2X28A

Cadmium bound structure of sporosag
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
235
structure length
219
Chain Sequence
TSCETEGSSISFTVEKAGHVVRFNCPSTLEEIKPAYEAGDSTKVCTTADCSNEAALKDVLKSASLAQAEGSSGGNDFTLTVDALPEAETSVFFLCQRTGADKCGVHILVKAAPQAPVCSAQDHTLELQITAANSDTSFVCGGTFNVIKPANAAKVLQDSCETEVDLVSLVPHASRSALEQSGLIKLSVTDLPQQQQKLCYRCEDSSQKACKVLVTVSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of Sporosag: A Sag2 Related Surface Antigen from Toxoplasma Gondii.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Membrane protein
molecule keywords SPOROZOITE-SPECIFIC SAG PROTEIN
total genus 47
structure length 219
sequence length 235
ec nomenclature
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04092 SAG SRS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1320 Mainly Beta Sandwich Immunoglobulin-like SRS domain 2x28A01
2.60.40.1320 Mainly Beta Sandwich Immunoglobulin-like SRS domain 2x28A02
2JKSA 2X28A 1YNTF 1KZQA 2WNKA
chains in the Genus database with same CATH superfamily
1HXYB 1IILE 5DK0B 1QLEL 3MYZA 3QARA 5K9QG 3P4NA 3BQVA 3QXVA 3SDDA 5JHAA 1T6BX 5F9OL 1WQVT 2VDPB 2OMUA 2ZOLA 3U1SH 12E8H 2WB1A 4CGTA 4ZMXA 1NCTA 1QFUH 2D7TH 3NGBC 3D09A 5B4MD 3QDAA 4B27A 3VXRE 1NBQA 3JWDL 1W0WB 4D9QD 1WPCA 1CFSA 2YPKB 3UPRB 4JANB 4M7JL 4JG5A 4Q14A 3FN0L 4PMEA 2APVA 4TUOB 5KS9E 1HE8A 3BHBA 1A7OH 1GJIA 1S7XB 2VR4A 1I4FA 3MFGB 4P2CG 1D5MB 4KV5F 3NCXA 3TXAA 4I4WB 5GRWA 1SXNA 3MODL 3RPKA 4J1UA 2QPSA 1WAEA 2WOBA 4KNQA 1TQSA 3QDMB 1CR9H 3B9VA 3AY4C 2DQMA 1R19A 4U1GC 2M1KA 3ALWA 4J3UA 3PDGA 2VXSL 3QRGH 4QF1B 4LASH 1IO4C 4JUSA 4PJCF 2XSKA 4OTXH 1DSFH 4P2RD 1INQB 1O7SA 2IQAA 5D7JD 3AAZB 5HI5C 3R19A 3QDME 4Q89A 3ETSA 1E6OH 5KYUB 5GRVL 3GK8H 2GTWA 3H3KA 4NXKA 4TMPA 5F9JB 3D3VA 2ZKMX 4WWKB 3EYFA 3GBEA 4P4KA 1S5IL 1C8QA 4FQHA 2VKWA 2OZNA 1B2YA 3GMPA 2X2UA 4U1IB 4TQEH 3COOA 3BAJA 3O2VL 4HG4K 1S9WA 3LRGA 5ADPH 1KXQE 1UZ8B 4GAAA 5FDWA 1T2JA 4B9ZA 5EU7C 4OGYH 1U8CB 4FQ2H 1F4WH 2EE0A 2I5YL 1TT6A 1TZGH 3BT2H 3T0AA 5KYWB 1HWHB 3V52L 1TIUA 4FX5A 4PHZA 4QWWC 1KULA 4JL2A 1INEL 1KB5L 1P5UC 4IBTA 4B53A 3BH9A 1WH0A 2D31A 3NEXA 4XBPA 1AG6A 2DRUA 4D94A 2NW2A 2ICWB 4M1GH 4FTVA 2VL5A 3IEAA 3HC0B 2QQKL 4JDZB 1WZMA 3B5TA 4JY6A 3TIEA 3MUY1 3H7LA 2VDOL 2W9EH 3MRRA 2AQ1A 2KUTA 4PRAB 1IQDB 4FXKB 1AO7A 2EH7H 5ACZA 3VXQB 2R2BB 4FL4B 3H1ZA 3F6JA 4NQED 4PGEB 5KSAA 4GUQA 3GINA 2VAJA 3M17B 1A5FL 5CLWA 2GI0A 2DN7A 5HJ3A 1YY8A 1S6NA 2ZOKB 1X5AA 1JDAA 1UM4H 4S1RH 4A2LA 1W72B 2DWXA 4GW4B 3PV6B 4N2IA 1IEBA 1NBZA 4HHAA 4OZIA 4P59L 3P0VL 3UDWA 5LKNA 2IWEA 1JHLL 1E8ZA 1ZSDA 3EKCA 1MFCH 4MD0B 1P0SE 1U92B 2QHRL 1U3HA 3T3MF 4NC0B 2DW5A 3ESUF 3WLWD 1QEWA 2P44B 5D70H 4EDXB 3NA9H 4Q97A 2LAGB 2BNRB 3GO1L 4KNTA 3A3YB 4OLYH 4JO1H 3NFSL 4D0DA 1MCRA 4LKXA 1CGSH 1AS6A 4N0UE 1LK3L 4NN7B 2UXGA 5HPMB 1DJSA 5H2BA 2L4OA 5HJBA 2NSQA 2K0RA 4NHCL 3SOBH 2P4AB 2XV2A 3K2UL 4RGNB 3DIDA 3D1MC 4DAGH 1GCYA 1SJVA 3T8XB 4JLRB 2OSLA 3ZDYB 5JPMC 2X3AA 5DGQA 1IGCH 5DEZA 3P2DA 1XH1A 3T77B 1ONQA 1SEBA 1ET8A 1CXEA 3MLTA 1EWHA 5CR8A 2B1HH 2ZP0T 3VG9B 1U92A 1I8KB 3L5JA 5E8PB 3NIFF 3FO2A 5EZLB 1OSEA 4P07A 5IMOB 3RTQA 2EDJA 3GSVA 3FB6B 2ZAGA 4KI5D 1IKFH 4RFNC 2E3VA 4F20A 5IB3B 1D5ZB 2XQYG 1A65A 5DUBA 3BMVA 2YO3A 3NJIA 4QHLB 2IH1B 4LXFA 1BP3B 1E28A 5CZRA 4C57C 3VUAA 4DN3H 2EO1A 1YEFL 1F58L 2DQUL 2JKRM 5I8CB 3WY3A 5K39A 2LABA 3ECWA 2WZPA 2IBZY 3H42H 4QT5B 2ZCKL 2O5ZH 1BIIA 1IGFL 1VERA 2ZOOA 4ZZKA 3SDAA 4FFVC 4G42B 4JDZA 4Y19D 4DQAA 1T7ZA 3G6AA 4FYTA 3PY9A 2BZCA 2FLMA 1WWAX 2YQ2A 5IB5A 4JM0A 2XWXA 4MMXB 1VIWA 5JXEC 1H0DA 4XBPB 2QPFA 4L4TE 4WWKD 5CM1A 1BD2A 2OR9H 4UINL 4TVPH 2BOCA 4XN2A 3F58L 1SF3A 4YHKL 4PJ8B 4FA8A 3BW9B 3OMNB 2P8MA 2Z93B 1JXDA 3K74B 5D6DA 1HYSC 3S5LB 3WHE0 5IROD 3AM8C 3H9SB 3QUXA 3Q8AA 2G9HB 4NQXB 5ISZB 4X4ME 5J9PB 3KE0A 3IFOB 4ALAH 3O9WB 4P2OB 3OMAB 5KSUA 1CVRA 4AEHH 4RAUA 3A4FA 3D8MA 5IT2L 2KI6A 5FGBC 4OFDA 1PSKL 4WWKA 3DV4A 5LHDA 3N1MC 2FJGA 2IQAB 2XZZA 3MOBH 1R24A 1YECL 4EN3D 3I9GL 1F90L 2JB6A 2JKLA 3D69B 3IYLW 4AGLA 3VFRB 4BEIA 5I30L 4NXSA 3K5RA 1DUYB 4LSSL 4XNBA 4JFHD 1P4BH 4BBWA 4HV8A 4X7DC 4X6DA 3GMMB 1XGTB 2MIZA 3NZ8B 4L4VA 1WICA 3ZE0B 4HUMB 4K3DH 1N59B 3DX9B 4M6NL 5ENWB 5IESL 4N0CC 3PWVA 3QFDB 5KBKA 4OLEA 4PLOB 4AIZB 3V6ZA 3RTQD 3FO0H 4XCYA 2ZZUT 5CFAA 3T1FB 3II1A 1I82A 2V8LA 1FG2A 4NUJB 1X7SA 3I9GH 4R7NB 5DJ6A 3TIDB 5EUOB 2RCSL 4CC4C 4KVNH 4WK2B 4BXSV 4GG6A 2CO6A 2VZVA 4U1MA 1OF2A 1Q9WB 1D5IH 5CP7A 4IBUA 3GRWL 2XPYA 5FOBB 4U1KA 1NCJA 3DVIA 4N2AA 3K0WA 4RESB 2ATPA 1PYWA 4UQAA 4CVWA 5FV1L 2ATAA 2E7DA 2RFXA 1YEIL 3MLWL 5C70A 5EDXA 1MFAH 3RTLA 4K94L 3N41F 3IN2A 3P2BA 4PJXF 4DGIL 3SGKC 5ICYA 5DCCA 5I82A 5BRZA 1MI5E 2A6IB 4K94H 4YE4H 3KGUA 4LSTL 4GS7C 4M03A 5IW3A 2GBVA 1H3GA 1X4XA 4ANVA 3H0TA 4JFPB 3SDDC 3QDGE 4Y19A 1C08A 3VYPA 3D39E 3TBWB 4LCCA 1HKLL 1T1XB 1F1DA 3PJLA 4NRZA 5E8OA 1ADWA 2Y1VA 2NY2C 4GO8A 2UVFA 2GITA 4P06A 3TVMB 4JQXC 4EMZA 3CVIH 4NZRL 3QEGL 4N8VB 5EC2A 4IRZL 3Q01A 3UBFA 3BPOB 4R0LB 1KCWA 4P5RA 1THCA 5JO5A 3PS6A 4I48B 2YUVA 4HJGA 4KK9D 2FBJL 5DJ2B 5IOPB 4BCYA 5F7LB 1Q9OA 2HFFA 5DJZA 2ARJB 3X14A 4KK6D 3V8CA 4GG6F 1UD6A 3UZEA 