5F89A

Structure of the unliganded fab from hiv-1 neutralising antibody cap248-2b that binds to the gp120 c-terminus - gp41 interface
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
228
structure length
228
Chain Sequence
b'EVQLQQSGPGLVKPSQTLSLTCNVYGVAISNEDYYWTWIRQHPGKGLEWIGDIYYNSGTTHYNPSLKSRASVSVDLSRNQFTLKVTSVTTADAAVYYCAREASTKITDDGGAFDFWGRGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAP248-2B Heavy Chain
publication title Structure and Recognition of a Novel HIV-1 gp120-gp41 Interface Antibody that Caused MPER Exposure through Viral Escape.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 228
sequence length 228
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f89A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f89A01
3S4SG 3QSKB 4NKIH 1IC1A 5I1DA 2MTPA 3CUPB 3K8KA 4XZUA 5KN5A 2ZKHL 5C2BH 1LDSA 4K3JL 2CK0L 4MB3A 1NMBH 5BS0D 4Q9RH 5HVWA 3RNKB 4I48A 3UBXA 3BZEB 2XA8L 4KK6C 5AWNH 1T2XA 5C8JA 4Y4FD 2ARJQ 3O6FC 4GUPB 4NNXA 3T08A 5KAQF 2E6QA 3BH8B 1FFOB 4MX7A 4X8JA 5T1KD 4R2GD 5I2IB 4LRNL 3TP4A 1X7QB 1KOAA 1RIHH 5TGBA 1C16B 3VXQA 1GGCH 2D7PA 4Y4HA 4RIRB 4QHKJ 3ZHLA 5KSBE 4H1LH 4L8CA 3BPCB 2KZWA 4PGDA 2IANA 4OTXH 4KTEL 3ZKXC 3FHAA 4U1GB 2DICA 4OT1H 3OF6D 2WK2A 2IBZX 1FGVL 1F90H 2M1KA 5JMOC 4OZFA 1C5CL 3O6LH 5DTFB 3ZE0F 2GYSA 1RZIA 1ACYL 4PLNC 5FUCC 3O3EB 4OM0H 5FM5O 5IHLB 4YUEL 4ZOEA 4WEUD 2DQGH 2B5IB 4HD9A 1IAII 3U30B 1S7UB 2Z8WC 1NEZA 4Y2DD 5T1DH 1T22B 2XICA 1GYAA 2QADC 3KYOA 1I1YB 2HVJB 2DIBA 1EJ6A 5LGKA 4JZJB 3BKCL 1JGLH 5FYJE 3FQWA 2HH0H 3MGOA 3UTZA 4I3RH 1F97A 1PX4A 5T3ZH 3ZLQC 2AXGB 4W6YB 2Q86A 2KDGA 1IQWH 4M8VA 3T09A 1S9VB 5I73B 4Q9QH 3S8WA 3VRIB 4ERSL 2IF7A 4MWFA 4Q6IA 4F7TA 3KPSA 2MQCA 3CVIL 3HUJB 1QSZA 3W9DA 3V52L 4NZJA 1PQZA 4JM2F 2Z0BA 5FF6B 4YDIL 5IKCA 5JPMB 1RJZA 2OQJA 4LEOA 3PWVB 4HZLA 4GKZB 4IMKA 5GGVH 1OGAE 5AAMA 3RVVD 1KELL 1NL0H 2BSSB 1S3KL 2I9TA 2L4OA 4HAGA 3U1SH 5I1KH 3LPGA 3OKMA 5DJ6A 1UXWA 2O26U 5KSBA 5IESL 4NHCH 1I9IH 1Y6KR 4PV9A 5J9PB 2FLBT 2PO6D 2BNRD 5ESQA 2R0WL 3LN4A 4ZPTB 3ULUF 1E6OL 1XCQB 3WDHA 3QG6A 2EDOA 1M71B 1U3HA 3KXFD 35C8H 3QNZB 1CIUA 5L88H 4OCWL 1NAMB 3O3DB 5BO1H 1N5YL 2RIKA 3BN9C 4P23C 3MV7E 1NC4A 3V5HA 5FKPB 1U95B 2ZCKH 3OZ9H 5C0AB 3GJFB 4GW1A 3AFLA 2E6JA 4M6AA 4ZAKD 3LD8B 4JY6A 4LARL 4UT9L 5DVKA 3DMMD 3WN5A 1J05A 2OR7A 2ZPKH 1MVUA 2DYPA 4HUUB 4YHKH 5IB1B 5IIEB 3VXSE 3D69B 4CL7A 3DI2B 3LHPH 4PRHE 3SKUD 4TYUA 3RY5A 4QRUA 4Y8DC 1OTSD 1DZBA 4UDTA 3QPXL 3ARFB 3RNQB 2DQTH 4YZFF 2ZUYA 4DGIL 1O5DT 1ZVYA 3HZYA 2IQ9H 3IAQA 1M4KA 1CLZH 4PYHA 4KMTH 3QYCA 1J5OL 1P6FA 3HFML 1A6PA 3BKML 2YMXH 2XQBH 3LH2L 3QCTH 1OHQA 1BF2A 3MLZL 4N68A 1I9RL 3DWTA 5IJVB 4Z0XA 1FL3B 3ZTNL 3WNNA 2RAMA 2ADGB 3HPLB 2EYTA 1UCBH 3FQNA 1BEYH 1IGTB 4F9PC 3VFSB 1KIUA 2AJVH 3WFCL 5K33A 2Y06H 1LNUA 4LSQH 4X80H 4P3CH 4ZO6A 1EBPA 2EYRA 3CGTA 5D7IE 3C60D 3TO4B 5F6IB 3KPNA 3Q2CA 3I2CH 3QHFL 4ELKA 2CIKA 1LE9A 3UC0H 1TQCB 3Q1SH 4UNTA 4MDJA 3QUMB 5GGQL 3VWKB 3SCMB 2ESVE 2AK4B 4EXKA 1SEBA 1HYSC 4XWGH 3RIFK 3PV7A 1NUNB 4C56B 1RZ7L 4Y4FA 1CD0A 1M7IA 2QKIA 2O5YL 4XNMB 4FNLL 1NAKL 4S0TD 4CADB 4PJ8A 3GI8L 4MD0A 5A3IC 1UKSA 3E6HB 3MACH 1EFXD 4XP1H 1GOGA 4S1QH 3C2SA 4X6FA 3RKPA 3D25B 5KW9L 4HIIB 1WBYB 4XPBL 4UOJA 4JR9L 1KCUL 3TJHC 1ZHNA 2GAZA 3RWFB 3IT8D 3VI3F 4YBQD 2V7NB 2Q7NA 1XH3A 1G9NC 2CK2A 4YHZL 4U6TA 5C0JA 3MNVB 2P7TB 5GZND 4WCYH 5FYLD 1I7RB 3L7FB 5EORH 2HWZL 3MGAA 4JDZA 1U91B 4NQEB 5J12B 5LXGL 3BKYH 3QJFA 3STBA 1YYMH 2P42B 1I9EA 1CZ8H 3MNWA 3L6FA 1T0PB 4FFYL 3RWHB 5CIPB 5IVXF 5BV7B 5EIIB 4D0BB 3HZMB 3PGCB 5IBUG 1Z5LB 1IGJB 1XR8A 2WW8A 4B7IA 5HSFA 5CLWA 4HV8A 5FO9A 3RL2A 2HKFH 1MCRA 4ODVH 4WWKD 2XZQL 1C08B 3PDGA 2FWOA 1ERNA 1U8KB 3J7HA 1FGNL 3A6BH 2NY5C 2EXWC 4GG8B 4TQEH 3W11D 3UX9B 2Y4SA 3GJEB 5EPMA 4G9FB 2RFXB 1MY5A 2ESVA 1ZLVK 1GJIA 4QGYA 3WFDL 5KSVA 5CJQL 1NC2B 1HOCB 1CD1A 4U0RB 1DE4A 5SWZB 4O2EB 5JUEH 3PWPE 3TN0B 5EG6C 2DQDH 2JE8A 3DUSB 2EEDA 3W0WE 2UVFA 1T1XA 3WLBA 4YHIB 3QIWA 4E0RA 4NRXB 5GHWL 4KROC 3MFGB 2I25N 2WUBL 4OCSH 3UROR 2F8XC 1MLCA 1WWBX 1RHFA 3FCTA 2NY3C 3CVHA 4YHNA 1LK3L 1S7RB 2YPKA 2E9IA 4IRSC 4AH2A 4YHYC 1KIPA 4LVOB 4P2OD 5D2NE 1HHJB 1QYGH 4XNZB 5CD3B 2O5XH 1EK3A 4NT6A 2JCCE 2HLFD 2LU7A 4HH8A 3RKDC 3OL2A 4X6DF 2BNRA 4P5TD 1JGDB 1MRFL 3JTTA 2XV6B 3M8OL 1NCNA 4GRWE 3FO2A 5DJ8A 5CILH 3KXFA 4KJQD 4TULL 4CMHC 2OYPA 2D31A 2HN7A 2RGSA 1FIGH 1BJ1H 4ODTL 3MUJA 3LKSA 2ZUQC 1HCVA 4U6VL 2AJYL 4O9HH 3TNMA 4BH8A 5I1JL 5C0FA 4KI5C 1BFOA 5JQHC 4DTGH 4ZAKA 1D5IL 4Y5VC 3L3OA 3AAZB 3AXLA 4XHJC 4M6OH 2P8PA 2VDNL 3O2DL 4RGOL 3VFNA 4AIZA 1KB5B 3B9EA 4HS3B 3P4OB 4TTDC 5DMKA 1Q9LB 2CIIA 1PZ5B 2FL5A 3LPFA 3T2QA 4QRPB 1I7UA 1KYOJ 1YEFL 3KJ4B 2JTDA 5DT1L 3WJJA 3P9WB 5MI0B 1IZJA 2YD6A 1XF5B 