2X28A

Cadmium bound structure of sporosag
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
235
structure length
219
Chain Sequence
TSCETEGSSISFTVEKAGHVVRFNCPSTLEEIKPAYEAGDSTKVCTTADCSNEAALKDVLKSASLAQAEGSSGGNDFTLTVDALPEAETSVFFLCQRTGADKCGVHILVKAAPQAPVCSAQDHTLELQITAANSDTSFVCGGTFNVIKPANAAKVLQDSCETEVDLVSLVPHASRSALEQSGLIKLSVTDLPQQQQKLCYRCEDSSQKACKVLVTVSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPOROZOITE-SPECIFIC SAG PROTEIN
publication title Structural and Functional Characterization of Sporosag: A Sag2 Related Surface Antigen from Toxoplasma Gondii.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Membrane protein
total genus 47
structure length 219
sequence length 235
ec nomenclature
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04092 SAG SRS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1320 Mainly Beta Sandwich Immunoglobulin-like SRS domain 2x28A01
2.60.40.1320 Mainly Beta Sandwich Immunoglobulin-like SRS domain 2x28A02
1KZQA 2JKSA 1YNTF 2X28A 2WNKA
chains in the Genus database with same CATH superfamily
1NCHA 3QIUA 4HC1L 4TUOB 4CNIB 2QKSA 5EO1A 1MWAA 2E9BA 4HHGA 2Y1AA 5DS8B 1J8HA 1QEXA 3CXFA 3K46A 5E8OA 3LQMA 2WXOA 1IFHL 1S7SB 4Q6IC 3JWOH 4UUJB 1AKPA 4JANA 3QFJA 1TZIA 4C56E 5EOCL 2NSXA 4QWWC 4M7KL 5CGBA 4ZMXA 4GW1B 1URLA 1CDIA 1XF3B 2ZYHA 3HN8A 3AITA 5GSVA 3G6AA 4G6KL 4E41E 2YUWA 3UGUA 4F7TB 4F7PB 3D0VB 4LPCA 2VDRB 3DXAD 2GBVA 1ZT4A 2DQCL 3RPBA 4IYKA 5F0JB 3WE6B 3QDAA 2GJPA 3PHAA 1P1ZA 4NP9A 1HYSD 1SXCA 4IOIA 2I9TB 1RZ7H 4XB7A 4NUJB 5IESH 4N0UA 5KYWA 2W80C 5ID0A 2KC0A 4HKJB 2WZ0A 5FC9A 4QKXB 2OSLB 3I02A 5I1GH 2HLFD 2FJHA 5DUJA 2EKSA 4O4YL 5DQDH 4HIEB 4HCGA 4ZX5A 1JGDB 3QQDB 4ZMVA 2XVLA 3KPQA 3TPUB 5MERA 1OCCB 1ZT1A 2NY2D 3NCYS 3T0ED 1JYWA 1OAQL 2J6WA 3GSOA 3FTYA 1JWMB 3GDBA 2BIMA 5DHVB 4EMZA 4JRLA 2ZTBA 4ONOA 4DW2L 4IIZA 3U25A 4DAGL 1Q0YL 5AKRA 4U2ZA 1KXTB 4CVZA 3ETSA 3QO1B 1T2JA 4GW5B 5L4IA 3S4SA 2XY1A 1TPXC 2EICA 3GLZA 1JGLH 1KIRB 4XMLH 4TNFA 1NAMH 1ODUA 1RJZA 1QLFB 3F7RA 1WBYA 4BK8A 4EJ1C 3P3SA 1PD0A 5EDXA 5EOQH 3U4EB 1WK0A 3IFPA 3AT0A 4TN9A 1ZHKB 1TYJA 5J1SC 3FB7A 1R3HA 3ILPA 1HL5A 1I7ZA 2YK1H 1X5FA 3QEQD 5IVXE 2XWJB 5E6IC 4G11A 1R3JB 2H4EA 5IVOA 1MCJA 5AFAA 4XHJD 4MAYB 2IPUK 3DDGA 4X6DB 5IF0B 3S35L 1PQZB 4BQ9A 3K0YA 4ONGH 4FFZH 4UF7C 2O6FA 4LSTL 4XNZB 1G7JA 5JNYB 3ULVL 2B08A 3TT3H 2F5BL 4UOQA 5KVMC 4L9DA 1R9FA 3TJPA 4PWEA 5E6IA 2OW7A 5E6SB 1QFWI 3LKSA 3TBCA 3HS0C 3W2DH 4TNGA 4FFYA 1V3LA 1DQML 2IG2H 3NH7H 4PGBB 5IB3A 3P9LB 1FV1B 4YBQC 3KLKA 4JO3L 4PRHD 1LMKA 4NKOB 1YY9D 3EYUL 3AQZA 1ZGLM 4O02B 2AVGA 3FB8A 4H8WL 3HEIB 4NAQA 3HS0A 1KBGH 2ARJQ 4G6FD 3QA3B 1JPTH 4R90H 3BAKA 4CVWA 2FJGA 2VDMB 1E5UI 5ETUA 4Q6KA 2VZTA 2H8PB 4QRAA 3IMBA 1HZKA 1DVXA 1Z0NA 2IAMB 3RWJA 5BS0B 4PR5B 2NXZC 4KKBC 2JMRA 4UMSA 1YUHA 4YHNA 2W5PA 2VLLA 3ZE2F 3L1FA 1YNLL 2XXCB 2FX7L 2GTWA 3JUZA 5CBEA 1IFHH 3UTTA 1A9EB 5K9KB 5E2VL 4XCYB 1NC4B 3VXTB 1E5BA 5EOCH 2XKNA 3BFQG 2Y06L 4M7KH 2BY2A 2RTTA 5GGVL 5D93B 1HE8A 4Y4KB 3P77A 4G6MH 5ANMA 4G6KH 5KVDL 4EBQL 5C0EB 5DU7A 4JDZA 5DSCA 3FT4A 4AT6A 1SJEA 4QXUL 4P46C 4PJHF 4PGEA 4UTAH 4G9DA 4FZ8H 1FFPB 2X3BA 2YR3A 3F7YB 2DQCH 4WHTB 2DQGH 2EDOA 4DQOL 4AVJA 2B7DT 2CCLA 4DN3H 2W0FA 1WIUA 3EIFA 4YEEA 1ZLUH 2V37A 1CFTB 3BW9B 3BX7C 2QPSA 1XF4B 3VWJC 4D8PB 4R7NA 3DX6B 4P46A 3UTSD 4XODA 1L0QA 4X42A 1FE8L 3BUBA 3DLQR 3RIAF 4I9XA 3BUIA 1N10A 2XXFA 2AXJA 1T66D 1E65A 3B1TA 2E4FA 1R3KB 5EU6B 3VWJA 4IGBC 4HETA 3ARWA 1OAQH 1K4DA 3D05A 4QAMB 5HGHA 3E2HB 1GOHA 4Z7UB 5CEYA 1EEYA 2W59A 2ADFL 4Y7OC 3ZKXC 1D2PA 1TTUA 1Q0YH 1RK0A 1W2KT 2VZVA 1Z32X 2GHZA 1W0VA 2P8PB 3QEGH 1NCDH 3QUMA 4FZEL 2FHBA 4W68A 2OTWA 3NFNB 4IGBA 3IJ9A 5IHUL 4KJQD 3NTCL 4UT6A 3F7PC 4WY7H 1VFOA 2AK1L 4MHHI 4DZ8B 4UT9A 4Y8DC 1AHMA 1IVTA 1G7IA 2N7AA 1KJVB 4FKKA 5CSZB 4B0MM 4BCZA 3D0LA 3LNIA 4ELMF 2Z3FA 1P7KB 5H94A 6PAZA 3WIHL 1GS8A 1MG3C 1U6AL 3IEAA 5FW7A 3BH4A 3H3BC 4ANXA 3RILA 3ZYOA 2YPLE 3QWNA 4LHUB 2Q3AA 2B59B 1JPGB 4WK4B 3MUJA 5I6XC 1JGVL 1SBBA 4JFQB 3S35H 1UT9A 1YEEH 3D3VE 1FFNB 2X38A 4KJPC 3K71A 2EC8A 5E70A 2J56A 2F53A 2LU5A 4XN1A 4Z7VF 2BJML 3FQNA 5LGHH 3IETA 5I1DB 1Q94A 2XQYG 3LKOB 4GW4B 1EDYA 1V7ML 2KBGA 2XBZA 2EIZB 4Y19E 5GS2D 2PWFA 1TNNA 3GBDA 4BXSV 3RHWF 2GSGB 2MSPA 4JO3H 2ZOLB 3V55A 4RVBA 3VI3B 4RNRA 4E5XA 3ULUF 3EYUH 3UAEA 3HKZA 2VLRE 5DS2A 3M86A 4X0KB 2ZXEB 5I24A 1CFBA 3C9NA 1IAKA 2IDUA 4A6YA 2AV7A 2WXLA 3QUKA 3ZDYE 2HFFB 2A83A 3CDZA 3G04A 3L54A 3BQUC 5J11C 4GP8B 5FLVA 4PJXE 3OKNB 3C5ZD 4IBLT 2IMMA 3C6LD 3LVTA 3VFNA 1UG9A 5DC2A 4PIBA 1YNLH 4QDGA 1H3XA 1ZEAL 1AD9B 2GT9B 3IFNL 3UPAA 4I3RL 4EI5C 5IQNA 3QRLA 3BQUA 2OJ1A 3BGFB 1KYFA 1MJ8L 3RTQD 4Z7OE 4EDXA 2PTUA 4DCQA 3CDFA 5SX5K 1XCWA 4WKZA 1CICD 2FLMA 4N2FA 1HNGA 1FRGL 5ICYB 1HHHB 3B4NA 5CHNB 5JQ6H 1QVOA 5GQBA 3T1FA 4EI5A 3NIGF 3FRPB 2IXQA 1HDMB 1RPKA 3STBA 3FT1A 1ZLWH 3HUJF 2GY7B 3MRFA 4JO4L 4DQOH 2AS5M 1VACB 4MCMA 5D1XB 2HLEB 4FFVC 4O58L 4XH2B 2EDXA 1UUSA 3ZYZA 1FE8H 4DSYA 2JCCB 3ECQA 2HX7A 1XEDA 4PP2B 4QRQA 4QRPB 1H3PH 3P73A 2IADB 2Y5EA 4PJ7B 4PJEE 1S7QA 2XV6B 1PTZA 2NX5E 2YKLL 4PLOB 4FS0A 2BSSA 1QRNE 3PS6A 3NEXA 4FTVB 4CSPA 4XVSL 