4JPWH 2VITA 3DSNA 3HG1E 4YO0B 2Q8BH 3ZDZB 2J5LC 4AK2A 4XP4L 5BRPA 4JRYE 2EUVA 4S1SH 3MR9A 3NT0A 5EV7A 5EOCJ 3W1ZA 1AZRA 3GJFK 4LSUL 1RPUA 5IMLA 1VSCA 2DLEA 4PGBB 3MLVH 3KPSA 1Y0LB 2GY7B 4TQHA 1K3IA 1ZLVH 1UXWB 3QEQD 1NKGA 1XSKA 3I6GA 5CD3B 3VRIA 3OX8B 4QRPB 4FABH 5L2KE 2GEEA 1E7VA 2PO6C 1SYSB 2E9BA 2Y07L 2X40A 2MNUA 2VYRE 4OM0L 2VDQB 3CLEH 4RNRB 1A0QL 3O41A 1BZ8A 3OHXA 1XF5A 4PWJA 1LP9B 1N2RA 4YNYB 5EEZA 2PR4L 4OFYA 4MJID 4NAQA 4LRNH 4P2OC 3IJHA 1OK0A 1WFTA 5C0JA 1RIUL 1IZKA 3D0VB 4PG9A 1CU4H 2YEZB 1U3HD 1RZJH 4ZMNA 4KQ3L 5JHLA 4N6RA 4MCZA 4U1SA 5B8CC 1Q0YL 4QRRE 2IGLA 1PJWA 1NCNA 3QNZB 2BIPA 3OKEB 4HLZG 5F88A 1IGML 1DR9A 3HUJF 2XXMB 4S1DC 2ZG1A 2VQ1A 2DQ6A 4ZUSB 1NDTA 1ML0A 2XDHA 3LKSB 2F8OA 5K59E 4I2XE 5CP3H 2HFEA 2A1WL 1U95B 4O4YH 3IGKA 3SBRA 3NIGB 1MXDA 4XNQB 4LBAA 3SPVA 4FTVD 3V6FA 5FHAL 8PAZA 3DIVA 3GXFA 4JHWH 5AG9A 1QRNB 3BWZA 4GG8A 3MCG1 2V5SA 4PW3A 3B4NA 1HOCB 3P4OB 3G08B 2A99A 4RGOL 3NCJL 5CEYB 1D5XB 2F7OA 4YDMA 1IKFL 3ELQA 5HPOA 5L4FA 3RVVD 5JHLL 1F4YL 4EZMA 2DQCH 1ASQA 2JLPA 1HH6A 3VD7A 2V2TB 2DDQL 1VFAA 2BWIA 1O9VA 3CC5B 2Y2TA 3QNZA 1J5HA 4FFYA 3TX4A 5FPIA 1L0PA 5BO1H 1DVYA 4FQ2L 5DMIH 3HR6A 3HI5H 2D0HA 2WLJA 2CNYA 5HXMA 1DQQB 4AJYV 4FNLH 1I3RB 4NKOA 4OKDA 1L9NA 3U9PH 5C09D 4PJIA 4WJ5B 3KEHA 1QKZL 4P4RA 4TUUA 5AYTA 1GGBH 3CN1A 4JFXA 2VR3A 2DICA 5E2WH 4OGAC 3TGXA 43CAB 1FL6A 4X4MA 5LBSL 1LK3H 4JFUA 5IBTL 4M3HA 4KZCA 5I6XB 2FAUA 4KUZH 1RIHH 3WEXB 3SPJA 4KUCF 3QH3B 1TEFA 3C6LB 3VFWA 3HHMA 2V2XA 5GISH 4M7LH 4CMHB 3OF6D 1F4XH 3N1PC 4KO5A 4KI5E 3RJDA 1FFOB 3S96A 2D3LA 3VXSE 3UABA 5D2NE 5IW6A 1HQ4B 4JPIA 2XWZA 2YGQA 5FO2A 3UAJC 4R97C 2HTKC 4XNZC 4Z7QF 2EVIA 3DVNB 1LO3H 4X6BA 3UROR 4PJXB 5HI5D 4YIQA 3RFZC 5E9DD 5JPNB 4Y5YB 2DYSB 4OJFL 4GI6A 4MRBA 5T3XE 5F6IC 2HH0L 1TVHA 2EDRA 1SM3L 4F8TA 5IJKC 1SPDA 1X9QA 3BIBX 4KRLB 1EDHA 5LGJA 3W57A 2LAAA 3JT0A 1ZK5A 2KQMA 3N5AA 3UPCA 5EU6D 1AKPA 2KH2B 2R69H 5TF0A 5ID0A 4Y19E 1WSST 3DBSA 4L9DA 4DJMA 4Y16B 4LSPL 3N1FC 3S35X 2H47C 4YEEA 5F7BA 1J12A 2OV0A 4B5EA 3TJHC 4P2QB 1LO3L 2NMSA 2H9GA 4DK6A 3CHRA 2R8SH 5I9QB 4JDEA 4QJ5B 1MZZA 1GJWA 4G72B 3RQ3A 3AQZA 2EDFA 2WINB 5EO0B 5C08B 3SDAD 2BW4A 4BD4A 4ZMYA 5GRVK 2TSBA 3MNWB 4BRJA 1QD0A 4Z7WF 2I85A 5AYUH 4KGLA 2YPLB 5C0NC 4WHTA 5AW8B 1C5BL 2RFXB 3WE6A 2Z7YA 2Y5EA 3H53A 1CIUA 3DHPA 2FHCA 3LH8A 3UYPB 1DFXA 1VCBC 3C60D 4U3CA 1HHKB 4F37F 3NABL 3QIBC 3MRPA 3L4TA 4Z7QE 2JQAA 1JF6A 1HYSD 1XD0A 3FNKA 3ZX1A 3CSFA 2FSEA 4LASL 3T4AC 3MRNB 3IKCA 2YBGA 5KS9F 2V2TA 3JVGA 1CFNA 4BINA 1LDSA 1N12A 1IBBA 2MQ0A 2FQDA 1R9FA 1ZE3C 4KK9C 5I17A 1MFBH 1QSFE 3LS4H 1RK0A 5ANMB 4UZUA 2P46B 5IMMB 2CO4A 3BP5B 5AVXB 3MOAL 3LJ3A 1F2XK 4HJEA 4JG9A 4LQFH 5K1VA 1XCQA 3LKRB 4KVCH 4FFZH 2A74C 1BHGA 1A8ZA 3D39A 4X6DB 5CO1A 5J7CC 1D9KA 1KPUB 2AMUA 3ZW3A 3QEQE 1U8KA 2JCCA 1G5GA 1X5LA 3WD5L 4K3GA 1EJFA 3ABGA 4HAGA 2VLKD 1CZ8L 1QFUL 2VN7A 1IKOP 2C3VA 3OB0K 1C5DB 1I1CA 4H1LG 2X4NB 4KX7A 5D1ZI 4XP6H 1U8NA 2KBGA 3ARED 2XLLA 3N43B 3WTSA 1KN4L 4F7KA 2LR4A 3NG5A 3D34A 3LQZA 1QG3A 4NNPH 1PZ5B 4FS0A 4MAUH 5ISZA 3HG3A 2N3JA 1FL3A 5E5LA 3H9SA 1NC2B 1FNHA 2XJKA 4RA3A 1E65A 2FHBA 1JK9B 3QQ9C 5DWUL 2VXQH 4KRMB 4XP5H 1J8KA 3D33A 3QDJB 2VDKH 3RBSA 4D0CB 2RD0A 4OD1L 3OHXB 5MEOB 2Q7AA 4RNRA 2VLJA 1YEEL 5HHOB 3QUHA 1BPLB 4S2SB 3CZFA 5F89A 2CSPA 5INDA 1LE5B 3WTYA 1A7NL 1U91B 2JXMA 5AD0B 2WO3B 3WXWH 3STZB 2XIIA 2OQJB 3HZ3A 1JS4A 4G6FD 4PRHD 1LK2B 1BFVH 1AXSA 2UYLA 2JCWA 1X5GA 5K39B 3GQFA 3WIHA 2FWOA 5IVXF 1E3ZA 1XV8A 1BVLB 4UIMA 1ZLSL 3T1WA 4U1JA 1JZ6A 3IDMA 1TF4A 4HF5H 2NSXA 3NACH 4KNUA 2CLRB 1DQJB 1IFGA 3CQPA 1D5ZA 1THAA 3DO4A 2P24B 5E0FA 4UTBL 3GSVB 3ME0B 3GHEL 4EI5A 3OWEA 1UXSB 4EN3C 2VCOA 5IOPA 4PB9L 1ORQA 3OKKA 2CBOA 4NWUH 1F97A 1QATA 3TA3D 3MLVL 4JCWA 1ULVA 1LE9B 4DO6A 1MCPH 1KCUH 3EADA 5DRNB 2ZUSA 1F0LA 2V17H 4OAWB 4QLRA 1FZMB 5I6XC 1AQDB 1ECYA 4LSQH 4UAOC 5ALBH 4ODBD 3WBDA 3VVVA 2B1AH 3VRLF 3PDDA 2IV9A 1T2QH 1WUZA 1NIAA 4PB0L 2NY4C 5EOTA 2E74C 4LHJB 4IBWA 1UATA 5HPMA 2WVVA 3DARA 4XODA 1WS8A 2J8UB 3QJZA 5DRXA 2HRLA 3ZMEA 3BP7A 3RILA 2OL3H 1ANUA 1NGYB 3CZJA 3D48R 4RX4D 1LEIA 1SDDA 4OIAA 2Y1AA 5F9DC 1FJ1B 1YEJL 3DC0A 3H9ZA 3WN5C 4CKVX 4NCC1 3HPJB 4WFFE 3SYQA 3F12A 4HUVB 2YC1B 1WIPA 3ECUA 5A2LH 5CEXA 3OHXC 1JNJA 2IWGA 1QI3A 2AABL 5HDOA 1DQIA 2WW8A 1HL4A 3MXVL 1F6AB 3TYGH 4Z7UF 5D7SH 2YSTA 2FK9A 5DJ8A 2BOBB 4TNVK 3X13A 3WY2A 5BNXD 2E7HA 1PZ3A 5DD1L 4KK5C 3PWPD 4MNGB 1IC4H 2V5YA 4HHAB 4R4BA 1JZ7A 4OZIB 5E08L 3GBNL 2IEPA 4NKQB 3KR3L 3PV6A 1EMTH 1XIWC 3QHZH 5GQBA 1YY8B 4ZG1A 3SY6A 4AIOA 1MFAL 1GAFL 2CKBH 4KI5C 5DK2A 1ZIBA 3MCYA 4PGEA 3TNNB 5KSAB 1N26A 4ENZA 4AWJC 1MFNA 3Q3GA 2FECL 1IJNA 1UYWH 3QFDA 1KBGL 3RY4A 4N0CD 5E94A 3TF7C 1HL9A 1ADQL 1MCOL 4P57A 3DX9A 5CKGA 2VDQL 2A74B 2X4PA 4Z7NF 3QEQB 1TETL 3PPSA 4YFEA 2XWBB 1JZIA 2NT1A 1MCLA 3N43F 4XH2B 4Y9FA 5FLVA 4IRSC 2AMGA 3LEYH 3L5WB 3FU8A 1JGDB 4DN4L 5CJQH 5FM5M 3PWNB 4JVPA 4NO0D 1YA5A 4KXZH 3SBQA 1XF1A 1QLEB 4KK5D 1DN2A 5FDWB 1DVFB 3X11B 3O2WH 3D85D 2Z1PA 4KI1A 4RETB 3TBYA 3B8YA 4PJ8D 4XB8A 4D9LH 5J9PA 1J18A 3AS2A 3NJXA 5FW7A 5AKVA 4N2LA 4KKRA 1HZHL 4LLDB 4ZXBB 2PPCA 1JZ4A 3GZOA 1BX2A 4L0ZA 5IROC 2F53B 