3RPIA 4BSVA 1FVDA 3PWPA 4RSVA 4HFUH 4MDIB 1KPVA 4KK9C 3W0WA 3DO7B 5D70H 3WSQL 1JYXA 4XB7A 5KSAC 1BFVL 3NTCH 1EEZB 3SQBA 3ZL4L 4BZ2H 2BOBA 5IOPA 2CKBH 1FLRH 5I18H 1DL7H 3ZDXE 3HE7B 1DUZB 4OF6A 4TVPE 5D2LB 3UDWC 1SM3H 3EYFA 2UWEF 3WCYA 3GSOA 3V6OC 3MRHA 2YK1L 5F21B 3MREA 3VFRA 3DURB 2FJGB 3B2UD 1WFNA 4LPTA 1PLGL 4YDKH 4OUUB 1V7NH 1A7RH 1WEJH 4EN3A 4LSDA 2CKNA 3ULVC 4LLWA 3WFEH 1KJ3L 3O9WB 3JV5A 2YD9A 3G5XA 4K9EL 4AM0A 3HNSH 1D7FA 1FO0H 1HHKB 4N5ED 3B2VH 4U05A 1OW0C 1H3VA 3DROA 3EYQC 4CN4A 4PS4H 3DX8A 4TNWK 4X9IA 3S5LG 3HI5L 4HUVB 1MSPA 4IJ3B 1FZMB 2EE3A 3GHEL 2A77H 3NA4A 4AIXA 3PNWB 3WIHH 2GSGB 4KHXH 3BZEA 1NCAH 3V0WL 1EFXA 1FNSL 5IBLC 2CQVA 4GUPA 4YXLL 3AS2A 2LE9A 5BCAA 4LSRL 1FFOA 4PJGF 3F62A 5J6GB 3HUJE 5LWYL 3SHSA 1ETZB 5JQ6H 4D0CB 1BJMA 2YC1B 4N8PA 1VESA 1X7QA 1IVLA 5HYQB 2E7HA 4MXWH 1FFQA 2GCYB 1XR9B 4ZDHA 3QUYC 3FOMA 1A14L 2UZIL 2VXSL 2ZJSL 4LDEB 3FFDB 2IG2H 2MQ0A 4UNVA 4PBXA 4QXTB 3S7GA 1X5ZA 5HI3C 4PJBF 1QSEB 4JN1H 4RX4A 3TYFA 1J1XH 3OG6B 4Z78A 2H2SD 1S7WB 1CR9L 3QIUC 2DQHH 1A1OB 1WFUA 2X1QA 4XAWL 2C26A 4MJ5A 4YHMH 5C0AE 5T5FL 4OFKA 5TE7H 5DVLA 3UO1L 2HMIC 2CXGA 5E95B 1T22A 3SY0A 3SJVD 3UEZA 1AC0A 3CZJA 1I1YA 2HVJA 2LAGB 4JZJA 2FSEB 2CR6A 1CLYH 2AVGA 5IHZA 1UA6L 2AABH 3UTSD 4JVWA 2AXGA 3V0VB 3L5IA 3G6JB 2KKQA 5C70A 4P3WA 1S9VA 4HKBB 1MHCB 5SWSB 3OJDB 4X4ZA 3VRIA 5I6XC 2R0KL 3NIFF 3HUJA 1MJ7H 1DQQB 4LASL 5FF6A 5JPMA 5DJ2B 5DO2C 3V2AR 1YC7A 1I75A 2OK0H 4P5TA 1BD2D 5FYKH 3VXOA 3QUXD 1FYTB 4ETYA 2D0FA 3EDEA 4Y89A 1LO5B 1BJ8A 5CLTA 1HK6A 3VH8B 4NZRH 1KTKE 3GEWB 3HC4H 3GMRA 3O6KL 5A16B 5EC2B 1QZ1A 4KFZC 5J9PA 4XTRD 3F8UB 4A6YH 4LU5H 1BECA 2F5BL 3MRFA 4ZPTA 4P59H 1NGQL 5DUPL 1WGOA 5DC9B 4P9HH 1M71A 4UIKH 3UTTD 4OSUH 4TUKH 1A7QH 3AU1B 4KHTH 1A47A 4Q6YA 2AK4E 3VFMB 3O3DA 4MMZC 4PJFF 2CUHA 4YDJB 1OVZA 1U95A 5C0AA 3GJFA 5BVJA 1ZLUK 1SQ2N 1X3DA 2I27N 4MCZB 3HB3D 3SGEH 3KPQB 2B4CL 4IRZL 3NA9H 4HUUA 1G7IB 5IB1A 4Z7QE 4NCC2 5B3JE 5IFAL 4QTHB 1W0WB 1KTDB 5ECJE 3D69A 5SV3A 5D5MF 1KTRL 4WU7B 3BRFA 4NNPL 2A6IB 4OLUL 3RNQA 1WZLA 4P46B 3IU4H 2G60H 3P0YL 4C54A 2L7UA 2YUWA 3PHOB 4NGHL 1A3LH 1FVCB 4QXUL 1OPGL 1P84K 1FDLL 5I19L 5CINH 4WO4C 1ADQL 2PYFB 5I75C 5IJVA 1FL3A 5HDQL 4G6AD 2APVA 4NQEE 5HHOB 4FFWD 4BM7A 4MZ3A 2ADGA 4APQD 1XGTB 4WI2A 3L3HA 3VFSA 4PRPB 1LK2B 5JOFB 2J6EA 4KRPB 5DUBB 1S8DA 3MR9A 4OGYL 3C08H 5ACLA 3U46B 3NBNA 3UXFA 2Z31B 2R1YB 3FMGH 4NHUB 4LCIH 1L0XA 4IOFD 2XY1A 5FYJL 5JA9A 3TO4A 3U6RB 5HPOA 1QUNA 1L7IL 5E2JA 2NLJB 4GAJL 3TVMB 3K1DA 3BP4A 5C08D 3DUUA 1N3NB 1IILE 1XZ0B 1ORSB 3QUMA 4FN0A 3VWKA 4G9FE 4GG6F 2B1HL 3SCMA 2CGRL 2B0SH 3VRJB 2R4RL 2MCPL 1MCDA 2Q8BL 3B5HA 5SWZE 4C56A 3PGFL 3VW3L 5IQ7L 4PGEB 3GSRB 3SOBH 3T0AA 1AKJD 1A6WH 4XNMA 3OJVC 3MNZB 4H1LB 3V7AE 2D7TL 3W39A 4CADA 4HIJB 4OFYA 3E6HA 2NXYD 4OCYH 5CP3H 2LQRA 2DDQH 2VR9A 5D7LD 2IPUK 3NIDE 3A6OA 3P4LA 4QYOA 3D25A 1CD9B 4L8DB 1CVRA 1L7TH 4LSSH 3AREB 2PR4L 3GGWB 4L4TB 3V4PL 3SKJL 3RWFA 1GC1H 1K4CA 5GJTH 1HI6B 2DLFH 2MSPA 2V7NA 5C0EB 2FECI 3LKOB 3MNVA 2P7TA 4K3HA 3BWUC 3BRDA 2P45B 4I0CC 2ORBL 3L7FA 4LMQE 3WV0A 4X7SL 2GEEA 3P9MB 5F7EL 4ELMF 4NQEA 1WTLA 3MLYH 2AJZA 4JRXB 4MB4A 4M7LT 3RWHA 4RBPK 5CIPA 1T1ZA 4R4BB 5EIIA 4J1UB 4D0BA 3PGCA 1DBKH 1Z5LA 2OL3H 3MJ7A 1LO2L 1IGJA 4JDVB 3QWRA 3GRWA 5F7DA 1HNGA 3V4VL 5IHBA 4KQ4L 2HTLC 4ORGB 5IMKB 3QZWB 4ZS7H 1C08A 2GI7A 5DGRA 5C09B 1U8LB 4YK4C 3BDYH 3CXDL 2J4WL 5DD0H 4GG8A 2X89D 2ZUWA 3GJEA 1FZKB 4QRPE 1OTUD 2X9XA 3MV9D 3OG4B 3ZSSA 2OR9H 1IEAB 1I8KB 3LS4L 2V9TA 3NVQA 1NC2A 1DANU 1VPOH 2W9EH 4KQ3L 1KPUA 2D7QA 3S35L 5SWZA 3AY4A 5KS9B 4N9OB 4O2EA 4K8RD 2UY7A 4KJYB 2YPLB 3RGHA 3QG7H 3FO0L 2BNQD 3QEQD 3DUSA 2XI9A 3OBAA 1JZ2A 1U8JB 5DDHB 3EJYD 5DJDA 1X5FA 1CFNB 3RWIB 4YHIA 3OR7B 4Y5YB 3E2HC 4M8QB 1MIEH 2ZG1A 3BZDA 3FRUB 4GW4B 3ZDYE 4F57H 3FJTA 5CJ8A 1KG0A 5E5RB 5D2LE 3H9SD 4LLUB 3WO4C 3F7VB 3OPZL 1LDPH 2P5EB 5F88A 1A21A 1BD2A 5DJCB 3SKOB 5EA0L 4HWZB 2QSVA 3OKYA 4MA1C 3TT1L 3MLVH 3KLAB 1HHJA 3QUZD 4JFDD 5CD3A 4U1HB 3SDDD 3UJTL 4IS6B 3JWOL 2VABA 4NO5B 4ENED 4L3AA 2WBKA 3H7BB 1JGDA 5BW7A 4ZPVB 5F1KC 4Z7UA 4PJ5D 3UTTA 3WKML 2NMSA 3CXHJ 3EYSH 3K7UA 1EDQA 1HIML 3OGOE 4OAWB 4AEFA 4OCLC 5HDOA 1IKNA 1Z9MA 1N6VA 3DV6B 3WYRA 4MVBD 2PTUA 2AJ3B 3OV6A 1RJLA 1MUJA 4MA3B 4M9OA 3T2NL 4FQCL 2J5LB 5ILTH 1KEGH 1DFBL 1CGSH 4ZSOA 2A6KB 5HD8D 3PWLB 1U6AH 3P9LB 1B2WL 1MHPH 2XN9B 4HS3A 3GHBH 3P4OA 1LO4L 1PSKH 5IP4A 1PZ5A 4L4VB 1IJ9A 3LDBC 1MREL 4QRPA 1RUMH 5B3NA 5GPRA 5D1QB 1XF5A 3MROB 1MHEB 2FX8L 5ID1A 4MDIA 5EULV 1FNFA 3O45B 7FABL 3DO7A 2NX5B 2Q1EA 1JGUH 3A67H 1EEZA 4XXDA 5JTWA 3B9KC 4L1HA 4HAFA 4S10A 4CN6A 1OQXA 3QDGB 1NBVL 3BP7B 2C3VB 2APTA 3BWAB 3G5YB 1YC8A 3HE7A 1DUZA 1OAQL 2OP4L 5D2LA 5BVPL 1QFWM 3CX5J 2BNUB 2VDPL 4MD5B 3T0BA 