2C3VA 3BZFA 5HI5C 3MRLB 1LO0H 2Y7QB 4ZI8A 3HZ3A 1JHLL 2ADFH 2CKBB 2VJXA 3DRQA 3KPSB 4U4BA 2VMDA 4X4XB 4AJWA 5KZCD 3JZ7A 5EBLA 2O5YL 5IWLC 2BIIA 1C7SA 4LEBA 3BZEB 3X1BA 1INQA 2WZPD 2UY6A 3HMXH 4IK7A 4QCIB 3DVGA 1TUPA 1NFDE 2AK1H 2CG9X 2YHGA 3PHOB 3BC9A 4MMYA 3QNFA 5HI5D 3UBXB 4M8QB 4IDJL 4ALAC 4H5SA 3ZVVA 3GHBL 5IWLA 1RJYB 1SVCP 3S7GA 4NM8L 1AG0A 3MV9E 4N5EC 5BUGA 3WEXA 3WIHH 1CPUA 2R1YA 2C3XA 2ZX5A 5AB1A 4YLQT 4JZNA 2DLTA 3NCYP 4HUWA 4CAGA 2CBTA 2YD1A 5FA3B 4IBZA 3L9RB 4XXCC 3GZOA 2X1PA 4LMQI 4WUUD 1T1YA 1E7VA 3IU3A 5D96B 5HJ3B 3BIKA 1NAKL 3QORD 5DYOB 2D03H 3OR6A 5BQ7A 3GSQB 3SD2A 4R3SA 3ZT5A 5TF1L 1BSIA 4N6RB 1IJ9A 4W6XB 2BJMH 2XTJE 4XXCA 4R7XA 4I2XB 1M57B 2H1XA 1C8QA 4ZZKA 4PREB 1V7MH 3RA7L 4WO4B 4ZMPA 3VFVB 1TVHA 4FQ2H 1XSIA 3QR2A 2KS0A 4LVHB 4NQVB 4KI5D 1HHGB 1IILE 4UQCA 2E8ZA 4XC1L 3PQYA 3RFZC 3MRQA 2G2RB 3Q9PA 4MLSA 4YHKL 4QGTA 1YN6A 4AUJA 1PU0A 4YXKL 1KDJA 2J2ZB 2VIRA 3VQMA 5A3IC 5GS1C 3C08H 1Q9LB 1MVUB 2JJVA 5LAPA 4L5FE 1VGEL 1BQLL 1RUKL 4K9EL 3RTLA 5MEPB 1GVIA 1YMMB 3FUFA 1UOWA 3RFZA 4WI9A 1HXYB 3KPPB 1EXHA 2FT6A 4MS8C 3V6FB 4KRPB 4XC3L 2A6IA 2DJUA 4LLDB 3WYRA 1ZEAH 5GS1A 3IFNH 1A1OB 2B15A 1O7SA 2AK4A 4GRLB 3APMA 3PP3K 1VFAA 5HDQH 3C6SB 2IANE 3GMPA 3ZMNA 3MO1A 3HE7C 5FWQA 1DQQA 4L8CB 1FRGH 1Y07A 1Q72H 1CD0A 1R17A 2ZUYA 4EI6B 2G0KA 4DF9A 4HJTA 2K3TA 4YEFA 3SDXE 4XMTA 1IIKA 5AW6B 1OP5K 3S2AA 5L0QC 4JO4H 1XGQA 3ZMRA 1QR1B 3QZLA 1RIVL 3HE7A 1CF8H 3VXSD 3PE9A 4L3CB 3I9IA 1FVCA 2FECI 3K6NA 4JFEA 4HV8A 4WFED 4O58H 4ZDHB 3KPNA 5HHQB 2P24B 4B60A 3DSNA 4AENA 2ZWNA 2WINA 5I0VA 2WNGA 3IDUA 5C70A 3AC0A 2DQFA 2VSCA 3FZUC 2YKLH 3KBEA 3L5XL 2NLJB 5B1BB 3KWUA 35C8L 4NUMA 4JG1L 2FSEA 1A2YB 3I9PA 3PL6C 2ZWYA 3TBSA 5FFLA 1UJ3B 4FNLL 1JHLH 1J48A 2QQLL 1AC6A 3QULA 2IWFA 2UZYB 3QNXA 4LHQB 3T8MA 3WY2A 2DB8A 4KROC 3ISRA 4KKQA 5I75C 1O9VA 5IVZA 1HEZA 3GRWH 4MJ5B 2DIJA 4JHWL 2PPEA 3L17A 2WB7A 3PL6A 1TTAA 4ESKA 1JZ6A 4QXTB 3VU1A 2FQEA 4N87A 3FSWA 5K59F 1KWKA 3SJVB 3I9GL 5JOFB 4HG4K 4NM8H 1QABA 3WUWG 1NKRA 5FFOA 3LN5A 4HT1L 3GBML 5TE4H 4GMTH 4JFVA 3VUAA 1MEXL 1MQKL 2BP8A 2IEPA 3EADA 3BUYB 3ES6A 3G6DL 3P02A 1XF2A 1YDPA 3V0GA 4OUUA 4DP1X 4Y4FD 3IS0X 1OB0A 4LDOB 4YHZH 1NANI 4HEPG 1OD9A 2J1XA 3EJQA 2XTSA 5AZ2L 5B7EA 5E9DE 2LAAA 4BDVA 1H9DA 5J6HB 3GRGA 3DSFL 2DWDB 1ORSA 5H4YA 5E7BA 1ZHLA 1I8LA 2Z4QA 3GSVB 4XOCA 3VRJB 3RG1C 1NCWL 3R8QA 4R84A 5IMMA 1LK3L 3MKGA 1E7UA 4QRRE 2ZAHA 2AJVL 2YXMA 5E8PB 5I5RA 1I1RA 4Z7WA 1PZSA 4F3FA 4PRIE 4N2DA 1CUOA 2VAAB 4XC1H 3W9EA 4KKLC 2D73A 3MCLL 4P2RA 1XB6A 2F7QA 3T4YA 1A8JH 2VR5A 1O9ZA 3FT0A 2GC7C 3KHOA 3LQAL 1T20A 1KN2L 4BH7A 2B0SL 4MVBC 5I19L 3FN9A 3FT2B 1L9QA 3UTQA 4YSCA 5I1HH 5D4HA 1VGEH 4HP5A 1BQLH 1I1FB 2K0RA 1RUKH 1WWWX 4OLVL 3DX9A 1I1AB 1W72H 4XE5B 3QJVB 3WO4B 1HH9A 3PHQB 1T22A 3RVVD 4QY8A 4PJFA 5DD6B 1HL4A 4D0BB 2VR9A 3A4AA 4HSQA 5EU7C 4PJIE 2OMXA 5IJDC 1Q8MA 4PG2C 3BDYL 3DHMA 1J12A 4HJJL 4PLNC 4AI7A 2P5WD 1DDHA 4XO3A 5BO1L 1J1XH 1PF3A 2H6PA 3QDGE 1JGUL 4R2GC 2ED7A 2ARJA 2AXHA 4IOSD 2VUOA 5A7EA 3KMDA 2DH3A 2YFNA 2X4RB 4OKVA 4PG2A 3VD9A 1BXVA 3FMGL 1ZVYA 2I25N 3QQ3B 2XBDA 4YLBA 5GGRA 5IMLB 5DJYB 1TZGH 4KK5C 1DSWA 4YHYC 4N9GB 1EO5A 1RIVH 1Z9SB 3CC1A 3ISWA 4XR8C 5BZWB 2P8LB 3FUHA 3N91A 4MXVF 3MA7B 3PGDA 2WXGA 4PM1A 4WI5A 5EEZA 3ZW3A 4G42A 3PAVA 3US1A 4J3OH 3X3FH 2BSDA 1DQLH 3C5XA 2GJ6B 4ACTA 4BA0A 1BQSA 1RURH 1A6ZA 3WKML 2VDKB 2Y24A 3B2VH 3NIFE 4YGVA 2H32H 1ZS8B 3WO3B 3D52A 5DJCB 3BRDA 1RSYA 3EFDH 3LNFA 4H40A 4JO5A 4YBHA 3GQFA 3O45A 4AGMA 4JG1H 4MX7A 2VUYA 1P5VB 3L08A 3VXRE 4PVBA 4GEIA 1GY2A 3KL5A 4JRYD 3TTSA 1N5YL 5CIPA 4FE9A 2HKFH 2DQEH 2UUDH 2GI0A 3WAKA 3ALWA 5KSUA 3ARBC 5HDLA 4AYSA 5IHWA 3GMMB 1QACA 3I9GH 1E4XI 3L3OC 1CBJA 1U8JA 2EDYA 4Z9KB 1FC2D 2WNKA 4WCYL 3H7BA 5EUOB 2ZX9A 1M05A 2P5PA 1GYCA 4M7ZC 4P3DA 1I9JL 1MQKH 3G6DH 2L7EA 1EFXB 4QOKB 4IJ3B 3X17A 5IB2B 1QHOA 4Y9CA 2F54B 3JT0A 4HKBA 3ARBA 4M62H 5D6CB 2P49B 5F7NC 3RWFA 4F91B 3S37H 3L3OA 3ALXA 4HH9A 3VNZA 3AT8A 3EH5B 1U3HB 1F41A 3DSFH 1ZV9A 4YDZA 1I1YA 1VZHA 3NJIA 1ZMYA 4JHUA 5MEND 5CZVL 5HGGS 4KTYA 4JVPA 2NYZA 3UYPB 4X4ME 3OKMA 2R0LH 5F3BB 32C2B 3T6ZA 4QYOA 1LK3H 4X9GA 1AP2B 1B2YA 4LLUA 3WFHB 1I85C 4JPIA 4KUCF 3BCDA 3QEHA 4NENA 2YOAA 4WDIA 3VGHA 3CFKA 3IPEA 3PIQB 2VM9A 5FO9B 3KBFA 3L3JB 2J4WH 1AQDB 3GXMA 1O5DT 2R0WL 3SY0B 3V52L 4CNIA 3OLGA 5A6MA 5B7FA 3QPXL 1M1XB 1PCSA 1WIOA 2OX5B 3K3QA 1I85A 1IBFA 3VACA 1DBAH 1KN2H 2FH8A 3ARYA 4FL4C 2BIPA 2B0SH 3TBYA 1XGTB 5I19H 3WI9A 5EUKB 1HFUA 4A68A 5CCKL 3Q2CA 2YGPA 3ZDXE 4HS6B 1TZHA 2E9IA 3B5HA 3TA3B 1WSST 4OLVH 3A24A 1FVDB 2B5IB 4ODSH 4PPTA 2EEAA 3HHMA 3QR1A 3QNZB 5C0BA 1H9VA 5D9SA 3GSRB 5EA0L 4GW1A 4DKAA 3TN0C 4M5YL 3SE8L 5KG9B 1NC2B 1AY1H 1TLMA 2P5EB 3GXPA 1CDGA 4F7TA 4F7PA 1RK1B 3BPCA 2FGZA 3JTTA 4ZMTA 3HCVB 5JHDE 3C8HA 5BO1H 4AGNA 2XWCA 3QWRD 3APNA 1JGUH 5CEZD 4F5CE 1XCQB 4QHUB 3I6GB 3TN0A 4L1TA 2Y4SA 2PCYA 3FMGH 2AXGB 1F02I 1KIQA 1T83C 4V1DE 4NUJA 3VD3A 4P2QD 3LZOA 2F7IA 3L9BA 1J9QA 4IW4C 1FAIL 1OV8A 4NP4L 5D7HA 3MRKA 1SOQA 3IDGA 5HYIA 5LHDA 4J5VA 2P1YA 3EHBB 5C07B 4YH6A 3VGAC 2CDFB 4XNAA 1CFSA 2CO4A 3QQDA 1OPOA 1T83A 2P28B 5C0RH 1AI1H 1EH9A 1MJ7L 3WKMH 1UTDA 