2WY3B 5IP4A 3F5WB 1EFQA 4NZDA 1IBGH 3IRPX 1G9NH 3KLAB 4ODWA 4ALAC 2XCMC 1NC4A 2NUTA 3S4SA 2PETA 4BHUA 4DCQB 3VD2A 1Q94B 4OCWL 1U8HB 1EEYB 3RDTD 2NY4D 3VA6A 3ZMRA 1NH6A 4BFOA 2FZ3A 2BVUA 1MRFH 3FUEA 3N40F 4GI9A 4S1QL 4YDJA 4FFYH 1AY1H 4XCFH 5JXED 1CBVH 2Q9OA 4X9HA 4NKMA 4P9HC 2YAEA 3QPXL 3QC6X 3QDMA 5JOPE 2GI7A 2XRAL 2P7TB 5DMJB 3MV8E 4FZ8L 1WEJL 2QSQA 4JFFE 3C12A 4HXAL 3W0WD 2J8HA 4Z7NE 4GY4A 2OZ4A 3UZVB 3JUYA 5EU5A 1MNUL 1A6WH 4I0PC 1L7TH 1E3XA 5MI0B 4K9JA 3SGDI 4KTYA 3ETBJ 1WS7A 3V8OA 3RA7H 5JNYB 1QBMH 3P77A 3QIWB 1NCDH 2EE2A 2EO7A 1FVCB 2NUPB 3V4LA 1QAWA 3HZKA 3I3DA 1MJ7H 5FYJE 3QZWG 4OBSA 5DZJA 3L2MA 3A6BH 3VQ2C 5KSBA 1BQHA 4L23A 4X5XA 1NIEA 5JPNC 3EJTA 4Q6IC 1ONQB 3KHQA 1MI5B 5I8KL 3SDDB 2VXQA 4J23A 2Z1KA 3QHZL 1Q0EA 1LHZA 1JGUL 4X8GA 3IU3A 1O5DT 3EOTH 5T5FA 4TULL 4N0FA 4ODVH 3GMLA 1E4WL 3UGXA 4FLRA 2LLNA 2CCLA 2YUZA 3QQ4B 2NLJB 2A83B 1A1OB 3KZ8A 1JF5A 1I7RB 2MOVA 3C6LC 5DVMA 3VG0H 3HRZC 3FHEA 3ECVA 4FQJH 4XOAA 4A2DA 4K5PA 5EOQL 2GK0B 2OMWB 5E1AA 1IGYA 4AQOA 3OQ3B 4DAGL 4GQ9H 1IM9B 2M2DA 4KTEL 3TFKD 4YSAA 2C4FU 3CE1A 5I1KL 1ZSDB 4NKIH 3M8OH 4ODVL 4LNVA 1H3PL 4JS7A 5JUEH 1C16A 1YG9A 4R96A 4MNHB 1NBZB 4G8FA 3X3FH 1KDIA 3CFCL 2V17L 3QJSB 2ZCHH 3F6IA 5MENE 2CHXA 2AEQL 2CXKA 2F7RA 5BMFL 1R3LB 1G4MA 3U7WL 3T4AA 3QBTB 2ED6A 4M43L 1AXSB 2AEPH 1GL4B 4TXVB 2UZIL 1BWWA 1RZKC 3HLAA 1BZOA 1R33A 3L4WA 3FTYA 3AQXA 3AFLA 3BC9A 4WNQB 1GZPB 1MHHA 4WKXA 3RB7A 5EHFA 1M05B 1RJCA 5IIEA 2VL5B 1BZ9B 4P59H 1WK0A 5GGVY 3L6FA 3L4YA 1KPVB 4IRSA 2IDQA 3JYBA 3BH9B 4X5PA 1FYTB 4LCWA 1JZ5A 4M4RA 4NIKB 4PJCE 2VNCA 3V5HA 2IDTA 4DWHA 4PJ9A 4L8SC 4HAKA 1S7VA 4UM9B 1G94A 3BWUF 3PDOB 4OI7A 3OM3B 2AKRB 5LJYH 2AV1B 3S3JA 2V3FA 1T04A 2IXQA 4DHLA 1FL3B 3PWUB 1QLRA 5T3ZH 2XZCL 4NQCA 5FK9B 3LQZB 4DP7X 4UTAL 3LH2H 5CHNB 4BFBD 3JQOB 2YQ3A 3IS1X 4NNYB 2IGTA 1U8NB 1SEQL 3F7LA 1X7TA 4K3JL 4XMLL 1ACXA 2AW2A 2HX8A 1E27B 2P5WE 2UUDH 2YAFA 3CSYB 3DURA 4W9DC 3C60B 1U9KA 3ZZ1A 1OANA 1RUAH 1JJUA 4JHAH 1V54B 3TJHD 3TV3H 1DEEA 2R56H 1JFQL 4K7PY 1G6RL 1OF0A 4A6YL 5I1CL 4ZMOA 2QEJA 1Z2KA 4B0MM 3WKML 4KTDH 3BP5A 1AAJA 4Y1AA 3Q1EA 1YNTF 4ZO9A 1FWXA 2RALA 3QIWD 4AOFA 3H7BA 1JWUA 2GHWB 1E7UA 4BA0A 3NZUA 5GGSY 4QRSA 5KBMA 2BP8B 2F5BH 2BS9A 4TUOA 3I9AA 1J0ZA 5F3HA 3WFEL 2HRPL 4RMBA 2P5EB 4A67A 4PQXA 3WIIH 2YPKA 4N87A 1IVLA 5HYJE 1ZA3B 3RVUD 2W95A 1UEMA 4ZAKD 5CGBA 2NZ9D 4K5OA 4GH7B 4P23D 5I74C 1SF5A 4HKBB 5CBAB 2D03H 3E0GA 3IJ9A 3L7EA 4YXHH 2HVJB 1T5WB 2ZUVA 3KXFB 3DUSA 1XGYL 3MNWA 5D72L 4Y4FB 1KTRL 1T2XA 5E2UH 4MA3B 5F7EH 2OBGA 4APXA 1OWWA 1EMTL 2N4IA 3KDMB 5JOEA 3VI3E 4Y8AA 1MCBA 1RHHB 5GSVA 5IB1A 4XBGA 4H4NA 4YFLF 1M6UA 3F3HA 2JSFA 2QGBA 1QYGL 1KIPA 2EH8H 3SE8H 1T3FA 5D71L 2X4OB 1XR8A 3S2CA 3SEPA 4GUPA 3EHBD 2Y6SC 4XRCA 4ZOAA 1WCBA 4YX2L 3UGUA 5FCSH 2XVBA 3ESOA 3U7AA 4QAWA 2N7AA 2IH3A 1S7RB 3U46B 3BQUC 3FFCA 4L9LC 3BP6A 5KVFE 2OL3L 4XMVA 1TQTA 2W0FA 5IUCA 3KVQA 2J6EH 5LCVL 1WE5A 5D1ZB 3P4LA 1CCZA 1FP5A 2NY0B 2X3BA 2OP4H 2ZYSA 4FL4C 3C5XA 4BCZA 1MRCL 5LWYH 3DVNA 4DQOL 5HDRA 1HCFX 1CDIA 1EXUA 1K2DA 2JIXB 1NL0L 4ZFOL 3U2JA 3HNVL 3SE9H 5EEWA 4W4OA 3QDGA 3VVWA 4XPGH 4QI3A 4WW2F 4HUXA 1KTCA 4N0YH 1GC1L 1HEHC 1E9PA 4KZDH 3S3DB 1OSYA 2QV4A 5LAXB 4Y5VC 1CUOA 3U1QA 5E9AA 4GEJA 5GGRA 3GLDA 5FB8A 4JQIH 3PGDA 3RP1A 1DBAL 2EDMA 4J3TA 5CCGE 2VDLB 4FNQA 4PJ9C 1OSPH 4QNPF 5TF1H 4EIZC 4F8QA 4MMYA 1YN7A 4KDVA 3WKNA 3BZFA 4C56B 1Z9NA 2BP0B 1GHFH 2DQJH 2VXVL 4HBCL 5DQJA 3OMIB 4EBQL 1V27A 2DYPB 2L8AA 3UGEA 3TM6A 3H4HA 5DEGB 1IM3B 4XI5C 5KYYA 3D2UD 5ESAA 5ID1A 3MJ9H 1RUKH 4GAJL 5GGTL 3ESMA 5EBGA 2PCPA 15C8H 2VXVH 4HBCH 4FA6A 5DYOB 5DD6A 1G1KA 5KJRL 2CD0A 3WJJA 2ITCA 1SHSA 3QQ3B 5C2UB 5KVDH 2OSXA 2PP8A 4FYRA 2BVOB 1B0GB 1DBAH 3TVMD 4HJSA 3QWOB 3VYOA 1JAEA 4E68A 4MAYC 2YZ1A 4ONFH 3SJVA 4TKWA 3SKJH 1J9TA 4ZUVB 5L8LB 1B0WA 2EIZA 2E4TA 4PJAE 5KS9B 1EJOL 1GSMA 1A4KB 1U33A 3GDBA 5ESVA 1JGEB 3ZKNC 4H88L 3I3BA 3VB9A 2YJLA 2E8YA 3N6YA 1KT2A 4OJEH 4IKJA 4BFKA 3MRCA 3ZKMD 4BZ1H 4ODXA 1E30A 2EKSA 4NZTH 4P5TA 4UI2A 5E5MA 5KJ7E 2NQCA 2Q7YA 2ZWKA 3IMUA 1J86A 2HFGL 4J6IA 2A0LD 3HE6B 4HJ1A 4H8PA 5EBLB 2MRYA 2P45B 2ZPKH 2GUOB 2JB5L 1XF4A 4JHWL 1EERB 2GBAA 1NCWL 1OTUC 3Q05A 3M45A 3VD1A 1EJOH 2HLFC 1EO7A 2DLFL 3VXTA 1N3NB 3VI4B 5G5DA 1KB9J 3IMVA 5E0QA 3FHAA 4XT1C 4P3CL 3D85B 2PYED 1X5HA 2UX7A 2BY3A 2ZX9A 2HKAA 1X7QA 3CFKB 4NUGH 4ODSH 1HOEA 1ETZA 2BHUA 4P3DA 3TO4C 2JJTA 1OB0A 2L0DA 4V1DA 4KO7A 1ZHLA 3IAQA 4B7IA 5G4NA 4RFEA 1AHKA 2B9BA 4IS6B 4OT1L 5E8DL 5BQDA 3ZTEA 5LGKA 1HSAA 4JZNA 4GQRA 1RZ8A 3OX8A 4I0CC 2MMXA 4QMEA 1KEML 3I6GB 5C2BH 2WYHA 3KPSB 5D2LA 5GZND 1FLRL 1MHPL 3WDJA 2D4DA 4ABWA 3QJFB 2OXGB 4GMSL 1X9LA 3NIDE 1YN6B 4L29B 5EC1B 3VXSB 4OV5B 5EU7E 3CLEL 5BJTA 2WZ6A 5L8JB 1BA9A 4PRHB 5EF1A 1OE2A 4N1CA 2OFQA 2R4SL 4JGUA 4QXTA 4QUOA 4PRPB 3DVGB 3U82B 2WXGA 4MA7L 1O7VA 5DD3L 3ATEA 4XNXH 4M6AA 3EOYG 1ZDSA 4NSKA 5EB9A 3B7UX 3CHXA 5DC0A 3CU7A 1ZLEA 3TJEH 1BJMA 4E9QA 4PI0A 1OAQH 2ZKHH 4KKLC 4N8VA 1NANI 4NQCD 4OF7A 1OAUL 3VWJC 4XVUC 3WKMH 4BFJA 1U4FA 1S7TA 3P2TA 3DECA 2YD5A 1TJIL 2B59B 1HX0A 3ARBA 4QYAA 4ZYKA 5C8JA 3LCYA 2YLHA 2DL2A 4R83A 5AZEH 5E56A 2VE6A 3NN8A 5ETUA 3ZQWA 