1NPUA 4PTUB 3OAUH 4WFGD 4APQA 4QOKD 2FATH 5HJ3B 1OF2B 1YJDL 3DURA 2Z8RA 3HZVB 2OXHA 4XNYH 2FJGA 2A1WL 3NIGF 1QSEE 4JFYB 3JUYA 3S3JA 4LCCB 4OUUA 1TETH 3QO0B 4OGXL 4U1KB 3EIFA 3B43A 3NFPA 4O02L 3O9WA 2FJHB 5C08A 4B53A 1YQ2A 4JHWL 3V6BR 5B38G 3IFLH 4DZBB 2ITDB 2AJUH 2E8ZA 4UAOC 2YN5A 1FNHA 2YXFA 3EO1B 3Q5YA 2MKLC 1NGYB 5EU4B 3QDMB 1JUFB 4XVTL 3QH3B 3NCEB 3H3PH 4HUVA 3KGRA 1LGVA 2HJKB 1TJGH 3WXWH 3PNWA 1G6RA 1BQHA 15C8L 4UTAH 5C0BD 1KULA 3BSZH 3G6JE 1T1YB 2I60H 4FQ1L 3L3DB 5KVFL 2AK1L 1N59B 5SWSE 3DNKA 4ZNEE 3EDJA 5F7NC 2VDLH 4GMTH 3ZYJA 1WAAE 2X70B 5CJXC 2XRAH 1OP9A 1NJ9B 4D0CA 2AQ2A 2VLRD 4I18B 1YMMB 3FO9B 5HYQA 1O0VA 3ILPB 1MJUH 3QXAB 3V6FA 3FB8B 1J9CT 4P57A 1R5VB 4K3JH 1XR9A 3SDCD 4JFEB 4NZUL 5FM5M 5GS3A 5HYIA 2HLAB 3S9DB 1FYTE 2ERJC 4XI5D 2NQCA 3FFDA 2IBGA 4G5ZL 4R0LB 3S88L 1UVQA 1FE8H 3VCLB 1UM6L 3B6SA 1WBXB 4YFDB 4Z7UF 1NANI 1VFBB 1RAMA 2PW1A 4PGJA 4BH7B 4ZG1A 1SBSH 2Z9TA 3BH9A 1QSEA 3D85D 3HTLX 4EDXB 4MAUH 4OFIA 4K3EH 3ARUA 2FIKB 1GZPA 4XPHH 4XC1H 1LMKA 1XF1A 1K5NA 3HMWL 2WIMA 1S7WA 1IC7H 4C4KT 2A83B 5CZXD 4Q7DA 3EJZD 2NNAA 2VYRE 4MS8D 4EOWH 1CFVH 3KPRB 4GAYB 1BZQK 4ZFGH 1QFWL 2Q8AL 1CVSC 2BNQA 2FSEA 1MH5B 3U7WL 4NUGH 1CN4A 3R1GL 3IJSB 2UV3A 2VKWA 3KPMB 4RMVA 4TVPL 3O3BB 3ET9F 4F3FB 2C3GA 3G6JA 5GS0D 4YJZL 4FQLH 1SY6A 4HKBA 1MHCA 5SWSA 4HC1L 3OJDA 4ZNEA 3TCLA 2BVOB 2EKSA 4HIHB 1QKZL 3CC5B 2APFA 1DQQA 1LILA 1EAPB 4JFDA 2YEZB 5DS8B 3SDDA 1INDH 4P2RD 4LCYB 5DJ2A 3NABL 2J3SA 3ZTJG 5HHOE 2YSSA 3GSXB 4OLYL 5FFLA 1FYTA 1EO8H 1JGVL 1LO5A 3PJSB 3ARYA 4PRPE 3T04D 3VH8A 5A16A 4M1CD 4OF3A 5EC2A 3MXVH 3EW3B 4PY7B 2CH8A 4M61B 3O4OC 2O5ZL 1RIVL 4JRWA 2PTTB 2X4SB 3DXAE 4WHYG 5DK0B 3ZSTA 1T20B 2XYCA 3VFMA 5DD6B 2GJ6B 3WD5H 4OI8A 3LIZL 4YDJA 1MAKA 4KK6D 3RUGB 2CKBB 2Q87A 1EHNA 5I1GH 4KGJA 4MCZA 3MUY1 5FDWB 4Z8FH 5I8OL 4LQFL 3QI9B 1MRDL 4KDWA 4UB0H 1TPXC 4XRCA 1G7IA 1ZGLB 1DTUA 1W0WA 4XP9H 3VFGL 1KTDA 3DBXB 2Z8VC 5I1LB 5I66B 4WU7A 2P5WB 1I7ZB 1RZJL 4PJHA 1N7MH 4PRDA 3HA0A 5FXCH 1N5YH 2AEQH 2CRYA 1F4YL 4L4TE 4NYLB 1AE6H 3BESR 4YXHL 1JWMA 5I15L 4K7FA 5AZ2L 1HKLL 3GI9H 3O8XC 2H32H 5ITFB 5D93C 2VZUA 1M6OB 3LCYA 3ROOB 3R0MA 5F70A 4DGVH 4BFGA 2PYFA 1JE6A 1NAML 4QRTB 5KBNC 1ZSDB 1CG9B 3KYAA 5HHOA 3X13B 4LSTL 4GT7A 1ZMYA 4JRXE 4PY8I 3VJ6A 1JI1A 3DYPA 3C87A 1H9VA 4HDIB 5TH2B 3PWNB 3TCXA 1IGFL 4KAQH 3TZVC 5T3ZE 5GISH 3IGAB 5DUBA 2AP2A 1QNZH 4J6RL 5B39B 4GQ9H 1DVFB 3U46A 2Z31A 1I9JH 3KR3L 5SX5H 2R1YA 4BZ1L 4LPUA 1RULH 4NHUA 5D9SB 2QADD 2Z91B 1F5WA 5C09E 3UYOD 3MUGB 1P4IH 3KG5A 1H3UA 3TVMA 1WT5C 3MV8D 1TNNA 1BQUA 2LVCA 2N56A 4OZHB 1N3NA 5I17A 4OV5B 1XZ0A 1ORSA 3HE6C 2DQJH 2IAMB 4KTDL 1QBLH 3U48A 5KS9E 5SX4I 1CICB 2YPLE 3MUZ1 4PREB 2IPTL 1I8IB 4PGEA 3DJ9A 1AXTH 2R2BB 3MNZA 4H1LA 2P43B 1Q72L 2WMPA 1T03L 1MFAH 3BQUC 1A7PH 1T6WA 4HIJA 1X44A 43CAA 5FUOH 1NMCC 3OX8B 5JXEA 1FP5A 3QJHB 2P5EE 4WW2B 4L8DA 4I0PB 4EVNB 2XKNA 3AREA 1MFCH 1IL1B 3MJGX 5BQ7B 1HDMA 4K71C 3MA9H 2X4QB 1HI6A 4PG2C 3G5ZB 4Y5XB 5C0EA 1JPGB 4YO0B 3QUML 2X5PA 4XP4H 4P49A 4H25B 3VWJC 1DLFH 3P9MA 1Z3GH 4GMSL 3KPPB 1H8OA 4R4BA 3NZHH 4J1UA 2XTJB 5L9DL 4LBEB 3JWDC 4NJAL 4ZXBB 5EUOF 5BRZD 4NO0B 3X12B 4JDVA 3GKZA 4UOW0 1D5BB 1KXVC 4HWEH 4ORGA 4MXQC 5IMKA 3QZWA 3JV4A 1FAKT 3I50H 2XN9E 3MRKB 4DKDC 5ICYA 1KCSH 2YD4A 4L4VE 1OAUL 1DN0B 1ZEAH 2D0HA 1JK8A 4U6HB 2YPVH 1OAKL 4G3YL 1IEAA 2HJFB 2VXQH 1I8KA 4K9EC 4B0MM 1DP0A 4JQIL 3UZQA 5KS9A 4KJYA 4PJHF 5D1ZB 2XZAH 5IGXH 2NX5E 1U8JA 4IRJD 5HHXH 2Y07H 3UCRA 5DDHA 5L2KB 4WHYH 3RWIA 3OR7A 4Y5YA 4U2YA 3QDGE 3FRUA 4GW4A 1JN6B 4LLUA 3BP6B 5J4MA 1EEUA 3F7VA 1XGPA 3RL1A 1E4XI 2P5EA 3HPJA 5IV2B 5DJCA 3SKOA 5T33L 5F9OL 1MJ8H 2DKUA 5IK3B 2JK5B 4HPYH 2A6DB 3KLAA 4ODHH 4U1HA 4UT6H 4IS6A 4NO5A 3ARWA 5HYJD 4LL9A 2IH3A 2AEWA 1S9YA 2ZCLL 1CT8B 4DOHB 3H7BA 4NBYB 2GKIA 3WJLC 4ZD3H 3MGTA 2EDHA 4HK3N 3EFFA 4OAWA 2E27L 5E56A 2JF1A 4QEGA 1HYSD 3RU8H 4JCMA 4JG1H 3SE8H 5JZ7C 3DV6A 1ZLWK 3QDME 3TF7C 3WIFA 3QAZB 4MJ2A 3CH1A 2FZ3B 1I8LA 4MA3A 1QBBA 2I5YL 1X5JA 3D2UD 4DVRL 5D71L 3VG9C 4CBPA 2NTFA 5FK9B 2A6KA 2QJDA 3U7YH 5A3ID 3PWLA 3P9LA 3C5SB 4WUKL 1RUAL 2XN9A 2VISB 4XNUH 2BX5A 4XVJL 1UG9A 4L4VA 5LCVL 3U4EA 3P77B 4GW5B 2RJMA 2K1MA 4LSPH 4N90D 5FHBH 5H35B 3MLSL 5D1QA 3G9AB 3TJHD 3KJ6H 3JVGC 5BOPA 1YMME 5ICZB 3RJQB 2OXGA 4U1MB 1MHEA 3O45A 4V1DB 2NX5A 4JFEE 3PL6B 4PR5B 2OI9C 4PBWD 1HHHB 1KIRB 1Q9OA 4JY5L 4Y4HC 5JIHA 3NN8A 4PLJD 4NKDA 3QDGA 1FFPB 4AENB 5CEXB 3MOQA 1GZQB 1U42A 3BWAA 3F7PC 1ROWA 2D4FA 3MUHL 1GOHA 4MD5A 1A4JB 4OUOA 4YR6A 3HNVL 3C8KB 2Y5TA 1R3HB 4AYFA 1KJ2H 3P11L 3BGAA 1A6AB 1KCVH 5HJ3A 4PTTB 3L9RA 1FBIH 4BQBA 3HZVA 3EDDA 3O2WH 4XAKD 1K8IB 1UT9A 3EFDL 3MJ9L 2FB4L 1Y0LB 5I1IL 4LVNC 3BMWA 1KB5L 2GTZB 4HGWA 1QFUL 4L8BA 4MNHB 5J0BA 5E08L 3RI5K 3GDBA 3GIVB 