2X28A

Cadmium bound structure of sporosag
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
235
structure length
219
Chain Sequence
b'TSCETEGSSISFTVEKAGHVVRFNCPSTLEEIKPAYEAGDSTKVCTTADCSNEAALKDVLKSASLAQAEGSSGGNDFTLTVDALPEAETSVFFLCQRTGADKCGVHILVKAAPQAPVCSAQDHTLELQITAANSDTSFVCGGTFNVIKPANAAKVLQDSCETEVDLVSLVPHASRSALEQSGLIKLSVTDLPQQQQKLCYRCEDSSQKACKVLVTVSAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPOROZOITE-SPECIFIC SAG PROTEIN
publication title Structural and Functional Characterization of Sporosag: A Sag2 Related Surface Antigen from Toxoplasma Gondii.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Membrane protein
total genus 47
structure length 219
sequence length 235
ec nomenclature
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04092 SAG SRS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1320 Mainly Beta Sandwich Immunoglobulin-like SRS domain 2x28A01
2.60.40.1320 Mainly Beta Sandwich Immunoglobulin-like SRS domain 2x28A02
2WNKA 2X28A 1YNTF 1KZQA 2JKSA
chains in the Genus database with same CATH superfamily
1YAIA 4YN3A 2IQ9H 5EUOA 3T4YA 2XQ0A 3STBA 1BREA 3EO9H 1NAMA 2BFVL 1OZUA 2XZCL 3FB5A 4PJAB 4F33A 4B9JA 4Z7NF 5DFWH 3CVDA 4YBHA 3O2DL 4QTHA 1ZVYA 4JPIB 1WA1X 3OB0H 2XUWA 3UMNA 1FNFA 2X4QB 3RGBA 1KG0B 4V1DA 5C0CA 2D7TH 2HVBA 3BKJH 3WY2A 1A22B 3ARDB 2J44A 4GRLC 1UWXK 2L7QA 3OLDA 3PWPA 4U1SA 3SE9H 3SO5A 5BS0E 2NZ9D 2FJSA 4WUKL 3PGFL 2XI9A 5EU6B 3WO3B 4DGVH 3K6NA 4IRJC 3T77A 3IT8D 1OY3B 4HJEA 4L5FL 5FUOL 3AG4B 3BWZA 3ESMA 4GW5B 1KB5B 5AAWA 3QDMD 1FVCB 2QADC 4OM1H 3TEYA 4WEEA 2J4WL 5I6XC 1E4XI 1WE5A 3H9YA 4Y19A 2YAPA 4P46C 5TF1L 2Z6FA 2QR0A 1KZYA 1FFPA 1SLWA 4AGQA 2Z8WC 3QQXA 4HC1H 1QHPA 3MOBL 3II3A 4U6HA 1BF2A 2OMXA 4XGZB 3ZKND 4AQAB 1YEEH 3LKRB 3NOIA 4AL8L 4NFCA 3AVEA 3LRSB 5E6IA 2F74B 4ALAL 2NNRA 3LNDA 5TF0A 3NZSA 5ACMA 2GCYA 2FNBA 3F7RA 4TKWA 3O4OB 5DC9B 3QGVA 4NQXA 3K2MC 4W9FC 4ZUVB 1GTNA 4G7RB 1UA3A 3UBGA 3VMOA 4JPVH 1B0RB 3GMNB 5CINH 1DR9A 1NPNA 1X3DA 1XMWA 1CF1A 3MFFB 4CAGA 2E9WA 2P46B 3UC0H 1H3PL 3S3BB 4KXCA 1JIBA 3J27A 3V7AG 3Q6FA 2ZE0A 3NFPA 2NXZB 1W72H 2DM4A 2RQ8A 2ZZUT 4Y5YA 4ZPVB 1CLZH 2VDPB 4HBCH 1UQSA 3LKNA 4QHUA 1N0XL 3S3DB 3B8SA 4FG4A 3NZHH 5HDOA 2HKHL 2R23B 2BOCA 2X4UA 4JMXA 4NQUA 1FE8H 5A16A 3GSNA 2BRQA 3J07A 4UIKH 3S3SA 2FH8A 5J06A 2ZPKH 4HJSA 4MD0B 1AR1D 1OGPA 1SEBA 1CXEA 4GKOA 5CFAA 1AG6A 2J43A 4OD3H 4JQIH 3UGUA 1AKPA 2MQGA 3HE7B 2FQEA 2VLLB 3VMPA 1N2RA 2BZCA 5FUZL 1JL8A 1UKTA 5DI8B 3ABZA 4JKNA 4AEHH 4PUBL 1HEJC 4JMNA 5F1OB 4LLVA 1KTDA 1TTRA 1W16A 3RNQA 3Q3GB 4N0YL 5I17A 5FO8A 2B1HL 4N26A 4QHKI 2ZXGA 4OI9A 1W0YT 3QVAA 3KPSD 4XN8A 32C2B 4UQEA 4PLJC 4Z23A 1D5IL 1NCGA 1XGQB 1A4JB 2NX5B 3PREA 4LCYB 2ENYA 2Y22A 3D3VB 3FU7B 5D7JD 5G2NA 4BXVA 4F3FB 1A7BA 4RWYL 5I2IB 1TZGH 4TULL 5HI4D 3GO1H 5IM7A 1SHWA 3CDZA 3O6FC 5LBVA 3T3PB 3VI4B 2XU9A 1HHIB 3OZ9L 4KKCC 2Z65C 4D8OA 4AM0A 1RZKL 4F8NA 5HGAA 1RUKH 2DWDA 3IJYB 5D1XC 4GG6B 3INOA 2JWYA 1KIPA 1RK0B 4UT9H 3QWRA 4U1IA 3MACL 4PHXA 4HOXA 3KHQA 1J5DA 4G8IB 3VG0H 4YZFF 2DQHL 5DDHB 3V9EA 3IGLA 1NMAH 1GH7A 1NGQH 2C9SA 5ANHA 5A2KH 4P2RD 3BQUC 4TQEH 2PNDA 5D7KD 1JDCA 2DTSA 5C08D 2EXSA 5DUPH 3OKEA 2CR3A 1ZTMA 4I3SL 1JWSA 1X5YA 4FTVB 4KXBA 3V6BR 5HPOA 4PJHA 3CMOH 3S35L 5EPMB 4D3CH 3M8OH 1D5ZA 3DUUA 1RAMA 4O58H 2YZ1A 1E42A 1OSZA 4GBXA 3T6WA 4FG2A 5EMYA 1X5JA 3HUJA 4FG6C 1FLTX 4G9FB 5I6KA 5C0DA 3TJEL 1U41A 3WGVB 1YPZE 4GAFB 4EI6A 4YHYC 1MQ8A 4W1TA 4Z7NB 3EOYG 3WV0A 1S7SB 3UEQA 2EH7H 3BVUA 3X11B 1BBDH 5PCYA 1MCNA 5CEZE 1X5GA 2NQ3A 2F1EA 3QIBD 3QO0B 2DQCL 4HWEH 1DQQA 1NFIA 5BQ7B 3E8VA 5HDRA 4JM2B 5C0BD 1U3YA 3PABB 4QHMB 2DQDH 2UY6B 1ED3A 1NGZA 4OTXL 3DROA 5DT1L 3TP4A 3MFGB 4CNIB 3MLTB 4NXSA 3FW6A 4RISH 4KKZA 1U93B 1SJMA 3A0OA 4IGBB 1A6PA 4LBEA 5FF6B 4JUTA 5CGMA 3K46A 5GS1C 1QX1A 3E0GA 4XMPH 4BFIA 1KBGL 1KXVC 1MAKA 1AXTH 3APDA 5FYJU 3MRNB 3RPIB 4K7PX 3Q5YA 1L7TH 5C09D 1EXGA 3ARXA 5CZVH 4L3EA 3ZT5A 2H32B 1A6AB 3D09A 3BWUF 5K1JA 4W9IC 1WFIA 2CHXA 2YAFA 1FHGA 5I1EH 4BKLB 2XX1A 2ISDA 4XI5C 1G9HA 3IPBA 3RE0A 3CZEA 4FKKA 3PF2A 2Z34A 5DEGB 3D85A 4PJ9A 5F70A 4MHHG 3FTSA 5M95B 4QJ3B 4UILH 1YC7A 3WJMB 2MIZA 2DQGL 2ED8A 3DDGA 3B9AA 4PGEA 1KJ2B 1LEIB 3RY4A 4A39A 4NBYB 1LO5A 3HZKB 4NN5B 3STLB 1A66A 4S1QH 5DD0H 3ARDD 4CN6A 3H42H 3Q0HA 4FC3E 2HA1A 3IDJA 1CE6A 4RVBA 2VXUL 5DA4A 1MXDA 5EU6D 1M7IB 1O9WA 2WQ8A 1BEYH 1NUGA 1HDMB 2XWTB 2ZWLT 3TWYA 1EEQA 5GS0D 3KDMA 4GOSA 2V9RA 4UQAA 2ADFH 5F88A 2VXVH 4JW3A 4KJWC 3BPNC 4XX1E 4YHZL 4KV5F 4KRPC 4UBDD 5GS0H 1AH1A 1UASA 2VT0A 3CIQA 4JKMA 3X1BA 1UTDA 3D08A 4GKSB 4U1LA 5I73C 1SQMA 3U83A 3TCLA 1IT9H 4RWHA 5C9JA 4U05A 4XXCA 5GHWL 2ROYA 1D6EA 2OA9A 1LO2L 1K8IA 3MCYA 2A9CA 5TPWL 3ZMNA 2B1OA 2FR4A 4XB8A 1RZGB 3QR1A 4JHWH 1CGVA 1YEFH 3A4FA 4X83A 4N8VB 4WFGE 1NH6A 5I26A 4YZWA 1C12B 4I77H 2NXZD 1DUYA 4IS6B 3ZO0A 1AGDB 1OE3A 3VWKD 2J25A 2WQRA 3L1GA 3TTSA 3VO0A 5CLTA 2COVD 3KWXA 4JKKA 4WHTB 5CEXA 3MGTB 4LCVA 3FYIB 3MZGB 2GKIA 2WBXA 3OX8B 5C0ND 3IXTA 4PRNA 4JEGB 2VDPH 5I16B 1JGDA 2B7DT 5D2LE 1P7KB 4LSSH 1UWGH 4YPGA 3KVQA 3HE7D 1XT5A 5L9DL 1BBJA 2AABH 3US9A 1W6WA 3LZNA 3GZOA 3GI8H 4M7LL 5KYUA 5HY9B 