2OP4L 4TTDC 1XL6A 1MI5D 4OJAA 5SWSD 1NWOA 1D6VL 5C09B 5LB1A 3V0IA 3FL7A 4K3JH 4Q4EA 4XMLH 5D6DC 1BW8A 2XPZA 5KVMC 1NA8A 1HNGA 4OZFH 4NZRH 3FCBA 4HXBL 3JTSB 4PGCA 3LKPB 2ERJC 1R47A 2BSTB 2Y3AA 1S78D 1P5UB 1BEYL 2PXYC 3RBGA 3CFIC 1FNGB 3O3EB 3T0BA 4Y1AD 2HLAB 5DJCA 1D6EB 4WI2A 3T08A 3IPEA 3VXOA 1JNHA 3WE1A 3IMWA 4I77H 3KL5A 2LLGA 4XCNA 5EUKB 2X44D 5I0YA 4A2FA 2BLFA 4XXDB 3RG1C 2ZX6A 1FH5L 4KMTH 3GSNB 4YPGA 4NYLB 5LBVA 1L9OA 2RH0A 4JM4L 2CO6B 3MGOB 3PL6C 3I2CL 1IM9D 1DL7L 3W9DB 2DM4A 3KPOB 4NN5B 4MXVE 1XCTB 1CLVA 4GW1B 1XGYH 1GVIA 3V5DB 4PYGA 2H6PA 1ZHNA 4JFEA 5G55A 2B08A 2QQNH 4KZ0A 1EXHA 2ED9A 5C0BB 2VDOB 3EBIA 3TN0B 1ED3A 1MHCB 4ZQKA 2FT7A 4ECNA 5D4IA 1YYLL 4ODUA 4UCFA 3Q2WA 1K85A 1PF3A 4KOBA 3GMMA 4XMTA 2X6VA 3CFJA 3CFTA 2DJUA 4U1GB 3VE0B 2Z4TA 1C7TA 1FGNL 4HS3A 5HVHC 1HS6A 5HHVH 4PJEE 3F7KA 2JB6B 2WQWA 4EOWH 1W80A 3AS1A 5D1QB 3FTXA 4XX5A 3P69A 1SY6L 2VDML 2FJGB 4GQ9L 4WJG3 1K5NA 4K3DL 3K46A 2HLEB 4PJCB 3QQ9D 5DZOA 1UJTA 3MJ9A 3QJVB 4J12A 3BGFC 1TQCB 2VMEA 3AWFA 5PAZA 2C9XA 5DFVD 5BW7C 4BHUI 3TO4B 1M2VA 1H3TA 1RUPH 4RMUA 5AW2B 4X6FB 4J3BA 4ELKA 3CXFA 1F1GA 1YC7A 1ZVSA 2HRHA 2B3RA 2NW3A 4HSCX 4XN1A 2AQPA 2YK1L 3DV6B 3O6FC 4WW1B 5KZCB 3RPBA 2YPVL 5K9KA 4QTHA 5C6TH 3U4KA 1JWMA 1H0DB 2WXNA 4PJDA 2V5TA 5A1AA 5IB5B 3BZEA 3GPSA 4HJTA 3PCYA 4KQ0A 1YYML 1PQZB 3W11C 3D50A 4HMDA 3HC4L 5F8QC 5GJSL 1MLBA 4UM8A 3EYOA 5ESQA 1WFOA 2J57A 2YD0A 5HGBA 3L3OB 2FR4A 1D2PA 3CCHA 4JPSA 4BQCA 1CK0H 1NICA 1B2WH 1AHWC 3FT2B 3UTQB 3W9EB 3E8UH 4QHLA 1EJ6A 4RAHA 5TE6L 1DBMH 3BH4A 2YWZA 3VTTA 4KKZA 3BKYH 4OZGE 1CF8H 3KG5A 3EBHA 3RTQB 1TTGA 1XO8A 5D7HA 2RHEA 5IHBA 1OCOB 2WAHA 2B8OT 3RWEB 5I1EL 2R23B 1N7ML 1NWPA 5F6IB 3VFNB 1UD2A 2XV6B 4KO9A 3KPQB 1IBZA 1PD6A 2E86A 3B2MA 4N1HB 2VDNB 1WUNT 3RJOA 1F58H 1D5BB 2R4RH 3RWDA 3DGGA 2ZOTA 4FFYL 1CBVL 3BSHA 4X9YA 1F18A 2ED7A 1YEDB 2ZNXA 5J1AB 4OQ1A 4OB5H 2EYTA 5IHUL 1SXZA 4DPRA 3IPBA 4G82A 1BF8A 3CZKA 4GIAA 3HJ0A 1R5WB 2YOCA 3K81A 3UJJL 4PJFB 4CMHC 2XA8H 3EJJX 2DOCA 3UTTE 2B1HL 2XVGA 5FUOL 1J05B 1EGJL 3KPPA 4HCFA 3TFKC 5KVGL 3MSPA 1SDYA 4OLUH 2D3JA 4KRPC 1A3RL 1HKLH 2XPGA 1QSEB 5E4OA 1J5DA 4OUOA 5DVKA 3JWNE 2Y24A 4UQ3B 5AKTA 3RX7A 3L17A 4JREB 1JNNL 3MA9L 1KGYE 1VF5C 4BQ8A 2DL9A 2JKNA 3OKOA 2WUBL 3AY2A 4AQAA 4YJZL 5IB2B 1D5RA 2C3GA 3I75A 3RDTA 3MBED 4IJ3B 3B1UA 1U6AL 3NFSH 3TWYA 1DVXA 2QZQA 4L3AA 4BE5A 3ULAB 3UTSE 4BUQA 4H8WH 4OF3A 2EILB 2AFNA 4LCUA 5IEHA 5D1XD 1CLCA 3FQ4A 2GSIA 5LBGA 2BVPA 3MZTA 4YXLL 4EVNB 4K23H 5MEND 3MV9B 4ES8A 3CLFH 5KJ4A 2CO7A 5D1ZC 5I1EH 4H8WL 2QZ5A 1NCDL 4JVWA 3RKDC 3I9IA 2GJ6B 1ZMYA 3ZQ9A 3ZE1B 2GBUA 4TOYL 5C0BE 2Y7SA 5IWLA 3T71A 4U4BA 2RB8A 5I8EA 2XWJB 3WFHB 1IMHC 1B2WL 3TEXA 4K8RH 2ZXEB 5DD1H 3ULVD 4X6CB 1I85A 3L45A 3AG4B 4I2XB 3GXMA 5AB2A 1WTLA 1LXMA 4JKWA 3ISYA 4PRNA 2Q76B 3IDYB 5D7IB 3VCLA 1TR7A 1O6SB 4S0TD 3KWXA 3DX6A 5D5MF 1HZKA 2B4CH 1L9SA 4P4KB 4N2GA 3V4VH 2FL5B 1B0RB 1YMMB 5C6TL 2CDFB 3MHZA 1IM3D 1NAML 4WU5A 3OXRB 2V9UA 3U4EB 2VR9A 5EBMB 3TBBA 4PJDF 5D96B 4PIRF 4KQ4L 4RRPA 4QRRD 4MASA 3IDUA 5GS2D 4ZDHA 3VFUA 2I9TA 4JFZH 2BY1A 5IVNA 2X9XA 1EANA 4TL5A 5GS0D 1IEAB 4D9LL 4NQUA 1RUPL 2OMTB 3Q8BA 2ILLA 4Z0XB 1FFNB 3PQYE 1HCYA 1LO2H 4LESA 1NPUA 2E76C 4JPQA 4CBPA 3SJVD 1WBZA 5CEZE 4PJFF 3F62A 3TBSA 4FFVD 4J1UB 5SX5H 1AHMA 2ICES 3VI3A 2N56A 4D2NA 4O2CB 3V6OC 1HIML 4I87A 4XBEH 5IG7A 2G2PA 4DN4H 1MWAB 1TJHH 1XD1A 5A40E 1IGJB 4J8RB 1VA9A 1ZY9A 2A77L 4PR5A 4K7PL 5B7MA 3HNSL 5BZDB 3DK0A 2HB0A 2ZWLT 1KGXA 3V0WH 2YRLA 3M1BA 2HPOA 2VDQH 3NAAL 4HIJB 1E90A 3IAGC 1FZJA 1KYOK 4JN2B 1KJMA 3UTSB 4R5VA 4MMZB 4OZFA 1OTTD 4QHMB 2OX5A 2D3NA 4RISH 5J6HA 3TEWA 1DTUA 1ZGLP 3MNVA 1SQ2N 5KVEE 2CDEA 4XI5D 2DLGA 3MJ7A 1ILSA 4G1EB 6PCYA 4LGRB 3CSGA 4WTQA 1W8NA 4HLJA 3I2CH 4N3TA 1X6NA 3GBNH 2VLKA 4ZMTA 1IL1B 1U93A 2FRGP 4ZS6C 1FH5H 3FSZA 4WSGA 4A7VA 1RVFL 4F9PC 2CK0H 4LBEB 3BIKB 4Y7OC 2EDHA 5DRZB 3QUMH 1O7DE 3RVXD 3K6FA 4MKMA 5EFIA 5F1NB 5BOPA 3LIZH 1MJUL 4NUPA 4KFZC 3UAJD 4X0KB 4L8SB 1DEDA 1J8HD 5KN5B 2Z64C 1IGCL 2NTSP 3GJFA 4NNXA 2NX5B 2OZ4H 3BUDA 1AZNA 1EUTA 5IVZB 5D7EA 5JW4Q 3MX0B 1MG2C 2NQDA 5KSVA 1T6VN 4V33A 2NNXA 4YR6B 4MJ2A 3TP4A 3KH3A 1UFUA 2K6YA 3VMPA 1VEOA 4DF9A 1F1AA 3N40P 4GQZA 1E6JL 2WC7A 3F7YA 5BVJA 4OGZA 5ALBL 1S5HB 5T1LA 3FSAA 1L6PA 2DPKA 1NDGB 5HHQA 8FABB 4HIXL 1NCGA 1UZGA 2W92A 3BD3A 3ORJA 3LEVL 2HJKB 4H0IA 4WUKH 3W82A 1QFWH 1ZRUA 2Y5TB 2NNFA 3MV11 4XPTH 1AE6L 5A2KH 1KACB 3CVBA 1JZ3A 2AV7B 5E6YA 3LSOA 3RL1A 4F57H 1JCVA 5C07A 4PB9H 3QI9C 4KDTC 2O26U 2PCFA 5AW1B 4CVZB 3OVUB 5CIPB 2CBQA 3FO9A 4XNYH 5HJDA 4AXWB 1CI3M 4A2MA 4UOJA 2YMXH 4M93B 1BM7A 5CZXD 4ZOCA 2FX8L 3ZGHA 4OM1L 1OQXA 4P46A 5B1JC 5ERWB 2APTA 3O4LA 3QYMA 4EI6A 3F7PC 1P7KA 2ZT9C 3F7VA 1J0HA 3NABH 1A9VA 3ZE0F 1S7QB 4WFFD 4ZMPA 1M7DA 1HU8A 1LM8V 5BV7L 4TQ8A 5JIHA 1GYVA 3EYUH 3Q5TA 4UAHA 1XWVA 2PLTA 2EC9U 3RL2A 4RQQA 3WUZA 1DBBH 2J1ZA 3OB8A 2H6UA 1RQ5A 1UB5A 5D5MB 4IBYA 1SYVB 1WZ1H 2DF3A 2ZXWB 3AUWB 2EC9T 1OB1A 2NZ9C 1UKQA 2BSSA 3EYVA 2V7HB 4OR1A 3RVUC 3UBXA 1UVQA 1NSNH 1ETA1 3M88A 4LF3B 5LBSA 3EXLA 1QABA 1NC4D 1AANA 1YEHL 2J1YA 4F7CB 1CG9B 4I0PA 1LEGA 2VW4A 1A3QA 4UB0L 1QO3A 3QEUA 4PD4K 1KENH 