1TTUA 2VN4A 3NP3A 1JGUH 3TN0A 3L48A 3SQOL 5IQMA 4PYGA 2CR6A 2MKLC 2K7PA 1A4JA 3FFDB 1IM9D 1FAKT 1LNUB 2BLFA 2WUBL 4Y5XA 1JYXA 1HL8A 1FFTB 4EXKA 2VDNB 5EOCH 3X1BA 1KB5H 4JHWH 5C0CE 2C3VB 3HNTH 4A7VA 3E2HB 1HHIA 2X4RA 1WAPA 3AWGA 4JN2B 4OFPA 3RQ3A 4TUKH 2CBMA 3L3GA 3G5WA 4AOFA 4DVRH 2I9TB 1YHPA 2Z1KA 4AYFB 5AZEL 2I85A 4OIAA 3FN0L 4JFHE 4L3EE 2VXQH 5IB2B 1TR7A 5A2KH 1OHQA 1WRFA 4N0RA 1JHLL 1ZXQA 4TRPH 5I73B 5CAYB 2WWOA 4D9QD 4JM0A 4F57L 2V4LA 4AMWA 3QA3B 3PLYA 5L4IA 3KPQA 1I85A 1OCCB 1UT2A 5JPMC 4X5XB 1WEJH 4EI5C 1G87A 3PWPB 3VXNA 1KYFA 3VFPA 5GRWA 4LO9A 1M56B 2X4TA 4V1DD 3KPMA 4GRWF 1CO1A 5B1CA 1TVHB 1X5YA 3U9UB 3U6XS 5C0BE 3BZ4A 1OE3A 1R3KA 4YDVB 1W8OA 3WXVL 5HVWA 5DRNB 3GSVB 3SYPA 2C4FT 2GJ6B 1QW9A 4Y4HB 4QF1A 5J6SA 1WZAA 3LZNA 4AIEA 5A2FA 3ZHLA 3BUBA 4AQAA 1FRGL 7TAAA 4YHPA 3S3DB 2OX5A 3PWVA 1N8ZB 4YHOH 2P43B 2B3IA 4PP1C 3W38A 4I1PA 1GGIL 5KYUB 3FONB 4C4KO 4KO7A 3QJHB 1RAMA 3KXFA 2QLVB 3L3JB 2E8YA 5E1GA 4JHVA 2BHYA 3IVKB 3V4PH 3QO0A 4HLZH 4IK6A 4CMHC 2OXHB 1CFNB 3IJHA 2WBJB 4N1CA 2IAMC 4FG2A 4YXKH 1II4E 2D7PA 2RFXB 3TO4A 2MOQA 2F58L 1D5IH 3P3SA 2A38A 5JYMA 3BSZL 4HCRA 1ZVNA 1R3IL 3H1ZA 3LZFH 5FYKD 2VSCA 1N9PA 3QEGL 3E38A 4DW2H 1U8IA 3JZYA 2BSCA 3X3GL 2AVGA 1SFHA 5CU9A 3HB3C 1WFUA 2YA2A 3GXIA 4TOYH 3T4YB 3RWJB 1F4YL 1S3KH 1HYRC 4NPYB 1U8HB 4G1EA 1EXHA 1NCDL 4UTBH 5TTRA 4MWFA 4WZ9A 1EGJH 3FU6A 1M1SA 1MNNA 5D1ZC 1NAKL 4ZQKA 4Q9CA 2XWJA 1BQSA 2FEDD 4CRPA 4LCUB 1YO4A 4HIIA 4MJIA 1LEKB 5DC0A 2P8MA 2ZUWA 2XZAL 2CQVA 1QACA 4QRBA 2FT6A 3IAPA 4WI8A 4X9IA 3FRUB 2F15A 5I18L 3IDUA 1I3RB 4GAJL 2WNGA 1IUZA 3LVTA 4MZ3A 3UDWA 3AT9A 2D7TH 5ACMA 4JL2A 4JFXA 1MWAH 2FR4B 3QEHA 4LMQI 3GGWA 5I1HH 3DXAA 3RL1A 3GM8A 3MQIA 1PKQE 2DM3A 1ADQL 1XH3B 3GBML 1MCBA 1BLNB 1U8PB 4YXHL 4YSAA 5KVEH 1YAIA 1E6OH 2FBJL 4PV1C 