5D7IA 1HJBC 2Y06L 1DDHA 4IK7A 5EF0A 1NSNH 1KACB 4JFOA 1PKQE 5I8CA 1HSAB 3MV7E 4XP1H 3MJ9L 4Z1PA 3VX1A 3VFRB 3KE0A 1HKLH 2CRIA 4OLWL 4U7KA 2JKXA 3BRDA 1DN0B 1LD9B 4Q9BA 4I0PC 2EVGA 3SY6A 2IQAB 2ITCA 2MKWA 1XB6A 4PRHB 3O8XC 4WW2F 2NX5D 5E8EA 3D3VD 4L4VD 2HPOA 5CN2A 3W37A 4JFDB 1R3LB 2D03L 5J13C 4B96A 3ETBF 4NO5A 5INCA 2VXTL 4FQ2L 4NGHL 3HC0A 5D1QB 3FL7A 3QJFB 5CO1A 2AAVA 3ASWA 4GQ9H 1I1FB 3MYJA 4MQSB 1DTUA 2VABB 2P3YA 2YKKA 5BO0D 2AQQA 2GJRA 4MJIA 1OQXA 3GS7A 2A1WH 2GBTA 1T22B 4PY8I 2W88A 2DQMA 2YEZA 3L3JB 2NMSA 4A68A 5ABZA 3L1OH 1HHJB 1SXAA 5CHNB 1KGIA 4NIKB 3UBFA 4OZHA 1D6VL 2XXCB 2CA3A 4BWUA 1TEYA 2MRYA 1AQDA 2NR6C 2WC7A 2YKLL 3MRRB 3O3EA 1E4WL 4XPAL 3C8KB 4FTVD 5FYJE 4L29A 3GF8A 4NWTH 4G1EB 3QJQB 3GXNA 4R5TA 2WQAA 5IB4A 3T08A 2C9PA 2Q8BH 3SE8L 2XDHA 2FX7L 4JRYB 1QNIA 4Y8DC 2F53E 3FQRB 4OZFB 4LCCA 3LZPA 3B7UX 3VFWA 2SEBB 3LMJL 4FHBD 1TJXA 5DJZB 2R7EB 2O5YH 3FQ2A 3RDJA 2NSXA 4RGND 4RMUA 2H6UA 4G9FD 3HAEB 1E40A 3ZKSD 5EDXA 1G87A 2JJVA 1R5WB 4MQ7A 3V0VA 1XIWA 5I28A 5I75C 4JAMA 2VDNL 2WLZA 4BK5C 2R1WB 5I66B 1L0PA 2F5AH 2AJYL 3C60A 4YHNA 3QEQB 2DJSA 4Y9EA 4BZ1L 3IE4A 4JM2D 4PV1C 1KJVB 2FLRT 2BP0B 4EZLA 3DSNB 1R1CA 1GGTA 1RUPH 5AVYB 3RVUD 2CGRH 4Q9QL 2AK1H 2IGFH 4P2OA 3QAQA 2EUWA 4GS7B 4I3RH 1G7PB 2EXYD 1KBPA 4PJXE 2WVUA 3MU3A 1MJUH 3WENA 1DSFL 1PZBA 3KLAA 3J7HA 3CE1A 3LH9A 2ZUYA 1YEKL 5E1GA 1NCBL 4TQHA 4NSKA 4U1NA 1UZ8B 4FADA 2XWEA 1QEWA 2VXQL 4KZDH 1OAZL 2NPLX 1I1CA 1BXAA 1SDDB 4TNWK 4KITB 5EO1B 2JJSC 4L8BA 4LSUH 3WELA 3HB3C 3RGVC 3VD9A 1ES0A 4JM4L 4ONFH 2AEQH 3WNMA 1JUFB 4JHUA 2H32H 4W9JC 1R3IL 1YO4A 4L8SC 1SDYA 3NJNA 4JFEB 3QZWG 5SX5H 1YMME 1ZDQA 5F9OL 1BLIA 1IQDA 3EH4B 4HIIB 1L5GB 4B0MM 5T1DL 1QRNB 4OJFL 4HOWA 1Z5YD 2A9NL 3ME0B 2OMYB 2YD2A 1AE6H 4DQAA 2OJEA 5DMIL 1F58H 4YBLC 3KLHD 3T4AA 3HN5A 4G5ZL 3FRPB 5LN4A 2V7HA 4P5TB 1NCOA 2LLGA 2HX8A 2Y7QB 3T0WA 1KJ2H 1ET5A 2YGPA 3BN3B 2BS8A 2E8ZA 5L0QB 2WW8A 1D5BA 4KJQC 1L3NA 3RZCA 4KO9A 3CTTA 1NTDA 1DQLL 3OLIA 1B0IA 1ZTXH 15C8H 4E41A 3U9PL 4M8QB 5K9OB 5FCUH 5EZIH 1LO4H 2FD6L 4ES8A 4LSPH 3NP3A 1N4XL 1N67A 4G6ML 1CPUA 5F71A 1F3RB 1X4XA 5DURB 1AHWA 3P1VA 4P23B 1JGEA 1J8HA 5D70L 1TT6A 1YEJL 5IVZB 3PAYA 4OLYL 3A6CH 3V5HA 1OAUH 3MGOA 5AL8A 4I87A 1I3RA 5EUKA 1RD6A 4LLDA 3B1UA 3KLQA 1F90H 4P48A 1WT5C 4P4KC 1M7DB 4QHNA 4A2MA 3RLSA 5GGTL 1D7BA 1NC2B 4DUVA 3BN9D 3FUJA 4WW2B 5DFVD 4XZUA 5I71B 4Z3EA 1NCWH 2GJ6E 7CGTA 3A47A 3OVUB 1GYCA 1HCZA 1CN4A 2P45B 2G9HA 3QULB 2QZQA 3BUTA 5HGGS 4PJGB 5KYWA 1UWFA 1YNLH 1AO7A 1BMWA 1DFXA 2G3NA 4PWFA 2FEDC 1A6TB 1KNOA 1YQ2A 1FIGH 1QLRA 2K1MA 3MLYH 1Q72L 4WSJA 4OD1L 2AJUL 2JMRA 4P2AA 3EJQA 2D3JA 3WSQH 2F7QA 1JZ3A 2XJKA 1VA9A 4X6CE 5ILTH 4OQTH 3GTVA 3ZDZB 1JZ4A 3TVMC 3VXTB 3U30B 4C83B 1X9UA 5KVFL 4MA8L 1INQA 1QYGH 1GSKA 3ARGB 2R4RL 1GZPA 3P9LB 1SUJA 3A5VA 4BZ2L 4JZOA 4N4YB 1Q9WA 2CIIA 4LLUB 3GBNL 3FQTA 2G3MA 3SGKC 5IBLD 4PRHD 1L7IL 4KGJA 1M56B 4MNQE 2EDNA 4M7KH 3BXNA 4ODWA 1EQWA 2XA3A 2QJDA 5AENA 2Z31A 1QSFE 2ESVA 4M7LT 4PV9B 3MLXL 3T6XA 4CADA 1D7CA 4JFDD 4HK0A 1IMHC 2WTPA 3LKOB 2BY1A 4Y5VA 2PCYA 4FNSA 3QNXA 4LEXH 5E5MA 2ZNWA 5E5LA 5AW8B 4CDGC 3O6MH 5D1QD 5SWSA 3DV4B 4GO6B 3VACA 1OAXH 1B90A 2NY3B 2AZAA 2NY5H 4L18A 1R3HA 5HI3C 2IDSA 4FLOA 2D4DA 5J0BA 3LN5A 3DHJA 1GTFA 3TO4B 2XX0A 2AEWA 2AJZA 4OV6F 5CILL 1RHHA 1MCOH 1XSKA 2BMKB 3WXVH 3SGJC 5I0XA 4Q4EA 4MD5A 2AFNA 2JK5B 4R9HA 4F7TA 4GQZA 5KSBE 3ROLB 3EFOA 4FXKB 4JK0D 3LXUX 5CKGA 3L4VA 3V6FA 5CR1A 2V5RA 4JRYD 3B3IB 3SGEI 3POHA 4HPYH 4J6RL 1LK2A 1HTYA 1NIFA 2ICWA 4OD2A 5E6SB 1NIAA 1DL7H 3CFTA 1SLUA 4EO5A 4HIXH 2DLFH 3K8MA 3B2VH 2J8OA 2CCLA 1F3DJ 5F6IC 2JI1A 4ZTPH 1MFCH 4NUJA 2H47C 1AP2A 4W9KC 3I6LD 4LGRB 3QZWA 5AOJA 2C4FU 2FIRT 3DMMB 3QEQD 1RMFH 3HAEH 5E1AB 3MLSL 1I31A 2VDML 5ACZB 3AQDA 4F9LC 1MIEL 4WF7A 5JR1L 2OR9H 4QO1B 4X7DC 1SN2A 5F8RC 1ZANH 3UCQA 4AGPA 4K9EL 3RVXC 5HVGB 1IC7H 3W3BA 4OGXL 2VQ1A 1YPZF 4IIZA 3STZA 3FRUB 2W0LA 2EYSB 3QCVH 4OZGE 5TDNB 2FIKB 1CFMA 3VXMA 1Z9OA 3WJJA 1HYSC 1K4CB 1TJGL 1E27A 2UYLB 1VFMA 3V4PA 5BS0B 3BKCH 4YXHH 1CBVL 4XVJL 1HOCB 4DGIH 3PNWB 4Z7VE 4JPWH 5MEOB 5IQ9B 2LLLA 4HJ0D 4GSUA 2GI0A 2JTYA 1H3TA 3L54A 3LX9A 4PJFE 4BZ2A 4JFED 5DJXB 5CGYD 3UTQA 1MW0A 3QZNA 2J5LC 2NUTA 5JIPA 1QRND 4BRVA 1MELA 1MLCB 2VM3A 2OMZA 1NM9A 3EYFA 4HIJB 4J3OF 3U1QA 4E9LA 4L9LC 2GAZB 3U9WA 1E6JL 4NM8H 4P5TD 1TVHB 3FO2B 4RFOL 5KVDE 2Q8AL 5JHDA 3NJGA 5IBUG 2R2HA 1SHMA 2R0KL 4XP6L 2FSEB 4XPFL 3ILDA 3V0JA 5E4EC 1CGTA 3QDGD 3LKSB 3D18A 4BA8A 1CVRA 4MLIA 2OJ1A 4G43B 5EIIA 3FUIA 3V0WL 3VW3L 4LLWB 2P8MA 2MCPL 1MFDH 4QT5B 4NI6A 4IOSD 3N6YA 4RAUA 5CUSL 4YH6A 2OP4H 5FKAA 5GPRA 5DURD 1NDGA 4P23D 3GFUA 3KG5A 4FNLH 3S4SG 3SKMB 1QKZL 1UFUA 3PAUA 5CAYB 4NERA 3N1PC 5FYLL 1TQBC 2YXFA 1IIIA 2I85A 4L3CB 1Z9MA 4QNPF 2R69L 2MNUA 4MAYA 1GY2A 1Z2KA 3OKNB 4UYQA 4FFWD 3PHOA 4LHUB 1FJ1B 1A9EA 3UAFA 1NC2D 2IF7A 5C0GA 5M7QA 1EV2E 1V5JA 3I9AA 1XB3A 4Z76B 5C6WH 4GXFA 2CIKB 3OWRA 3G5XB 4H1LG 2ZAHA 1TJIL 2ZG2A 3RBGA 1XR8A 4FXGB 4NO0A 5EOQH 3RTQA 4ABWA 4N2HA 5J9PB 4MMXC 1CK0H 5MHSE 2LV4A 2VDRH 5GISH 3RAJL 5EH1A 4GAJH 3WHE0 3PDDA 5IHHA 2CGZA 4LRIA 4JHAH 5AVZB 2GTZA 4AG4L 1XH1A 1A1OA 2JB6B 1GJWA 5BJTB 5ADPH 