3GSWB 3VCLB 4DK6A 3ARDC 2J12B 1F18A 1OAKL 3GO1H 1RFDH 4Y2DB 1KXQA 5CZXC 4KITB 2XQBH 1KXTA 3MGOB 1ZA6B 1FAKT 1DL7L 2UY7A 5FO8A 4ZD3H 3HNVL 2R69H 3KGUA 4NJAL 2ROXA 3ZDZF 1KIRA 1KB5L 2BOLA 1OB1B 1T7WA 3ARDA 4RWHA 4WUKL 1EEZB 1UZ6F 1N5YH 2GW5A 5D8JH 3U7AA 4S1DD 1CT8B 4PJ8D 4Z3IA 3IK2A 2V17L 2AZUA 4WI4A 1ZHKA 3VFGH 4BELD 3V0VA 15C8L 4GO9A 3NJNA 5I0XA 2R15A 3DMMB 4M02A 2AQ1A 1JRHI 3OZLA 4MRCA 3SQBB 4S1QL 1CGXA 1OHQA 1CQYA 4G7VL 2D3LA 2BNRD 2AMUA 3VD5A 5E99L 1I9JH 1TJHL 2VISA 1VB9A 5IF0A 4XVTL 5C0AB 3HG1D 2K9FB 5E5MB 3MLVH 5FYJE 5E4OA 4OCXH 3CZJA 1UHVA 3GBNH 1LK2B 2DQTH 1R24A 2GSIB 3CK0L 2ZPKH 5ITBH 4ISVB 3LXCA 5FOBB 2VLME 3QEQE 4MQSB 1TQCB 3AG2B 2Q8AH 2WLLA 2H26B 4Q9QH 3HE6C 2XSKA 3WN5C 1JXDA 2AV1B 4W6YB 3F7VB 5F3HA 1L3NA 2YA1A 4OV5A 4NPJA 1P4IH 4N8VB 5E23A 1MHHA 3K4ZA 3N3EA 5AZEL 2ZUSA 2C1PB 2IV8A 2CK2A 3Q9QA 4JHAL 4ZO7A 4ZMZA 3DX1A 5I1LA 3HE6A 5F0LB 1MCKA 1RY7B 3QA3A 3WN5A 3HMWL 4POUB 2X3AA 1IQDB 4CDHA 2B4CL 2LV4A 3H4FA 3WTWA 4OLWH 2CO3A 2F8XC 2CIKB 2R0WH 3DOIA 5DHEA 3V52H 3CDGB 4ZW6A 1MXGA 1VHPA 4LOUC 5DEJA 4BQ6A 2VRQA 4H26B 2V3DA 5I66B 5CCKH 4PLKC 5I9QB 5T3ZD 3VXUB 1T1XB 2YGVA 5K9KA 4MCZB 4B9CA 2EIKB 4GAYB 3KPRB 5LO7A 4XCYA 3D2UB 3FF7A 5LDUA 1TTCA 1J8HE 3SYCA 2QVMA 3IN0A 4PSRA 1T4KB 3AROA 3SE8H 1AQKH 2VJ0A 2VMFA 1GJIA 2BVUA 1RZIB 3ZUCA 4PRPA 3QG7L 2DD8H 1HHKB 4N0RA 5DJDB 3RPKA 3IE9A 4AL8L 1XMEB 2L04A 1U93B 4AMXA 5HYFA 5I16B 2K45A 3H2PA 4MXQC 3T2NL 5F7EL 5E8NB 4IKNA 5AOLA 2SODB 3P2BA 2VRKA 4OF0A 1UC6A 1A6AB 2J6EL 1LO3L 2Z35A 2XIDA 2ZXBA 1UURA 1ZKAA 2O61A 3WMQA 1A7QL 2VXUH 4G8EB 4PY7B 1HK6A 4HJGB 3QG6A 4BFEA 2Q0ZX 1P84J 3EJZC 4GLRI 5A16A 2YPVA 2GK2A 3I3BA 4AJVA 3GT6A 3SDAB 3T71A 4ZMWA 1MFCH 1QI5A 2CH8A 4G72B 4N0UE 2I5YL 5LVEA 3KLHD 4FMKA 5L8KB 3PABA 4IJTA 3P9MB 5F2FA 1UWFA 1MJ7H 3DETD 4J1UB 1ERNA 4LDCA 1AIFA 3C2AH 4Z7UA 3BCFA 3AGWA 4IQHA 1OAKH 2DIAA 5DFWH 3P9WB 4K7PY 4YX2L 4OZGA 2P8PA 4LCUA 3KW7A 3UGEA 4BZ2A 2EDEA 1ZLVH 1DL7H 3CQQA 4GT7A 3VFRB 2LE9A 4M1GL 4XCFH 3WL9B 2QQKH 4X99B 5EEYA 1XD1A 2DWTA 4NSKB 2GJZA 3MTXA 1KJVA 5CSZA 4G8IB 4YL9A 4X7TA 2FO8A 3EJPA 3KZ8A 1JI1A 5DXWA 2BVEA 4ZFFA 4WJ5B 4HKZA 1S7TB 5FUZL 4MAYD 3RIAK 8FABB 4S1QH 4G7VH 2YUXA 4Z78B 1PGRB 3IDXL 5HHOD 1JN6B 3OM3B 4NO5A 3B3IB 4JFQA 4XVTH 2J88L 1CDUA 1MRCL 4HLEA 3VH8A 4KC3B 1SY6H 5D5MF 5ADOL 3L2NA 1HQ4B 4XZ4A 1TTFA 3K5SA 4TVPH 1OTTD 4HCFA 4XE0A 3TWCL 5IFHH 2XWTA 3A22A 1G9MC 5I1DA 4GW4A 2TRYA 4W9KC 5I0DA 1ZCRA 3TYFA 1DCEA 1U8QB 2UYLB 1AS8A 1DVFB 3BZ4B 3LDBB 1DFBL 3UIYA 4FQXB 2WK2A 4GRWB 1FNGA 6FABH 1X9QA 5AZEH 1QFHA 3S9DB 4IBUA 4A7UA 1T7YA 3OKDB 5ITFB 5DJ2A 2IAMD 2YAQA 5DD1L 5BS0D 3MRGB 4NS0A 4JL2A 4X4ZA 1PX3A 1GJWA 5IROC 4P2CG 4JRXA 2Z6FA 5EBGA 1SDDB 1WFTA 4XMVA 5LCVL 4EDWL 4JJHA 1WFJA 2KI6A 2XHNA 4DK5A 3MGTA 1UCBL 4LSVH 5A2IH 1OGAD 43CAA 3N0AA 3ZR5A 4R5VA 1NC4D 5GGRY 3W82A 4UIMB 3GJFK 2QR0B 3MLWL 5IROA 1MHPL 2R56L 2CDEB 2W9EH 4Y4KD 1DEEB 1EO8H 4DOHB 1N26A 3PWJB 3I85A 4PGJA 3SPVA 1YRKA 4X6CA 2JI1A 2F15A 5H2BB 3WFCH 2K1MA 4ZS6D 3UTTE 4J3OG 2BM3A 2FEJA 4U1NB 3TESA 2PXYB 3KXFA 4L5FL 3RHWK 5GS0H 2Z1PA 1IJNA 2OFQA 2G5BA 3I84A 2R7EA 2F1BA 3REWB 4AL8H 2H6UA 2X7LA 5ANME 2X4UB 4PV9B 3PFUA 3BVXA 4PJAA 5C08B 3CU7A 3MBXL 3T2NH 2EUZA 4LCWB 4JEGB 4IU3A 5CS7A 3TC9A 1OXYA 2VN3A 1BPLB 1RERA 2J6EH 1F3JB 1LO3H 3NFPA 5H37H 3VJ6A 2BCKA 1P7QD 3BPLB 5CLTA 2JCCA 3PXHA 4YZFE 5EU6D 3SCMB 2AQSA 1AGBB 1NDTA 1A3LH 3F64A 1INDL 3ARVA 4HUUA 1XB8A 4OJYA 4POZD 4MNGE 1C16B 1WFNA 3MNVB 4Y1AB 4A7QA 3PPEA 3DPBB 5DZJA 1IC7L 5FYKU 4AEIH 4Z3HA 4YMPA 3MRPA 1EANA 3OSKA 5AVYB 5A2BA 1NWOA 3IMTA 3QC6X 2WMPA 2VDQH 4X4XA 2X4QB 1AHKA 3DV4B 2JI2A 2ADGA 1FG2B 3B34A 4WRLA 4MA8H 1Z6JT 3RGBA 3KJ4C 1PLGH 1BFVL 3QCUL 2WCSA 5J56B 5JMRA 1N8ZB 4M1GH 2RQEA 4MCYB 3U4KA 4JAMA 1XSOA 1B4LA 2PCFB 1WAPA 4K94L 4WW1B 3K1DA 2A0LC 4P48A 5L9DH 1BMGA 3BUDA 4F80A 3HVDA 4NRXB 4LHUD 5D96C 5CD5D 2IBZX 1NIDA 5C9JA 5FUZH 2GI7A 4OGXH 3IWUA 4H1LH 1ID5I 2D4DA 4ODHL 3HAEH 1U3NA 4XPTL 3QI9B 4GKNB 1QNIA 3V5HB 3W38A 2OL3L 2RH0A 1JV2A 3L9RA 4U0RB 2BZ7A 2WTRB 1N2RA 3WGVB 2YAFA 1E6JH 1IEAB 4WO4C 1KNOA 4WENB 1J1OL 4PS4L 3P1VA 2HX8A 4XWOC 5ADOH 2VLKB 4UTBH 1RUAL 3MJWA 3KDMB 4AMWA 5J12C 5EULV 1EO7A 1JGIA 2HT3D 3TBTA 2DQDL 1D5ZA 4OFQA 4QAWA 1BIHA 1UACH 3NIDF 4WO4A 3RGVB 2A6KB 4JFDB 4HGKC 4ZUUB 4IBWA 3NCCB 4WUUE 4LP5A 3FU5A 1IV8A 4NQVA 1DFBH 4YUEH 3S34H 3DGGA 2HRLA 1IIIA 3LD8C 4AJYV 1D6EA 7FABH 5JHLL 1WT5C 2CWRA 2X9XA 4L3EB 1G6VK 4MNQB 3SKNA 3QHTC 2GC4C 2OJEB 2XKUA 1DVUA 2EINB 3MJGX 2X89A 4KRPC 3T0EC 5DD1H 5B3JF 4FXGB 3DJ9A 1ZV2A 2XN9A 3HI1A 4JS7A 5TTRA 1XGYL 3L13A 4HSAC 2DLHA 2NZIA 3G5ZA 5LCVH 5DVLA 5GRUL 5DK2B 1WT5A 1L6ZA 2EVHA 3PGCA 2BINA 2A9DA 3B2UC 3E3QC 2FLBT 3CAFA 4LLDA 2X2JA 1BX2B 2VN7A 2R56H 2OMZA 3WDJA 2R4RL 5LN8A 2IGLA 1SEBB 4GXUM 2ZOKA 5T5NF 3PNRB 4KH2A 3FL7A 3LIZL 3C6SA 1KCWA 3X3GH 1I3GL 5F89B 4GMSL 2Y2TA 5F7MC 3KYAA 5GRJL 4MMZB 4PJCE 3WXWL 1KCKA 4AW7A 3SO3B 3H55A 4U1GB 3N9GL 5J1AA 1Q0XH 1CXHA 4WWID 5DMKB 5GGUA 5CP3A 1J87A 4UQDA 5D1XD 3MX0A 4A66A 1A66A 1QZNA 1KTRL 3DTXB 4NLHA 1QR1A 2HMID 3NCXA 4GG6B 2H0JA 3P0YL 2VR6A 5IQ9B 1J0HA 4QRUB 4LIQE 4RZKA 1B0GA 4NRZA 3C2SA 3HC0A 1X5LA 1MIML 2BP3A 3L5WB 2ITDB 