5AVYB 1FFNA 3FTYA 2A7BA 1DFXA 2ZSWB 2EH7H 5DS1A 3ULVD 1JGDB 2AQNA 1O7DE 3MODL 5IQ7H 1DBML 4G7VH 4H0LC 3B9EA 3R0MA 1E27A 2WNWA 2Y2WA 3QQ4A 4G9FB 4W9IC 3VG0L 4A7QA 2APWA 4GO9A 4ZX5A 2XXCB 2ZCHL 4KZEL 1S9YA 4ODVH 3GLZA 5T5FA 1N7MH 4CN1A 1HX0A 3GTNA 1OF2B 2JE8A 5KBDA 5KVFE 3NG5A 3SCMC 2CGRL 4G6KH 3TEZA 4KJYB 1I53A 1A9EA 3MOBH 4PJXF 5C8JB 3S34L 3QBTB 3FQUA 1RURH 3CSGA 1QA9A 2VDQL 3KPTA 4P3DB 2B08A 1PG7H 1WDAA 4L48A 3K6SB 3PXJA 5FF6B 3G6AA 1FORH 3LDBC 4HMEA 5B4MD 4XVSL 5DVKA 3IDMA 4Y19E 1NSNH 1SEBB 4OJEH 5CEZE 2VH5L 3P9LA 2PW1B 3II2A 3U48A 3IJSA 3HE7D 3SGKC 2Y3NA 1LO4H 1G6RA 3ZIMA 2E86A 5ETUB 3VWKD 4OCXL 3D0LB 3QIWC 5BO0D 3EFDL 3PJLA 4FNLH 2GBVA 3EUUA 4TVPH 4A38A 2WXQA 3P3YA 2W88A 2MQGA 1ML0A 5JPMA 2IPTH 5DRWA 1PCSA 3V4LA 4F7EA 1EDYA 1F86A 4D2NA 4E9TA 3IGAA 1QP1A 4MVBD 5FOBB 1YN7A 4J6RL 1MCQA 3STLA 4ZW3A 4W6WB 2GTQA 1W72H 3DV6B 5JR1L 3PUUA 1HWWA 2YD5A 3QCTL 4Y4FB 2X7LA 4F1SA 2NZ9C 3AT8A 3U46B 2W9DH 2ICEA 2KZWA 4R4NC 2FVNA 4HUWA 4RAUB 3MHZA 4UBDC 1F4WL 5L0QB 3QWRA 4Z95H 3HG4A 4NKOA 5FYKU 1LE5B 3K2IA 2P8PB 4MYWB 3VNZA 1RUAH 2F1AA 1JBJA 1IAIM 4WHYG 3WLBB 2BY1A 4NNYB 4BA0A 3FO2A 1QFWL 2P48B 4OCMC 4E42B 4LLQB 4WU7B 5C70A 4M5TA 3MV9E 3L5JA 4AXWB 2RHEA 4D3CH 5DJDB 3ZKND 5G4OA 3KEDA 2WLYA 2OYLA 3MJ9A 1KDIA 5TDPB 2IOOA 1KEML 4I1NB 4OQTA 1IZJA 5D1XC 1KV3A 2IAMA 2OL3L 3SDCC 3ZBMA 3ROLB 4MD5B 3SDXF 1DVFD 1NM9A 1V54B 1RZKL 4BK8A 3O9WB 2J73A 4Q9RL 4PJ6A 1R3HA 1CFQB 4I0PC 2GG1A 5I6OA 1CE6B 3ZSSA 2YS4A 4OZFG 5DLMH 2DQ6A 4YDZA 1B90A 1MY7A 1R5VA 4PJIB 2PMZA 4H88L 5I17B 3ASNB 4HWEL 2DF3A 4KNUA 1F90H 1E8YA 4YSPA 3SDDC 4P9HH 4YHNB 3OJ2C 3H4FA 1U58B 3MLWH 5D1ZA 1AQKL 3I6SA 3W37A 1EO7A 3TFKD 3IS0X 2PCFA 4TNFA 4U1SB 1IKFL 3QUXC 3S5LB 5KSUA 4J4PD 2FEEI 2AXFB 3P30H 1DEEA 2GW5A 4K8RD 2OMXA 1A7RH 5KYWB 1EVUA 1QFUH 