4F7CA 5IVNA 1QZ1A 2EDDA 5TE7L 2ZWNA 4ZYKB 2UXGA 1T2XA 4JN1L 4QKTA 1BZDA 4RNRA 1P4LB 2R9HD 1B6DA 3TC9A 5FECB 4JY4B 3ZQWA 1KDJA 3KLLA 2W9EL 4NP4L 3FUFA 3EGDB 1ZD6A 3RIKA 4OSUL 3ILQC 4JRXA 4QXUH 3ARGD 5F9AC 3RX8A 1OD7A 3CC1A 3DV6B 3ERXA 1DVYA 3SYAA 1CFQA 2NT0A 4H5SA 4A63A 5A7BA 5E8OB 2NSMA 1LDPH 2GITB 4L4JA 5D2LF 2XQBH 3P0YH 5KVEE 4MB4A 4OCWH 4YSUA 4KUZH 1SFHA 1CDGA 1G7MA 1MXGA 1ZPLA 1JGUH 3QG6A 1YECH 4XP9H 3S3CB 5CCKH 3O2WH 2QPEB 2ETWA 5IK3B 4ZMVA 2EIZA 4WKZB 4ZMNA 3NN8A 5ETUA 1V7MH 3DX9A 3JZ7A 5EB9A 4O9HH 2LW3A 3QXUA 3KXFA 2WLLA 3FBKA 4XCYB 3TN0C 4KZEH 4WWKC 5ICZB 3WEXB 5I0WA 3GSWA 3QO1B 3DTUB 5EN3A 1KYFA 2ZOOA 4Y89A 3M07A 4PJ5E 4XXWC 5FKPB 5IJKA 3GSVB 4GUOA 1R47A 2J56A 3E2HC 1EUTA 1MRCL 2FJUB 3FTUA 1H15A 3TO4D 4YSRA 1YYLH 1F13A 1IC5L 2F5BL 5FYKL 1YPZB 3U7WH 3E7JA 5I8EB 4QRRA 4G6FB 2P8PB 4IJ3B 3OZLA 3EDKA 3QH3A 4LNRB 4FLSA 5D1ZA 2E3VA 2VAJA 4PJ8B 1I7TA 4OKVA 4APQA 4NKDB 4C4BA 3DGGA 5F1IB 2G0KA 5D93C 5FGBC 3VFPA 2LTQB 1FGNH 1N64L 5F0JB 3B34A 3NA9H 5JPNC 4F2FA 4JKLA 2BPBA 4N85A 3NJKA 1T7XA 4XHQA 4TUKL 5B1KA 4JVPA 5A2JH 2NRDA 1FO0H 1S7WB 3ULUD 3IU4H 2R69A 1OARL 3WO4B 3ZRFC 4E68A 2BSTA 1NWOA 2C5DC 4NZFA 2FX8H 4POZD 4PRIE 1XEDA 4W4NA 2Y7NA 1JNNL 2JTDA 3DMMD 4K5MA 3ZRSA 5I5MA 4GPVA 4NRYB 1F1GA 5CCJA 3R06B 4MBOA 2NW2A 2VL5A 1JWMB 4Z0BH 5KG9A 1FFOA 1FN4B 1OT1A 5AW6B 4N86A 3FO0H 4NP9A 3BIKA 1KTKE 2DQIL 4A7SA 3EYSH 2WGNB 3F84A 1DVUA 1R4XA 3SDAC 3ABLB 3TT1L 1NMCB 4JGJA 3IDXL 3RNKB 3FB6B 3HR6A 1HL8A 3N41B 1AQ8A 5I19L 1J0KA 4A2GA 1NAKL 1Z9SA 1OO2A 3H54A 1QSZA 2P7TA 3D6GA 4UOW0 1AY1H 5D6DC 4JRFA 1YEHL 4NBXB 3U46A 4NCC1 3BP5B 1TEGA 2JCCF 1HINH 4KNUA 3UTOA 4AE0A 2RBLA 4FKHA 5IB1A 5BS0D 4PD4K 1PQZA 1U4FA 2ZCHH 4YAQA 5CBAB 3AXHA 3NJXA 2BO0A 1HL4A 3S4SA 2HT4D 4CSPA 3VQMA 1JF1B 1SDAB 4K8RL 2J1WA 4XT1C 1GHFH 4RH4A 3SE6A 1PKOA 4Y88A 1NCAH 4JVWA 2A6DA 4O2CA 1Z9LA 4R26H 3OQ3B 3MREB 1HL9A 4F58H 2BK8A 3DX7A 1IQWL 2JH2A 3KM2A 3B7TA 1MW2A 1RZJH 4G3YH 1UOWA 5D71L 1U3HA 3TF4A 2HLFD 3M17A 3TYFB 2Q76B 1VPOL 3OR7B 1ODUA 3NZUA 3U36A 3GMPA 2UZIL 2ZUWA 2KLSA 1S9WA 3CIAA 4WNQA 2OL3H 4H8PA 4PP1C 1I7RB 4D2NA 4R2GC 3IJ7A 3G5VB 1BAFL 2QVIA 4E9QA 4WY7L 4G42B 3SYPA 2PP9A 3I74A 4TVPE 3WHE1 5B3NA 2NDFA 3PL6C 4LEOB 2VMCA 4KKBD 4KFMA 2IAAC 3WLWD 3C5XA 2J3SA 3HC4L 3MBXH 5HHXH 2VL4A 2R8SL 4V11A 3JYBA 2QSTA 4K94H 4PCYA 4NN6B 5GSRA 2KQMA 2IJ0C 5I1KH 4UT6H 4PHZA 3KPRA 4ZJ9A 4NQEA 1VEOA 4YXLL 4CW1A 4CVXB 4J39A 4LHUD 5T3XH 5HHOD 2XIDA 3N2JA 5D2LB 5DWUH 4D9QD 3OAZK 4K2UH 4PJEA 4EUPA 2E75C 3LSOA 4XNYH 1UXMA 1JMXA 1L9PA 5FW8A 1TYJA 5ID0A 4XMWA 3ZBMA 1PS3A 4OH2A 1U8CA 2MKLC 1DBKL 4S1RL 3L3DB 4MNGE 4B9IA 3OAYH 2DL2A 3ZLQC 4DGYL 4F7PA 4Y1AA 3MV7B 1WD8A 2FBJH 2VSDA 4OCNC 3FQNA 1OP3K 4LBAA 4AVIA 2ZNXA 4O51A 1QVOB 2YR3A 4UNIA 2NYYC 2BIIA 5D4HA 3T2NL 1ECYA 2TSBA 4DKAA 2IPUK 1OV8A 3HRZA 3IFOA 4TNVF 1NDMA 1HNGA 2DN7A 1NINA 5DVNA 3NZ8B 3VUAA 1AVAA 1NCNA 3X3FL 2WXGA 3DGCR 4I85A 1FV1A 3LXBA 3AY2A 3F85A 3KVDD 4NDMB 5E9DE 4XR8C 4HFWA 2OULB 2F68X 3QEHB 5H37H 4YDKL 3HI1A 3DVIA 1SOQA 3JT0A 3O45A 3WIAA 1MG3C 1MCDA 2QTVA 1NQBA 2L04A 4AMKH 3IDIB 3ZE2F 1ZSHA 3GBML 2LVCA 1RVFL 3VWJB 4X4XB 2QTEA 3OBAA 1GGCH 3LV3B 3L7FB 3ZZSA 2PCFA 2Q86A 2WBJC 4NKMA 5EC1A 4E42A 1F4HA 2XV3A 4X5XB 3CBRA 1UH2A 4X6CF 5BUGA 3G6JE 5DR5H 3RG1C 1M53A 2V2WB 3HJEA 4UIMB 5GIRA 4M6OH 5IMLB 4OFYD 1CXKA 7FABH 3T0BA 1ZPUA 2X53A 2XFGB 3ASNB 3W2DH 3C2AL 4X6BA 3SE3C 5JOFB 2VH5L 3KW8A 4P9HL 4WI8A 2RFXA 4R90L 2HFFB 4QYAA 1LVEA 4OIIL 4OT1L 4L0ZA 3VQ1C 4JREC 1QOKA 2WYTA 2FJHB 3MO1A 2A38A 1GL4B 4G6FD 2APBA 2IANA 3GSOB 1PDKA 4H8HA 3SODB 4JKPH 2ZONA 5CEZD 4ZNCD 4KVPA 4PJ8D 5CU9A 2C1PA 2JCCB 3QP3A 3TZVC 2DWSA 1JZEA 5FV1L 3IRCA 1X9QA 2WTRB 1A6WL 2P5WA 5HHQA 7TAAA 5TGBA 2OJZL 5CEZH 2YS4A 5BV7H 2CO7B 4F2MA 1GGUA 4UOW1 4N2OA 5KAQG 3EO9L 2YD3A 5DZJA 2GSIB 4GG8B 4XBGB 3WAJA 3MX0B 5F7LB 5CNHA 4PJXB 4P05A 1M9SA 5C0EA 5BMFH 3QORA 2DYPB 4FN0A 2V9UA 3WTTA 2D7TL 4Q9RH 2CAKA 2DLGA 3BPLB 4J3OD 4AENB 3V95A 2EEBA 1GAFH 4A2EA 5EBMB 3HMWH 3SE9L 5C0IB 5ICYB 5LXGH 2ICWI 2ROXA 2VDKB 3UCRA 4MTMA 4DGVL 5HVWA 5DJAA 4J3OH 2CHWA 1S7XA 3WAKA 5F9WC 4XCEA 5LGHH 1OVZA 1BVNT 3MBEB 3FOLA 5ITFB 5C0RH 3BSZH 4NYLA 1YMMB 2XVBA 1C16A 2H41A 4OQ1A 4HJIA 2GYSA 4FI8A 2BS71 3PQYA 4HC1L 4PBWD 5ESAB 2DMGA 4KNSA 1YEEL 3KPPB 4V1DE 3FUDA 3S35X 3AU1B 2WCSA 2EVFA 1MCIA 2Z92A 1GPOH 1N12A 5K39B 3AY4A 3D2UB 1ZA3A 1V3MA 1I8IB 2X6MA 2H2PD 4JO8A 1EHAA 1BVKA 4KWUA 3ZYOA 5C7XL 5CINL 4IBLT 5KYYB 5BZDB 4QRBA 4R4BA 2C9QA 3SD5A 3WLBB 3O4LA 1K4DB 1D9KB 1RLWA 1LNUA 1MRFL 1FUNA 1HX0A 4Z7UE 4Z18A 2WB7A 4OJYA 5TDPB 1MCEA 4OZGF 5D2NA 5E2UH 3W9DB 1Z5LB 2ZOLB 2HYMA 1IGYA 3GSRB 4HBCL 3E9TA 3UABA 1INEL 3NZHL 3GSXB 2J2ZA 4LASL 3S6CA 3E1ZA 1O6SA 1IARB 4Z7VF 1A6ZA 1DBBH 2ZPKL 3BAJA 1LQSR 4MQXC 4OD3L 2BCMA 4JQIL 4AK2A 2D9CA 1IBDA 4PJFF 3T5WA 4IRSB 5IV2A 2X1PA 5LWYH 2DEYX 4Q6IB 1T04B 2GJ6B 1CGSL 2NY0D 3EO0A 4ISVB 4N0CD 2D3NA 2Q7AA 5CD3B 4WEBH 3KPOB 4XBPB 2X4RA 1UXSB 2V2XA 4WFEE 4M5SA 4DP2X 4NNPH 3WUZA 2BSCA 4PG9A 1G9NC 4MS8D 3EAKA 5F7KC 1MCCA 3FAWA 2BY2A 1JVKA 1A7OH 1MEXH 3CZFA 4NKOB 5C2BH 2CCWA 4J4PA 4XB3A 3RA7H 3VQ2C 4KO7A 3S8FB 1B4LA 1NBQA 1I9JL 2NY1C 5IIEA 3ZU8A 3GO1L 4MXVE 