4LASL 4CU8A 4X6EA 1YEFL 3QIWB 5CJQL 2AF2A 5BVPL 3VAEA 2XPZA 1SMOA 3CHQA 1Q4NX 5KSBF 4FTVD 1QSEB 4MBOA 2SEBB 5HD8D 3ERXA 4KXZH 5FCUL 3O6FD 3KPSD 3QJXA 4JY5L 1E3ZA 3WD5L 4HIQA 4HIJA 3TO2B 1OGTB 1I4FA 1HI6B 1IGML 3GI8L 2CPCA 2V2TA 1OP9A 5HI3C 5IFAH 3LZFL 3QCUH 1E8WA 4HS8L 3VXPB 1BZ7B 1IBDA 1SXZA 3C8KB 3EH1A 2ADJB 3FTUA 4G8AC 5C3LD 4KTEL 3FSAA 1CQKA 1E9OB 4QXTA 3OB0H 2X3CA 3W0WB 2PETA 4Z7QF 4GQ9L 3Q8BA 3SJVA 2VLJB 1DQVA 2VC2H 4HWZA 4Y0GA 1OANA 3QGVA 5EIVA 4AQ1B 1OARH 3NJXA 1DJGA 4WSGA 4BFOA 2AANA 2Z8RA 2FWOA 4KZCA 4KX8A 4PY8J 3BAXA 2RMNA 2HT4D 5EC2B 3T0DA 1INEL 1GOGA 3EAKA 4TV3A 2R2HB 1D5BA 4JPKL 4OUOA 3S3PA 1AAJA 3MJ9L 4PS4H 1IC1A 2NY6B 4PMEA 1WA2X 4UDUB 1JZ3A 5FM8A 1DJYA 3KYOB 2W9LA 3ZTEA 1FZOA 3WFZA 3H6AA 4QF1A 2R4SH 2A74B 2RAMA 2DQDH 5HYSA 3MLSL 1JVOA 4TSBH 2BHYA 2ICWA 1ANUA 2DQIL 4A67A 1PMYA 4NZUL 2HRPL 4KXAA 1JYVA 4PTUB 2JQAA 1IGJB 5JHLH 1H5BB 1I1AC 2PP7A 3UJTH 2P26A 1OQXA 4JFFA 3D25B 2LU7A 1HZLA 1NIAA 1BYNA 1IAIH 1U8CA 5AD0A 1YMMD 4N2IA 2P46B 1UB6B 4X8CA 1WCBB 4J3OF 4TLSA 1P4LA 4EIUA 1KGWA 1COBA 1O7VA 1I8KA 2AVFA 1I1AA 3I6SA 3ZE0F 5EEVA 1LYQA 1EGJA 1C08A 3L4WA 4LBAA 5I15H 2BSEA 4GRLD 3SE9L 4RH4A 4GXVL 2ZOWA 5D72L 1M7XA 3HBPA 1F6AB 1YVLA 1SHXA 1OCOB 2AI0L 5ALCL 4ZAKC 4XRCA 3IJEA 3FHEA 3QAZC 1HN1A 1HTYA 4GMSH 3BVVA 4PJGB 4HUNB 1KJMA 1MCWW 4UV4H 2MPAL 3W9DA 1JXKA 2I69A 3B8YA 2X4RA 2VB5A 1WZAA 1DE4A 1KIUA 1K6QL 2AK4E 2ED6A 2ENYA 1WHOA 2K8QA 4LCIH 4TL5A 1T0PB 4ZAKA 3KE0A 3WTTA 4CUCA 1ASOA 3CMGA 4RCAA 2E6QA 1VF5C 4K73A 4N2HA 1OOWA 3DHUA 4M4RA 1JMXA 2ZONA 3OKKB 2NNFA 4BH8A 4IRJC 2MKLC 4MAZA 1C8PA 3QFDB 3MRBB 1YEFH 1K8DB 5BVPH 2GJ6A 3ARFD 2B1OA 4GOSA 2XG5A 4M6OL 1ZS8A 2X0WA 5DZNA 5FCUH 2MQ0A 4IRJA 4OIFA 5EF0A 5DJCA 4CU7A 1DSYA 2PP9A 4G1EA 3BWSA 4YE0A 3LSOA 1AXTH 1E27A 1DEDA 3EYQC 5F88B 1RJCA 1CLVA 1B0IA 1YPZE 4I48B 1IGMH 1WGVA 4LKCB 1T03L 1M71B 3EZJB 1MVFA 1SM3L 3ZJAA 1CTNA 1MFBL 4GNKB 5I8OL 2A3TA 1R3LA 1KPRA 4CC1A 4ZOEA 5D6DC 4AQEA 2GAZA 3HVNA 4IJ3C 2BP5M 5ILTH 4LNRB 4Z7QB 2L3BA 5JIIA 4ANKA 3IMVA 1ZGLB 4GQ9H 3VFUA 4H8HA 1L4IA 3SZ6A 1P9MC 2NW2B 1AYRA 5E1AB 4WQOA 4FHBD 3WNJA 2WYHA 4GAJH 1NGXA 4G7QB 5D6DA 1KYOJ 4KMQA 4QOKA 3V9FA 3V95A 5DFVC 1F4WL 2F54A 4UILL 3VW3L 3BD4A 4URTB 2Z8VC 4TRPL 1P9MA 4KK8C 4LVEA 5FLUA 1R5VB 4CW1A 4PJBA 1NEUA 2DDQH 25C8H 4Z0XA 3V0JA 4MJHA 4BQCA 1QFOA 4OZHB 2ZP0T 4DESA 1CLZL 1C7TA 4OM1L 3NPSC 2BOBA 1FORL 4Q7DA 1AP2A 3WFHA 2C34A 5TE6L 1XR9B 3FQWA 2WLMA 3T4AB 4NUGL 3JWDH 2MOQA 1LO4H 5DRXB 3GS7A 1J5DA 3KEHA 4NZUH 4M56A 2XFGB 3TA3C 5FYJL 1BQHA 4AIZA 5EEXA 3QJOA 4NQEB 3P0VH 1R0AH 3MREA 5MENE 2EVGA 4N2LA 3VFSA 2DYRB 1BZQK 1UWEL 3BN9D 4FQLH 4CC4C 1F0LA 2ZJSL 4JRWA 5GZOD 1E9QA 1LP9A 5EUKA 3H7LA 1GPOH 4NC1C 1G87A 1UD6A 4DO5A 3LZPA 3UIZA 1JZ2A 1SXNA 2WVVA 3TA3A 3U4BH 3WLBA 2PPAA 4P2RE 2FUTA 1CCZA 2E74C 2WLIB 3N40F 5FA4A 1BJ1J 4OLZL 1CGVA 4CC4A 5AW4B 2BK8A 1BBJA 4BZ1L 5I82A 5I5JA 2XTLA 1CE6B 4GXVH 3F04A 4G2AA 2Q86B 2P5EA 3O8XB 2YO3A 2FX8L 3GXFA 2YAPA 3ZZ1A 4F15B 1KBBA 4QLWA 1VRSA 1HINL 4BJLA 2VM4A 1M1SA 1A14H 1SXSA 1GGCH 1KCUL 5EZIL 5FYLD 1J1PH 2DM3A 4ZO6A 5DD0L 3IJHA 4J27A 5MEQA 1MWAL 4JLRB 1KJ2A 1WGOA 4JFYA 2FBJL 4YNYB 4OD2A 3RX9A 4GRMB 2UWEB 2NY7L 4L48A 3WNNA 3FO2B 4RAVB 4N0FA 3LPWA 5EU7E 4M7LT 3FUDA 4B0MB 4OFPA 5D7LB 4C47A 5C07A 3GIVB 3VB8A 4ELKA 4DPRA 4JL1A 4CRPA 4NO3B 4Z6AT 4AWJC 1UH4A 2MKWA 4RMWA 4CGUB 5ISZB 1CE1H 5AVXB 1B0WA 1A9VA 3CFBB 5AB9A 5EU5A 1EZSA 5FM5M 2Q9OA 1UVQB 3ZT7A 3LZNA 4UAHA 3J2PA 2ALWA 3RY5A 1PNDA 3NJVA 5K69A 5DMIH 1KGIA 5CCJA 5DJ0A 1ZA6A 3E6FB 1A21A 3II2A 4RWYH 2WPGA 3WG7B 2MQGA 2XV3A 3WIAA 5FKPB 1MFBH 4APQB 3VXQB 5I8OH 3M8OL 5K1NA 1AXIB 1JHKL 3RVUC 1IBHA 4H25A 1U8NA 4YHPB 1S7XB 2D7NA 3ME0A 4YXLH 1DVQA 3G6JA 2DWSA 4MA3B 2D2CC 3RUGF 1P5UB 1S8DB 5ENWA 3LOWA 1EFXD 1UOLA 3QHZH 3NSCA 4AGPA 1NH6A 1UXLA 3UP6A 4CJ0A 1TQCC 4HU8A 5C0JA 4NO2B 3TM6A 3GMLB 3OMIB 4L4TB 3QFGA 3ATAA 3F83A 2VDPH 5FHBH 1U3HD 1ORQB 1FNAA 3QUYC 1BVZA 5DQJA 3EO0A 3O2WH 4TRPH 2GSIA 2WIIB 3LKPB 1UUNA 1OTSC 5B8CC 1DVTA 4XT1C 2RACA 5TD4A 1LTXA 1G9EA 1CLZH 2ENQA 5T1KB 3QUYA 5GIRB 3DIFB 1CTOA 1FL5A 5B8CA 4C56B 1OD7A 3QIBC 5JW4M 4KOBA 3D51A 4PBWD 3OD3A 1UXWB 5CP7A 1IQDA 4UDTB 4E41B 3FSOA 3VXSA 1K2DB 2YAEA 2BSTA 4UNIA 4DN4H 5L4JA 2WQWA 1UWEH 2IGTA 1IQWL 1KCRL 1VFBB 2ZJSH 2VSKB 3QIBA 2C4FU 2Z7ZA 1E8YA 3L4XA 5DHYB 3W11C 5K9JL 5J89A 2XIBA 3FH7A 1E2WA 2GBTA 4RQQA 3KH4A 1MCRA 4X6FA 1NC2D 4XAKE 1E5CA 1M56B 1H3TA 2B8OT 1L9PA 2AXFB 4FFYL 2QGDA 2DYPD 4OFYD 3GWJA 3N42B 4WSJA 2QQNL 4QTIH 1NCAH 1RMFH 2FL5A 1OO2A 2FX8H 4U3SB 2H3NA 3VFOA 4P06A 5C0BE 3UYOD 4A7TA 1ZLUK 1CN4A 2OMVB 1PY0A 1U93A 1B6UA 5BV7H 4JFXB 1GHFH 4R4NC 1ITBB 5D7IF 1AGEA 5I16A 4G8GA 4OT1H 5AAWC 3RWCB 1YCSA 2Z0UA 3CVIL 3EOBA 5E8NA 5I73C 2BSCA 2EUVA 2CGYA 2NT0A 1EMTH 2HN7B 3CX5J 4PV1C 5EO9A 4PMFA 4QRTA 3EHBD 5IFJB 4NQXB 4ZUVA 3VDCA 3CH1A 2OCCB 1QQDA 3AB0B 5I76B 3GB7A 4MS6A 3TVMC 5AAWA 1OAZL 3T1WA 4DPAX 4JM2F 4N2MA 5KSAB 2O5ZH 2WN3A 8PAZA 4YHML 3Q06A 2FVNA 2DIBA 4Y2DD 4QUOA 3V0WL 4LOEA 3RKDC 4B50A 1AHWB 2JKSA 4ONFL 4DUVA 5C2BH 4YSRA 5IVXB 2YN3A 3DJZA 3TO4D 2C9PA 2J73A 3CFNA 3TVMA 3H1ZA 1YN7B 3QJHA 1X7QA 5GRVL 4WF7A 1OF2B 2WD0A 4XNBA 5AUMB 1XGRA 