2GY5A 2LTQB 2ADIA 2I24N 1LEKA 3UERA 3SQBB 1WO2A 4M9PA 2GIMA 1Z3GL 3WHXA 3GEWB 1A47A 3MRDA 3VFOB 1GS6X 2NX5E 4MD5B 3GMOA 2OXHB 1AHWB 3TBTA 4QCIA 3LDBC 2VDMB 2HFGH 3TC9A 4EN3A 2YPLE 2DI9A 4WNSA 1BZDA 2EYSB 2YUXA 3OC5A 4KKAC 4P3WA 4KXBA 2ZAHA 5CZVH 2X70B 2BPBA 5A2IH 4YGVA 3C8DA 3ZL1A 1XH0A 2R1XB 1SLVA 4F9PA 2E6QA 3FO1B 1MHPH 4IRJD 4F37K 1SXAA 3F83A 5CBEA 1T0NA 4U1LB 2FD6H 2UUDK 3BO8B 5E6ID 3U0WL 1IE5A 2A9DA 3MROA 3II3A 4DW2L 4A55A 4N2BA 3GHBH 4DP4X 1JCKA 4MSWA 2VLLB 3TO2B 2YD1A 2AP2A 1V55B 4NFCA 2JVUA 3VG9C 5BW7A 5I6MA 1ZT4B 2CBPA 1LVEA 3L3KB 1SMOA 5ISZD 3FCTA 5CN3A 3CIAA 1T4KA 2XQBH 3CUPA 1TQCC 4LLYA 1TZHA 2ID5A 1FIGL 3WY4A 4EUPH 3HMXA 4BZ2H 5BQ7A 2NX5D 4EKJA 3M1OA 4J3OC 3C8KB 5EU4B 1BF5A 3NZHL 1RZ7H 4XN4A 1OK8A 4OCXH 4RGNC 4ZW7A 3F04A 3CMOL 4PV9B 2DI7A 2LW3A 3BUYB 2Z31B 4R8WL 3BSGA 4B9KC 3MRFB 4EBQH 2ITFA 1P7QD 2BINA 4AYEC 3GB7A 5EZOH 4FHBD 3FHQA 3FQ2A 1KBBA 3HN5A 1MFUA 4HFUH 4LMQI 3AXLA 2AAAA 3PQYB 3BDXA 3PWJB 2FUQA 1U3YA 2GSGA 4G7VL 2WUCL 5E5UB 1ZT7A 3SDAC 3WFEH 1OCCB 1IBHA 4KX8A 5B39A 3BESR 5F72S 1DLHB 2XKNA 2WBKA 2GT9A 4JQIL 3ARZA 3Q6GL 3EGXA 4LNRB 5FOJA 2WWKT 5E4AA 1XR9B 4WCYH 3ZUCA 1IKNC 4S11A 4FP8H 1ZHKA 1FZOB 4JDTL 1TTUA 1DJWA 1P5VB 4E42A 1T22A 4JG0L 4M61A 4TRPL 3T3PB 1BWMA 3ZDXF 5J6SA 3FQWA 2FYVA 3AY4A 4WI6A 2IAND 4YHIA 3MV8A 3EZ8A 1KTLA 2VERA 3P9MA 4F5CA 4ILDA 1XB8A 2Q20A 1CFTA 2XN9B 3ULVL 1KXQA 1JZDC 1HHIA 3D12B 5AG8A 2K4WA 5IJCC 3VW3H 1ORSA 1E4XL 3O3AB 5JDSA 5AB0A 5BS0B 4GG6E 3AG2B 2ZUQB 1FO0L 2BCKB 4EZLA 4YLCA 3AMLA 1AQKL 4N2FA 1KIUB 4YHOH 5I6OA 2ESVB 3PG2A 3OLDA 1DDHA 3QNYA 2V2WA 2VN5A 5ACMA 2N0MA 2HTKD 3EOAA 1YPZA 3L1FA 3BWSA 3D06A 3VX0A 5AB9A 4K15A 1CBJA 4HUNB 1O6TA 3KLSA 5AVSB 2VABB 4HH9A 1X5ZA 5H35B 3L3JB 1OSPL 5D2LE 4ZPVB 3PLYA 5GJTL 3APNA 1XEUA 4KAQH 1QSED 1G9ML 4UV7H 1FN4A 3VI4E 2FLRT 1XGPA 2HJLA 2MWCA 5PCYA 4E41B 1A2YA 1CTOA 2Y9RT 1BJ1H 5E2UL 3RWHB 3VWKB 2Y07H 5J89A 3FU7B 4BKLA 2AJZB 1KLGA 2DH2A 3ZL4L 7FABH 1DQKA 4S0SD 2I60L 1DQMH 1LO0L 4HS8H 4NAMA 4UIKL 3GHBL 5HD8D 5L2JA 3CG8A 3E6FB 4PGDA 1CICC 3TJPA 2HPTA 3QNXB 4OZ4B 5T1JA 4KDWA 1R0AH 1GC1H 4HPOL 1MPAH 2BP3A 4WI3A 3Q13A 4XCEB 4Y2OB 2Q0ZX 4XP1H 4Z7VF 3KCWA 4YFDB 1OTSD 1U8QB 4EO5A 2HN7A 1XH2A 5E6ZA 5TH2A 3SDCB 2IOIA 1CXFA 3CPUA 4A2GA 1MFDL 2Y2WA 4X99A 4NQVA 4ZTPH 4GXVL 3VGHA 4ZMAT 1JHKL 1P6WA 2HVKB 2AK4B 4OCYL 4TPRH 4OIBA 4P5MA 5I1KH 4O5LL 2DZEA 3QO1B 4AMWA 1OGAB 3A23A 5D4HA 5I6PA 4L37A 3EGSB 4JKPH 3TA4D 1HHGA 4JGJA 3B7RL 3RZCA 2OZ4L 4WW2A 2R2HA 2HSIA 1G7QA 2A1WH 3ZU8A 3ECQA 4F2ME 2OMVB 5AZ2L 4QRTB 1SHXA 2DYPD 4CU7A 2MJWA 5D7JA 2DQEL 3IXTB 5E4EC 4CUCA 4XGZA 5KEZA 5EPMA 1U8PB 4YC2B 4UYPA 5A2CA 3IWVA 2NPLX 4QRFA 3VXNA 4WHYG 4Z8FH 1Q90A 4M5YL 3L3GB 1SEQH 4HUUB 4CNIA 3T2LA 2WWKO 4X2UA 2I7OA 4L48A 4F58L 1G1YA 1MCHA 3T6XA 3DMMA 3L5HA 1HWGB 1UM5H 1WC7A 5CLXA 3V0VA 3HE6C 4F7PB 1A14L 1KB5A 1NEZA 4NQDB 5FKPA 2YZ8A 4DVRL 4QXGL 5A2JH 4IOSA 3AITA 5E7FA 4WUUE 4P2AA 1AQHA 2DMBA 3VD5A 2EJ1A 3RI5F 2I07A 3LN4B 3ROOA 3ZDXB 3TBVA 2X4RA 2NTFB 3D4CA 1FPTL 2PO6A 3MGTA 2W8CA 5TGBA 1DJIA 5FR3A 4PLKD 4ZUWB 4XPBL 5GGSB 6FABL 3B3BA 3CLFL 3OF6A 3RUGB 4APQD 4GRLD 2P49B 1JV2B 1U8MB 2PPAA 5JHDE 1E5AA 1BFSA 3FRUB 4XMKL 4GPVA 2WNXA 1RI8A 1MJJA 3LKQB 4R84A 5TDOA 4WFED 4KY1H 4XP4H 3UTSD 1H3XA 1FV1A 3P73B 2PWFA 3SE4C 3TN0C 1N0XH 4TNEA 4JHAL 1RJZB 5JUEL 2UY7B 1F90H 2GFBA 2X7LB 3WXVL 1NC2D 5C0CB 2FBJH 2WP3T 3MOBL 5HHXH 3SO5A 4HMEA 1E9OB 4NQSB 4HWUA 1KLUA 1JPGA 2H41A 2Z4QA 2XV0A 1TZIA 3L9BA 2F54B 2R51A 1R3HA 3AG3B 4EAEA 1XGQA 5IKCA 5DT1L 4PCSA 5IM7B 1U21A 1OAXH 2QL1A 3K6SB 3PL6B 1GKOA 2D7PA 4OFYD 1NEUA 2FT8A 4NN6C 1C5CL 1BQSA 2GTZA 3D9AH 2ENQA 3QUGA 2G30A 4H0LC 3SBWC 4IBVA 2J43A 25C8L 3TWCL 1H3VA 1UASA 3LIZL 2OYLA 2VXUL 2OL3B 4Z77B 2IH8A 1EZVY 2CQVA 2Z7UA 4JFFB 2ADFL 1J8RA 3NH7L 4G6FB 4O00A 3DRTB 5I28A 2XWRA 4JQIA 1QRNE 1RIVL 5IW1B 3NRFA 4XVOA 1DJGA 3KPSD 1YC8A 3OTTA 5GRUL 1HJCA 1IAIM 3L5XL 2HT2D 2E7LC 2AQNA 4ZFOB 4JO4L 2GJRA 2R0WL 2ZUQC 1RLBA 3FB8A 3IE4A 3QXTA 4PJEB 4FD0A 1U0QA 5HVFB 1DZ0A 1K3ZA 2Z9TA 3GZKA 4DFHA 4GKSB 1XCWA 4Y5YC 4TSBH 1UOVA 5E2VH 2JF1A 4Y4KB 3N04A 3QP3A 1Z9LA 3WV0A 4F2MB 2NR6C 4HCRA 3MQIA 5D1XB 3V5KB 4CC4A 5J06A 3DROA 3J27A 1AZVA 1M2OA 2GCYB 2QVKA 2IOMA 2QADB 2BFVL 3FQRB 3QI9D 5I6LA 3GWJA 3P9LA 5C0IA 1I75A 1I53A 5F6HJ 4R26L 1T1WA 3QHFH 1JNNH 3MA9H 3IMBA 2C9SA 4DH2A 4HAFA 2GJ6D 4W9EC 1UA7A 5FO8B 2ICWJ 2UZYA 5SWSB 3TCLA 1N6VA 5CUSL 2E9IA 1BBDH 4MJIA 5D6CB 5ECJE 5FUZH 3W0WE 3IDIA 3FUDA 2O61B 1PVHA 3T09A 3T0EB 3TLRA 3ARWA 4WI0A 3HIZA 2E0PA 3BCDA 2XNAB 4DGVH 3DBXB 3BXNB 1TEYA 4G43A 3HS0B 4PWGA 4WO4B 5DO8A 3EDEA 1S7SA 3VGDA 4HIQA 4LL4A 3OKDA 1WISA 4UF7C 2UXTA 4LHUD 4Q7DA 3U2SB 2OR7A 2R1WA 3ARRA 3PJSB 3VFTA 3R06A 5DDHA 1S9KC 2ZXCA 5T1LD 4Z3FA 1HI6B 3ZDWA 1URIA 2QHLA 1YMMD 4G8EB 2OS7A 3DMMC 3K4AA 2C9PA 4U49A 4KY1L 3ZDZE 5LVEA 2KZBA 1MELA 2E6PA 2H32A 3B3IA 3SGJC 3HI1B 2BSDA 2IALA 1M7IB 3EZJB 4X5LA 3IDGA 4PRBA 5C86A 2VLRE 4GW5B 2GJ6E 3S5LG 1FCCA 1P4LA 4ZOEA 5IK3B 4D3CL 1HZLA 1D7BA 4TVPL 2JE8A 3WTXA 1MQKL 3S98A 4N2MA 4YSPA 4AY0A 4I18A 3LZLA 1UM4L 5J11B 1JRHH 1F00I 2DEXX 2WZAA 5E6SB 4I3SH 4IDLA 3BPLB 4H13C 4M4PA 1MFVA 2PW2B 1F4AA 1ZHBB 