4A7GF 2CO6B 1UXWA 1RJZA 4G5AA 3ZZLA 1KJMB 1IKOP 4X6CB 5BW7C 5DGQA 4A7QA 1UWEH 3EJZC 4NKIH 5LLIC 1RUKL 5BZZA 3HBPA 3ZRCC 4MWFB 3MV7D 1CDBA 5D5MF 1JERA 3X17A 1UGNA 5B8CB 1PEZA 5J1SC 1YYMH 4AC2A 1S7RA 1G0DA 3VG0L 3WKYA 1F4AA 1WH0A 2XN1A 4JDVA 1NMAL 1NCUA 2A6KB 4MNQB 2NTFA 3GSQB 2PPDA 5DUPL 1QSFB 2AJSL 4PLOB 3C5SA 4OFIA 4IEFA 4KKLC 2CJ3A 2K6WA 3LKQB 4YL9A 1CTNA 3B7YA 1O75A 3CMOL 3QDMA 4HC1A 4CKVX 3M8OL 3SPGA 4GW1A 3TIEB 1E9PA 3NBNA 3TF7C 1BIIA 4O58L 3QUZC 5I23A 3CFEA 1KIQA 2G4GA 5DD5H 2YGNA 5CP7B 1YHPA 1XH3A 4BH8A 3FQ4A 4NC1C 4CJ1A 3VWJD 4L5FE 3TOPA 1BXUA 2B9BA 2EH7L 4PBDA 2VW6A 1BBDL 1S7TB 5HYQB 1NFDE 3I2CH 5L4MA 5H35A 1G7LB 3HNTH 4RQQB 5FV2A 4WU7B 3QPKA 1MJ7L 3F2LA 4URKA 5KSBB 1ZT1A 1DBJL 5FYJD 3QUYC 3P3UA 5KSAC 3ARBD 2GJPA 3WY4A 2DQDL 1BLNA 1W72A 3GXTA 4MB3A 2VLRE 3CDGA 1HWHB 3NFSL 3W39B 1QHOA 4RISL 3HPJB 2KBGA 1G6VK 5FYJH 3HUJE 3JVFC 4PMEA 1I4FB 4LKCB 3OKKB 1CD1A 4P07A 4XMPL 1NBVH 2A9MH 1BZ9A 4AM0Q 3DRTB 4Z3FA 2PETA 4N6RB 3BSGA 3TV8A 4AYMC 2NCEA 4JQIA 5IY5B 1L7TL 1CWVA 3QYNA 5C0AD 5DD3L 3SQBA 5CZVL 1BP3B 5JNYB 1IBGH 1XR9A 4CN1A 3C12A 1D5XA 1X7QA 2BHUA 3CN0A 1ERNA 3TU6A 2B0SH 5I1EL 4MJ4A 1PCSA 4GRWE 2HVJB 4PWHA 1X6LA 4RGMB 4ONGH 3QUHA 5KJRH 2VDOL 5EBWB 1KLGB 3HCVB 2HVKB 2H3KA 4JJ5A 3MRGB 4LKXB 1V27A 1C08B 1K2DB 4PREA 1FL6B 1NGXB 2DYPD 5D1ZI 1FH5H 2BVQB 1XGTA 1YEDB 4OZGB 3VGBA 3K8KA 1GYWA 3KPSA 3QR2A 4LPVA 4S1QL 5DD0L 3ZL1A 4DEWA 5HD8C 3F83A 3JSSA 3I9PA 4NQSB 2G2PA 3U4BL 3H42L 5IB3A 4MD4B 2GC4C 4B9FA 2WINA 5D7JA 4TPRH 2DQJL 3DBXA 1BVZA 4Z7VB 4WI0A 1JF6A 1XGYH 4JDTL 3QRFM 2F08A 3DHMA 1MZZA 2ADFL 2ED6A 1E6OH 4OCYH 4UT9A 2VDKH 3MBED 4PJFB 4EDWH 4O02B 1YMMD 4ORZC 4AC4A 1OP9A 5EEUA 5DS8B 5IJCC 1H0DA 3CSGA 5GS0L 1KTRL 5DJ2B 4NI3A 1G0XA 3DUSB 3K6IA 3QG7H 1VZGA 2OI9B 3V79C 3ESUF 1RZ8A 5AW5B 1EXUA 4ODXA 5F6HJ 3V7AE 3Q48A 4PJBA 2WB1A 2WQUA 3D2UD 4EDXB 4K9JA 3AB0B 3MGAA 4P2RA 4FTDA 1FL3A 3BCDA 5KW9L 3ZHLA 3WNPA 4G8FA 4DEUA 1BG1A 2X9WA 4K7PH 3U4EB 4JHWL 1YEFL 2C34A 2EYTA 3LNGA 3MRKB 3N0PB 1T89C 4RMRA 2IADB 4WV1A 3FPYA 3MOQA 1N8ZA 4ZXBB 4HG4K 3DOSB 3VSQA 1LWHA 5SV4A 3UTZB 1RJLA 4I77L 4Z7AA 2WSDA 1MHCA 2EYRA 3FT2A 4YOKA 5AZ2L 3QUMB 1OF2A 3WGUB 3VD2A 1PLCA 4LGSB 5TDOA 2VDPL 4ZUSA 5IWLA 1H5BC 4LSSL 1UWGL 3QIBA 4TSBH 2CNZA 4GAAA 1QBLH 2AABL 2J88H 5C0BA 3VG9B 4PY7B 4KHTL 5A6MA 3GI8L 2XN9E 2GJ6D 3HS0B 2QQNH 2WXFA 1FZMB 1A3LH 1DJGA 4OKDA 4UB0H 5DJ8B 1NSNL 1U36A 2CLRA 3B6SB 5AOKA 2BP5M 2GW5A 1TMCB 3QI9C 3JTTB 4H8WH 4DN4H 5I1HH 4RZCA 3KYNA 4PB0L 2O93L 3QQNA 2BY0A 3D05A 3LTVA 5E70A 1CU4H 3ZMEA 3RWJB 2G75B 4QGYA 3EFFB 1XF3B 3UROR 1GSMA 4O4YH 3FCGA 4FGMA 1WD9A 4X7EC 4CC1A 4AWJC 3WTVA 43CAA 4GUPA 2NW3A 3U6RA 3I75A 1LEGA 1S9VA 4MMYB 4BIKA 4E5XA 1ZLSL 1FI8C 2IALA 4N9GB 4NFBA 5D7IE 4JZNA 4XRCA 2PP8A 1JD7A 4U3HA 2Q0ZX 3H7LA 4GQ9L 3CH8A 5IQMA 4XNQA 4PJAA 3I3BA 2QGBA 2XFXB 1JZ7A 1QSVA 1CB4A 2AQSA 4HEME 4JPIA 4GFTB 1MCBA 1L9RA 4ESKA 1FIEA 4U6TA 3V0HA 3L1OL 4FNPA 3MUZ1 1KIRB 4HXAL 2JLPA 3F7VB 5A1AA 1QEXA 2AW2A 4N2MA 1BXXA 1QSFD 5EZPA 4IRZL 3D0VB 3GJFB 1PNDA 5C9KA 5HYSG 5EU6A 4NWTL 2BM3A 2C9VA 5C8JB 4PB9H 2Q8BL 4MS6A 1F4XL 3IU3B 1AQKH 3BW9A 3VD5A 3TX4A 1SXSA 1IGJB 4YO0A 3SDXA 2O5YL 4PJ5B 4UINH 1OE2A 1XEUA 5JORB 4AQAA 1X5IA 3LKRA 4WK2B 5A2CA 2G5BA 4OZHE 4NCDA 3QYMA 3LZRA 1UD2A 2YD7A 3BIAX 3LRSA 3RL1A 4BWWA 1Q1PA 2F74A 4YHIB 1FBIH 2F5AL 1UUSA 2X2UA 5EOCJ 2M1KA 4ATTA 4HW6A 4KKPA 2FVNA 2AQ1A 2OFQA 2WSKA 2HMID 2CPCA 3B56A 4LVOB 4UOQA 2OK0H 1RUPL 1QR1B 2JE8A 2IGFL 4IIQB 3CLWA 4UQ9A 1BQLH 5E6IC 1MJUL 3TBYB 5EU4B 5T5FL 3WKNA 3VWKA 1S46A 4LOUD 1AGEB 5FHAH 2MQ0A 2R23A 1PVHA 4DO4A 2UVEA 4PRIB 4GI9A 1N6QH 4FYQA 4C58B 3G6JF 1RFDH 1THCA 1I9RH 2VE6B 2MOQA 3ZUNC 1LO0H 4QXGH 4XE5B 4BGDA 2VLLA 4ONFL 2AEQL 4PSPA 3CPUA 2I9LB 2R29L 3HZMA 3DYPA 5DI8A 1KPUA 4AZUA 3QAZB 5FHBH 5JIIA 5JUEH 1B4TA 2OYMA 4Y4HB 2WN2A 4KROC 1AE6L 1U58B 3PS6A 4RAVB 2J7LA 3E3QC 3KGSA 3NDYE 2PO6B 1RPUA 1I7ZA 2K6ZA 4XN1A 3F7YB 1KXHA 4TYUA 4IM8A 1KJ2L 3KWVA 1A4JA 4M7ZC 4F3FA 2NLJB 3D3VA 4L4VA 4WK0B 3SDDB 3ESPA 2ICES 3IAQA 4S0TD 5I2IA 5JQ6H 4OI8A 2AKRA 4AH2A 1KPVB 1ZTXL 1EVTC 4KRLB 5AZUA 5HI5D 1LMIA 3VI4A 1N0LB 5FCUL 1LO4L 4KK6D 2MPAH 1UB5A 1A7PH 5DK2B 5FGCE 2HFGH 3IJYA 5CD5C 3TBTB 1CFSB 4LPXA 3CX5K 1HZHH 4N90E 4GH7B 1C5BL 1ID2A 2H4EA 1UZ6E 4G11A 4O02H 4G8IA 4Q4IA 4X98B 1BVLA 4NC0B 4ZS7H 1T7YA 5DF0A 1X4YA 1BQSA 1HXKA 4P49A 1SVZA 3CBJB 1F90L 1DUZB 4PWIA 4EN3B 4RDQF 1OTUD 4XVTH 4FTVA 2WP3O 3KCPA 5IVOA 3FH7A 1L9SA 5L2KB 5KVDH 1N3NB 1NCWL 3A21A 5EPMA 4ZXBD 1E4KA 1CE1H 2Y6SC 4NZRH 4U4IA 3JWOH 5JXED 2WWNA 2OM5A 3ZHKA 1F8TH 1FFQA 2P4AB 1PZ5A 1YNLL 4X4MA 4Y4FC 3SPVB 4G9FA 1OHQA 2VO8A 5H4ZA 1AYRA 3MLYL 1FIGL 1A6VL 2NCMA 3UAJD 1R17A 2YRLA 1S7SA 4J3BA 3RB7A 3LN4A 3BZFB 3X11A 4H4NA 3QUMH 1WQVT 2GTQA 3QO0A 4TUJA 5BQ7A 5DMKB 3PABA 4KRNA 4QHMA 2X4NB 2UY6A 4GBXC 4Z7UF 4HUMB 4OQTL 1WA0X 4CNIA 3MLTA 2VDQB 4QLWA 4MNGB 1QYGL 1U93A 5DTFB 1AO7E 4Y9FA 5MHSD 5HYSA 2WXQA 4NQVB 4PGDB 5ISZE 4YGVB 3RYMA 1WEJL 2HT3C 1H19A 3RPIA 1IC4L 3MRNA 5DHYB 1VFBB 1BWWA 5GGRA 1UURA 5LAPA 4FQQB 3WHXA 4X0KB 4XOAA 2XWRA 5J6HB 4KK5D 5DCCA 1MHHB 3PU7A 1U8JB 2H32A 2DQUH 1A6AA 4QYOB 4OVUA 5E2TL 3WN5A 4NUGH 3IDMA 4ZQTA 