5D7KD 3QO0A 4XX1E 1EFQA 3ALWA 3OAZK 4U1KA 5C71A 5I71B 5DQJB 2FJHA 2EXWD 2YRZA 3T4YA 4POUB 3WEXB 2DKMA 5EZJA 2IMMA 1D9KB 1A7BA 4HXBH 1F13A 4YHLH 1JIBA 3EO1A 5D7SH 3UJJH 1NGYA 1R3JB 3KPRE 5EU4A 3QDMA 1JUFA 3QH3A 4PIRF 2HJKA 3LEVH 1MFNA 1MELA 4JZNB 5CGTA 1G0YR 4J3SA 3IDJB 4XPTH 1B4JH 4ODWB 1I1AD 4KROD 1T1YA 2N1KA 1CFQA 1N59A 4LNRA 5FM4A 2WUCH 2NY3D 2XWJB 2R2CA 4Q6IC 5DMGC 5K59E 1VA9A 3V79C 4IRSD 4OFPA 2X70A 4DEPB 2F9BT 3F6LA 3RFZC 5F1NB 1NJ9A 2A73B 5FYJU 2YD5A 4I18A 1YMMA 3FO9A 3MLRH 1FH5L 3E0GA 3ILPA 2AJXL 4IMKC 3QXAA 3QQ3B 3RKDD 1HSBB 1R5VA 1J18A 5E7FA 4JFEA 2OL3B 1EA9C 3CFDB 4XBEL 4FTVD 4R97B 2F53B 3VRLE 1JPSL 1A9EB 2BJML 3MLPA 1XF2B 1DN2A 4R0LA 4YFLI 1ZLVH 4YBLB 5I1HL 3TYGH 5D72L 1WWAX 3VCLA 3BDBA 1VFBA 3S3PA 3X14B 4BH7A 4TSBL 3HNTH 1ZT7A 4KI5D 5EO0B 5BRZA 4GAGL 1U3HC 2DMKA 4NRZB 2NY2C 2FIKA 3V5KB 2F58H 4JFFD 3RQ3A 4GS7C 3U0TA 1KJMB 2ADIB 4XNQA 1J0JA 4L3ED 1OAXL 2VXSH 2GJ6E 5E8DL 1HH9B 5I1EH 5C86A 2A83A 4IDLA 1RU9H 1D5MB 2GFBB 4DAGH 1VKXA 2PNDA 3RUGE 2YBRB 3CK0L 5SWQB 4O58L 1V7ML 2Y36L 3QRGL 3BVNB 3WN5C 4TN9A 3KPRA 4GAYA 1ZA3B 3N1QC 2H9GB 1MH5A 2VQTA 4HXAH 1KN2L 4KK9D 3RGVB 4IRJA 2P5WE 1E4JA 5KSAD 4XXCA 1EV2E 3KPMA 2DLIA 5EDXA 2GK2A 4HPOH 4F3FA 1XIWB 2IGFH 3MTRA 2COQA 1G7QA 3G9VA 3GMQB 3IDYB 4FFZL 4HKZB 2BVOA 3BP5B 4HIHA 4JVUA 4D9RD 4IHOB 4U3CA 3CC5A 5E99L 5F96H 2EO1A 2D7MA 4OLVL 2YEZA 1NBZB 3ULSB 3WUWA 3C2AL 4ORZC 3CU7A 3VE0B 1LEIA 5EOCL 4B41A 4OM1L 3Q3GA 3QCVL 4OBSA 5ACMA 3C5JB 3GSXA 1ZHBA 3CSGA 3ULVD 3QFDB 4F7MB 3MZTA 4E42B 3TO2B 4YX2H 3VGAB 5MEQA 2VLLB 1OT1A 5LGHL 5E8EB 2IBBA 1B0GB 3FRPG 3INUL 1R3KB 3EYQD 4PY7A 5DLML 1T04B 5HVFB 4M61A 4XVSL 4HUNB 4CU6A 1TCRB 4CKVX 5C0RH 3LMJL 2X7LB 4WTXA 1MI5B 3HI6H 2YD8A 5HGGS 4ZO8A 4OZHE 4R90L 2X4SA 3SE4A 5E4EC 1T20A 5DD6A 3ARTA 1KEMH 4AMKL 1VGEL 3MRJB 4O2CA 5JHDD 5DMIL 4ODXB 2CKBA 4G8EB 4Y4FC 2H6PB 4WV1B 5FDWA 2FJFB 5IB5B 1BQLL 4Z7VB 4PY8J 3QI9A 4C58B 5JDSB 1NGQH 2DOCA 2D0GA 4PJ8C 5DRZA 5HPMB 1ZGLA 2NCMA 3OHXA 5C0NC 3EKCA 3DBXA 2VDKL 5GRUL 5EB9A 3U9UB 1HXMB 4PV8B 3U9PH 5I1LA 5I66A 1I7ZA 3QUYD 2FEDC 4PJAF 3BYYA 5F9DC 5IG7B 1JZ5A 1X5HA 1SHMA 3P73B 5CBAB 3Q48A 1PGRB 4M1GH 4NYLA 3CSBA 4S1SH 5MENB 1FCCA 1RHHB 2X44D 2BCKB 5ITFA 3SDYL 2V17H 1LD9B 1M6OA 4CVUA 4HJGA 4OLZH 1K4DA 2R69H 5EUKB 2W38A 5HI3D 1GGYA 1QA9B 4WWID 5ALBL 5E2UL 4OCRL 1ZSDA 1JYVA 5FA3B 1CG9A 2X4PB 1NBQA 2F54B 5DWUL 3TFKC 1KCRH 4UTBL 2MQ3A 1BX2A 3AC0A 5A2IH 1SYVB 4FXGA 5E9DB 4HDIA 3RTQB 3KYKL 2XTJE 3PWNA 4I2XE 3WIHA 1P9MC 5BXFB 4MNGB 4HWBL 5DK2B 4CRPA 2XT1B 4H8WH 4MAYB 5B39A 1DVFA 4DGYL 2HMID 4WI5A 2QTEA 5C6TH 2UY6A 5D9SA 3JWOC 1BAFH 4WI7A 2Z91A 4M7LH 3WDIA 2B2XL 3MUGA 1KPRB 1UQSA 4N0UA 4NQCB 4PJ9B 3L5XL 3TBSB 3GK8H 5ICXB 4OV5A 4J3WA 1I1AA 4HIEB 2IAMA 3EYUH 2EIZB 1BGXL 4KZEL 1A6ZB 1CICA 3FB5B 1A6VH 4Y1AD 1F42A 1YNKL 5FYKE 1I8IA 3FT4B 1YUHB 5JXAH 5LBSH 2R2BA 5C07D 5L2KE 3NH7L 1OSPL 3MODH 4NKIL 3QIWC 3FQRB 3VFUB 1PZUB 5DO2D 2NY0B 5C2BL 1BIIB 3CSYB 3OX8A 4FMFA 3QJHA 2YWYA 5TPWH 4WW2A 3SDAB 1NMBL 2HVKB 4Q9RL 4PB9H 2IPUG 4EVNA 2BOCB 1IL1A 4OD3H 5BQ7A 5AWNL 5E94B 3BDXA 5EBWB 4ODBD 3G5ZA 2XWTB 1JPGA 5MHSE 4UDUA 4DOHE 3GSUB 5I76B 3VXRB 2XQYK 3V0AC 4E9LA 4H25A 1RIHL 1PW3A 1QFHA 5C0GB 1GGCL 3D18B 2BHZA 3VFWB 3ZKSD 1MCWM 2DS4A 3KPPA 5DURD 1KSRA 1JPFB 2J8OA 4L5FH 4OTXL 4QHMA 4ZAKC 4ZXBA 3ZKMC 4JPVH 3DVNB 1YJDC 2BC4B 1D5BA 1U8IA 5FGSA 3C6LB 5CEZH 4HBCH 4WGWB 1JRHH 2DQCH 5DJYB 4GKNA 2WANA 1WICA 4UI2A 2BMKA 1F90L 3BGMB 2C3HA 5DHYB 4OI9A 2WM0A 5LQBH 1A8JH 1CXKA 3PXHA 3O6LL 1ZTXH 3TV3H 3WLWC 4HKXB 2ARJB 4OM0L 2HJFA 2VLJD 4MJ6B 3WJJC 5FCUH 2XXCB 5DC0A 5I8CB 4MGXA 2DQGL 5E1AB 4WIQA 1BP3B 2YD2A 3MRCB 4V1DE 1U2HA 5HHPB 5T1DL 4WO4D 3TLRA 5L2KA 1IAIM 2P24A 1U8OB 4G8IA 3GSNH 4QRSB 1BVZA 1JN6A 3LS5H 2BY3A 3FONB 1T2QH 1JGLL 3BP6A 1AO7B 2HH0L 4I3RL 3KWWB 1RZGB 2YN3A 3MRLA 5T3ZL 5GZOC 5IK3A 3K74B 2JK5A 3LS4H 1JYNA 1IQWL 2A6DA 3RDTB 3N1MC 1ZAGA 4Q9QL 3KLDA 1JGEB 2AXFA 1OW0A 3PABA 3QHZH 1TJIH 4OGAC 1JF1A 1BLNB 4D9QD 4EN3C 3THMH 4DW2H 2BVYA 2Z35B 2VDOH 4ZTOH 4JVPA 5FO8B 1N6QH 5GGVL 4RISH 2E7BA 1NL0L 3SKMB 1NUGA 3U1SL 4G8FA 5I1KL 1ZGLP 4YIQB 4NUJB 3RVWC 5DFWH 5JHDA 5J89A 3L7EA 1S9XB 4TRPH 4NHCL 1I9IL 4WFFE 1DDHB 4L29A 4W4OC 2RBLA 2R23B 5EZOH 1UM4L 1PBYA 2GJZA 2H32B 4JDTH 5FK9A 1BBDH 3SO3B 3C5SA 4QXWA 3D1MC 2JJVA 1FNEB 3BD5A 5T1LB 1FV1B 1SJXA 4EI6B 2VISA 35C8L 5L88L 4X9GA 1U8MB 3P77A 2YOCA 4GW5A 2FHBA 3TH3T 5BO1L 4JANB 5H35A 1OP3H 3OZ9L 2ZCKL 2YZ1A 1KV3A 5ICZA 4U1MA 5L0QB 4YBQC 1GVIA 4V1DA 3T2NH 4PR5A 4NIKB 5GZNC 5T3XD 2ZPKL 1HHHA 1KIRA 4YHKL 2CDEB 1FFPA 1TENA 2F53E 2HT4C 3ARXA 4IIQB 4S1RH 3BT2H 3LHPL 1M1SA 4XBGB 4G80B 1NCTA 4HSQA 2WWMC 3C8KA 4KI5F 5L8KB 1R3HA 4Y16B 3OWEA 2DQTL 4YBHA 4U1GC 1A6AA 4U2ZA 1MCEA 3V7MA 4YFLF 1K8IA 