2HG5B 1GOGA 3H42L 2VDOH 3LDBB 4HCIA 5KUMA 3RPIB 4G8IA 5DJXA 5I2IB 4O58L 4N0UB 3GUFA 3VH8A 3LHPL 4NPYB 3PYCA 3S8FB 2DWSA 1PZ2A 3CPLB 3PHOB 5DFAA 3AREB 4UU9B 5A2FA 5B8CB 2EUXA 4P5KB 2YPVH 4IEFB 4UDTA 2EQDA 2NY7H 4FJYA 1WGVA 5DSCB 4R2GB 5CEZH 3BYYA 2CCVA 2WUBH 4POUB 1F4WL 1AXTL 3MCLH 3TH3T 4OUUA 3QORC 4OLXL 1RJLB 3IJYA 2YXMA 2Y22A 3VFPB 1JUFB 2OMZB 1A4JA 2Z35A 3UTTB 1KNOB 4JO5A 2BDNH 5I73C 2HZHA 3CFBB 4KTGA 1BM3H 2NQ3A 2DWEA 2VQTA 2W0PA 4HJIA 4LE8A 1VGEL 4XWGL 5FAAA 4Y2DB 1YEKH 4GQQA 4F9LC 4J7RA 5EMYA 2LT9A 3UJJH 1J8HB 3PABA 2DYRB 1WDAA 1LO5B 1PZAA 5HHXL 4EOWL 1QQDB 3NZSA 5DUML 3GYRA 4PGZA 4ZSOE 2NR6A 3IJSA 4AT6B 3ML9A 4X98A 2Q10A 4ZTPL 1ILUA 4P2RE 4RA0C 2VXSH 4DKDC 2HWZL 3CVHA 4N22A 1HFUA 3RKPA 2QMJA 3MBXH 4WGVB 1BFOA 2R7EB 4Q9BA 4NRYB 4IGBD 4M1DL 4PREB 3DMMD 2R4RL 3S3BB 2CPUA 2A9AA 3OJDB 1MPAL 1SOQA 2QQNL 3HUJA 2BZ7A 3D07A 4A68A 2QADD 3K2IA 3QI9B 5HGGS 2AZUA 1NOAA 1KXTA 3KPLA 4X4XB 5F7FA 2ZONA 1BXUA 3T5WA 2WM0A 3MLYH 2BXYA 4AUYA 1DDTA 5F71A 4M6MH 5CILL 4FG2A 4KMTL 3NESA 1HXMA 5DJAA 2G0KA 1RUQH 3FH5A 1MHEA 4XB3A 5T3XL 5F9AC 1FLRH 3QUXD 4IYKA 2EH7L 2VR7A 4WZ9A 4ZUUA 4JNXA 4L4TA 3S8GB 1G9MC 2Q2LA 4NJ9H 4BDVA 2ESVD 4NWTH 4QO1B 3LRSB 4G7QB 1XGRA 1FCGA 4GLRI 4POYA 2HCZX 2OW7A 3HTLX 1H8SA 5IFHL 1T89A 4WK0B 3SE3A 5F70A 3JWNH 4X5RA 5K9JH 1JVOA 3IJ8A 2WXIA 4LIQL 4PLJC 3UTPD 2X1XR 3BZDA 2VN6A 3DHUA 1NCUA 4L3ED 3K6DA 4J5VA 2XXGA 5F44A 1FSKB 2ZSWB 4BQBA 1DYZA 4OFKA 1ZT1A 3PWPB 5CZKA 4OCNC 1DFBH 1EEUA 5EF0A 2W9LA 3P4MA 3G5ZB 4HK3N 4J3OG 4FQIH 1IC5L 3NEEA 2XXFA 4NCDA 4NWUL 4JKPL 3GK8L 1CICA 2XJLA 5IJVA 5SX5K 5BRZE 3EF4A 1LNUA 2ICEB 2YKLL 3MNMA 1TQWA 4ORGB 1Z6JT 3U9UB 4EZJA 1U8OB 2JKTM 2UZXB 3E1F1 2J55A 3GMQB 1A6ZA 4MJJA 1NTDA 1PZDA 1NCAH 4IK6A 4BSWA 4MJ6B 2YFOA 3CX5J 3KAAA 1GGYA 5LCVA 4CRPA 1BD2D 3MU3A 2X10A 5EIVA 1DQTA 1T03H 2E27H 1TOXA 3KYNB 3WNJA 1XBRA 1FGVH 3FRPG 2XT1B 3APDA 3FOLB 3H55A 3Q06A 2NXZB 3T9WA 1MFBL 3S36L 1JG9A 4JFTA 4G6AD 5FGBA 4LPXA 3RGVA 4IRJB 4G7YH 2PYFB 5DQ9B 2FJFB 1DL7H 3QPQC 1QUNA 1UWEH 3GMNA 2XQBL 4ADJA 3DXAE 4JKKA 4GXFA 4ODSL 4GSRA 1L3WA 5E6IC 4PY7B 3MMEB 1N5AB 1HEZB 4OLVH 2Z7ZA 1CT8A 1Y18A 4WGKA 3AWEA 2W65B 4ZSOA 3OKYA 3APCA 1TQUA 1W0VA 2I25N 5T1KB 2CDGA 3AROA 3EG9B 4ZTEA 3QE5A 5DI8A 4X7EC 1MCKA 4QTIH 2P8LB 1AQKH 4FMFA 1KV7A 1X5YA 3RWCB 5DJ0A 4OJYA 1OL0A 2JK5B 3TT3L 1CZ8H 2Q3ZA 2XKSA 3LS5H 4JHUA 4LHUA 4NFBA 1TZAA 4K55A 4P05A 3DJRA 2OPCA 3UC0L 2WCSA 1AC6A 5DS8A 5HDQL 3RHWF 1E5UI 1CLZH 1Q9KB 4W6XB 1AZCA 5GRYA 1QR4A 3OJMB 1OSZB 4DT2A 4JFDE 4LCIL 2UWEA 4M5TA 3RWGB 2F8IA 3BEVA 1A1NB 1MAKA 1AD9A 5GPRA 5CINL 4RGMB 4KJYB 1ROCA 5I1DA 3CSBA 5FKAB 1RH8A 1OAUH 1DFBL 3BRFA 4H8QA 5AALA 3GSOA 1TYJA 4QOKD 3TJEL 4JCLA 1HQRB 2XUWA 1NM9A 4QRRA 5GS0H 3AVEA 1WBXA 1BVZA 4Q9RH 1BVNT 2HH0H 4DZBA 1S9YA 2C34A 1X9UA 3OGCA 4X5WB 4G7SB 1NGWA 2R4SH 3APFA 2KC0A 2BP5M 2DBLL 3FOMB 3MPCA 1SOXA 2ZSVB 3DTXA 1WZ1L 4HFUL 3OJ2C 5ICZA 3TBCA 5B7FA 1FYTE 2AJYH 3C6SB 3JWOH 1MJ8L 2BSRB 4MQSB 7CGTA 3H54A 3QUYA 3KVPA 4ELMB 2H3KA 4QLWA 2MNWA 4FN0A 2W9DL 4PD4J 5JZ7C 2E7MA 4PJ7F 3EYSL 4PLJD 3CAFA 1WWCA 1A4CA 3GJEA 3T6WA 3O6FA 1RPQA 1SUJA 5E8EA 1L4IA 1JWSA 5EU3A 4EUPB 2APXA 4L1HA 4ZTOL 3CFQA 5CILH 5FA4A 4XPHL 3BAKA 3BE1H 5AZUA 3KWUA 3CVHH 3B6SB 2D0GA 4KNSA 4EDWH 3N55A 4LVHB 4LSRL 3T4YA 1ZWIB 3TESA 3LQAC 1JXGA 3NSFA 1EVTC 1V7NL 3DX8B 4WDIA 3BWAA 3GKWL 3NFPB 5EN2A 5FW6A 5DTFA 3UJTL 5SWZE 2Y7LA 4MD4B 4M6OH 4CADA 3ARTA 3G04B 4AKOA 4K71C 3C5JB 2YLKA 1VKXA 5HGDB 1BQKA 3LKOB 5BXFB 1SM3H 2H26B 2Y2YA 1UTDA 1YMHB 4WRLA 3BAYA 1EA9C 3BP4B 5LWYL 2XZAH 3CDGB 4F7MA 5CJOL 4G8GB 4LDEB 3SQOL 2HJFB 4PBVC 1TFPA 5DUMH 3TN0D 2DH3A 4D8PA 3ATBA 1WBYB 1KG0A 3HAEA 4FFWD 1SFDA 1DP0A 1ZTMA 2JKIS 4JM2B 4N2CA 4PP1D 5C0CE 2BWDA 1QX1A 2DQTL 3L4XA 3T6VA 4C56E 4DK5A 3GGWB 5DMGD 3MRHB 4BQ6A 1PNCA 2FWSA 2XTJB 2XACC 4KJYA 3SKNA 4AENB 1PU0A 1WZLA 2MPAL 3RWGA 4HPYL 2EUZA 3OAZH 1RL1A 4PPTA 3F6LA 4R5XA 2BIOA 3FJTA 5FGSA 2K78A 3X1NA 3BPCA 1MAJA 4APQA 4FADA 5JW3H 2QPUA 1CFMA 2A6KA 4L1TA 2C5DC 4NJAH 1BYPA 2DIBA 3ZHFA 1KIRA 3REWB 4OQTL 2CE6A 1CLOH 1GGUA 4OZGB 1Q0YH 1ZPUA 3FBKA 3QS3A 5IQ9B 1SJEA 4BH8B 4MNQA 4WWKC 3B56A 2A6JB 3GIVA 4WUUB 1OT1A 1JMZA 1Q38A 2WSKA 1NCBH 5T3ZE 2AANA 1JZEA 3G5YB 5FECB 3MMEA 1E50A 1EDQA 2CRMA 1IEHA 1PLGL 3GD1C 2YQBA 2PR4H 2EIJB 3NAAH 5EOCH 1ZGLM 1MDTA 5F1IB 5KUKA 2NNAA 4P5TC 3VI3F 4H20L 5F1OB 2WCGA 3WHE1 3AW5A 5F9WB 2J5WA 1J1OH 3JV6B 4JR9L 2DMHA 4FKKA 4RSVA 4J4PC 4ISVB 2A73B 4OQTA 4XBEL 2C9AA 5D7KD 3NCJH 4F9LA 1YQVH 3GHPA 1FL5B 1BBJA 1E2ZA 3U7YL 2UZIH 4M6NH 4UT7H 2Y7QA 4N0YL 3L9RB 5LLIC 4C58B 4JQVC 1OCWL 3GJFH 3C5ZD 4OZHA 5GGUB 3VD9A 4L8BB 2ZCHL 1KGUA 4A39A 3BVXA 2YBRB 1NL0H 3I6KB 1LL1A 2EEBA 3QIUD 4GAYA 3K6OA 4U1HB 4ZAKB 2O72A 3IFLH 2OYKA 4JPWL 3CD4A 4JFYA 4BSWB 4HFWA 1FNLA 3ERXA 2VLJE 3NGBB 4JE0A 2EYRB 3B34A 5DR5L 2KZKA 5I16B 3KXFD 4G9FE 2VW7A 5K1NA 3V4PL 4NN5C 4JJHA 3VFMB 4ZMWA 3R7QA 3STLB 3CFDB 1I1YB 4MDJB 5HI4D 3RNQB 3B9DA 2ITDA 4X9GA 1XIWB 3ULUD 2ZP8A 4OVVA 1I8MA 1BGXL 1SXCA 3MLUH 4LEOB 3TNMA 5T5NF 5HVWA 1YPZE 4AIXA 5C0GB 3BUBA 3TZVB 5IZ7A 5AB1A 1P7HL 4RFOL 2D2OA 2AQQA 3ARUA 4ZW5A 4UNIA 1JN6A 5DQDL 1UA3A 2C3WA 1HNFA 3MRMA 3A4EA 