2ZX8A 3BH8B 5CN2A 3WY4A 3LKNB 1FFRA 3V5KB 3SGEH 2HVJB 1HHIA 5EZPA 3WL9A 2VDNL 4X99A 3AXIA 1Q1JL 3Q1SL 1S46A 1KXQE 5A6LA 4F37F 2AW2A 1FZJA 3DMMD 1JHKH 3CZEA 5C71A 2L0DA 1MIEL 3LQZB 3NCBB 1ZGLP 4PVLA 2XU9A 3DTUB 3MRNA 4WU5B 1VKXB 3L9YA 4MD4A 4YOKA 4Y7MA 3BGMA 1BJMA 1R3IH 5C0AD 4Z5RA 3PAZA 3ARZA 4Z76B 1MRFL 3K6SB 1JVKA 3ESNA 1JN6A 5EU4B 3MNZB 4P5KB 2GSMB 2OZ4H 3FAXA 1A3RH 1HQ4A 3ZDYF 3LTVA 4XNUL 3QUML 5IKCA 3DI3B 4LLWA 5I8CB 3ARUA 1NCBL 2AQNA 4X6DE 4UT6L 2G3ZA 1ONQA 1BBDL 4PJXF 1PIFA 3S5LA 1A7NH 4KUCD 1SN5A 5JPNC 4BSJA 2WP3O 1OTUD 4UT9L 2PR4L 2AAAA 4M93B 5K5YA 3FFDB 1NGPL 2NNRA 4RDQG 5CBAB 4YXHH 4LL1A 1KYUA 4X7FC 4AQAA 5C0DA 2F5AL 5JXED 2A9NL 1A1MB 1BF8A 3IRZA 4Z7OF 1JPFB 4AITA 3TEZA 5JPNA 4J3BA 1CZ8L 3MRGA 4MSWB 1SJHB 1SLXA 2G0LA 2YD2A 1FNHA 3ALPA 5IB1B 1VZGA 3VXUD 3HHSB 3OKOA 3GMQA 1IQWH 3WDIA 2H6OA 3OPZH 3KPRD 4LQ1A 1GGIH 2FRGP 3D2UD 2X41A 1VERA 4MMXB 4NQDD 4P8QA 2QVIA 2B9AA 1SF3A 2QR0A 3PJSB 4WV1C 4B96A 1ETZA 2CDEA 2D3JA 3BEVB 2OJZH 4XGZA 1FUNA 3ECBA 2R2BA 1FL6B 2XX0A 3CX2A 3PWJA 2D31B 4FFYH 1DP0A 3CZUB 3ELAT 1KB5B 1JWSA 1GSMA 3K4DA 5IBLD 3AREB 5IP4A 1A65A 4XZUB 1ZLWK 4U1NA 4WV1A 2F1EA 5CKGA 5GS2H 2XVGA 3VH8G 1N19A 4PJEF 2EDTA 1S5HA 3OL2A 4A6YL 3CV5A 4KXCA 1MF2L 2A9AA 5BJTA 3MYJB 2PW2A 1ZHBA 2X4UA 3NAAH 1CFQB 1T1WA 1C5DB 2ZSWA 2HJFB 3B83A 4PY8I 2NNAB 4BM7A 3CVIH 4F27A 4XO9A 4PRPE 5CILH 1DO5A 4W6WB 1F3JA 1MH5A 1NGQH 3GS0A 3QAQA 1HEHC 3SDAD 1NTDA 4IU2B 2Y1VA 4GSXA 4BYHA 4ZPVA 5JO5A 3SCMA 3ZX1A 5INDB 3UG4A 4GIOA 3QQ9C 4LGSB 1MVYA 5HJGA 2J71A 1I9RL 1OAZH 1LQSR 3EDEA 3IWVA 5C6PB 3DPBA 5EIIG 1NGZA 3WV0A 1EZLA 1WH0A 4JFHE 4TSAL 4AV0A 4N90E 4HJSA 3V0WH 3QUZC 4ONFH 3V0DA 5D1ZI 1KTKE 4LIQL 2X4QA 2IJ0C 4FLSA 5C0FA 3H9HA 2EZ0C 5EF2A 3BO8A 1WBXA 4WWPA 6PCYA 2JFCA 1AMXA 2EJ1A 4JDEB 2IPTL 3H2WA 3QUZA 4Z7UE 3D3VB 1Q1JH 2J8UB 5JIKA 3Q1SH 4G7RB 4OZGE 5CR8A 3L1OL 2V8MA 4WW1A 4E68A 4ODTL 1PS3A 3KPLB 1MIEH 4FFWC 4Y5VC 1JHTA 2QLVB 1DVZA 3GMRA 3R18A 4R96A 1EHAA 5DK0B 3CLEL 4AM0B 2V9TA 4GG8A 1YNTA 5CINL 5BVJB 4PRNA 4A7VA 4UOW1 3V5HA 1M2VA 1A6UH 2D0GA 2VLRB 5F7AA 3FK3A 1BD2D 1RKRA 3PG2A 3UX9B 5JLZA 2HX9A 4K2UL 4NKDA 4AQOA 1HAUA 3BI9X 4XNUH 1HT6A 3QRGL 3KDMA 3FUIA 4JG5A 1TMQA 2B1AL 2H2PD 1KEGH 2AEOA 1F8TL 1NCBH 4N2BA 3HPLA 1N7ML 2F7PA 2Z7UA 4UT6H 1BBDH 4FQXD 1GAFL 5A2CA 2X4SA 1MI5B 2A6KA 3I6LE 4FXGC 1KELL 2PR4H 4NZRL 4EN3C 3OMNB 1A0QL 1ZT7B 4HJIA 1BYOA 1ET8A 3CN1A 4KK6C 3DV6B 2K6WA 2OI9B 5FK9B 3SOBH 3D6GA 5HGAB 4L3EA 3T8XB 1UB5B 2A9NH 4ZS7L 1UGNA 2BP0B 3QB7C 2F08A 2YBRB 2DLGA 2V33A 1QUPA 3ZE1F 1CZ8H 4ZTOH 1F11A 1QBBA 3LB6D 2VZ1A 4FXGA 4EN3A 4XMUA 1RZQA 2WHVA 2Y3AA 4FLRA 4ALAL 4EIGB 1BZ9A 4ZFOA 4JY4A 5JIHA 2GTZB 3QHFL 5HHMB 3EH3B 1SUHA 4G3YL 1NJ9B 1EEUA 1RULH 2KKQA 4XNYL 3SDXF 4P5MB 4JKNA 4J7RA 5JORA 1CLOL 1MCEA 5ESVB 4HWEH 2BNQA 1A47A 1AOHA 1HWHB 3BAJA 4MMZC 4S11A 5CGYD 5IQ7H 3SO3C 4OZIB 4M9OA 4JRXE 1R4XA 1A6TB 2W95A 4U1GC 5DUBA 1GZQA 4K8RC 3TCLB 2W1NA 3OQRA 5IR1A 4YHLL 2CBQA 2PXYD 5I1CL 1W16A 4OGAD 3EF7A 4MMZA 3D8MA 1MAKA 4Z0BH 2CLRA 2YAMA 3NQKA 4FNUA 4Q56A 5DRNA 5C08D 3PUUA 5DMKA 4LCWD 3BAEL 3VRLE 1QRNB 4X6CE 5GZND 2WWMD 3X14B 3KYMA 3X2QB 2VN5A 3EGXB 3JUYA 5B38A 4QRUA 1USZA 2GABA 4NN6C 4P4KC 5BQDA 2TAAA 4QHNB 4K23L 3ULVD 3NCJL 2BRRL 3FOMA 3L5WA 1XCXA 4WFGD 4Y1AD 3BKCL 5FDYA 5IW1B 4WU7B 4NZTH 2V2XB 2EQDA 2B39A 2D7OA 3OKLA 3FCTA 4ZODA 1NFDB 4YVUA 2R51A 1HSBB 1QSEA 5AW1B 4OH2A 1I9RH 3X1GA 1PZDA 1YEJL 4XMWA 4P4KA 3AG1B 3O4OB 2KYIA 1GJUA 3L48A 3MV9B 4OQTA 2JCCE 5JDJA 3NP4A 4YIQA 4NIYE 2YGOA 1UD2A 2I60L 2JNZA 1W8NA 3CSGA 4JJ5B 4QRPE 3TO2A 1HI6A 3MRDA 2CO6A 5IBUG 3I9AA 4WTQA 5F9WC 1KGXA 2JIXB 2COVD 1EQWA 2XETA 4FTVE 3VXPA 3GKWL 3MBEB 3K74B 2WXFA 2IPTH 4ZRGA 3C8KA 2ED8A 1EHKB 2CK0L 3L3HB 3KPSE 4H88L 5SWQB 3FO1A 3C60B 3W0WA 1NWPA 4ODTH 2YD5A 2FWLB 4G70B 2VLJA 3UPCA 1RZGB 2XTJB 1IGTA 2ZWLT 3QI9D 1L0XA 4X7EC 1U0QA 2Y6TE 3K72B 3LS4H 2ADYA 3RX7A 3D9AH 1F2XK 2XT1B 4AYFB 1R34A 4NO0B 4KVPA 5B1CA 4RDQF 4KVCL 4BFIA 4PV8A 4QXVA 2R2HA 3PPSA 4CMMA 2A74C 2VLKD 2WUCH 4PGCB 3FPXA 3U6RA 4K2UH 4DGYH 1FHNA 4XX1G 2LT9A 1BEXA 5ADPL 4NXKA 4DEPC 3N43F 4Q9RL 3RGVD 2OTUA 3GYRA 4JFDD 1NGYB 4H2AA 5L8JB 1BMZA 3MLXH 2A74A 4LARL 3BLBA 5FKAB 3M46A 3QR0A 1O0VA 1TIUA 1KELH 4MNQD 4NZRH 1J8RA 1A0QH 2NY4B 4X9IA 1ROWA 5LBSH 3WGUB 4PJIF 4CMHB 4GUPB 4HUKB 3IN2A 3D25A 4Q0XH 1U36A 4K7PL 5E8EA 3EJJX 3QQNA 3FU7B 5I71B 2CSPA 1WCBA 3A6OA 3EBAA 3O3EA 3WEOA 4NN7C 3GLAA 4ZTPH 4ALAH 2ZSVB 3HC3L 4X9FA 1XGUB 3QWOB 3A5VA 4G3YH 3F01A 5HBBA 3TYGL 2EDBA 2PCPB 3BOVA 1S7WA 4U1LB 4XNYH 1ZLSL 1XR8A 3PAUA 3Q2WA 2DLIA 5BUPA 5JOPE 2XN9E 2OAAA 3MZGB 2WANA 3JVFC 3AADB 4MJIB 5EB9A 2DL2A 3KWVA 1T0OA 1MCPL 4YHLH 5HDBE 2X87A 1MCFA 3VRIB 3VDAA 5HPMB 5I1CH 1BA9A 3CPUA 1RUPH 2FNWA 4KU1A 1JXJA 4X5LA 5CEXB 1OAYL 1V10A 1XV8A 3ECWA 4NCDA 2WUBH 4M1DL 2WJ7A 1KY7A 3NIFF 5ICXB 1B3JA 4OU3A 2NY1B 1KENH 3E3QE 4LSRH 3FRUA 4PVNA 4A7GA 2EUXA 1OF0A 1ZS2A 5D7JB 3QIWD 2OL3B 4ZQTA 5L2KA 4K5LA 1SOXA 4HUXA 1M3IA 2AJZA 3NCJH 4K23H 2X4NB 3MTRA 4OSUL 3HZKB 1EXUB 5DA0B 3WFBH 1DTUA 5HXMA 4BWUA 1K8DA 3K6DA 3DI2B 4YAQA 1NEZB 1IAMA 3Q6GL 5GRZA 5AL8A 2NSMA 4HIHA 2ZE0A 3CSBA 3W5MA 2MEJB 1AO7D 4JZJC 3RAJL 4JO1H 