4N0CD 4UNUA 1CLZL 5JW5B 2VDRH 3ALPA 4KMTL 4O4YH 1Y0LA 3P40A 2XQBL 2GTZA 3QCTL 1CFSB 1SMOA 2HTLD 3H6JA 3RBSA 3ARSA 3GIVA 1MCWW 4N8CH 5MEOB 5DQJA 2B5IC 4PJEB 5HHMB 4BSWB 5A1AA 1YEKH 3U30C 1D9KA 5CP3A 4U3HA 3I6LE 2FGWL 5E2TH 5CWSA 1JV5B 1UCBL 1BEYL 4DKFH 1R3JA 4NWTH 2AJVL 1MWAH 3NAAH 4KVNH 1NCWH 4J3OC 4JZJC 5ESVB 2Y06L 1AQKH 4LSQL 4P3CL 4X80L 4JZNA 5C07A 3IDJA 1VADB 4NC0B 4TUJB 2Z4QB 3NCJH 3I2CL 3O6FB 4P5MB 4LDOB 4JREB 5IFHH 4J3XA 4OZIF 5I73C 3UC0L 3Q1SL 4XCYA 5ALCH 2XWJA 4N8VB 2AXJA 4RBPH 1JBJA 1AGDB 4XWGL 1X5AA 5FECB 2OSLA 5F1NA 1JWSA 2X42A 2A73A 2ICWB 2DI7A 3ULVF 3BZ4B 1QRNB 3QQ3A 3MJ6A 1HSBA 2OL3A 3VXMD 3CFDA 2BVEA 2RB8A 5IB2A 3DRTB 2VAJA 4JPKH 1MQKH 2F53A 1RZJC 1U3JA 1WCBB 3MACL 2VR4A 1A9EA 4KJQC 2DBLH 1JFQL 4XP1L 4S1QL 1XF2A 1HQRB 3OB8A 4C83B 4O00A 1TQBB 1QD0A 3MCG1 4GLRI 3X14A 3QIBB 1KLUB 1HQ4A 2H3NB 4MD4B 1ZA6B 1MI5E 2P8MB 5H94A 5IHUH 3GIZH 4NRZA 2XKUA 3BEVB 4KI1A 1KJMA 2FD6H 2ADIA 4WCYL 5J1AB 1LO0H 2D7NA 4WNQB 1HH9A 3PIQB 1IM9B 1D5MA 1PG7W 3V8OA 3KS0H 3SQOH 5EORL 5FIEA 2YBRA 4D8PA 5DQDH 3UTPD 2R29H 5HVHB 2P8LB 3LD8C 3BKYL 3NGBB 4UBDC 1YYML 5D1XD 1CZ8L 3NCYS 4Z7VE 3TH2T 3BVNA 1E0OB 4DFIA 1ZA3A 5IT2H 4JO3H 2DM7A 1J8HB 1E28B 2E9WA 5DJZB 2H9GA 1DBJH 3ARZA 4POZC 3MV9E 2EDNA 2QR0B 3LN5B 1HWHB 5DD5H 1QSFB 4KH2A 3GNMH 2HKFL 1MCNA 3B9KD 2P4AB 4ODVL 4FQPA 1VACB 4XWOC 3SDXF 3A6BL 4PJDA 2BSRA 3FAWA 4TQEL 5MENE 3BIAX 3HMXH 4LPCA 3BP5A 3G6AB 1B6UA 3QDJD 3OKDB 5DF0A 3RA7H 3WNMA 43C9B 1W0VB 1IMHC 5F9WC 5JUEL 1NBZA 1N6UA 1G7JB 3VE0A 2DQDL 2HRPH 3ILQC 4HLJA 3OKLB 2F54E 4I5BB 4XMPH 3KNBA 1JYWA 3C5JA 2VWEE 5E9DE 1BWWA 3VG0H 3QFDA 4EUPG 4F7MA 5L7XH 4E42A 3NCCB 4OCSL 3TO2A 3U4BH 1AH1A 2VLLA 1ZKAA 4MNGE 3VI4F 3F7RA 4N5EC 4LFHG 3RWDB 5JHLH 1B0GA 1QR1B 2OTWA 4R6UA 1R3KA 3GJFK 4RGNB 4OQTH 3E6FB 4P2QD 1T04A 1QYGL 4RFNB 2O5XL 5F6IC 3TO4C 2X7LA 1MI5A 4OZ4B 2KL6A 4K2UH 3JTSB 4NQCE 1TQCC 4TSAH 4P23B 3VWKC 2UUDK 5HGBA 3SCMC 3ZDZF 4M7JH 1KT2A 4WI9A 5D96B 3MRJA 5F72S 5CILL 4HIXH 2VSDA 4ODXA 1UB6B 4G8EA 4P5KB 2QHRH 4K07A 5KVGH 2H6PA 2FJFA 1FIGL 5IB5A 1TZGL 4Z7VA 4LLMB 1NGWB 3D39B 1F2QA 3AM8A 4O9HL 3EHBC 5JDSA 5HPMA 5KSUA 3V95A 1G0DA 3U9UA 3BO8B 4PV8A 5TE4H 5JO5B 1DEEB 4M6OL 4XBPB 5FV2A 1UH4A 5GJSH 5C9JB 5CBAA 2PKDA 1EGJH 5MENA 2NY4B 1RHHA 2BCKA 3LSOB 2B1AH 3LQAC 4NZDA 3VXRE 5EUKA 3BI9X 2R1WB 2VIRB 4HFUL 1QA9A 3NPSB 2X4PA 5D70L 2F54A 4P4KB 3NTCL 5J12C 4BZ2L 3UMTA 1J1PH 2CKBL 1FLRL 5I18L 1P7QB 4Z7WB 1SYVA 3C5ZB 4KKBC 1HH6B 1DL7L 5BV7C 3P0GB 3NZ8B 1B0RB 1QHPA 4YXHH 4YNYA 1SM3L 4MNGA 3S6CA 1KLFA 5DK2A 5HYSG 4I9WD 4MAYA 5IF0B 3ARGB 3PXJA 2NW2B 1ZHKB 3TA3B 4PPTA 4YDKL 4NQCA 4PJ9A 5AEAA 3TBSA 1PD6A 1V7NL 1A7RL 2MWCA 1WEJL 4MLSA 4HIEA 4W6WB 4KWUA 4UOW1 1A6ZA 3WFEL 1Q0XH 4U0RC 3AY4C 3FB5A 1JHTA 3HNSL 1FO0L 1NFIA 1YUHA 3X11B 3HAEA 3B2VL 3CCHA 4N0FA 3SE3A 4UUJB 3LOWA 1QO3A 4PS4L 4PJDF 3O11B 3BISA 4NQTA 3VFUA 1YZZA 3HC3H 4HLZG 4MCYB 1F3DJ 2EH7H 3CSYA 1EHLH 2A77L 4WHTB 1AO7E 1UWXH 1MFBH 1MEXH 3WIHL 3SGDH 3SDAA 3FFCB 1HSAB 4FQJH 3GSQB 4KHXL 1P5VA 2BOCA 5IJKA 1NCAL 1CTOA 2DQEH 2RCSH 5EBWA 2BHYA 2GT9A 2V9QA 1XGRA 3VMNA 4DKEH 5HHQB 5GRYA 2XWTA 2WLZA 4U4BA 5JQ6L 3GSUA 5I76A 3PWUB 4NQXB 1I7TB 3R4DA 2G2RA 5BW7C 2FBOJ 2BERA 3OAYH 5FKAA 5KG9B 4MXWL 3RHWK 5C0GA 3VFWA 4D0DB 2VLMD 1IKNC 1Z9LA 4OF0A 4PRBA 1JPFA 1N5AB 2IG2L 3TJEH 3DVGB 3RRQA 1KLGB 3DVNA 3HS0B 4XPGH 2BC4A 5D1XA 1ONQA 2AERT 3W81A 3C6LA 5JORB 5J1TC 1G1CA 5DJYA 2AJSH 1YECH 5F7WC 3BGMA 1H5BB 3QXUA 4LCWB 4EUPH 4JN1L 4NPYB 3L5JA 1J1XL 1F11B 1I1FA 4L9LB 2ARJA 3KJ4C 2DQHL 3CFCH 4U1IB 4HUXB 2Q3AA 2XKSA 3K80A 4MJ6A 4URTB 4YHML 5I8CA 5MI0C 4XVUC 3IFPB 3O8XD 5EBLB 5TE7L 3MRCA 1QSVA 4KGLA 2G5BB 4Z9KB 3QDJA 3WUZA 2AXHA 3VXUD 5F7UA 5FCSH 2WQRA 5DZOA 3F5WB 1U8OA 3ZT5A 1J0KA 4QRSA 1PYWB 3HE7C 3IRZA 1JHLH 1GAFH 1CLYL 3BXNB 3FONA 5JLZA 4G6AC 2QQNH 2XFXB 1AO7A 4YHYB 5CAYB 2W65B 4FFWC 3KWWA 1NCCH 4HH9A 2AABL 1BM3L 1SYSB 4APQC 5H8DA 5AUMB 1T6VN 3RDTA 1UWGH 3TZVD 3RWCB 4ODUB 4K7PH 3Q6GH 3T3ME 5K9QG 1NCBH 1MJ7L 4Q58C 1BLNA 4P2QA 2VDQH 3ARBB 3O41B 4NZTH 3KS0J 4RRPA 2VDMH 2Z35A 2I24N 3IVKB 3O9WC 5FO8A 4PJEE 2ZOKB 3CDCA 5HHME 5JMRA 3MQIA 3SKMA 2OK0L 3QEHA 5FYKL 1FVEA 2CMRH 1LP9F 5EN2B 3HRPA 4YIQA 3MRQB 5GGTH 3GFUA 4NZRL 3KDMB 4TPRH 1S9XA 3NCYP 3HC4L 4Y5VB 3IS1X 3DO3A 4LVHB 4IJ3C 1DDHA 1F2XK 4JQVA 5ANMA 4PJIA 4YGVB 2R23A 4LU5L 4A6YL 3MBEB 4P59L 1PEWA 2CRMA 2OTPA 4QRRD 4P9HL 1OY3B 4UIKL 1FNEA 5T1LA 4OSUL 4EI6A 4TUKL 1A7QL 4N5UA 4KHTL 3D3VB 1U8MA 3T0ED 1F6FB 1ZT4B 5BZDB 2DL2A 4JANA 2E9BA 1MRCH 5EC1B 4CVXB 1NGPH 4W70A 4NKOB 1U41A 4FQXB 5GSVB 4F8TA 5K9QI 4PRIB 5GIRA 3HG1B 4DQOH 1QRNE 1RQ5A 3VD9A 3PG2A 5JNYA 4LHQB 1F3RB 3NA9L 1GGUA 1R5WB 1TLKA 3OMZA 4FG6C 4QHNB 2CDEA 5ADOH 4ZO7A 9CGTA 4FQIH 3VWJD 4XBGA 5IUSA 4X7TB 