4LEXL 4BKLA 4DOHE 4N0FB 2HLAA 3GXFA 3O6ML 5IMOA 5E9DB 5DEGA 5IBTH 4UAOC 3B2XA 2DQFB 4FQHB 1U8OB 4PN6A 1T03L 2FAUA 1B4RA 3OXSB 1WCBB 2GFBB 3N1MC 1EO7A 4J3VA 4U0RC 2CDFA 3SGDI 1ORQB 2K3HA 1KJ2A 3F7KA 1LEIA 3B9VA 2X7LB 1QBAA 3UACA 3GS4A 3S96B 3STLA 2Z35B 4F1SA 5KS9F 2ESVE 3WNIA 1O7DE 3WXVL 3LDBC 1FSKB 4P3CL 2NXYC 4Z95H 3VFVB 1M7IA 2VC2B 2B39A 2ZWZA 5ABAA 1J88A 3G6JB 4PJ9C 3K0YA 1HDMA 2XWTA 1N6UA 1KEMH 4NAJA 4HPYL 1PNCA 1UOVA 1AI1H 1TEFA 1RPQA 1MUJA 2DLIA 5HTSA 3LQAC 1W8EA 4KK9C 4PJ5D 2DLFL 3EXLA 3TJHC 3NK4A 2LQRA 3O11A 1R5VB 2WZPD 5IW6A 5E8PA 4DAGL 4GKSA 1M4KA 3K5RA 3L4CA 4OM0L 1H8SA 1I9IL 4ZTPL 2ADIB 1MDAA 1MFCL 3QJUB 2HG5B 3BI9X 1NCIA 4WJ5A 2I7OA 1RMFL 2FWUA 1RPKA 3MRPB 4HLZH 2WLIB 4PGBB 5FGSA 1KIUB 1BA9A 2W07B 2OR9L 3VX0A 4WI5A 1DO5A 1RZGA 4I1NB 1ZANL 2YEQA 4RFNB 4N8VA 1QASA 3ZDYE 1UVQB 3CLFH 3KBEA 1SFDA 2M83A 2EDEA 3JUYA 2C3VB 5GSVB 1IC7L 1KN4H 1ZLDA 1J8RA 2H3NB 4ODHL 2BVEA 4PG2A 3RIAK 1AGDA 1IE5A 4JG0H 4XXCC 1E9OB 2CM5A 2KKQA 3FKUS 3QCVL 4ZUWB 2J8UE 5ID1B 1NFDF 3GZKA 3MGTA 5IW3A 4PRID 4Y9CA 4HUKB 5E7FA 2TRHA 2Z4QB 4YSSA 2F7IA 2HXAA 4PGCB 5FUCE 4DUWA 4KK8D 4OQTA 3IJEB 1P7KA 4YXHL 4XMXA 4EBQL 1GMEA 4QTIH 5LBSH 2YC1B 1TCMA 2H9GB 1HT6A 5IESH 3NIGE 3ZQXA 4RZKA 2FWOA 5AL0A 2YRZA 3HFFA 3P4OA 3T2LA 5IJDC 1W2KT 3T4YB 4D0BB 1FF5A 4XN7A 3HI6H 1KYDA 2WGXA 4QTHB 1KB3A 3SPHA 2ZUTA 2EIEA 3VFRA 4B9KC 2YD8A 1IM3D 1DN0A 1LD9A 2PO6D 3NCBB 4NBZB 2NY2C 4NM8L 4V1DB 4B5ZA 5MI0C 5BVPH 1IZKA 3A67H 5AB1A 4PRHA 3SPCA 1OP4A 1XCWA 2CZNA 4GRWF 5KVFE 4LIQH 3SDDD 1COBA 4JFDA 1TU2A 3AQYA 1MQKH 2ZSWA 3BFQG 4Q0XL 4ZW8A 4K3JH 4MCNA 5D1QA 3Q6GH 3QJFA 3GXUB 2ZUUA 4KH2A 1MFDL 1KCLA 2QSCH 5HDBE 1I1FA 4JFFA 4Z7UB 2OP4L 3BAWA 3KDPB 1NC4B 1CD0A 3AXLA 4GP4B 2VABA 1LHZA 5GGQH 3UXFA 4ZMOA 3L3JA 4ETYA 1HHJA 2BXYA 4N2KA 2P26A 3IXAA 5CHNA 1UM4H 3KLSA 3LNFA 3D1MC 4G1MB 5TE4H 4EN3D 1A7RH 1ROWA 4MCYA 2ZAGA 4TTDC 5I1DB 3C8KA 4H0LC 4G1EA 5F96H 3ARRA 5L2KD 1QWNA 1T7VA 2GK2A 2ERJC 4FQIH 3RTLA 1XWVA 1Q38A 5BOZG 4TVPD 3WCYA 1SYVB 2W94A 2AAAA 1E4JA 3FQRA 4KI5C 2CU9A 2SEBA 1CK0L 1GZHA 1QFPA 4Y5YB 2R7EA 2VDRL 5DJZA 5I73B 1UQSB 2VSMB 2XCMC 3FT1A 3LKNB 3R4DA 4N28A 4ODTL 4PRDA 4FE9A 5GISL 1S9KC 3HAEA 1TENA 4AGNA 2X4UB 5EEZA 3B9KB 4I18B 4JHAL 5DD1H 1DBMH 5EF2A 3GSNB 2HRLA 1J5OH 2R1WA 4N5ED 1EZVY 2F8IA 4HWBH 4AXWB 5I66A 3QEQA 4Q52A 3B43A 1F45A 1YC8A 3GPEA 4NQQA 1BQHG 2AVFA 1N2RB 1RK1A 4EIBA 1XZWA 2YD5A 2BP0A 2OMBA 4HUUB 1MIML 1TLKA 3DSNA 3QS3A 5E5UB 4NUMA 2J20A 1HZLA 5AYUH 4EXPX 1KTDB 3VFNB 1I8LA 4QXUL 3RJDA 5E6RB 5I17B 1G7PA 3I50L 3L5XH 1MJJB 1QLEB 1CLOH 1H3WM 3RBSA 2XT1B 2FB4H 3E6HB 2VDQH 2VRAA 4OJEH 3GXIA 2WO3B 3K7UA 4KTDL 5FA3B 1N26A 2OMUB 2XQBL 4HDIB 5A3IC 4OCWL 5FYKU 4KUZL 2DIJA 5CCKL 1YECL 3CVHL 2E7LC 1SDDA 4M61A 3O2WL 5DJDB 4P2OC 4PV8B 3N3EA 5EO1A 3EF7A 1ILUA 1X5AA 3CDZB 3BLBA 5E99H 2BNQD 1V7ML 3LVEA 5IB5B 3PHQB 5E9DD 4OJDH 4GINA 4JRXE 4TVUA 3DNKA 4KDVA 2LLNA 4AM0B 3KYMA 5ELIA 1WZLA 1L5GA 4JO2H 1KTJA 1OT4A 4XAKE 3T8XB 1QRNA 1T2QL 3ME0A 3Q1SL 2OMYA 3H53A 2VR7A 2DEWX 5B4MC 3ECBB 1YYLL 3DYOA 1VGKB 1WS7A 3Q2LA 1F97A 1WITA 3U7WL 4B60A 4L0PB 4MA1C 4P5TA 2EE0A 4FFVC 2XN2A 2NY4B 2NNXA 3KNBB 1DJHA 1NFDB 3OKEB 3AQZA 1JWSB 1DJXA 4Y16A 4OZ4B 1BFOA 3GWJA 1A9BA 1IKFH 3QDGA 3KXFE 2IBZX 5F9DC 2VISA 3HZYA 1TO5A 1H3VA 1FGNL 1D5ZB 5K9OA 2VLRB 1OAQH 2VC2H 1ZS2A 2XXFA 1K9TA 3NIFF 4HKJB 2IO5A 3KYAA 4I9WE 4IOSA 2X42A 5DHMC 5KN5B 1JAEA 3HUJB 1CCZA 1FO0L 4JQXA 3CC5B 4QTFA 6FABH 3IU4L 4P23A 5KBDA 4EI6B 2PUQT 5IVZA 4APXB 1FCCA 3MRLB 4QRRE 3ZKXB 2FX8L 5IT2H 5AUMA 3V55A 3OB0K 4FX5A 3C5ZB 4CBZA 4J8QA 1DQQB 1M7DA 4G8EB 3NP4A 1I9EA 2XV0A 3LHPL 1ADQH 1NC2A 4OB5L 4Z0BL 2V3EA 2IDTA 4WW2A 2NYKA 3FO0L 1G9MH 2V3FA 4GRWB 1DZBA 1AHWC 3JWDC 1KC5H 3EYSL 5FYLE 3TYGH 5E0QA 1N7MH 2F7PA 1J0YA 2A99A 3QULA 4TLSA 2BRRL 4N8UA 3FF8A 5IFJA 4S11A 3GKWL 2HT2D 1JPTH 3APFA 1BQRA 1AY1L 4RFEB 3WTYA 4TRPL 4PEEA 4EQ2A 1MWAH 1HINL 1H3XA 1LP9E 1HL5A 1IL1A 3O9WC 2B1AL 2ZCHL 2AGJL 2ATKA 3KR3L 1G5GA 5F97E 3DX8A 3H3PH 1GHFL 1SBSL 4AEFA 2VERN 4PVNA 4AQ1B 4LCWE 1Q4NX 3GM8A 1W8NA 4C83A 5K9JL 2PTTB 5FX3A 4R26L 3H8NA 4GQRA 3ARGA 3LEVH 4F58L 4PGEB 1SF5A 1SYSB 1RZJL 2JIXA 3NYKA 4P59H 2KERA 4IU3B 3VD7A 1FVDB 1JP5A 2V17L 4LLUA 1BZ7B 1RP8A 4AV0A 3CDCA 1WGOA 2LVEA 3IDJB 4YC2C 5HGHB 3RGVB 3K81A 2E47A 4J1UB 3NPZB 2IDCA 4PV9A 1NLDH 1IJNA 2N7BA 3A6OA 3I02A 3LKOA 2J1YA 4H0IA 2OL3L 2XV6B 3K74B 5F88B 5EZLB 3CQQA 1QAWA 2VITB 3INUH 4HQQH 1LE9A 1VGEH 4FYTA 3MBXL 1NC4D 1T5KA 4K94L 1EAPB 4U1LB 1OAJA 5H37G 3WIIH 3TO4A 5I1KL 1T66C 4UT6L 3BZ4B 3TCLB 2X89A 4XX5A 4F37F 1B9KA 2CALA 4Y5VC 4DCQB 3L9YA 5SWZE 3W11D 2BMKA 4R4NC 5I74C 3VYPA 5T3XL 5IFHH 4YDVA 4TQIA 4K2UL 4XB7A 3WTWA 4FXKA 3I6SA 3NJIA 4XNYL 4AJYV 1FO0A 2DKUA 4M4PA 1HQRA 2WLNA 3NPSB 2XN9B 4GP8B 2XKUA 4XMUA 5FYKE 1HHHA 3RURA 2HKFH 2W65A 3MZTA 1DUYB 1UZ6F 4YDLB 5AB2A 3ZL4L 2FBJL 4BZYA 4GSQA 1HE8A 1PW3A 5CEXB 5MP6H 1JFQH 3KL3A 4WFED 3B9KD 2FGWH 4JB9H 2WCGA 1L9OA 4QHPA 5CIPH 3O3DA 1JGDB 3LRLA 4HS6B 3RVVD 2ZYRA 4YPGB 5E1AA 4F5CA 1HSBB 4N2EA 4PJEE 1ZK5A 4PLKC 2BZ7A 1GZQB 2UXTA 4XMKH 3NFNA 1TVBB 2QFPA 1JPGA 1VDGA 5D7IB 2XTJE 4JPQA 4QO1A 5DRZB 4UV4H 3RRQA 5HYEA 5I8CB 2GK0A 