4E36A 3RB5A 4OGYL 2I60H 4LRNL 2OSYA 1REIA 4I48A 4H7VA 4KHTL 5FYJU 2BERA 1MLCB 2APFA 4D0CB 5IVNA 1M71A 2OBGA 1MHCB 4MBRA 1GYWA 2CUIA 2UUDK 1Z9NA 1IFRA 1GIGL 2QT6A 1CO1A 4GBXB 2JB5L 1EFQA 2VRAA 3QO0A 3GKWH 5E9DB 3V4PH 4L05A 4Z77A 1WUZA 4JZJA 1KFGA 3QRBA 1ADWA 1JD9A 2VKWA 4FLQA 4GS7C 1B0RA 3MKKA 1QR4A 1AYOA 3O3DB 2EEXA 4NWUL 4XNDA 1ZGLA 3U9UB 4JN2A 4FQQB 4P3CL 4PD4K 1PKQA 5E1AA 3TBVB 4R7VA 4QIRA 5FDWB 4JJOA 2ZKMX 3RYMA 4RGOH 3PP4H 4YDLB 4G9FD 4PRIB 4HCRL 1E4JA 2DQJH 3UJIL 3SJVE 4HMEA 2NY6D 4MYPA 1J5HA 1UZ8B 5BZDB 5JW5B 4PCKA 1JE6A 1ZE3H 3Q0HA 2WKLA 3QZWG 1CDHA 3EYOB 1X4XA 3H54A 1EXGA 4OZHA 3KL0A 1OM3L 3MV7A 1OKEA 1TITA 2ZKYA 5KW9L 2BSRB 1M6OB 2G75A 2ZXAA 1P4BL 2ITCB 4PWIA 4XP6H 1NZRA 3FU0A 2P80A 2OXHB 4PG9A 3BWAA 4NNYB 1BLNB 2NSQA 4K5NA 4NDMB 1PZCA 5E4EB 2AQRA 4NQEA 3FUKA 1H3GA 1VPOL 4WAFA 2EDJA 4FQCL 2VJ8A 3TT1L 4QGYA 4CKQA 2WO3B 3KR3L 3V5DB 1LJMA 2GQHA 3OAUH 2Y0SA 1JD7A 2ERJC 1S3KL 4G7YL 3CSFA 4WFFE 2G4EA 3U36B 1THAA 3DROA 4JFFE 2HTLD 4U1SA 5J3HC 1TJGL 3CVHH 4U0QB 4UWQB 3DX7B 3TYGH 3R4DA 4XCEB 4PP1D 1UKSA 1ZLSH 2X0UA 4UQBA 1BFTA 3CFCL 1JXFA 4JN1L 4FAAB 3EZ8A 1CE6A 2X40A 5FECB 3GNML 2ILLA 3FQUB 5F6HI 1YEHL 1NQBA 1GZPA 4HHAB 4XPBH 5LAXA 1TSRA 1U92A 4KBPA 3OJDB 3SODB 3CFEA 3FQTB 1FO0H 4UNUA 2PN5A 3DRTA 5CD5C 3Q1EA 1HHJB 5D71L 1DQKA 5T1LA 3P30L 1J86A 4HZLA 4HJ0C 2B1HL 3RNQB 1RZJH 2WKGA 1SFDA 2OMTB 3TWYA 3U1SL 1TDQA 5IBTL 1ROCA 4TVSa 4K5OA 4YQXL 4JKWA 4GRMA 1NLDL 5I74C 3QUXD 1A25A 4RAVA 2YXFA 3L4CA 4E9TA 4IEFB 3NACH 4F8QA 4J6IA 1WP6A 4OSUH 3QDJB 1OP4A 4LVNB 4M6ML 3CDCA 4NO3A 1FCGA 4Y1SA 3T8VA 1HILB 2JLLA 5F7HA 1NGWA 1LEIA 5DC0A 1URIA 2AJXL 5D7EA 5KEZA 3Q6GH 5IHZB 2G3MA 5FYKD 4IDLA 2H3KA 2K78A 4F8NA 1JZ5A 5D70L 2IPUG 4RMBA 4MD0B 3GI9L 4BFGA 3F5WB 4S0SD 2GJ6E 1D9KC 1WBZB 1S9YA 3CVBA 4OGYH 3RZCB 1S9WB 1ZA3B 2OYPA 3MBWA 2RA1A 4XPAL 5I6NA 1T21A 2PWDA 3Q5YA 4APQA 5EDSA 4MRBA 1QLRA 1H15B 2HSIA 5CEZH 2EACA 4OFVA 1GIGH 3GUTB 4HALA 4WGVB 2AGJL 2JB5H 4XAWL 3SYAA 4WNQB 1PYWA 2QGBA 1D9KA 1UEMA 4KY1H 2ZG1A 4EI0A 3WFEL 2FTAA 5DJZB 1UQSA 3GLDA 3LRLA 3H2QA 1SNRA 4QT5A 2V5MA 4KXZI 3WBDA 5LDSA 1VCAA 4P3CH 1E8ZA 1UWGH 3QXAB 3G08A 4QXGL 4XBEL 1KFAH 4PJ9D 3GHEL 4L4TA 2ZCHL 3JV4B 4HCRH 3M6DA 3V6ZB 1AE6L 3PAYA 1C1EH 1MJJB 3U46A 4GSQA 4QOKE 5E6UB 4K3EL 1D6VL 1U95A 4NZJA 4PJHA 2F54E 2YD3A 4PYHA 3ZDXB 1OM3H 2BDNH 4RAUB 1RZFH 1U58B 2GUYA 5T1KA 3B2DC 3GXDA 3HTLX 4OW6A 4NAMA 3VFPA 5KW9H 3DIFA 5CIPH 4PJBE 1B4TA 1DJHA 2AEPH 3CGTA 4HK0B 4DP0X 4AV4A 1ZPUA 3HJ0A 3F58H 1MUJB 3K2IA 1DLHA 1U3ZA 4PRDB 3TNMB 2V2WB 4EF3A 2HRHA 4HZAA 3U7WH 1PAZA 1T5KA 4OIIL 4Q52A 4BIKA 1KYOK 1VPOH 5JHDB 2DQHL 1WUNT 3M17A 3SDYL 2IH8A 3VVWA 3IU4L 1N3NB 2DM4A 4DGVL 1S3KH 1DANT 3MRHB 2D7QA 4DJMA 2AEQH 3U7YL 2O5XH 4B97A 1KXVC 1EVUA 3IDYB 3O8XD 3TH3T 3Q2VA 2Z9TA 1LP9E 1AGCB 1B6DA 4KAQH 3SSGA 3T2PA 2NY0B 5FB8A 4D9LL 1CXIA 3PGFH 4D0DB 4JR9L 4Y2LA 4B5EA 4Y8AA 2Q3XA 1KXVA 1BVKB 4ODUA 3W37A 1G7PB 3RDJA 1YAIA 1IAII 5EFIA 3N85L 4ELMA 5M94B 3RL1B 5D71H 3VWKB 1N59A 4X7SH 3TIDA 5ESAA 4JM4H 2P5EE 4X5XB 4Y5YB 5CLYA 5IY5B 2E76C 5CJOL 2HFEA 5IBTH 2HN7A 3IF1A 3ZPDA 4YQXH 5D7LD 5DLML 5IFJA 3AG3B 1AKJA 1V7NH 1HL9A 1ZHNB 2CUMA 2IWEA 4U6XA 1QUNA 5ISZD 4L8DB 3GTVA 4N1CA 4ZW3A 3GJFA 1SN2A 2E3VA 5JYMA 4M6MH 3IKCB 4HPOH 2W81C 5IB5A 4LAQL 5T3ZH 5JZ7D 3ULUC 2JK5A 2GKIA 2AJXH 4AK1A 4Z7VA 3MV11 1BDYA 4NQQA 4GKSA 4HIXL 4JFZL 2O6CA 4P9ML 5C07E 5AYUL 3BSZH 2VDRH 3D85B 2QZQA 4ZO8A 3D39B 3II3A 3LEYH 3SKJH 2XCMC 2EXYD 4PRAB 4WHDA 1M3JA 1OF2A 2HCZX 3OWEA 4ICXA 5AUMA 2IH1B 4O2FB 2VMCA 1Y18B 2ZOTA 4H0IA 5G4MA 3EO1B 4AJ0A 4XN2A 1B2WL 2DMKA 4N2GA 1WFIA 3FPYA 3DARA 1MAML 1YEDA 2F0CA 2XVBA 4G1MA 4LSPL 2AGJH 5BZZA 1G6RA 3I6KB 2E46A 3LQZA 4XAWH 1R1CA 1CL7L 3C09C 4N2KA 1S3RA 2WGNB 4L2YA 4QHKJ 4XOAA 1G5GA 2YPVL 3R19A 3NFSH 4CVUA 5IGXL 1OK8A 3DPDA 5KVEH 3AGVA 1ESOA 4EXPX 1E90A 2X0VA 2EDNA 3QZNA 5HSFA 5HHVL 4XBEH 1I3VA 4Z7AA 3BZ5A 3S96A 3GHEH 3L7EA 2X2IA 4JW3A 3QZBA 3UFIA 5DHVH 5F1IB 3MNZA 5BRZA 4HKXB 3T3PE 3AQYA 4OD3H 3P4LA 5D1ZD 1S7UB 4QHMA 4X9YA 4BZ2L 1AZBA 4K3EH 5HHXL 4LSUL 3MUY1 4RIRB 4Z7NF 3M88A 4C56D 3HUJA 3INOA 2ICEC 2WXRA 3QIUB 4EAEA 5CBAA 5EO1B 2B14A 1MWAB 4R4FH 3B8SA 1ZSDA 4KUZH 4E41D 4L4JA 1QATA 3MU3A 4JFUA 3EJUA 1J8HB 1A1MA 1SOSA 2C7UA 1LO5B 4NKMA 4N5UA 1JFHA 5E8OB 4OF3A 4LL4A 4MMXC 2HTKD 5JDSA 3BJ91 4TTGA 1SJHA 2ICEA 4RGMC 4JANB 1QKZH 5JPMB 4AMKL 4EN2A 3QFJB 3VO0A 1TZIB 3BP6A 3SDYH 1FP5A 4CADA 3ETBF 3OB8A 4MQXD 4JGNA 3V2AR 5GSVB 3G6AB 5GRXG 2X12A 1IGCL 4MMXA 2FDBP 4NN5B 3U7YH 3X1EA 2JB6A 2P52A 3PJSA 4Q6IB 1YEKH 4GB9A 2LTQC 4M43L 3LPPA 1ZT4B 3AFLA 3LVEA 1OCWH 3DO7A 3C5JB 4YDIL 2NZ9D 3HZVA 4XCCL 1IC5L 3EGDB 2MHAA 1HC1A 1L7IH 4K3JL 5D1QC 3VXUE 2FJUB 5CGMA 5E1QA 4IHOA 4XZUA 4D9LH 4N26A 4EZLA 1C12B 4IOIB 4QI3A 4I0PC 4WEUD 2F58L 3WHXA 4N0UB 3FU9A 4O02H 5ID0B 5KYWB 3OZKA 1G9ML 4PBVC 3I02B 3VG9C 2XLLA 3MR9A 2FJHB 2VDMH 2EKSB 3LYRA 1C5DA 5D1QA 3CZFA 1HOCA 1CFNA 2HLAB 4I0PA 4OB5L 4OJFL 3KPQB 4XOBA 2WO4A 5MERB 3L4VA 1XBDA 1ZT1B 5SWZA 3GSOB 2UZPA 1BOGB 3B7SA 1FH2A 5KSAD 4G8GE 1TO5A 4TULH 3REVA 4P9HH 2CQVA 1Z3RA 3PWUA 3KGSA 4CVZB 1KTCA 5TE7L 3VD1A 4LAQH 3GKZA 2H41A 1MPAL 2Q7AA 5FHAH 2HRGA 