1VDGA 2R9HD 3P54A 1BOGA 1AHKA 3VFRB 3U25A 4HJ1A 1UOVA 1DSYA 2E7DA 2Q7YA 1NGQH 3HZ3A 2YAFA 4FJYA 2DQCH 5EBWB 2BSTB 3LAFA 5BRZD 5AYTA 5D7JB 3UTTB 2IDCA 3OAUH 2BXYA 2ZWLT 4NQSB 4BHUI 5E6YA 3V5KA 4TUJB 1I7ZB 5IGXL 4Z3JA 1Y1DA 1JYWA 2UWEA 3HPLB 4JS7A 3F7YB 3HZMB 3KJ6H 2EIZA 3MX0B 3MUUA 3J7HA 5BO1L 5F9OH 4QRRD 4ZFOL 3PAUA 1DJHA 4LCVA 1JHTA 2N7AA 1JGLL 3O6FB 1PZBA 1ZDQA 3CTTA 4TYUA 5CXPA 4FTDA 4UMGA 5ELIA 5I1GH 4BQBA 4WHTA 4KKNA 4N6RA 3C60D 1F58H 5ACLA 1BZDA 4M03A 4WK2B 1CICD 4A7TA 3MJ8A 4N5UA 1OSPL 3BP7A 1FNHA 1WHPA 2A3TA 3D18B 4QD2E 3SCMA 4PAZA 3EGDA 1A4KB 2X89A 2YAMA 3AS0A 5EF0A 1IM9B 1CTMA 2IC2A 4HPYL 2BRRL 2CU9A 3REWA 4PRPE 2GSGA 1J18A 3LIZH 4ZS7H 4JRXA 2Z0UA 3HHSA 3P1VA 5GGUA 4LSPH 1WV7T 4X5RA 2EXWD 3MXVL 3RFZB 1OP5K 2WTOA 5C6TH 1DUYB 1L6XA 3FFCD 2EDTA 2YARA 1Z3GL 4BM7A 4BUHA 1CL7I 2OMWA 4N0UA 2X3AA 3K0YA 2VDLH 2ADIA 2X4NA 4NKMA 4AMKL 1XGTA 2VZTA 1WBXB 5E1AA 2BP0B 3OXSB 2RQ8A 2FGWH 3I6GB 3SGKA 4F8OA 3DBXA 3BZEA 1KBVA 5INCB 2HJFA 2WQAA 3QIWA 3A23A 2ROXA 4QRUB 4DZ8A 1E4HA 3CFJA 3CFCH 3FO9B 4ONOA 5CP3H 5D1QE 2JB6B 4WNJA 1JK8B 2DKUA 4LIQL 3L5XH 5DUBB 3DOIA 4RMVA 3I84A 4NI3A 2WQRA 2Z7UA 3UBFA 4V1DB 5MENA 1A3LH 3QR2A 4KUZL 3VXTA 1KXHA 2PO6C 4IRJC 4Q74A 4MMZC 5EU6D 4PTUB 1JV2B 4NXKA 3OXRA 3MV01 3GDCA 3WUZA 5HHQA 2DQMA 3CH8A 1TCMA 3UJJL 3OJDA 1P4BL 5JUEL 4B9PA 1R3JB 3T8XA 3F85A 4N8CH 4I0CC 2WVUA 2CALA 4R7NB 2X4QA 1QBLL 3AG3B 5FDWB 4PJCB 4OZ4B 4FQCH 3C75A 1HOCA 4LQ1A 3WV0A 1AXSB 4P46C 1W8EA 4TQHA 4PV8A 3HR5B 2VABA 2R0WL 1KN2L 3HBQA 1T5WA 5EUOE 4F58H 2J72A 2IANE 4X6CB 1MFDH 5D1XA 4TTGA 3SDCA 5DRXA 1E28B 2NY1B 4JB9H 4FP8H 4KDVA 2Z92B 1D6VH 3IKCB 4I0PA 3IJ9A 2DRUA 1U21A 3QG7H 4XN2A 5ISZD 3FBQA 1QLRB 3IXTA 1ZOXA 5IY5B 2WXMA 2WM0A 2L0DA 1XCWA 4NHCL 5EN3A 1IGMH 1IKNC 1Q72L 1Q9KA 1QSED 4PUBH 3TJEL 3MUY1 