4FEIA 4XZ4A 1N5YH 4KJPC 2DKMA 3LZQA 1AZNA 1QNZH 2IMMA 2WIIA 1S78C 2EYSA 1QI4A 4AMKL 2FIKA 4J3TA 3ECUA 1LL1A 2EKSA 4F91B 3RWIB 1R33A 4OF8A 4J3UA 3UZEA 3ZKMC 2UYLA 3IJ9A 3L3OB 3OF6D 2RCSH 4FRWA 4HS3A 5HJGA 1B3JA 4TN9A 5MEQB 3UPRB 3GRWH 4M5YH 3PNWA 4NO5B 4HIEB 5DR5L 4M6OL 7FABL 5E1IA 4MJJA 4U33A 2PR9A 2CHZA 3VSTA 3W2DL 1SEQL 3DPDA 1GYVA 3MYJB 4XPTL 2XZCH 3QS2A 3ZHFA 3P4NB 3DI3B 1MLCA 3GQFA 4DTGH 3VH8A 2ZWSA 3KS0J 2OW7A 2GAZA 3BESR 3OKLA 3WBDA 4OAWB 3OMAB 4D9RE 3ESOA 1F42A 4IMKA 1UJ3A 1TVHA 2OL3A 3FO2A 2NY4D 3DUHA 2NNCA 3L4XA 1EK3A 1GOFA 3IWUA 2E9BA 4WUKH 4ANWA 3EH3B 2XWDA 2FSEA 3DIDA 1X9LA 3D52A 5AVVB 4JFHE 4L5FH 2VZSA 1DCEA 1WWCA 4G43A 4MAUL 3EDEA 2DMHA 3AC0A 5CEZL 3NJLA 2VLRD 2Y36H 4LLWA 3TBCA 2C1OB 5BV7L 2O26U 1Q8MA 2Z8SA 4LCCB 2N0KA 3BD5A 3QZPA 4UT6A 5BRQA 4YSQA 3MOBH 1UENA 3H56A 3BE1H 1DP0A 1SOKA 3MVSA 3SKMA 5BMFL 1BPLB 2VLMD 4U1HA 3V0VB 4NJAH 1XIWB 3SQOH 2IANE 3F01A 4L3CA 3FBQA 2EEFA 5ALCH 1SY6H 3C5ZD 4E9TA 4LVEA 1GAFL 5H2BB 2MJWA 2DW5A 4LHUA 5HHOA 1KB9K 1PD1A 1UYWL 2Z93B 4QGTA 2CIKA 1L9TA 2NY7H 4FDWA 4MJ5B 4F2ME 1Y7VA 1H3PH 4FXGA 4YFEA 4BUHA 4Y0GA 2X88A 4KX7A 2IMNA 3BSZL 5LDSA 5CJ8A 1A8ZA 4JO5A 5CCGE 5J9PA 1J05B 1NOFA 1RJYB 4GRWH 4B3VA 2ZSVA 1N0XH 4XPGL 1GR7A 1DSWA 2HKHH 4DWHA 1JXDA 4U1NB 2V7NA 4NPJA 3B9EA 3ZIYA 5BJTA 1UT1A 2LFGA 3TXAA 2GBAA 4K15A 4LDEB 4UTAH 3DHPA 1SLXA 4LMQE 2CQVA 5CSZA 2PXYA 4ZYKA 5LUMA 4E9WA 4L1BA 4L8BB 5JIKA 1INDL 2H26A 1FFTB 2D7PA 3PXLA 3ARYA 1P4LA 3Q1EA 4UV7H 4WCYH 3T2PA 5FECA 1E2WA 5H37A 3ZDYF 3X3GH 5DGRA 4PUBH 5KOVC 5EHFA 3EGDA 1IQDB 1ZIAA 2ZWKA 3J8F7 3K2KA 1R24B 1OM9A 3UP6A 4N0YH 1UD4A 3PQYE 1NKGA 2J8UF 3DLQR 5FGCB 5C97A 3HKFA 3MMEB 5ES4B 3F7QA 4JFQB 1WYJA 3T4AB 2L4OA 5E8OA 5EC2B 3L3GA 3S3PA 3CFKB 2GITA 2BVTA 3DDFA 3OPZH 3RGVD 2B14A 3C6LC 1HJCA 1ZJBA 1DBBL 2VERA 2OMNA 4HJUA 1D5BB 3NIGF 4TULH 3RZCB 3CGTA 1NA8A 3W9EA 5IK3A 3P73B 5CZKA 4WKZA 4XO9A 1Q90A 3O4LE 3ZO9A 5IQ7H 2OXHB 4OFYA 3G6DH 4YPJA 2W80C 1M6OA 4AIOA 4XCYA 5ICZA 2G30A 3WEXA 1CL7I 3QO1A 1JMZA 1WDAA 3L3HB 5SX4H 4WEBL 1PYWB 2Z7UA 3QQ9D 3QJTB 1EXHA 5TQ2L 2PP7A 4TSAH 5E8DL 4NNPL 1Q0EA 3V5HB 4QY8B 5IP4A 4TNFA 1YPZA 3PWUB 5E4EB 5EUKB 5GJTH 4M3JA 4LLDB 5I8EA 3WFZA 4QHNB 1MEXL 5C2BL 2P8PA 1QBML 3WTXA 2APSA 2YD9A 5I76A 4K71B 1RUAH 5I15L 3M6DA 4PJ8A 4XVOA 2EIKB 3Q9QA 5F1IA 3S35H 3R1GL 5IJKC 3HLAB 1AZRA 5HDBF 5FDYA 2XN9D 1KCWA 4RMQA 1F3DH 2G9HB 3W5MA 2JSFA 4MXQD 2ENJA 1WFNA 1T6WA 4NKIL 4TL4A 2VDNB 2EABA 2VZUA 2K9UA 4H8QA 1AO7B 1S7WA 4M03A 1FNLA 4HUVA 4JL2A 5ISZB 1SZNA 1YDPA 3TJEH 4B7IA 4MRBA 1QLRB 1FPTL 5JHLL 3EHBC 2HTLC 1WLHA 5L4IA 3KGUA 3AFLA 4GKZB 4XCFH 4NRYA 2DQCH 4DEPC 3M7OA 3R06A 2EDXA 4Z8FH 1F56A 1YAZA 4NQDE 1JWMA 2CBTA 3BSZA 1ACCA 2FQGA 1BXVA 1R9FA 2CG9X 4DOHB 4GIPD 5K9KA 4FQXB 4ZMTA 4QRAA 5INDA 1IFHH 3U25A 1JCVA 4IBSA 4G7VL 2H1LM 4BRJA 1DVFC 3OQRA 4HLEA 3RNKA 1GZPB 2K78A 2W1NA 2WKOF 1T2JA 4YXKH 2EEDA 4PRPE 2V0AA 5EWIH 5JOPE 1Q9WB 4DPRA 1MFBL 1JZFA 4G8AC 4NZDA 4QOKE 1G0YR 1JPFA 4PCSA 1ET7A 2Z31B 3M1BB 3CU1A 2ESVB 3I2CL 3HNTL 1IO4C 5B3JE 2F8OA 3QNXB 1TQCB 1T20B 1PY4A 3BVVA 2NNAA 5JHBA 4JG5A 1W0WA 1ZLEA 1WRFA 4UMGA 1X5MA 3LD8B 4DKTA 1R3HB 3IS1X 4GKNB 3MREA 3LN5B 3QJVB 4PU2A 3FCBA 3VI3F 1NBVL 2A9ML 4WEUD 2WIMA 5GGSB 2AJZB 2W8CA 2EEXA 4PLNC 5KSUB 1RHHB 2EO9A 4YDJB 5E4OA 5D4QA 2VMEA 4W9DC 4MD5B 3OR7A 3BP4B 2VXUH 3MRBA 1XL6A 1FNEB 1NUFA 4YBQC 4AYEC 2B0SL 1L9MA 1I7RA 2D2CC 3U48A 4ONGL 3T2OA 1LK2B 4ODUB 4G42A 1S3RA 3MQIA 4LEOA 1T0MB 3ZDYB 3HEIB 4DESA 4XMTA 3BEWB 5SX5K 3IKKA 4N1CA 3IDUA 1SXNA 4R7NB 4AYDC 3QK0A 5FW7A 4OV5B 5IJBC 1XIWD 2CLZB 2J8UB 5AW3B 3ZGHA 2ICEC 4HMEA 3QZWB 5GHWH 4G6AC 5IHUH 4HT1L 2XJLA 4CVXA 1LO2H 5TPWH 3CZUB 5D2LA 1XAKA 5TH2A 2VSCA 3U7AA 4TPRL 2BERA 1PZDA 2H1XA 4G59C 4IOFC 3VSVA 3U0WH 5TD4A 1H3UA 3NIGB 25C8H 3NJFA 4X8GA 3R8QA 4OCYL 1PTZA 3L3DA 5IHBA 2K6YA 3FT4A 9CGTA 3QXVA 3STZB 4ELKA 3MV7A 3LY6A 4EQ3A 2AITA 3QJXA 2HSIA 1ZLUH 3L2MA 3EDFA 2RB8A 3QG7L 3DIFB 3WUWG 5CJOH 1QVOA 4LEEA 1IU1A 2WNKA 2KZWA 3BUYA 4DPBX 4AQOA 2DOCA 2GT9B 4TUOA 1DDTA 1FVEB 3SDCC 3NZ8A 5L9DH 1M7XA 5LBGA 3RVXD 3VVWA 3VNZA 3ML9A 4B5EA 2ATPA 2ZUQB 4HOZA 4M6MH 1OCWL 5C86A 3UTQB 3CZNA 2KPNA 1YA5A 3QEHA 5EU7C 5D9SB 3CFDB 5HDBB 4OLWH 1ESOA 3EYFB 1AHMA 3NGBC 5JZ7C 3C08H 4N90D 4EKXA 1LP9F 4U1JA 3RIFK 3VWJA 4ENED 4X4XA 5HVHC 2KZBA 1J87A 3C5JB 4P2RE 3OZKA 4M5TA 4BCXA 3LV3A 3Q7JA 3L7FA 1YEWA 1WUNT 3RZCD 3V0GA 2A2QT 4TSBL 4XNDA 2JV6A 1SJVA 4X8JB 1BZQK 1IJ9A 2E7DA 2V2WA 2J88L 4NGHH 3QPQC 5J4MA 3BC9A 3ARBA 1OTTD 5F7EH 2AERT 1D3CA 4X5QA 5DHVB 4IKIA 4J7RA 4ZS6D 1A3QA 2QQNL 2YGQA 4WJG3 1A3LL 4UB0L 3B2DC 3EJYC 3OKOA 3A24A 4RAUB 4E9VA 4FQCL 4M3HA 5JOFA 4H8WL 2WLHA 3PXJA 4HUXA 8FABA 3HA0A 4CL7A 4XWOC 3OLEA 4F8LA 4JRLA 4S1DD 1VFUA 3CX2A 1HE7A 2J1XA 1WICA 3CSYB 1CU4L 2QKIB 4KKRA 3H7BB 5DFTA 1FCGA 1HVXA 1TQWA 2J12B 5J6SA 1ZMYA 4O4YL 4HZLB 5C0AA 4MAYB 2BDNL 3QC5X 1A9EB 3H3BC 4XPAH 5FEBA 3CLEL 2Y1YA 2JCCA 4XPBH 3LS5H 1D7FA 4MMZB 5E51A 2VAAA 3GBDA 3QUXB 2FX7H 1XL4A 3RTQB 2CO7A 1MLBB 3JWNC 5IMKB 2XPYA 3C87A 3SE4A 3MJWA 1AMXA 4GG8A 4XBGA 3ES6B 1PG7L 1V10A 3HOGA 1WHPA 4PJDE 5ISZD 2RA1A 2VDMB 5E24E 4DPAX 3WE1A 2VDNH 3NCYS 3SYOA 3EJSA 4HX1B 4UM9B 