1JUFB 3ENEA 1CR9L 1F6LL 1RJZB 1WBYB 1XHHA 2ZOUA 2YEZA 3TS8A 3PLYA 2JJUA 1BM3L 3IFPB 3U0WH 5MP6L 1EJ6A 1CMOA 1G9NH 5F96L 1KBKA 3L3KA 3IRPX 2CPUA 3FB7B 1R3HB 3ILPB 4ZPTB 4M5TA 1I7ZB 1MFNA 1MRDH 2J72A 3CX5K 5IQLA 4AG4H 2J8UA 5FXCH 5GZOC 3HBGA 3U2JA 4LSPH 1OP3H 1IL1A 3IXAA 2OYKA 5DD3L 4LCCC 4LOFA 4ONHB 1MWOA 1YLBB 5C6WH 1CL7H 1FDLL 2G9HA 2GG1A 4XCNA 5CJBA 3ZTJH 1G7JB 2NTFB 3CMOL 3GXIA 3QC5X 4L1BA 5GZOA 3IDIA 1FIGL 1XH1A 2Y7MA 3G7TA 5EPMA 1BXXA 1KB9J 3MACL 5EZOL 1X9LA 5HHVH 3LKSB 2HJLA 4LCCA 2BVYA 2WXPA 3UBGA 5IB3B 3FFOA 3FONA 1QLEL 4Z3JA 1EAPB 1Z0MA 1T6BX 4I89A 3T77B 1DSFL 5FAAA 3SPIA 3B9EA 4JE0A 4QRSA 4BZ2H 1PCXA 3GK8H 2BZCA 2HT2C 1MREL 2E7MA 4BFKA 2WO2B 2FJGB 4KI5F 1MI5A 5ETUB 3UCRA 2HB0A 2WLNA 1ZT7A 2QVFB 3RWJB 3MA9H 3BUQA 3LKQB 5FK9A 2YRPA 4TLKA 3AWFA 3T8XA 1YUHB 3RVTD 4YHNB 5IMKA 2VLLB 5DD5L 2YBRA 5IT2L 3VDBA 2GTWB 5CBEB 3FW6A 1EHLH 3VXMA 4GRWE 4FG6D 4LP8A 4PJCF 4RGNB 3OZ9L 5J13C 2VL5B 4P59H 2DLEA 4ZG1A 3MRRA 5L4FA 2NXZB 2W07B 2P42B 4LESA 2XWZA 3P77B 5ANMB 2CMRH 2PYEA 5IW6B 4JDZB 2GEQA 5DSCB 3FT4B 4WW2F 4AT6B 1SJEB 1ZVSB 4K3GA 4LXFA 4PGEB 4AX3A 4G9DB 4M43H 4F7CA 3A6CL 4Z3TA 3ARED 5CJ8A 4FKHA 3TCLA 4KJWC 3DOHA 2OQJA 2O93L 4XCCH 1HX0A 3HFFA 5CD3A 2DMGA 3JT2A 2W0FB 2VXQA 4K3JH 3BAYA 1IM3A 2UXFA 3N0PB 2J43A 4DOHE 4R7NB 2BMKA 2GJRA 3MFFA 3NK4A 2BIOA 3L4TA 3P3YA 2VR4A 2K3HA 1YZZA 2DRUA 4KXDA 5MI0B 2N56A 4OB5H 3VWJB 3SBWC 3DOSA 3R06A 5E03A 3F00A 1RAMA 4RMSA 5J06A 4YVNA 2JELH 2V2XA 3RIFF 5HGHB 2Y9RT 3CCHA 5C08E 5ALBH 5CEYB 1RK0B 5BOZG 1W0VB 4UINH 3OTTA 3QUMB 1KC5L 4YSDA 5IHHA 5HY9A 4KZDH 2Y22A 5D2NC 5TE7H 3SBWA 1CIDA 4FXKC 2OTWB 2YPLD 1TLKA 4IGBB 4IOFD 5I30L 3RU8L 1AACA 5IG7A 4ZYKA 1A3QA 3MBEC 4S10A 3A0OA 1CR9H 5F7YC 1JNLH 3ZKXB 3MNDA 4Y5XC 3D0LB 1BM3H 4U7SA 2X42A 3UAJD 5D2NA 3D3VD 5H94B 2JIXA 3BFWA 4FXKA 1OSYA 5FOJA 2BVQA 3MBEA 5F0MB 5IUSA 4EQ3A 1E5AA 1UM6L 3H9SA 4Y19D 4Y5XA 3MOAL 3VGGA 3CG8A 1CGWA 4U3XA 4P4RA 1RZKC 5FX3A 3F7KA 5EEWA 3E8UH 4F9LC 1MW0A 2VLRD 2DMHA 4AYFA 5EH1A 2F53B 5T33H 3C12A 1EPFA 2W65A 3MACH 5I6XB 4DP5X 5EZOH 3IETB 1Q94B 2XIIA 2FAUA 1BP3B 2CGRL 3CPLA 4F9LA 2CKBH 1OLLA 1F3DJ 2FZ3B 3EH2A 4RNRB 4AYID 5B39A 4E5XB 1K85A 4M7LH 4CMHC 2EH7L 5CN1A 3C9NB 1IAKB 2UZIL 4A6YB 2AV7B 1A6VH 4DP6X 1MREH 4XNXL 3LNDA 3QUKB 3GMNA 4OCLC 4JB9H 5FKAA 4K3DL 3BZDA 4JKPL 1MCOL 2A83B 3CDZB 3G04B 5IREA 1CWVA 1LO2L 3HW7A 4LLMB 4AYEC 1UWXK 3QPQC 3EJYD 3VFNB 4HJEA 2HXAA 5HHMD 1EJFA 2X88A 2ORBH 4XX5A 1ILSA 5J11B 2Y36L 3BPOC 3BQUB 3GSXA 1XGUA 3OZ9H 3QWOA 4MHHG 3TO4C 1P6AB 4L3EE 5TDPA 4MNQE 4DCQB 1QBML 3FN0L 4WKZB 1CGSL 1KG0A 1OAXL 4N2AA 4U3CA 1QVOB 3BUTA 2Z65C 1OT1A 4EI5B 3TZVC 4AEFA 2IXQB 3OPUA 5KBLA 3MRFB 2RALA 5I1AA 2Y5TA 5KS9E 2NX5D 5DZ9A 4BQBA 1QRND 4RX4A 1IKFL 2R1WA 3TZVA 4BKLA 2ZKXA 1CDYA 3UC0L 2PWEA 4G8FA 4LDLB 1QRKA 4QRQB 2AJSH 2QV4A 3P73B 3QXTA 2J55A 4UBDD 1YPZF 2IGFH 1GTNA 3JVGC 4Y4HC 1I9IL 2BSSB 2A1WL 2OMUA 4XVUD 3HZKA 1EGJL 2YOCA 3BZFB 3CN0A 3CC5A 3V10A 4GG6E 3D4YA 3DRQB 3MV9D 1BZDA 1HCYA 1T04A 5EBLB 4EOWL 1WD8A 1KC5H 3JVGA 4Y4HA 1INQB 1W9XA 2UY6B 2OSWA 3UO8B 1GYVA 3RU8H 3SPJA 2JKJA 3DVGB 4S1RL 2VZSA 4MMYB 4O51A 1QSEE 4ZW7A 1MLCA 4D0CA 4H5SB 1OL0A 2H1LM 2EDDA 1LQBC 3WEXB 3FOLB 2GPZA 2VWEC 3MLYH 2R1YB 4XP9L 3C60D 4EUPG 4M48L 1M7IB 1QA9A 4JZNB 5D7SH 2XTJD 4HUWB 1XFPA 1UM6H 1AH1A 4ADGA 3EYSH 3PJLA 3MOAH 2X1XR 4MAUL 4NO0D 4ODVH 5IJKC 2JI3A 4FQQA 1T1YB 2DLFH 3IU3B 3BIKB 3ZYIA 2RR3A 3MUGA 3ZHFA 1MZYA 2V4LA 3OR6B 3H42H 2R0KH 1BOYA 5BQ7B 3CHOA 3W0WE 1QPXA 3KWXA 4PU2A 3VQ2C 3S97C 2DAVA 4KTGA 4GAGL 2VLJE 2ZKWA 5DJXA 1QO3B 1Z1WA 5IJKA 2W9DH 1TJIL 4IRSD 5BZDA 1NAMA 5C0CA 2KPNA 1YYLH 1TVHB 1TEGA 3EYOA 1OEZW 2LAGB 4QPEA 4DVRL 3PQYB 1H6TA 2G5UA 3COOA 1NCGA 3MRQB 1NL0L 3UBHA 1UA7A 2NY4D 2BSRA 2B9BA 4Y16C 1YN6B 1PD1A 4XNXH 4FADA 2VIRB 3QWQB 3CIAA 1M4KA 2V3FA 4OCSH 1S9VA 1M9WA 4JKPH 4NNYA 3LNGA 2IAND 1LO2H 4UV7L 2ZUUA 4DP7X 4PTTA 3RFZB 1JCVA 4DTGH 4DP2X 1E6OL 1LWJA 1G84A 2CM6A 5D55A 4FFZA 1OW0C 2CXGA 4Y16A 1QFPA 4RBPH 1DLFL 2A6IB 5CR1A 5GS1B 4E9XA 4JPWL 5CAYB 1TQWA 3MLTA 1LE5A 1AQHA 3RJOA 2HH0L 1BEYL 2YMXL 4I85A 3V4UH 3QDMA 3FSZA 1X5GA 3S88L 2ZG3A 1VFAB 5F1NA 2BWDA 3DX7A 1AVAA 3VU2A 2DYSB 2PPCA 3IBEA 3MO1B 4I88A 4MJID 2QFPA 3WUWA 1DQQB 1OAXH 4P23C 1MLBA 4OJCA 4EZMA 2MCPH 2R23A 3FQUA 2PMZA 1KGYE 3WLWD 3BP7A 5KAQF 4PUBH 4F93B 1XGQB 2X53A 4HEPA 2FB4H 3FQTA 4L1DA 1IGIL 2LW3A 3ZKQD 2GK0B 1J0YA 1FVCB 2NY1D 1TQUA 3N1MC 1XB3A 3Q43A 2IDCA 1MZZA 4JFEB 4P23A 4P5TC 4QJ4B 4W9FC 3NBNA 3CLWA 2CDGA 1UATA 2Q2EB 4LVNC 1QZ1A 3KPNB 3V9EA 1BF5A 4XI5D 3DSNB 1XL6A 5D7JD 3R0NA 4AENB 5L0QB 4PJGE 3DVFA 43C9A 2VXSH 4P5TA 2X1WL 3GRBA 1I9IH 2VDLL 5T3XD 1EGJH 1X7TA 3AT9A 1PG7L 2FSEB 2GJJA 3VFTB 3TBSB 1D3CA 3QJTB 3LXAA 4KH9A 1BD2A 4YO0A 1SPDA 3C8DA 4UTAA 2ENJA 3FT3A 5F7BA 5L2KE 3ZTJG 3EYFB 3QNXB 1MJUH 4LSSL 4HFWB 2WW8A 4L4VB 5IVZB 1HEZB 3H3KA 3R1GL 3V4VB 2EE2A 3F5WA 2VXTL 1WBZA 3PL6B 2W92A 1QSFA 4GBXD 3U1PA 5E9DD 5C3IA 3PDOB 2DQ6A 3ABGA 1F2QA 1KJ2L 4KK9C 2Z0BA 3LN5B 5FYLH 4B9IA 5KSVA 5FYKE 4FYRA 5I75B 1XF2B 2EVIA 1YDPB 5IJBC 4WNQA 4NPYA 4XPGL 2XVKA 4OUUB 1OHZA 4JDTL 1XIWC 3IDNA 4QRRD 3KLAA 2OXGA 4MAUH 5E5UB 1IBGL 5E00B 4BDVB 4PRID 4U49A 