4DCQB 3RWJB 3K8LA 4DVBB 3PHQB 5GS2D 1FFNA 4Y16A 2MNUA 5T5NF 2OX5A 3IU4L 3KHOA 1U92B 4X4ME 5EOTB 2G60L 3LEXB 2E7CA 1A3LL 4PJ7F 3WE6B 1T7VA 5DEZA 5CINL 5FUCE 5TQ2H 5DSCB 2DLEA 4UQ2B 4MXQD 3OKKB 3JZ7A 3I75B 4MNQD 5MEOA 2NZIA 4LK4A 4BSWA 1YEIH 1FN4A 4MQ7B 1CFTB 3R0NA 3F6IA 1JV5A 2VL5B 2C1OB 5IMOB 3UBXG 4K8RC 4WFED 1J8HE 2BP3A 5ESVA 3C08L 1TJHH 4P9MH 6FABH 2VZSA 3EO9H 3HC0B 1QSFE 3FMGL 5E08H 1A9BB 4LCIL 4TUJA 4GBXB 3EDFA 4JKMA 2Z4QA 4J23A 1O7VA 2JLLA 4Z0BH 4P0DA 4HG4K 1BREA 3LKRB 5AYQA 2B0SL 4N8VA 1I4FB 3N1PC 1AGDA 4FZ8H 2X1OA 2DQFB 1NSNH 2WBJB 4EBQH 5FECA 1B3JA 1ZHLB 3SDDC 4D9LH 2ICWA 3VGDA 3SOBL 3WFHA 2NR6C 3BZ4A 1QRNA 1A6WL 4LDLB 3BOVA 2AKRB 4GRLB 1D6EA 4RMWA 5E7BA 1K2DB 3DRTA 1ZK9A 1SJEB 1EJOH 2FIRT 4JB9H 4OCYL 2O93L 1WCBA 2DDQL 3X17A 4OZFG 1HQRA 1CXHA 4C83A 2VKXA 4RGNE 4PJXF 1YYLH 1L7TL 4LSSL 4KV5E 1KLUA 4JZOA 3UBXI 4Y19B 5JZ7D 3GSWB 1LEGB 2H3NA 2ITCB 2OS7A 4G6FB 1YPZB 2NYYD 4MD4A 1ZA6A 1GC1L 3A0OA 2P8MA 4ONFH 1MAMH 4CUCA 5GJTL 3OR6B 2DLFL 3QIUB 4OLWH 3W5NA 5KVMC 5E5MB 3BEVA 4P99A 1WVZA 2L0DA 4QF1B 4WNQA 3PIQA 1IM9A 4PJIF 2P8LA 1IAMA 5HY9B 3MLYL 2KPNA 2Y5EA 4TVSa 4QNPE 3GSNB 3N1GC 2J12B 4OFVA 2EC8A 3S97C 3D39E 4ZUVA 1BIHA 2ILLA 3VFTA 1DBKL 3DX9B 2OL3L 4DUVA 1B88A 1E28A 5DJZA 2QBWA 3JWDH 2QR0A 1YN6B 2BRRH 1QSFA 3VXUA 4WEBH 2WWKO 5CJ5A 4Y4HD 2MKWA 4WEMB 4ZS7L 1X4ZA 3BDYL 5DD0L 1QR4A 1IM3B 2QEJA 3PWJB 3RX7A 1MCLA 1OD9A 4KXZH 3WBDA 3MRNA 4BK5A 1INQB 5J13B 3G6AA 1TMCB 1AR2A 1V7MH 2OR9L 3B9AA 4NSKB 2W9EL 1VPOL 4M7ZB 2AQ1A 1G7JA 4M3JA 3HHRB 3QG7L 3QWOA 1LQSR 1U93B 1FNLA 3ARPA 2FYYB 3VXNA 1PX3A 5FGBA 1G7LB 3OKLA 4I5BA 5EU6B 4XP6H 4LVEA 1RK0A 3GMLB 1YNTA 4Z7WE 2DLTA 1MIEL 4M6MH 5HHVH 4F57L 4MJIB 3O3UN 5FM8A 5IW3A 4KRPC 5HI4C 3RWDA 1LDPL 2Y6SC 3F12B 5K9OB 2Z31C 1IGIH 4CW1B 3T3PE 3FZUC 3E6FA 3MLVL 4GOSA 3B3IB 3PP3H 3FOLB 3TVMC 4OZ4A 3LKPB 4KUZH 4BFBD 3JTSA 2VTFA 4M6NH 4LHUB 3ARDB 1TZHA 4QRRA 3T1FB 4HS8H 3EYSL 4P5KA 4NJ9H 1XEDA 4EI5B 4KDTA 5DEFB 5DMYA 3T0EA 3QA3B 5DMGD 3ZHDA 5HVGB 5J3HC 3ULUH 3TBWB 4LLMA 1NGWA 3D39A 1JNNH 5TFSH 3BIKB 3JV0A 2B8OT 3QHTC 3T8XB 3PHSA 2PYEB 4DN4H 5JXEC 5ILTL 5JO5A 1KEGL 1DEEA 3ZYZA 5GRXG 1CGSL 1UXSB 1S5HA 4XBPA 4BELD 1S7XB 3FFCE 3E3QC 1U6AL 5C9JA 3AREC 1MHPL 3T0VA 3U4AA 1PSKL 4Z18A 1RUML 3ES6A 4ZUTA 3MBXH 5DA4A 2R1WA 2VIRA 1Y18A 1U3HD 1KIQA 1TVBB 4P4KA 2NY2D 1JGUL 3A67L 3SGKA 4FA8A 1P7QA 4Z7WA 5IFJA 2FO4B 3C5ZA 4TOYH 1HH6A 1S7QB 2VN4A 3NZ8A 1B0RA 1KJVB 3SPVB 3EJZC 3W9EA 4UT7H 5CGMA 3IFNH 5IF0A 4MS8C 3OAUL 3ARGA 3F7YA 4U1JB 5DFTA 2FATL 4YHPB 2NW2A 3CLFH 2DYPD 4XNYL 1MOEA 3NCFB 3RVTC 3TA3A 4EJ1C 4LCWE 4PGCB 4KDVA 2Z93B 5FYJD 2V2WB 1TETL 4OZFH 4QY8B 4JGJA 2W60B 2GITB 5KVEH 4WGVB 1NFDA 3GKWH 2UVEA 1EHAA 1CDHA 3IFLL 4M5ZH 4WTZA 5I0ZA 2AJUL 4UUJA 1UM5H 3O11A 4OB5H 1JNHB 4Y5YC 3H3PL 5AYUH 4JFHE 2LFGA 4JY4B 1T21B 4MCYA 1TTGA 2C7UA 1QEWB 1JZ7A 3JXAA 1OGAD 1TJGL 3PP4H 3WXWL 4FS0A 3P30H 3FFCA 4UTAL 3HI1B 3GSQA 3BSZL 4ZO9A 5KTEH 2I60L 1G7MB 2ZUXA 3LKQA 4ZOCA 5KZCD 5JR1H 4LLDB 7CGTA 3L3KA 2VDLL 4GMTL 5TE6H 1C5DB 5DJXB 2XRAL 3RWEB 1AD0B 4B50A 4X7EC 3ETBF 1MIMH 3PWUA 3OJMB 1UZ6F 2DF3A 1I7TA 3QNYB 5E70A 4CN1A 1AHWA 5KG9A 1MJUL 3DUHA 1E6JH 2XQYG 5GQBA 1A3RH 4ZYKB 1UB5B 4D0DA 1OQOA 5K9KB 4NQDB 1QP1A 3MV7D 4Z7OF 4ZS6C 2PXYB 3O4LB 4U7KA 3P4MB 1I8LC 2W9DH 3IDMB 3P4NB 4QKXB 1KLGA 3HS0A 1FE8L 4L3EE 2C4FU 3T0XA 1QFPA 2IPKA 2J5LC 3F58H 4QTIH 3B9VA 5BMFH 5JORA 1SBSL 1BPVA 3JVGA 4PJ8D 1S7VA 5C0ND 3DIFB 3VXSD 4LCWA 1H5BA 4HJJH 4MAUL 4K3EL 3QFJB 4PRHD 4WW1B 4NPYA 3D3VE 5HDBF 4XPHL 4XC1L 2FEDD 2IFGA 1F11A 3H9ZA 4L9LA 1IC7L 2JIXB 3MLTB 4HUXA 4U1IA 2EC9T 5D1QC 2C9AA 5EFIB 1T66C 3IFPA 1A7NH 5E5UB 4PRIE 5EBLA 4LRIA 4OF8A 3HG1E 5C7XH 5IVZB 3HRZB 4P4RB 4EOWL 2R0LH 1CFVL 1CXFA 1K9TA 2CRIA 3VMPA 4ZFGL 3L1OH 3F5WA 1CGTA 4RMTA 4QRQB 1C5BH 1PYWA 1JPTH 3RIAK 4NUGL 3TIDA 2A38A 3EZJB 2XFXA 3TFKD 2GHWB 1XAUA 4BA8A 1BVKB 3QDHA 5AUMA 5IMLB 4FQLL 3RWCA 3SKNB 3TH4T 1HWGB 3EO0B 5DHVA 1RZKC 3ARBA 4WFHE 3I3DA 1INDL 5EH1A 4BQCA 3IVKA 3MOAH 2NXZB 4X9BA 3REWB 3T3PF 1TTFA 1DBMH 2ZOKA 2HJLB 2ESVD 3AS3A 3K2MC 5EN2A 1EO8L 4JRYB 1I3UA 3KDMA 4ZUWB 2DWEA 5F71A 3MXVL 4PJCB 3MRGA 1CDGA 4OCMC 4LAQH 1F00I 1NFDF 4YGVA 2XG4A 4QCIB 4K7PY 4GRMB 3MBEA 3RZCD 1W72H 3QIWD 2NY1B 4RFEA 2X40A 4NN6B 2VXUH 4M62H 3D3VA 1GCFA 4X0KA 3UTQB 5BZDA 3WD5L 3PQYB 2YS4A 4NKOA 3UYPA 4I8DA 5IW6B 4I18C 5I1GL 3GUTB 5GSVA 4PRIA 4Z8FL 3HG1A 4CDHA 3ZE1E 4G9DB 4WJ5A 1UM4H 4UB0L 5ETUB 1R5WA 5L6YH 4XP9L 2VH5H 1ADQA 1KCKA 4H20H 4F15B 5CEZE 5DRWB 5HYFA 3CLEH 4I13B 4R0LC 4DCQA 3RWJA 1N7ML 4DVBA 3PHQA 1N64H 4JJ5B 1ND0B 3RI5F 2AEQL 1U92A 3CMOH 4JFXB 4Y19E 1AE6L 5EOTA 3QO1B 3LEXA 2HP4A 1FC2D 1YPZE 3GI9L 4R9HA 4XCEB 3ZKMD 4BKLB 1T5WB 5DSCA 4DGVL 3OKKA 3GM0A 3I75A 4G6JL 2V2TB 4JO1H 