2AJYH 3AMKA 2K7PA 4BZ1H 1UFGA 3KLDA 5EBMA 2VN4A 2YXVA 4FNRA 3QDAA 2WYHA 4XE0A 5AVRB 1SRDA 1FC1A 5GS2D 4PWKA 4Q9QH 2DDQL 1UWXH 4FQXD 5TQ0L 1JTTA 2DJUA 5JXAL 4JRXB 1KOAA 3MBEA 3QORC 5I24A 2IH8A 5ITFA 5GS2H 1YMMA 4DGWC 3N43B 1CFQB 3GRGA 2JKTM 5AYQA 5ESAA 2MWCA 2MH4A 4UINL 1YEKH 3QQ3A 1NCBH 1ZEAL 3KPPA 4GO9A 3IDYC 3AU1A 5DRNB 3WEAA 3WFBH 3VXUE 3RVWC 3HMXH 3Q2VA 2VXQH 2AXJA 1OAZH 1FBIL 2ESVD 3D2UA 3QG6B 3TT3H 2R15A 4P3DA 1V3KA 1JV5A 3ILQD 2OK0L 5KYYA 5BZDA 2WLLB 4WFHD 3WLBA 1K4DA 1Y18B 5F9OH 3QJHB 3SDXE 3Q8AA 4ZX5A 5T1DH 5J12C 2DQTH 2A9NH 4M7JL 3W9DA 1Z5LA 5A7EA 2ZOLA 1I1AC 3AWGA 3FO1B 3AY4C 3ROOB 5FHAL 3FDWA 3WIFB 4QRRB 3ZE0F 5D1ZB 5H94B 4IKJA 4ODSH 2EDRA 1I9RL 2CJUH 4APQB 5F3BB 4DKFH 2WY3B 5E6ZA 1DQLH 3DGGB 3VFPB 5ITBL 2HZHA 1OTSD 1EO8L 4OCXL 5E7BA 5D2NC 3ULVL 2FD6H 4G9DB 5FOBB 2GJ6A 5CD3A 2EDLA 1N4XH 4ISVA 4G6MH 1MHPL 3L3KB 2X2YA 1YEGH 3KPOA 5D70H 5JUEL 4NOBA 1YEJH 3Q8EA 2Y25A 4OLYH 3ATEA 5EF3A 3ZX1A 3RKPA 5I8OH 1TTCA 4LARL 3QUKB 1LP9B 3QR0A 2Y5EA 5GGTH 2Q6WB 2NW2B 2VL5B 4KVNH 5I1IH 4XO5A 1ROCA 1XGUB 2A83B 5JW3H 2WP3T 4W9LC 2R27A 2CO6A 4WU5B 2EO1A 2NZIA 1OAYH 1KJMA 2ODHA 4X6CA 4AITA 4HSQA 3RQ3A 3CHQA 4W68A 4ZBJA 5FB8B 5IBUB 4LCWB 4BFNA 3FONB 1IEAA 3DKHA 4MWFA 5FDWA 1RK7A 4HHAB 1HZHL 3FAXA 3U46B 4J4PC 4BKTC 2DM3A 2VN7A 4H8UA 1Q72H 3FOMB 2WO2B 3V8OA 1XGPB 4NWUH 3PNRB 1F4YL 1T1WB 5IB1B 2QT6A 4RAHA 2GBVA 2A6KA 3BWAB 2BIMA 4L4VE 5G5DB 2ADYA 4R97C 4ZFOL 3GSQA 4NUPA 3S4SB 1QSFA 1U8NA 4WLCA 3DTDA 1T1XA 3NEXA 3ATBA 5KVDL 2CBOA 3ARTA 3QBTB 5KVFH 4MA8H 3TIEA 4NZRL 5J5EA 1BPVA 2X4PB 2F6AA 3EJJX 5EIQA 1JZGA 4JKWA 1NEZG 3TV3H 4RRPM 4A2DA 3US0A 2PWGA 2C7FA 5CP7A 1U3HB 3M17B 4TOYL 2VW7A 1JYXA 4OFPA 4AGOA 4Z7IA 5D96C 2R51A 3U36B 1I8MB 3RI5F 1FRGL 2R2EB 4WSGA 4B50A 2FRGP 3IMSA 3QUML 5SWZB 3VGAB 4P5SA 5IMMB 4WU7A 3BPCB 3D69B 3LS4H 1KGUA 5B22A 1JNLH 2E6PA 4W4OC 2E27H 3JV4B 4M00A 2WWKO 2DM7A 1YMHB 1JGLH 2QSVA 4KVCH 3W39A 1HFUA 1FZJB 3HPJA 3ZKNC 3F7LA 4X7TB 1I4FA 4LKCA 4RGNE 1ADWA 1SNRA 3FXIC 2ZCZA 5DHVH 3TA3B 3DRTA 1WWWX 1H9VA 4N6RA 1T7ZA 2CBMA 1EHXA 1E28B 3FS9A 4ZMYA 3RX5A 4MAYD 2P52A 2OAAA 1RP9A 1C7SA 5JNYA 4HJ1A 4R2GD 3N40F 5K1VA 2X3CA 2QGDA 1P7QB 3LSOB 4NUGL 4U31A 3QUXD 3PL6D 4ANKA 1E5UI 5ID0B 3WTUA 2HVJA 4HLZG 4WO4B 2MCMA 1U8CB 3IB4A 2IDUA 1JYWA 2XTJB 1KLGA 1SM3H 3HCVA 2HVKA 5IBTL 3LQZB 4LKXA 1C08A 3OMIB 1MKFA 4PYGA 4XMLH 1FL6A 1NGXA 1UB6B 2JLLA 4ZMWA 1J1PH 4TF4A 3V52L 1GXEA 1YEDA 1AR1C 4OZGA 4UM9D 4Q14A 4PRAB 3VVVA 1GYUA 3HRZB 3IFOB 4QRTA 4NQSA 4XN4A 3UZQB 5C6PB 2VDMH 1PSKH 3S0PA 4MD4A 1MIEH 4QRUB 4Z95L 2EUVA 5KZCB 4J12A 4Z7VA 1NCDH 1UADC 3B3BA 1CUOA 5DMGD 1KEML 1WCQA 4K9EH 4CVZA 3BUQA 3TCTA 1AI1L 3BH9B 4ILDA 1MCJA 4JRXD 4PJFA 3N44F 3EW3B 5JQHC 4O02A 4OGXH 4XAKD 5DS8A 2M2DA 2G5RA 5DJ2A 3EOBB 3KW7A 3DUSA 4ADIA 4ZFOA 1ZTXE 2R2BB 1FDLH 3AWFA 4L48A 2PCFB 3LNEA 2EINB 4EDXA 4NKMB 5E2WH 2BSBA 4E42B 2JKNA 4EEEA 5LKNA 3MNVB 4UAHA 3DECA 1UD3A 4N87A 4XOBA 1TF4A 4AGLA 1U0QA 2X1OA 4I2XA 3U4EA 2F54A 1Q94B 3MRKA 2AQRA 3CDYA 2Q87A 3CDFA 4ZXBA 3CLFL 5AVXB 4JY6A 4A7GA 2R39A 3C8HA 3ENEA 4TM9A 3UTZA 4BH7A 2RFXB 1KN4L 3UAEA 5JXEA 2ZXEB 5AW0B 3FQWA 3FN3A 4FXTA 3L6FB 3QUMA 1OE1A 2EDQA 1E6JH 2WBJD 4XMZA 3MO1B 3MSPA 4K5NA 4QRRD 5J8OA 4P5MB 5D5MA 4RFOH 4WI4A 2IANB 5B3JF 3UAJA 5D1ZD 1EHLH 2AQPA 2DYSB 2R0KH 2IWKA 4I0KA 4APQD 2C1PB 4N0RA 1KDIA 4YHKH 3LKPB 2ZX9A 4QTIL 5LBSL 2PPCA 4BM7A 2Z7ZA 2XXGA 3V0WH 5E2VL 2B4CC 3NQKA 2MCPH 2W81C 4NQTA 4F2MB 3HS0A 4KQ3H 5FYLD 1Z9PA 3JTSA 3RFRA 1R34A 5CUSH 1BM3H 3OAWA 1PU0A 1Z0NA 1QQDB 3JTTA 2PMZA 3HI6L 3S5ZA 3AQXA 1QKZH 1ZA6B 5FYLH 1UACH 3A4AA 5KAQF 5IWLC 3GTTA 2Y3NA 4JPSA 1OWRM 3QIBC 3EFFA 2HFEB 5BVPL 3P4LA 4YZFE 4AMXA 4F8QA 4Z7WE 5EEVA 3VGHA 2GSMB 2BVPB 1BQUA 1JZ2A 4MMYA 4HGWB 4LIQL 3EADA 4N9GA 3C75A 5DJAB 3EIFA 4RGOH 1MQKL 2GQHA 3DX2A 4FA6A 1YUHA 5CFHA 4JZJB 4K3JL 4XXDB 2KLTA 5M94B 3V2AR 4F8TA 4LCWD 2EZ0D 2QSCL 3Q8FA 3PE9A 4NXKA 4HS8L 3PQYB 4WVRA 3RAJH 2DLEA 4BJLA 3BWSA 2XFXA 2XKSA 2Y3AA 4B6ZA 3H4FA 5GGQL 4AG4H 1BMGA 4X80H 3V6OC 1Q0YH 4I5BB 3N1GC 1J0JA 3I6KA 3S8GB 1KIRA 1FFNB 1IGML 4MGXA 1A7RL 1GGIH 5ADOL 1BVKB 4HULB 3D0VA 2Z1PA 2N0MA 3V0IA 5F96L 2TAAA 5C8JA 4R4BB 3O4LB 1OPOA 5JIMA 1PIGA 3SKUD 3UJIL 1DEDA 3IU3A 4JFFE 1RH8A 2FEEI 2XQYA 1T6VN 2CJTA 5H8DA 1P84K 1TUPA 1IGJA 2I9TB 2LT9A 4PJ5A 2B8OT 1U3HD 4XBEL 5JORA 2YN5A 3ARDC 3OKDB 2W92A 2WNGA 1DBML 2PN5A 2IV8A 1J5OL 1O6SB 1GCFA 1W0VB 1ZOXA 4ZMXA 1THAA 4HWBL 5SWZD 1FGVH 4H1LH 5GS0C 4DFIA 3SPJA 4EXKA 4X9YA 5IV2B 2J57A 2DWXA 2WZ0A 3EOTH 5AZEL 2WAHA 4Y2DB 5J57B 2K70A 3GHEH 3EO0B 1QR1A 5AYUL 3FN0L 1CFVH 1DQTA 1TCRB 2LABA 5FYKD 1OW0A 3N1FC 1L6ZA 4IIQA 4XN5A 1J86A 3L5XL 1ZHBA 1MRCH 2V2XB 3TA3D 1CLOL 3N44B 1ET8A 5GGRY 3TBYA 1IC5H 2FB4L 3QXDA 4AQEB 5FYKH 3W38A 1AGEA 3AG3B 3O4OC 4K5OA 3OHMB 4MQXD 5LBSA 3TCXA 1KBVA 2ZKWA 4PRIA 3CZFB 5ERWA 4AJWA 3CQFA 3T1FB 3D9AL 2VE6A 5FIEA 3SO3B 1R6VA 4FCAA 1P7QD 1X5KA 1BF5A 1QLFA 4X6EB 2WTOA 1MY7A 1J11A 3GLAA 1LK3H 1UXWB 4NQDB 1N64H 4WO4D 5E99L 4XC1L 2I9LA 2XTJD 1DANT 2NXZC 2GSGB 4BD4A 4AQ8A 2WOYA 4G80B 5JDSB 3TIDB 5KBLA 4FMVA 5C0NC 3UC2A 3PWLA 4PRPB 4ZTOH 5CLWA 5D6CA 1U58A 5D7HA 1IM3A 1TTBA 3FZUD 4LPYA 4RAVA 5BXFA 