4H8UA 3QXAA 1ORSB 4YDNA 5DJAA 3G5XA 1VENA 4NBXB 2RIKA 4EKXA 4LEXL 2VDKH 2UZXA 2Z4QB 3B7YA 4K15A 3NZHH 4Q89A 1XIWA 4G80B 3WMSA 5TPWH 5IMMB 4N3TA 1PKQE 1QP1A 4LHUG 5AW2B 5HI4C 3RWDA 1BZEA 1TQTA 4FCHA 2L4OA 4Z7WB 3KVQA 4F3FB 5IJVA 2CGZA 1D5MA 4G7SB 5FGBC 5GGSA 1HNYA 4LMQE 3UH8A 1RUML 5GHWL 1MY5A 2O30A 3W9EB 2E9JA 1F4XH 3BXNA 1NL0H 3M1CA 4P2RB 1AS6A 1H19A 2CJ3A 3T4YB 4OZFH 2R29H 4FYTA 2ZG2A 4OQ1A 1T20B 3RRQA 1QX1A 1OLZA 1T0NA 2H2SC 3KPTA 1PZ5A 4N22A 4BH7B 1DHKA 4OZHE 3UTQB 1QG3A 4PRDA 4KVNH 2V2WA 4NZ8A 5FGBA 5C0IA 2AJ3A 3MV7E 1RIHL 3DX9B 3B5GA 4XPFH 4Y2NA 1GTFA 5DUPL 3ETTA 1QFWM 2IH3B 2XKSA 1HH9B 1T22B 4PS7A 4QY8B 4XNMA 4PJFB 5IZ7A 2WXNA 1OWRM 3U2SA 3IXTA 3W57A 2LLGA 2OMXB 4JPWH 3TOPA 3CIQA 2HH0H 1BEYH 4NQEE 4MKMA 4RRPA 5I1KL 1NEPA 3H3PH 3D4GA 5KBNC 1WZ1L 1U8KA 2ESVB 1DDHB 1DUZA 3JQOB 4OBSA 1QW9A 2C9VA 5E08L 4NOBA 5DZVA 2H6PB 2VL4A 3N41B 2ARJB 2NMSA 1AGCA 4OZ4A 1MHEA 1RHHA 4W93A 5ERWA 3QSKB 4HISA 4ETQA 3P69A 4OKVB 5KJRH 1FSKC 3CXDH 5PAZA 3WTYA 4D0DA 3BHBA 4ABUA 4TTDC 4YSSA 3L3IA 4XBGA 5GGRB 4HDIA 3VSQA 4R2GB 4U2YA 1ILUA 3OXSA 4TPRL 4PFEA 1EHXA 1MFEL 2CIIB 4KHXL 3T5WA 2X4PA 4N25A 4N4YB 3VG0L 2QLYA 4G42B 4DEUA 2YLHA 3V7AG 3QDJD 3EOTH 3TBBA 1ZHNA 1A6ZB 4YHYB 1X5MA 3ZKMC 1JZ7A 1GGYA 1JTPA 1FJ1A 5K1VA 5E6RB 1G7HB 3L1EA 5JW4Q 1LVEA 3O45B 3VTMA 4A39A 2MQ3A 1PG7H 1R47A 4TLTA 4YDMA 2DZEA 4MX7B 5EU3A 2NYKA 1N18A 2IMNA 2VM3A 1SHSA 1BXAA 4LSSH 3RZCD 4MDIA 5IHBA 4N0CC 2DW5A 4X9BA 3D33A 3HG4A 4JCWA 3P11H 2YAOA 1FQ9C 3T0XA 4DKEL 2IH1A 4F33A 3HA0A 3EO1A 5KSUB 3N1QC 2B77A 2EDHA 3ZQXA 2AP2A 1J7VR 3L3DA 3H7BB 2DI8A 3A3YB 1SXAA 1JPSL 1M05B 1XCTA 4P3DB 4TQIA 2WZ5A 4RZCA 2XY2A 4MFHA 2F19L 4X6DF 4HKBB 3ARBB 1GSKA 4ZT1A 4ENZA 2CALA 3NEOA 3RWFB 2F1AA 3L3OB 4HH9B 3VA6A 1IBGH 1ZTXE 3UBXG 2ZXQA 4W9DC 1F1DA 4M7ZB 3TJHC 3O3BA 3FUMA 2QV2A 2QVKA 1XAKA 2Y6SC 3VMPA 4PH8A 3V79C 1ED3A 3BKMH 4KKRA 4PWFA 5F1IA 1EA9C 2R8SH 2VYRE 1NMBH 2GFBB 3HMXA 4KWUA 5CNHA 3ZE2E 3MOBL 4HWBA 3HS9A 1Q0EA 4QYOB 4P49A 3A67H 1S7UA 4JPIB 3IFLL 3SQOH 1G0YR 3B9VA 2FJFB 3AACA 3QEHB 2OMYA 4NENB 4L4TE 4WDIB 2KMWA 3UTZA 2FIKB 2GITA 1GKEA 1WJ3A 3CFKB 4ETYA 1JXGA 5GHWH 1CXEA 3DVNA 3OC5A 1LDPH 1RIUH 5T5FH 1GXEA 1O6VA 3D4CA 3ZOAA 5JPMC 3HBZA 4MGXA 1HE7A 2Y5QA 1C5BL 4PJHE 3TBYB 2V9QA 1LO5A 1U8IB 1TYEB 2QSCL 2E4TA 5JHDD 5LGJB 1TZHB 4NN5C 3VMOA 5E94A 4DZBB 4PSPA 2LVEA 5DUPH 4KPHL 4KKAD 4C58B 4F7MA 4JVUA 4F7EA 5JPMA 5FW8A 5C0BB 2ZUWA 5D9SB 3ZL4L 4BBWA 3ILQD 5GXBB 4FL4B 3RVWC 1GKOA 2G60L 5HHNA 1ETJA 4V1DD 1T4WA 5I1KH 1NDGA 1NBVH 3BPCB 4Q6IA 3JTTB 4NKIL 4FEMA 1KCSL 3C5JA 3GIZH 3TN0B 3EGDA 1M53A 4YDJB 2X1OA 4IRZH 4JM0A 3FXIC 2WBWB 4MKTA 4U6HA 4HIIA 1C12A 3VWKD 1KIQB 3BEWB 1O9WA 1JWUA 2MTAA 5TFSL 1DR9A 4IBYA 1TKWA 2PO6C 3NN8A 2XA8H 1ZJBA 3MRKB 4JGJA 3IDGB 5AOZA 1WHPA 4TPRH 3DHPA 1CF1A 3EBHA 1CFSB 4KHXH 3DTDA 2HLAA 3PXJA 3VG0H 1S5IH 1M6UA 2E6JA 5B4MD 4ELME 3OG6B 4HJ1A 1PEZA 1BOGA 4FQHA 2PO6A 5F9JA 3S98A 1EBPA 1CS6A 1CXFA 3VGAB 4Z7UF 1S78D 3ZL2A 4EPSA 4TOYH 1IEHA 1RU9L 2ADIA 3N6YA 2K6YA 5FO8B 2MRYA 2UY7B 3D85D 4TQHA 5GRVK 1JUFA 3MLUH 5FO2A 1QHQA 2FQFA 3HJEA 3ARDB 1MFAL 4LKXA 2ZKHL 5GJSL 5C0GB 1WISA 2Q20A 2DIEA 3Q6FA 2BY1A 3CFJA 4JFSA 1FGNL 5FYJD 1B4JH 4DKEH 5FCSH 4OFIA 1L0PA 5CGTA 3V0VB 5CN3A 1WDAA 2YN5A 2I07A 4ZPTA 2VLMD 4JFOA 1W15A 1ZK5A 5DMGD 2AABL 2JQZA 4UZUA 1BM7A 2VISB 4ONHA 2AJYL 4HUCA 3GD1C 2NR6C 3BKYL 1EHNA 1IEBB 2NTFA 1AC0A 1AIZA 3MNWA 5E7FA 3X11A 4PLJD 2WC7A 1R24B 5TH2B 1FLRL 4MCNA 5E4AA 5KUMA 1XH0A 2WLLB 1VZIA 4NB7A 5ECGA 1QWUA 1DBKL 4BEIA 4PJ5B 2NR6A 4KNSA 5F3HB 4OV5B 2COQA 1MHHB 2WIMA 1EAPA 3VI3F 4ECNA 3GRWA 2CO7A 4NQCA 3T77A 4WGWB 5I1LB 2E7HA 4L0PB 4U1KA 1UM5L 2JKWA 3NA9H 2GCYA 3HE6B 3QIUD 1R75A 4UTCA 3T2QA 3WN5B 3M7FB 1FFTB 5BRZE 5M95B 4R26L 1ACZA 5HYJA 2DBLH 1J8HD 1FL3A 2Y07L 4RGNC 4FMVA 3D08A 4AZ8B 4HC1H 1UA6L 3LKQA 3BKJL 1YSOA 4X7CC 5I5IA 1A02N 3NIGE 2XWEA 4BD4A 3M07A 3U79A 3ISYA 3HUJE 2OK0L 3WKQA 1GGUA 2YKKA 3QZOA 3DJRA 4FD0A 4KV5E 1WAAF 2ZUXA 4WNJA 4KPHH 3IGLA 4L3FA 2VL5A 4AE1A 5KSBA 5HHPA 2WLYA 4D7BA 2W07A 4FG0A 3RDTC 4P57A 3VRLF 2G60H 4X6CF 2D2OA 1KTBA 4ORZC 4QWWD 3W5NA 3HLAA 1QFWL 1UOVA 1ZVSA 4X50A 4PRPB 1VEMA 3Q7JA 4NKIH 1Z3GL 3KWTA 4HXBL 3GZKA 4JQXC 3RDTA 3POCA 1TTRA 2OPCA 1GRWA 3RNKB 4LLYB 1KF9B 3STLA 5BMFL 4GRWH 3GTNA 3B9KC 5MI0C 1IU1A 2QSVA 4QHPA 3VQLA 3VFWA 2O61B 2Y25A 3IPFA 2Z35B 5TFSH 1V3KA 4JK0D 5G55A 4JG9A 4GKZB 4OTXL 3QG6B 4LLAA 3BN3B 1Q9OB 2JCCF 2WBJC 4JQXA 5A16B 4YDKL 4O4YH 2WNWA 2FEDC 3T0AA 4PJ9C 4ZFOL 1W72A 1IBYA 1OOAA 4AZUA 2KQMA 3B9KA 1ZY9A 3BD3A 3PABB 4PJ7F 2R9HC 4MNHA 2ZUQC 3L95A 5ACZA 1LMIA 4HX1A 3PWNA 2PWGA 3ATEA 3GHPA 1NLBL 4X80L 5EORL 1AIFB 2WBJA 5D1QE 3S8GB 4DW2H 4DAGH 4WJG3 1TR7A 4YE4L 2F74A 3L45A 1SLUA 4OZGB 4J8RA 4DUXA 1MCDA 5DJ6A 4XMPL 3PWVA 4YSQA 4LCUB 2ZYSA 3FN3A 3V6BR 2E9WA 2HYMA 2ZZUT 2EO7A 4GT0A 2IBBA 1PSKL 4HF5L 1HXMA 2YC1A 2ZYRA 2GJZB 1PLCA 2X2YA 4QXWA 4CSTA 4XBPA 4UM8B 4AXWA 4RISL 2A38A 4X7TB 4J3OC 4K8RL 4BK5C 1FGNH 3W1ZA 1I8MA 4ZFFB 4HKZB 1G94A 1T2QL 5AKVA 2NOYA 2FLRT 4LK4A 1YC7A 4BK5A 1H8NA 1GR7A 4NO5B 5EBMA 2ZCZA 4OGQC 4A2LA 5E6ID 1LWRA 1VESA 3VH8B 4YFLF 3ULVH 4LSTH 4OZFG 2H32A 5TQ2L 3RIFK 2J8UE 2DQUL