3VGBA 1MFEH 5CP7B 4YHOH 3WLWD 3ZYOA 1FL6A 2P47B 1HILB 4PG9B 2VN7A 1KCLA 2C1OA 1IC5H 4XCCH 4KAQL 5ERWB 3MLUH 2ZP0T 3PWPD 5GISL 5GSRB 1QNZL 1OAYH 1KTLB 1A7OH 4GQ9L 3W0WD 5B4MC 4IRJC 3HC0A 1I9JL 2RQ8A 2IMNA 3E8UH 4XXCC 1RULL 2FH6A 1T1WB 4GBXA 1DQTA 3GMOB 1PVHA 1P4IL 3JUZA 1OB1A 3QP3A 1OGAA 5F3BA 2DQJL 1IAIH 1I4FA 4G8GB 2FGWH 5GZOD 4M7KH 2DQFA 1QBLL 2WBJA 1ZVSB 2N4IA 1ZHLA 2MPAH 1KGCE 1REIA 1UJ3B 1AXTL 4F7PA 5EU6E 1ODAA 1G7HB 4OGAD 2ERJB 3QQ9D 2AKRA 4GRLA 4EN3D 1MFAL 2DB8A 1K2DA 4OF5A 1A7PL 3CDYA 3I02B 2VLKB 4QT5A 4MJIE 1VGKB 5FUOL 3WNOA 3K2UH 1IARB 2MMXA 3CVHH 1A1NB 3RVWD 3MV7A 3WFZA 1MFCL 5CUSH 1ED3A 4Y19A 1LEGA 3MRIB 1T7WA 2ITCA 1YPZA 4Y4KB 3MA9L 3B5GA 1Q38A 3OR6A 5E5MA 3SE4C 3TBVB 1P7HL 1PG7H 4OZGB 1MQ8A 4QF1A 4XP4L 4RWYH 5E6IB 3VXSA 4NCC1 3D87B 1J0HA 1JFQH 4PRHA 4ZUUB 1GPOH 1DLFL 3ROLB 5HY9A 1Z3GL 1MFDH 1CLCA 4DN3H 1B90A 3QI9C 5CHNA 4Y8AA 4G7VH 3NZHL 5E00B 5C0CB 1IRAY 2OMNA 4F8QA 2PYEE 2CR3A 5HI5C 4LEXH 4QO1A 4HWEL 5KSBF 1BBJB 4PLJC 2GK0B 1FG2B 2VQUA 3I50L 4F2MB 2X2YA 2HT4D 1IM3A 1EEYB 1P5UA 3PWJA 1KCSL 4TVPD 1INQA 2WWMD 1ZEAL 4IDJH 2YPVL 3MOBH 2VXQL 4NSKA 1P9MA 2XZAL 5IGXL 1U93A 5F1SA 2ZCHH 2ZUTA 2FYYA 5HHXL 1G7LA 2Y07L 4RX4D 5F89B 3IDGB 3FQUB 3BPOB 5D7IA 3GMLA 1PJ9A 1FZJB 1JNLH 5I1CH 1U3ZA 3LEYH 3U2SB 1A3QA 4HGKC 3EOBB 2J8HA 1DVFC 2ADJB 3F12A 3FQTB 1NFKA 4CW1A 1MJ8L 4JCLA 3EYOB 4HPYL 3AS0A 4ODHL 3MRRA 5D7JB 2QSTA 3B3IA 4UT6L 1OWRM 3N85H 3FOLA 3LKPA 3GO1H 4G42B 5CSBA 2YA2A 2JELH 4JO2H 5GGSY 5KOMC 4LHUA 1I1AC 3NACH 3ARDA 3VXTA 3RZCA 4E41B 2IAMC 2XIDA 2Y23A 5DRXB 3C9NB 5D4QA 2XWBA 3STZA 5E8PB 1CICC 3N0PB 4NC1E 4ZD3L 4EI5A 5DEFA 3QA3A 1TPXB 4G6MH 3TBWA 3RU8L 4CVZB 1FNGB 4JG1L 3SE8L 2GUOB 4WUUB 5C0IB 2Y7QB 2PCPB 3MSPA 2PYEA 3CJJA 4HWNA 2EE6A 4WW2C 1LO3H 1S7XA 3U7YL 3TPUB 2MHAB 1Y6NR 1WISA 1A4KB 5M95B 3CZFB 4XNUL 1R3LA 1KNOB 4N1EA 3S35X 3VD4A 1YEJH 3P0VH 4EZMA 1TZGH 1A1MB 1Q9WB 1QPPA 4LSPL 4QWWC 5FHBL 5FV1L 3KJ6L 1F02I 1BOYA 4YFEA 4BQ6A 4HK0A 2JB6A 1TVBA 5ESAB 5D6CB 3FN0H 4FXKB 3MLXH 3OKOB 2FO4A 4NQDE 1S7QA 1G7PB 1X5GA 3O4LE 2XTJC 4N1HB 5IEHB 2CLZB 1YDPB 5FYLH 1KJVA 5C0AD 3SPVA 4NM4H 4ZXBC 3KPOB 2WLYA 3C6SB 5ACZB 4UBDD 1KJ2L 1JI2A 2H45A 1KCVL 4EDWH 4YHPA 2R56H 1FBIL 1WFOA 3O2WL 3PDOB 2A9MH 2OJZH 3HE6B 4PGCA 5CJBA 4POZD 3QFJE 4CNIB 2Z93A 2GSIB 2VZ1A 1MJJB 4MXVE 2DKSA 2V2WA 3ARFD 1J87A 2F19H 4XWOD 2E7LA 2W60A 1TVDA 4J2XA 5C0DB 2VR5A 5D1ZC 4HUMB 2ATKB 3AB0B 3BQUB 4HXBL 3UJJL 3ZE2E 4YHLL 5D7SL 1GHFH 5ISZB 5D2NA 1H15B 1JNHA 5I16B 2FX9L 2R2HB 1WFTA 1J0YA 1NMCB 1U8PB 1UWEH 2ZUSA 2JCCA 1AY1H 1QQDB 3LEVL 3ILQD 3DRQB 5ELIA 1RJCA 2ICES 4Y88A 4XPTL 1B4JL 2MFNA 3LRGA 4P9HC 1NLDH 3HI1A 4K71B 4P2CG 3QUKB 1KFAH 5IB4B 1G7MA 3WNPA 1FL5B 1T5XA 4Z76B 5D7IF 2WUCL 4LLDA 2GQHA 3MX0A 1UJTA 1AGEB 1Y6MR 5IW1B 1AD0A 2A6JB 4OCNC 4M9PA 2A2QT 3TO4D 2J8UB 3CUPA 1LEKB 3MLRL 3QNYA 4W4OA 3CIQA 2X4RB 3VWKD 3CPLB 5IEKB 3SCMD 4H0HB 4K94C 2AK4D 4ZYKA 1UB5A 3O6MH 4JRYE 5DRNB 3RNKA 5K9KA 4NQDA 3LN9A 1RZFH 2PXYA 3WNLA 4C56D 1FORL 2M26A 3FQXB 3QAZC 4UILH 3FT3B 3BH8A 4PJCE 1Z2KA 3IDMA 3TYGL 3QXTA 5F9AC 4KRMB 4K3DH 5I2IA 3EHBD 3HNTL 4ZFFB 2DTMH 5B21A 2HYMA 4OFYD 3DIFA 1M7XA 4GAFB 2Q6WB 4F33B 1WF5A 3QFJA 4WW1A 1C16A 3VFPB 1IGYB 5GGSB 2F58L 3C09B 3BD4A 4RIRA 2JIXA 2PW2B 3PQYE 5I1EL 1RU9L 3PE9A 4DAGL 5EFIA 5J8OA 3BPCA 1K6QH 2BVPB 4LQ1A 3DGCR 3GJFH 1P2CB 2WIIB 3HRZA 4P4RA 3ESVF 4HHAB 1P4LB 4HC1A 1U3YA 5KANG 2ZSVB 1MCJA 2E5EA 4JM2B 4QRQA 4UINH 1QVOB 4HXAL 2W0KA 5E2WH 1J10A 4NQED 5DTFA 2NY6B 4I3SH 4HPOL 4KKBD 4XMLH 3O3EA 4NBXB 1L6ZA 2IGFL 5JW4R 3SKNA 1S7UA 1EUTA 3QWRD 4NP4H 3RX8A 1FFRA 5F96L 1F6LL 1MNUH 2CDGB 3HCVB 1RUPH 1W0YT 5EOQH 4ZNCD 5I71C 3REWA 4ISVB 1RIUH 2HJLA 3JBG7 4G9FD 1T0MB 4YC2B 1D9KC 4L8SB 2P46B 1BM3H 4MB5A 4XP5H 3VXPB 1NC2D 4XZUB 1H8SA 4NN7B 4YX2L 5SWZD 5EZIH 1B4RA 5FOJA 3TN0D 5TQ0H 4M48H 2J6EH 1EGJA 3AUVA 4I48B 3WMSA 4QCIA 1YN7B 4GRMA 1GC1C 5LVEA 1URLA 4M93B 2J1KA 5KANI 5C0RL 1CWVA 3PWVA 1NEUA 3HI6L 4NQSB 4GKZA 5GS1B 3DYOA 2BSSA 3PGDB 2HFGH 5EWIH 4G8GE 2EDBA 1IBGH 2JCCF 1N4XH 4DEPC 1KEML 1LHZA 5LG1A 4U6XB 1ZE3C 5IMMB 5TGBB 4LGSB 5IW6A 4LMQI 3VXQB 3GUTA 1IC4H 2H41A 1JHKH 1AI1H 4X6EB 4F37K 4DFHA 4GRWF 5GRJH 5ETUA 4R96B 4RGMB 4PGDB 4Y7MA 1S7TB 3I6KB 2IANB 1XCQA 4R97C 1TXKA 4M43H 3IDXH 2VLKE 1ZVHA 3U9PL 3QNZA 1EERB 5DRWA 1F4XH 1PEZA 25C8H 3QWQB 4YBLC 1NAMA 4JJ5A 1ND0A 5FGCE 5GGVY 2HAZA 4U1NB 2V2XB 4M1GL 1TCMA 5FKPA 3S36H 4S1SL 3QO1A 2B7DT 4LLQB 4OZFB 2V17L 4BKLA 4KVCH 1DJSA 1T5WA 1DQLH 5FA4B 4OZGE 4OLZL 2R69L 1KENH 1YY8B 3LQAH 5IIEA 1J12A 4OD2B 5ENWB 4X6BB 1RURH 3QRFM 5CP7A 1KCRL 1NGZB 4QRPD 3ARFA 1FAIL 4X6CE 1HILA 1BQHG 2VRAA 1MPAH 1DQMH 4I0KA 4PUBH 2G9HB 4J3VA 5C0CE 3UPAA 3FQWB 4XVUD 5GSRA 5BV7H 4H8WL 2ZG2A 1QLRB 1KTLA 2YRLA 3ZDXF 1FRGH 