2PO6A 4QOKB 1E3FA 1G9NH 4LOFA 3PRZA 4WW1A 3F7YA 3HE7C 2NTFB 1SN5A 3C5SB 1CG9B 3APNA 4OGQC 2NLJA 1VZHA 4R6UA 5KZCD 2O30A 3GKZA 1IKFL 3DETC 2DQIH 3EJZD 5EO9B 3K4ZA 1VCBC 2NZ1A 3VXOB 2FQDA 4GW1B 1E9PB 4RLDA 4LZKA 4PJDF 1BIIB 4W81A 2VC2L 3MA9H 2QQLL 3CFEB 1TZOA 3L4YA 5DK2A 1E7UA 4OF7A 5I19H 5J11B 3NRPA 4ZNEE 5MENE 1AQHA 3TBTA 1CFSA 4IHOB 4HCRH 1XH3B 2WYZA 2BSSA 1YEHH 3AWEA 4RDQG 4FKEA 3FF7A 5IT2L 3F64A 4D9RD 4K8RD 1JZ5A 4RRPA 5H35B 3NIDE 2BLFA 4FZ8L 1DUZA 3QDGE 4EN3A 1C5DB 4M5ZH 2WCPA 4JFHD 4M6NL 3QUGA 2N59A 4K8RH 4G7YH 1JPEA 4P46A 4Y4KB 3G7TA 4LF3B 4M1CD 5I1AB 5L2KA 4N22A 1KC5L 1WBYA 2B2XH 1N7ML 2XN0A 4U1KB 4W9CC 3WKMH 1CD1B 1DEEA 1DLFH 5A2FA 1CDHA 4ETQB 1JPTL 4HWBA 5AAPA 5I30L 4O5LL 2DMKA 3SPVA 2V5MA 5AOIA 2IAND 1KB9J 2P5PA 2ZX6A 3VE0A 4BFKA 1MWAL 4DNLA 2WXOA 3BZFA 5IREA 2VQTA 5HDLA 2EECA 2CSPA 1D5XB 1KY6A 3K6SA 1O9ZA 4HP5A 1JDDA 2WJ7A 2Z8VC 4X2UA 1E4KC 2WN3A 3N55A 4Y5XB 1BAFH 4NNYB 3FO9A 4G2AA 1MAJA 4WY7H 3TTYA 4JJ5B 2XIBA 2LR4A 2R8SH 4MNGA 3P9WB 4DN3L 1DJIA 1VEMA 4K23H 5DTFA 3LEVL 2APVA 1J12A 4UDTB 4NQVA 4PGDA 1I8UA 4YGVA 3WI9A 4YLCA 4P59L 3TEZA 5DHYA 1VFBA 2HB0A 4FQLH 4UDUA 4JM2C 4X0KA 4YXLH 3WL9A 5IB3B 1FP5A 4YVUA 4HWNA 1ZLVK 1MHHA 4DO6A 2OMWB 5D7JB 5DRXB 1NLDL 4RSYA 2GTWB 4XCCH 3TBSB 4IGBC 2GIYA 2BNQA 2XBTA 4N0FA 1DBKH 4S1RH 2EXYC 5E9DA 2VN6A 2O61A 2VN3A 4LL9A 3VM7A 4WJKB 3INUL 4XC3H 3TEXA 4HQQL 1TFPA 2I24N 4FQHA 1U8OA 2IC2A 1VGEL 3OXSA 2GFBA 2W5PA 3B2UC 2AEPH 1BG9A 2UWEE 3WIIL 4O2EB 5DEZA 1RZ8B 2X0VA 3S96A 3H9SB 2Z35A 1XCXA 3GS0A 5F7HA 1U8PB 1T5WA 4X4ZA 3MRHB 4TXVB 4IBUA 4QDGA 3OJ2C 4G8FB 3X3FH 3QNFA 3VFVA 3G6JA 3U79A 2EYTB 2WUBL 4ODBD 1VLXA 3TFKC 4WV1B 3KD4A 3U82B 3VRLE 1JFHA 2ZUVA 1CF8H 1NLBL 2FHFA 1RJLB 3KYOA 4U3CA 3ETSA 3GT6A 2EYRB 4NN5C 4Q89A 5DA0B 3KLHC 2HAZA 3BDXA 3EH1A 1OF2B 5GS3A 4U7MA 3BGMA 1AC0A 1OQOA 5MP6L 1JFQL 1R5VA 1ZT7B 4MCZA 1NCJA 1RVFH 2FGWL 4JB9L 1ADQA 1QTSA 2I26N 2ADIA 5TDOB 2CUMA 4FHJA 2YK1H 3LZOA 1IAOB 3MRPA 2Z91B 2FATL 1AJ7H 4XMKL 4AVKA 4NPKA 1X7TA 1KIUA 2CRMA 2W07A 2EE2A 4Y2DD 2ZG1A 4AYGA 2CLRB 2Y7SA 1UVQA 4S1SL 4ATWA 1NGWB 3NSCA 4P9HH 4PAZA 3U0TA 1N5YL 2C3VA 4R90H 5GSVA 1MWAA 2H3NA 4Y2OB 1QNZL 4OIIH 4PJDB 1YQVH 2LU5A 4OT1H 5F7NC 1NCTA 4URTB 1ZHKA 2GI7A 5KANG 1Y1UA 4NM4L 4Y1SA 1KT2A 3T1WA 43CAB 4GUPB 3BMWA 2Z4QA 3BN9C 3NAAH 2VDOB 3I75B 3REVA 1OK8A 5DFVC 4YMPA 4M9PA 3AACA 3IJEA 1XSJA 3Q01A 4M5YL 2B9AA 2NUPA 4XHJC 2YC1A 4NQDD 5K9QI 3H0TB 4XRCB 2H9GA 4M8RA 1HQ4B 2FJGB 5I0VA 4PG2C 2BH0A 3NH7H 4TNGA 2BSRB 2SODB 1DVSA 4D0BA 4XNQB 2PWEA 3AADB 4MJHA 3NCYP 5IF0B 4DTGL 5A2IH 5KWYC 4PRPD 3UH8A 5JOPD 1UG9A 4L4TE 1J5HA 3MV9E 1UH4A 4QOKD 4DP0X 1XZ0B 2YD6A 3VXUB 4G83A 1A8JH 1GMIA 2CBPA 4BEIA 1BV8A 3ZR5A 3ZZ1A 4ZMAT 2QMJA 4HVBA 4ONHA 2XWXA 2KLRA 2LU3A 3TPKA 3SCMB 1OB1A 2VLKA 4M3KB 2Y36L 1U2HA 3BW9B 3T04D 1AZCA 4OZIF 1F3JA 2P8LA 2ZXWB 1UOLA 4YO0B 3SDXB 4Z7UA 1KFAL 1AZBA 5IR1B 1NC4A 3N85H 3BE1L 5IBLC 1AD0B 1GS7A 4WTXA 2G5BB 4J3WA 3JVGC 4WFFE 4NJAL 3RL1B 2NYZA 3SQOL 4F7EB 5E5RB 3H1ZA 1T21A 3L7EB 5ALCL 1TPXB 1SY6L 1WAAE 2NY5C 4NO2B 5AEAA 3CU7A 2E7HA 2PYEE 4G1MA 5ECJE 3VM5A 4GLRH 4YNYB 4HMDA 1UZGA 1DQML 1YNTF 3F6JA 3ILPA 5D1QC 4NZUH 5I1DA 5C7XH 2X1XR 4YSDA 2JJTC 4Y4KD 4CSTA 4JFPB 1PGRB 2NY7L 5CS7A 2VJXA 1MRFH 3PJNA 2QPDB 1SYVA 3II2A 4UUJA 4Z5RB 1SJXA 3AXIA 1HEZA 3ZT6A 3O0RH 5DHEA 2CJSA 2ZUSA 1ZLWH 1BD2E 4AJVA 5CIPA 5T3XE 1ZY9A 3VWKB 3B5TA 1INEH 4O2FB 5FW6A 1HU8A 2IH1B 2EDOA 3B9KA 3PWNA 4I18A 4LASH 2BXZA 5F0MB 2DI8A 3X13B 4EOWH 3T0EE 4AXWA 5HHOE 4CVWA 4D9QE 4UTAL 1MAMH 2VR4A 4JDZA 1U2YA 2KC0A 4QKXB 4UV7L 1DE4A 1HHGA 1EA9C 3VFTB 5KS9A 3P0GB 4WCYL 5DJCB 4OLZH 3HZMB 5LGJA 3X3GL 1GZHC 4PJCE 4HUUA 1CGSH 1KPUB 4JR9L 2X9XA 2EE6A 3VFNA 4FFYH 3SZKC 1A4KB 1MJJA 3QNYA 3W82A 2X4OB 1QHQA 3T3ME 3E6HA 1ZV9A 3ABGA 3G9AB 1I7ZB 4L2YA 3GRWA 2ZQKA 4H7VA 1RLBA 1S8DB 4GP5B 5FA3A 2H6OA 2OMUA 3G08B 4HDIA 3PGDB 1XHHA 3OPZL 4G71B 3GYRA 3OF6A 2E7CA 4YDNA 1I9JH 4L4VB 3T8MA 3IN0A 5DJDA 2E86A 1ZV5A 2CO4A 2AKRB 4PV8A 4AH2B 5JW4M 3MLRH 4N3TA 1MFNA 3RB5A 4NRXA 4GS7C 3G6DL 5IB5A 2XV2A 3O2DA 2MTPA 3PHQA 4OCSL 1UB5B 3G04A 5A6LA 2KYIA 1VAHA 3T8XA 4LSRH 1U3NA 5AYTA 3FCTA 4TNVK 1BYOA 4TSAL 3HZVA 1BVLB 3ECBA 3OJDA 4Z7WF 1VGKA 3D25B 3H9SD 4M56A 5GJTL 1ORSB 5KEZA 3KNBA 2F1BA 4HJ0C 1NFDA 2AJSH 1RUAL 3KCPB 4OZ4A 5CGYC 5D4IA 4LK4A 1AOHA 1IBYA 2C8NA 1J7VR 4UOZA 3FNKA 3NJHA 2WVVB 1TQUA 2K7QA 2VLRA 4HKJA 2GJJA 3DGDA 4UANA 5KN5A 1PZ5B 4CMMA 2X70B 2BW5A 3CC5A 4P5TC 4RGNB 5I9QB 1MN4A 3FFDB 4APXA 3CXHJ 3MRLA 2VWEE 1CO1A 1QFUL 3LN4B 5EORH 5L0QC 1W6LA 4XCFL 2F9BT 3ARFB 2FEJA 3C5ZA 4J2QA 4KFZC 1MJ7H 4TUJB 3NT0A 4G8EA 3UEZA 4Z8FL 1DBJH 1L0QA 3M86A 3W57A 1V05A 3V9CA 1BJ1J 3AGVA 3NFSH 4TS6A 4P23C 1BQKA 1IFHL 4X4KA 4Y4FD 2Y5TA 5F7DB 4GEIA 5PAZA 1A7NH 5HYSB 4PJ7E 1OB0A 2R56H 4YXKL 1XAUA 1EVUA 1CXLA 1O0VA 5IW1B 3O2VH 5EWIL 4UTAA 2P49B 4QAMB 1J9SA 5GGRB 5JW4N 4FFWC 4RFEA 5DD3H 3WHXB 4HU8A 1DQDH 4R7DA 2FECL 1D5MA 3DVFA 4GIAA 2XG5A 3D34A 4WW2C 3O3UN 4H88H 5I71C 3WN5B 1RQ5A 4MAZA 4HH8A 3IDMB 2QDWA 3UERA 1C8QA 2CXKA 3R7QA 2HLAB 1OSPL 5D7LB 1E43A 3D30A 2VDOH 3I3EA 4AIEA 5IMOB 3CHOA 4OF0A 3EFDH 4AQ1A 3CV5A 4B3EA 2PTTA 1XVSA 3FT0A 4EPSA 2CDFB