5FIEA 3O2DL 2VC2L 1HAUA 4Z7VA 4YLQT 4ZFZB 3E80A 1U8IB 1KOAA 2LVCA 2AJXL 2DQFB 4JQXA 4G9DB 1HHHA 4FKEA 4JM2C 4CSZA 1R46A 1MUJA 2CGYA 1GS7A 2CNZA 3J7HA 5DA4A 4JFED 2J8OA 3BRDA 2G3XA 2XWCA 2AEPL 2Z91A 9PCYA 2Y23A 3UAJA 4G8GD 1ZV5A 4GKNA 3MBEC 5BRQA 1L0YA 3WNLA 1OLZA 1NOLA 4PEEA 4GB9A 1BECA 1R17A 3LNHA 2YA2A 4PJGA 4HOWA 5GRUH 3G3LA 3KL0A 4Q74A 3MV9D 2DQGH 1WD8A 3MYJA 3PIQA 4QOKE 3WENA 1T21B 2JMRA 1BG9A 3O3DB 4XMPH 5JZ7D 2ZCLH 1L0XA 1MAMH 2JKWA 5L9DH 3F8UB 1VGEH 3MV8D 4F3FB 4ZFFB 5I1JH 5BV7B 4MNGE 2H7WA 1KGWA 3CHSA 4N8VG 1ICTA 4JVUA 5IB4B 4PRIB 4XCCL 1H3WM 4BSVB 1A25A 4D7BA 4OIFA 4TSCH 3PAVA 4TVUA 1P4BL 1HESA 3ARFA 3GNML 5B38G 4HUCA 5DT1H 3QDGD 5I26A 3MRBA 1CFQB 5C0EA 1DVSA 5KVFH 1A4BA 4C4KO 1AXTH 3MCLL 1GGCH 2RGSA 1M6OB 3FUFA 2XETA 4KFMA 3IGLA 3BGMB 4AYFA 4U3SA 2E7BA 3BZ4A 3LEXA 4GBXB 5IHUH 2V33A 3ARBD 3I74A 4XVTH 2Q2EB 2H8PB 3L3IB 3CZEA 3WCYA 4H25A 5I8OH 3CFBA 3EUDA 1JNLH 4B9YA 3O0RH 4X6EA 5T3ZL 3VWKD 3TZVC 2V4LA 3CC1A 3ALXA 3QHTC 5EU6B 1TNNA 1AP2A 1UZ6F 2WNWA 4A2HA 2ATKB 2OI9B 1TTAA 3U0TA 1O7DC 4RGMC 4WF7A 3ZDZF 4FQPA 3HAEH 3IF1A 3OR6B 1OP3H 5DC4B 4X4YB 5IJDC 2AK1H 3EUUA 3E8UL 2ZKYA 1QFPA 5JXAL 2AGJH 3U30C 2DM2A 5D2NC 3AWGA 4K07A 1U58B 3M6DA 1EHNA 5IF0A 1JGVL 5F93C 1OGTB 4QXGH 4JRYB 3D52A 2A3TA 3T0VA 5D1QD 1MF2H 1I1AD 1MW3A 3E2HB 4N68A 1UACL 4MZ3A 1OGAD 2H0PA 4KKAD 4LLWB 4PV8A 3VTMA 4F58H 5BMFH 3UBGA 2BNUA 5J56B 2XZQL 1B6DA 5EEVA 5ECGA 1XZ0A 3E6HB 4ZO6A 3IXAB 4X7TA 5TPWL 1Y7VA 3TF4A 1GR7A 2QKIA 1I9RL 1TCRB 4F7TB 2BVEA 4GUCA 2YIHA 2IO5A 3WJJC 4NRXB 1INDL 3MRIA 3QUYC 4XVJH 2MOGA 3OAYH 1DZBA 2P48B 1FG9C 3WL9A 4ETQA 1JGLH 1Z5LA 3DO7A 1ZJBA 3KNBB 2AQ3A 4WU7A 3FQUB 4WY7L 4ZPTA 3X1GA 4Z7OB 5JHMA 2BIMA 1EGJH 4LDLB 4ZX5A 1IE4A 3EFFA 4DUXA 3BYTA 4KXDA 4ADIA 1M1XA 4PJAB 5GRJH 3RB5A 1FVEA 1HDMA 3WS6C 1DE4B 1T2QL 2F8VA 3PXHA 4MDIA 4W70A 1RD6A 3ATFA 3GXUB 4FLOA 4J8QA 4L8DA 2WB7A 1N67A 1SUHA 2ZWSA 4BSVA 1NBYA 2YSSA 5LQBL 1PKOA 4X9FA 4JZOB 1UKSA 1IIIA 1Y1DA 4Q0XL 1JZHA 2FX9L 3MREA 3Q2CA 5I8KH 5LG1A 1PG7H 4U7KA 4HSQA 3BEWB 3UAAA 1R0AL 5FO8A 4N9GB 2V7NA 2YN5A 2HT2C 2RBLA 4HGWB 4AH2A 3SYOA 1NPJA 3ALPA 3VJ6B 1RUMH 3MUZ1 1MJ7L 4F7EA 1WG3A 3LXAA 1QTPA 5L6YH 1GY1A 1N8ZA 5EIQA 2WKGA 3BKYL 1OD7A 3FSVA 2MQCA 2EUWA 3QWNA 1I7TA 4ZZFA 1NFDA 2NY2B 1N5YH 4JM4H 3OAYK 1L7TL 1NFDE 4NX0A 3ARXA 4A38A 4GKNB 3W2DL 2Y1ZA 3WDIA 1NINA 1E5BA 2V7NB 1SZNA 4HGWA 4W93A 2FIKA 1AMXA 3J8F7 3S97C 2MCMA 4FZ8H 2VSKB 4WEBH 1YDPA 1PIGA 4R97B 4FQXD 3WTTA 2QSTA 3VD0A 3HZMA 4PJ6A 5J6GA 2QQKH 4TL4A 2IADA 4NGHH 3SIKA 4JZOA 4M8VA 5B21A 1J0KA 4FFWC 1T20A 2YSSB 4KX9A 2Y5QA 2VMFA 4HXBH 1KLFB 1ACCA 4ZW8A 1M56B 1ACYH 4R3SB 4JJOA 2VH5H 1ECZA 1G1CA 4G5ZH 5DMIL 4UT6H 3K72B 1MCWM 4Z7UB 5DR5H 5FYKD 1SRDA 2B1AL 4FG0A 2XG4B 4UV4H 1IBGL 3WXVH 2X4QB 2XY1A 4PJ7A 3HFMH 3WEBA 5B3JE 1VLXA 3DJSA 2YGVA 2YD3A 3LN5B 1DSYA 3HS8A 3L4UA 4MXQD 2AEOA 5DD0L 1MLCB 3O2VH 1VEMA 3FTWA 1D7DA 3FQUA 3MRKA 2XG5B 4X8JA 5HI4C 4Y2NA 3O2WL 4CC1A 4DESA 5HHPB 4ETQB 5IM7A 2NNRA 3IS0X 5TTRA 2EDWA 1CMOA 2IBBA 3NCEB 3US0A 1TZIB 1E9QB 4FFTA 4JRFA 5JORA 3LB6D 2YJQA 5DA0B 1L9MA 1T7VA 3NSYA 4PV1C 5TJWK 3IXAA 2D4FA 1RV6X 3WD5H 2Q86A 1K8IB 2A4ZA 2P1YA 3OKLB 1NFDF 2F18A 3FFCD 4Q2ZA 1TETH 4I89A 4PVMA 3QQXA 5AWNL 3HN3A 3NJKA 4UUJB 4R4FL 2ICCA 1RZGB 5EBWA 2Y7QB 4WWID 4ABVA 4AV4A 2PR9A 4G80A 3B2PA 5GRXG 4UTAA 4O2EB 1OARH 1KB9K 3QZWB 2C7UB 5FUCE 4JRYA 4J4PD 4NO0B 1QFWI 1UM5L 1M53A 5IF0B 5I5IA 1BQUA 4Z7OE 2JI3A 2F19L 2JLLA 3BSZH 2G5UA 5GZOC 4X4YA 2ADYA 5D7LB 3BMWA 1I1FB 2I07B 3LN4A 3O9WC 3V2AR 1NJ9B 3AUVA 3FBQA 3FAXA 3ZZQA 1GZHC 3A6CH 2NY6D 5T1MA 2K70A 2GAZA 3ECBA 4GO6B 1EAQA 1NEZB 3EH1A 4NM4H 2EEDA 2EDYA 3MV7E 3V0VB 2WBJA 1FNEB 2FD6L 2PP7A 2Y1YA 3DRQA 5A6MA 4KJPC 5C09E 3NJHA 2LGNA 3HB3C 3OZLA 2VR8A 5C0AB 1IFRA 2ZOUA 4G7RB 2Y7MA 2BHZA 4NO3A 1SLWA 3ILDA 4OZGA 3WKYA 5CSZA 4LP5A 3GSQA 3LEXB 4GBXA 1MQ8A 1WWBX 3ILPA 5MERA 1NIBA 2GYSA 4OSUH 3IXTA 2AXFB 2WIIA 4MAYA 1DSFL 4LPVA 2F61A 3AQYA 3SB3A 5AOIA 2ADJA 1Q0XL 3BPLC 3N06B 1OPOA 4NPKA 4TF4A 5GHWH 1NDMB 2WLIA 4E5XB 1TJIH 1XMWA 3GMRB 5FYKH 1A6UL 2XN0A 1MW0A 3T0EE 4ANXA 1U8JA 4P9HH 3BUIA 3FK3A 4UNTA 2WCPA 4RFNB 5CCKL 4LLMA 4OCRH 4RWYL 4PRDA 4A2EA 1FC1A 1T21A 3VFSB 1ZTXL 5IV2A 3CDGA 1WA0X 1QBLL 2PMZA 2X4SB 3C9NB 3KYOA 1NGXB 3A67H 3EDDA 4BWTA 5C1MB 4PBDA 3JWDH 4Y5XC 3F65A 2O5NA 4PS8A 1E2VA 4Y2OA 5CIPH 4FYSA 3N0AA 3BKCH 1LTXA 4BH7A 3MA7A 3U36B 2EIDA 2X89A 4OZ4A 1G6RB 4GRWF 3OR7B 3ZR5A 2NY1C 3L81A 1LDPH 1QLFA 4LLVA 4YOKA 2CGRL 2JI1A 4JRLA 2PW1A 4NN7C 1E4JA 2DQJL 3NFNA 3T0EC 1UJ3B 5A7EA 1ZLVK 1RIHL 3ARPA 1DBJL 1K8DB 3I6SA 4HCRH 5FA4B 1JWSB 1FO0H 3FQXB 5L4JA 2QFRA 2FE0A 1E42A 4QY8A 1RZPA 3HRZA 5IEKB 1EAOA 4NO5A 2ZKWA 5EWIL 1QKZH 3GSXB 3DTDA 1FNSH 1NCCH 1AGCB 1HCVA 4LEOA 1Q8MA 1YPZB 3EOAB 3V6OE 1A6VL 5C7XL 1OD9A 4E0RB 1E5ZA 2DV6A 3OL2A 5FGCE 4KROD 1KIUA 3ZYOA 4OD2A 1A1MA 4DO5A 3RU8L 4OJFH 4PJDE 5I5RA 3HG1D 5ITBH 3GSNL 3DLQR 2VJXA 1TFHA 1VADB 4HIIB 2OW6A 3AG1B 4HFWB 5IR1A 2FO1A 5DMKA 1HQRA 5HDLA 4BELD 4ZD3H 5KG9A 4LCWD 5GGUA 5J8OA 2A9BA 2H2PD 2PKDA 1WIOA 4C59B 4LQFL 1LILA 3MJ8B 5MI0C 2IMMA 4ZMZA 4PJBB 3G6JE 1VEPA 4J3OD 3MO1A 3UAEA 4U0RB 1FZOA 4L3CA 4U1NA 3LS4L 