4Z7QB 2V2TA 3D2TA 5T3ZL 4CC1A 5DRZA 3SDDA 4JZNA 3ZVVA 5E8OA 3CN2A 3KCPA 4R4FL 3NJVA 3QDMD 4B7IA 3C5ZA 3DX7A 1KCSH 3Q6GH 3B2UC 3AW5A 3TIEA 4AYID 1INQA 3A67H 1E67A 1S7SB 1DO5A 4KJQC 1C5DB 5GSVA 2A6JA 4Z7NB 4HC1A 3VG9B 4JFTA 5BS0D 3U1QA 5JW4R 5C0JB 3OPZL 3WFEL 5JHBA 1RIVH 2XKSA 1ZVHA 2XWRA 4LL4A 4U3CA 2Q8BH 4A7UA 4P5TD 1J88A 3B3IB 2HWZL 3OKYA 1FNSH 4XXDA 2DEWX 2K45A 3BAYA 4G6AC 4JO4H 5GZOD 5HY9B 4HS3B 4YL4A 3RGVC 4AJYV 1S4IA 4POZC 1Q8MA 1ADWA 3KYAA 3OF6D 1G9NH 4OZHA 3BUPA 4L37A 2Z65C 3NIFF 3A6CL 3OHXC 4TVUA 4ERSH 3VI4A 4L05A 2ZXAA 2VLRE 1WIUA 3DARA 1UH4A 3H54A 3ZPDA 3BAXA 3OJMB 5AWNL 3A4FA 3NCYP 4CSSA 1FNGB 3T77B 4X4ME 4G8IA 3B7YA 5F6IB 1I1FA 2BX5A 3H3PL 3SPVA 1DQTA 1FZKB 4UWQB 4AQ1A 3S37L 1FZOB 3MLTA 3N50A 3RVXC 3FSWA 3RNKA 1N6QL 5G5DB 4X7TB 4JFFD 4R96A 4LRNH 3K0WA 3HAEA 2F18A 3LKSA 3UG3A 3ULUL 5LN4A 3MV8D 1T7ZA 5C07D 5BV7B 1URLA 1K8DB 1MJ7H 3P0YL 3CZFA 4LQFH 1OWWA 1SJEA 3STZB 4ZMLA 3J27A 5AB2A 2QVTA 1U8LB 2IFFL 4OV6F 1N68A 3BXNA 1I9IH 2AJ3A 2OR9H 4XMVA 3P69A 3HE7B 4AKOA 3A3YB 4MXWH 4URKA 4QOKE 1RZ8B 1DANT 3MR9B 3VWKB 2AGJH 4YGVB 3WMSA 3KPNB 2BVOB 4NO0D 1JIBA 4PIBA 5DFAA 5DD5L 4YN3A 1VFAB 3DRTA 3I3BA 3KYMB 4KTDH 5L4FA 1INEH 1MJJB 3FT1A 5K39B 1EX0A 3HC0B 2GHZA 2N1KA 1NGPL 3OB0H 4TQIA 1ZLSL 5GGQL 2W1NA 3VRJA 3NIGF 4IKJA 4PCYA 2H4EA 5K9QI 1JXGA 3SOTA 2PO6A 4IRJA 4M93B 4RGNC 5DF0A 4FFYA 3ARZA 4HETA 2MCMA 2WUCH 3NK3A 4MMZA 2J5LC 3VSVA 5SX5K 2HG0A 3J07A 4XVOA 1QNIA 2H1PL 1NBVL 5DEGB 1BMZA 4LLWB 4YFLI 3B5HA 2ZWSA 4WWKC 1HE8A 1DBBL 2JKXA 2I9LA 3M86A 1R5IA 3BIAX 2ZE0A 3RPIB 5JORB 5BZDA 2CK0L 1DDHB 1IBYA 3IJEA 2YXMA 4HZ1A 4E9LA 1KFGA 3M46A 2YPVH 1IGYA 3JQOB 4G8GA 1P4IH 3EXJA 3ISRA 2YEVB 4J8QA 4P46A 3NJGA 4R84A 5I0WA 1E42A 1EMTL 1JK9A 1UA3A 2FZ3A 3PDGA 4ZTPH 2VTFA 4LOEA 1UXWB 2C1OB 3OZ9L 4HZLB <