5E6UB 4QJ4B 5BVPL 4UM9D 4V11A 2BY2A 4FTDA 4AMKL 3HJEA 3MCKA 2GT9B 4LNRA 4Z95L 3VQMA 4BK4A 2WMPB 3UXFA 2NXYD 4HH8A 3PNWB 4KK8C 4EF3A 1SLUA 1TU2B 2VT0A 4RMWA 3CVDA 3ZY7A 5A3IC 1CGYA 5DI8B 1NCIA 1A6TA 3BVTA 2F1AA 4N2OA 4BFIB 4UILL 3EFOA 3S35L 1X5MA 15C8L 2PXYA 2W65A 4ZSOB 4AQ1C 4P49A 1CE6B 1SJMA 4JAMB 1Y18B 2GC4C 1ADQA 1ZEAH 2IAMA 2ZXBA 3GIVB 3HFFA 3L1OH 4WUUA 5A43C 4BFNA 1RIUH 3S3CB 4HYTB 2Z92A 3NEOA 4PCKA 4JCMA 1E8YA 2E27L 3WIFB 1P1ZA 1X5KA 1A6TB 4ZOBA 2DWDB 4F33B 1E4KC 2K8QA 4QRUA 1A9BB 4AW4A 4YSQA 1AIZA 3PNWA 3QORB 4UT6L 2E7LA 2AXGB 2BNQB 1B88A 4G6AC 3W0WA 4ZW3A 3FB5B 5ITFA 5C9JA 1F8TH 2ENPA 3FOLA 1JZJA 3LXUX 3QIBA 4YK4B 3S7GA 4U6YA 3D2UA 3ZVVA 5E99H 4IKNA 1BCIA 1MVUB 3LPFA 5SWQA 1AD0A 1G87A 4XPGL 5A7BA 2R1XA 2ZUTA 3MRHA 4FI7A 4BXVA 4JUTA 2MQGA 4KHXL 3Q1SH 2NY6C 3ZHLA 2G5BB 4GRLB 3TV3L 3V0DA 3DK2A 4I1RA 4H26A 4JY4A 5D2NB 1J1PL 5DFTA 1F02I 3FTGB 4IIQC 3RWJA 3TT1H 1ND0A 3IVKA 4YS4A 5J11C 4YL9A 1JP5A 2OJEB 5K9OB 4PVNA 1IT9L 1S8DA 2CR0A 2EP6A 3D4GA 4PJ5E 4HP5A 1WFUA 3WDHA 1OTUD 4YC2C 3WN6A 4Y89A 5EZJA 5CWSB 1K4CA 2CALA 3GTNA 3Q5YA 3MRQA 1GGIL 5T1DH 2YAQA 2VL4A 3OLEA 4AX3A 4DKTA 5EN2B 4WDIB 1V3JA 4L3EE 1L5GB 3SE8L 5LQBH 4G9FD 4M7LL 3SPCA 3PL6D 1AFVH 5I8OL 4XN9A 1JE6A 3G6DH 4LPWA 1UWFA 4AQZA 3S88H 2WLLB 1B3IA 3FYIB 2OSYA 1OB1B 2WTRA 2KKQA 4Z0BL 1RMFH 3FT4B 3QRLA 2BW5A 4YDVA 1KY7A 5DJDB 1UQSA 2IWFA 4AYDC 4L0YA 3EYQC 2WKLA 2Y7NA 4LLVB 3CDZB 2BCMA 5D72H 5D1QC 1RU9H 1L5GA 3G5VA 3HEIB 1KPRB 3D30A 3HS0C 4L4TB 4HC1L 2UWEF 4YHZH 3PWLB 1UD8A 5DMGC 4HS6A 1K4CB 5HVHB 4FERA 1DN0B 1DVFD 1BYOA 4XNDA 4HHGA 2CUMA 2X12A 3IDNA 1INDH 1P6AB 7PAZA 4IW4C 4HIXH 4MNQD 3F64A 4BZ1A 3OKNB 5F7KC 2OCFD 2YD2A 3FOMA 2Y25A 4FMVA 4JO2L 3CFCH 4YAQB 3X3FL 4AC2A 3NDZE 3QK0A 2WLZA 5TE4L 1H3PH 3GIZL 3ZPDA 1QOKA 3FO0L 2HMID 2BC4B 5CIPA 2PPFA 4RRPG 5AYQA 3WTUA 1MIMH 3TYFA 1J8SA 2QADC 3A4AA 2Z0UA 3L3HA 5T3ZD 1QACA 4JO2H 4L8CA 3VWKC 5DS1A 5HI3D 4L1LA 2CLZB 1FZKA 3PPEA 4XWGH 3S3PA 1O9ZA 1U8JB 3DGDA 3MGAA 1B9ZA 1AD0B 1BFOB 2R7EA 5KVGH 4PJ9D 4P23A 4U6YB 3M46A 1R4XA 3L4CA 5JXAH 2FX7H 3KPTA 3POHA 5MEQB 1G7LA 1VGKA 2AK1L 1QQDA 1KZYA 2VM4A 3W0WB 2R2EB 2CK0L 2H2SC 4ONGH 4NC1E 1CVSC 1S7UA 2ENJA 2FQEA 2ZE0A 1ZDQA 3HG0A 4M7KL 4UNVA 3VXRA 4HD5A 4TULH 2N1KA 4OB5L 4QXWA 4JFEE 2QV2A 2VC2H 3EO1A 3K7UA 3MV7D 4NIYE 1KCVL 3DX4A 3NCYS 2NX5A 1MSPA 3KYKH 3U4BH 4QKTA 3TFBA 4OZIE 4O51A 2IQ9H 3VXPA 1JNLL 1RERA 1FLTX 1AIFB 1G6VK 3KYKL 3U4BL 3ARFC 2I69A 5IBUB 4RISL 5I1LA 1GGIH 1OAYL 2KMWA 2ZUWA 3EFOB 3GRWH 4R7VA 1HJBC 4UDTB 1DQVA 2XWTB 2VWEC 3R0MA 4B7LA 4ONGL 4P5KA 4XPFH 3HNSH 1VFBB 3ZDYE 4LIQE 4HUWB 4PJ5B 2XWDA 4U6VH 1MQKH 1P2CB 4OY9A 2PYFA 5DQ9A 2DQHH 1UD3A 4AQEB 2CDEB 1N6UA 4UTBA 1TQBC 3MKGA 3MNVB 4JY5H 4TNGA 3HKZA 1U3ZA 2QLYA 5E51A 1JI1A 4UBDD 1RZGA 3R0NA 3ZHNA 4GOSA 2CMRH 3UMNA 4HIJA 1LO4L 4M5SA 3JWOC 3L16A 3EO9H 5D93B 1O6VA 2COQA 1DQLH 2JV6A 2ZOWA 5DMKB 1TJGL 2CO3A 2WQXA 3WJMA 5HYQA 5B1JA 1F3JB 1LNUB 2ICEA 1NMCC 1PSKH 2X4TB 3QG6B 4IU3A 5C07E 4FNRA 1IAMA 4WJKB 4LKCB 4ZK8A 2MSPA 3I50L 4ALAL 3MNZB 3OXSA 4Z0XA 4QTFA 1HHJA 5FO7B 2ZUUA 4XMXA 1S3KL 1G7HA 1EH9A 1QPPA 4TUJB 2BSBA 2WN3A 3UBXG 3GFUA 3SN6N 2FEDC 1UXLA 4PJ7E 3BIAX 1R3KB 5FLUA 4WENB 1ZKAA 2YAHA 2VUYA 3PF2A 3N1QC 2AI0H 3SDYH 3NPSC 4TVPE 3AT9A 1T0OA 3BXNA 4KOCA 2BERA 2XNAA 3G6DL 1ACZA 1JGUH 1ZVNA 3R1GL 3T0EA 1PG7W 3MBWA 4RFOH 4Y1AE 5GGTA 3KWWA 5I76B 3FTUA 3SKOA 1TKWA 4M56A 1QHOA 1TVBA 1SBSH 4PRNB 1ZE3H 1N0LB 1X4YA 1J5OL 4I2XA 2YAMA 3ULUH 2R2CA 3R4DA 1UWXK 1MIEH 2LU7A 3H9SD 3IGUA 2MOQA 2P5PA 2C26A 4YHPB 3EGDB 5IJBC 4OF0A 1NFDB 3O9WD 4YBQD 5F7DB 1EDYA 3L5XH 2WXOA 1RCYA 4LLQA 1NLDL 2RCSH 4JFVA 3WLBA 1KMGA 4YDKL 4NT6B 4W4OC 3PRZA 5GZOD 2X4SA 4O2FA 2YS4A 4GNKB 3VJ6A 3AGWA 4D9QE 4Z7WB 3RJQB 3MRJA 5J57B 3U79A 5I1GL 2CO2A 1A7PH 3KJ6H 5KBDA 3C5ZA 5I66A 1QBAA 3QA3B 4OZHF 3GSRB 3U7YH 2WHVA 2G0LA 3ISRA 2OCJA 1URLA 5HBBA 1U30A 1AQMA 3MLXL 3MV01 1NCCL 2YAOA 1FDLH 3OAZK 2D73A 2F2HA 3KS0J 3GBLA 4OCWH 1K72A 4FQXB 4U3HA 5AAMA 1F2QA 4ZJ9A 1RZQA 3ZYZA 2FBOJ 3JZ7A 2V3DA 3S37L 5MERB 1M1XB 4PJAA 3NCWA 1S7UB 1ID2A 2FNWA 2X38A 1DBJH 4FRWA 4U6HA 4XNUH 4ZTOH 2IAMC 4OLYL 4GXUM 3VD3A 1G7LB 1I3GL 4CVXA 4H8WC 4P23B 4I1NB 5LGHH 2OK0L 3IJEA 4FQCL 4U0RC 2RMNA 3NJVA 5E9DA 3FN3A 4YWGL 2ZF9A 4IOIA 4DTGH 1X5IA 1J7VR 1BLNA 4O02B 4Y4FD 5KOMC 3BD4A 1OGSA 32C2B 4MZIA 4JRXA 4J3SA 4NQEE 5SWZB 1CYWA 2W5PA 4M8QA 2YN3A 1H19A 5L0QC 4Y4HA 4UQBA 2WV3A 1DBML 4P9MH 4WI9A 3CQFA 5MHSD 3DHMA 3LKQA 1ZTXE 1IKNA 43C9B 3FRUA 1BQHG 1CR9L 1JK8B 1OO2A 1X9RA 3SCMA 1JV2A 4OCRL 1RK1B 2I7SA 2O6EA 1BFVL 3QCVH 3QZWA 2FO4A 4N8PA 3FT9A 3RUGA 3QZLA 2ZCKH 1ZHBA 1USZA 2O5ZL 2HUHA 3GLEA 1DN0A 4FNPA 3VRLE 3QUKA 4KUCD 3AZUA 3Q2VA 5FX3A 4PHXA 3KLHC 3ZHDA 3AU1A 3B43A 4OT1H 3HKFA 3U6RA 4DK3A 2JELH 2KERA 4P48A 1JPEA 32C2A 3FT2A 3C2AL 1BLNB 4O02A 4XHQA 5I18L 5E9DB 5HYIA 4AE0A 2ESVE 3ULSA 1WHPA 1A6VH 5C7XH 1XXDC 4F7PA 4LLUB 2ZKXA 1NAKL 1FQ9C 1UCTA 1YNTA 2DLFH 1PPIA 4U05A 2VDPH 2DB8A 2XG5A 1ZV2A 1ETB1 4XNAA 1CPUA 4IMLB 3B37A 1MLCA 4JPKH 4POZC 2CXGA 5EWIH 2VQUA 2BMKA 1U3NA 1YEJH 2IG2H 5I15H 3FH8A 5EZJB 5CD5C 1EEZB 1H5BA 3BVNA 4UTCA 1SY6H 1U8PA 2VDMH 3Q2NA 2J1XA 2WGXA 1NUFA