5C6TL 1MF2H 2AEPH 1BAFL 1T1WA 3GRWH 4M7LL 5H2BB 4DKAA 4MQTB 3GMOA 3OKNB 4Y0GA 1NQBA 3U36B 3HE7D 4Q9CA 3H9YA 4MWFB 4Q6IB 4OLEA 3KPSB 3MZGB 4LAJH 3GK8L 3IDYC 1CDBA 1JCKA 3W9DB 1OARH 1PQZB 3HPLA 3EYUL 5CCKH 5IKCB 1RJZB 1IGTA 4LEOB 4R3SB 4HZLB 3QT2A 3QULB 1IGMH 3ULVL 4NRYB 1A6VL 5JXAL 4WHDA 1UJ3A 5LBSL 4N0YH 1FPTH 1G7HA 3OKMB 3CFJB 5DJ6B 5DGQA 3MODL 2YKLH 3BAEH 2NW3B 4JFPB 1I1CA 4AQOA 3O9WD 4OIBA 1VGKA 4PV9B 3DXAB 1RUQL 2AK4A 5TPWL 1A1NA 3DARA 4PB9L 1KN4H 1ZLSH 3DX6B 3QG6B 4OD3L 5IVXB 4Y4KA 3D48R 1DBAH 5FUZH 2FEEL 4JKLA 3WS6A 3EOTH 1QBAA 1V3JA 3J8F7 5M94B 3TBVA 1NC4B 4G43B 3V5HB 4E41E 4CJ1A 2D4DA 5A2FA 4GW1B 4HMCA 2HTKC 4DWHA 5INDB 1AJ7H 1UH3A 4P3DB 3HUJF 4JY6B 4NNYB 4YPGB 4AQ1B 4ZUUA 1PKQB 1V3MA 3ROLA 1MCQA 2ZZUT 4WV1C 3KAAA 5DZLA 1MVUB 4HIIA 1WBYA 3AM8C 4WUUE 5C0CA 1OM3H 4L5FL 3BE1H 5JOPE 4JPVL 2VC2H 1YEGH 3LRSB 1BBJA 5CEZL 4HBCL 1JRHL 2IFFH 2DQCL 3HZYB 4FG6D 2GK0A 1I7RA 2Q20A 4Z7NE 3MA7B 2EYSB 2AEIT 1QBMH 5LQBL 1U91A 1MY7A 1ZTXL 3TV3L 1VFMA 2XG5A 4PP1C 5FCUL 5EO9B 5F44A 3HZMA 3SN6N 4PLKC 4N0CC 4R4FH 4AK1A 3VH8G 1QSED 2W91A 4RDQF 1FZOB 5GGTA 4Z77B 1RVFH 5F89A 3IDGA 1Z9OA 2EYTB 3FQNB 3NFSH 1CGVA 3FQUA 2GTWB 4HZAA 4X6DB 4FP8H 4WI4A 2VWEC 3VDAA 2R4SH 3GSNL 1U8KA 4GKOA 3LS5L 1LNUB 3BMVA 1T2QL 4KY1H 3WKNA 1F58H 1W72B 3EOBA 1H3XA 4G9FA 4MAYC 2RFXA 4YQXH 3HLAB 1A0QH 4ALAH 3KPNB 1H3TA 3AMLA 5J6HB 1HOCA 4O5LH 3VGFA 1G9EA 5D7JA 3W5MA 3TN0A 2ADFH 4UIMB 2DWDB 1G9MH 3RVUC 5BS0B 3QHZL 1TJIL 4G42A 4PJ9C 2BHUA 5DD1H 1FYHB 3THML 4DW2L 2F8VA 4NRXA 2VDOL 4Y4FB 4ZTOL 4S2SB 1UACH 1N6QL 1M7IB 4RISL 2K3TA 5T1KB 5AD0B 5SWSD 4R2GB 1EXUB 5DK3A 5C6PB 1S7RA 3RY6C 3TIEB 1LE5B 3KLHC 1N2RB 4PGZA 3SE3C 3CU1A 4PFEA 4KJPD 4CVZA 5ISZE 1FNGA 3RAJH 1CDUA 1S7SB 4TRPL 4WUUA 3PV6B 1X5LA 2QLVB 2R0ZH 3BHBB 2NY0C 5C0IA 2NR6D 2PCPA 2Y7QA 5EZOL 4JFZH 3SDAC 1D5XB 4JDTL 4PP2B 1FYTD 1BBDL 1G6RH 1CU4H 5IJKC 1A4KA 4LKXB 1KNOA 3DVIA 5C0JB 2YD1A 5EU7E 1BMGA 4K7PX 2UWEB 2E3VA 1Q9WA 1A22B 4I77H 4MJ4A 2CDFB 4JDZB 4POYA 2J8UE 1CXIA 4JHBA 3IXTB 1P7KB 1NMAH 3AAZA 3S4SB 4X7DC 1FNAA 3OKOA 3MJ9A 3ZE0E 1F4HA 4CMMB 1KB5A 1G7PA 3CMGA 4S1RL 3BT2L 5IEHA 2CLZA 2D9CA 1Q9LA 4HV8B 4KKLC 4Y2DB 3DSFH 5M7QA 1SJVA 4Z7QF 5B3JF 5ACZA 4EQ3A 5D1XC 5I8KH 1EHXA 3S96B 3C6LC 4LGPB 4HEME 1X9QA 4NO3B 4D3CH 3PDOA 2VDRL 4O4YL 4U33A 3DETC 4S0SD 4CNIA 2GSIA 2X4UB 4X4YB 4BQ9A 1V3LA 1CD1B 4H1LG 1DE4B 4N8CL 4P46D 2JJTA 3AVEA 3O0RH 5TDPB 3S34H 2ENYA 1WJ3A 1YEKL 1YNLH 3WLBB 2ATKA 5E2TL 4PJGB 4DKFL 1NCDH 3UP1A 1H15A 5I16A 1MLCB 4NWTL 3NAAL 1MWAL 2R2HA 4LKCB 4KVNL 4F7CB 1U8PA 1NCWL 3FCTB 1YQVH 3CVHB 1QQDA 1AQKL 4K8RH 3SBWA 1YEEL 2P1YA 1B9ZA 1KIPB 4HUWB 5HHOD 2OLDA 5B8CB 3LKNB 3NCJL 4BK4A 3QUKA 4PRPD 5IFHL 3RDTC 2BVUA 1WTGT 4Z76A 4KRPD 5ALCL 5HI4D 3RHWF 1HHKA 2BNRB 2PO6B 3Q6FB 1SY6H 2Y6SD 1X5YA 4ONHB 2Z31D 1G0XA 3JTTB 5IW1A 3FZUD 2LTQB 2FX7H 5DQ9B 2A6JA 4PBVC 5J7CC 3KXFB 3IYLW 2WWKT 3UYRH 2J8UA 1LEKA 1E27B 4LOUC 3ULUE 1G6VK 3TVMD 4XCNB 4PJBB 5DZNA 1FZMA 2X4RA 5CGYC 3LKSB 2VQ1B 3CPLA 5IEKA 4FRWA 1CF8H 3BJLA 2BSED 2GSGA 5DRNA 2YHGA 2VAAB 4JPKL 3QZWG 3CFIC 1MQKL 4ZFZB 4ZAKB 1OD7A 1C12B 1AFVH 5JPNB 2DBLL 3DMMB 3FT3A 3TT3H 2P8PB 3VFNB 5J6GA 5J3HD 4JQVC 1G84A 4RAUB 1ETZA 1I3RB 1UKQA 1NLBH 4ZFFA 3NIDF 2YC1A 4V2CB 3SO3C 3WXVH 4F33A 2QL1A 5IHUL 1I7UB 3GIZL 2GCYA 2RHEA 5JXED 3VFPA 5GGSA 2FD6L 4NWUH 1LO0L 2W0FB 3TNNB 2V5TA 1PKOA 3ARED 4YZFE 4L4TD 3SQOL 4GXUM 5DQDL 2R29L 4NFDA 1CK0H 2BVPA 2VXTH 4J4PC 5IOPB 3IAGC 1IGCH 5L0QC 1P2CA 2WIIA 4HHAA 2KUTA 1P4LA 2W1NA 4QXTA 5IT2L 1ES0B 4JO3L 2IANE 4JM2A 1FSKB 4IIQC 1DBJL 5DD5L 4XCFH 3GNML 4JRXD 3VFRB 4LHJB 2QQKH 4Y16C 2EDRA 1A1OA 4M1DH 4JG0H 1BHGA 3W2DH 5T3ZD 3HMXL 1H0DB 1A6UH 3C60B 3RA7L 5C3LD 3TESA 2CDGA 3HCVA 5C09D 3RVTD 1T83A 2HRPL 2XNAB 3IXAB 4RZCB 4JGUA 4XMPL 3DROB 4ISVA 5I0DA 1T0MA 4IEFB 4L8SA 1HINH 2G75B 3V0VA 4ONGH 3VG0L 3VXPA 5L7XL 2Y1VA 4NOBA 4PJFB 3U4BL 4JHAH 2H2PD 4HEPG 2YPLD 3GBMH 5JHLL 3EAKA 1WAAA 4NQUA 3ZDYF 1AD9B 3OB0H 4OQTL 4KKNA 1YN7A 5D2LF 2CO7B 1EFXB 1K3IA 1E4WH 1U9KA 1ITCA 4JREC 1YY9D 2QQLH 4K2UL 4NQSA 5GS1A 3KPSE 4CU8A 4TSAL 1N0LA 5CZVH 5D5MB 1UCTA 3PGDA 5SX5K 2P5ED 4M7JL 4HIXL 4U6XA 5ID0B 2AAVA 2BY2A 5IMMA 2I07B 5E4IA 2QHRL 4ZDHB 3HR5B 5KVGL 3FOMB 4X6EA 4AJ0A 3VI3E 4R96A 4LIQH 4OQ1A 1S7TA 3I6KA 3SE9H 2ZG3A 4JO4H 2JJSA 2DIAA 4Q74A 5TE4L 3AU1A 2Y25A 3N9GH 4N9GB 2J8UF 2C4XA 5GJSL 4ZTPH 1TQBC 3NOIA 4ZS6D 3QIBC 4U1NA 2V2XA 1EGJL 5IVXE 4YE4H 4LLQA 3TYFB 3NCBB 5HXMA 3KPQA 4WWKB 4Z78B 2B1AL 5FA4A 3WHXB 4HWBA 4HW6A 4MJ5B 3ARQA 1YY8A 3EDKA 4MMXC 2YRPA 4QTHA 4OD2A 2EDWA 4K3GA 3DVFA 2XN9D 1FJ1B 5ENWA 5I9QC 3H7LA 2HKHH 1FQ9C 4X6BA 1PKQE 2EDQA 2Q7YB 5HVHC 4L4VD 3SY0B 1J1PL 1NGZA 3NGBC 2A6IA 4RCAA 3NCMA 4GG6B 5IR1B 4P46A 1UH2A 5FHAH 3D0VB 5D1QD 5IM7B 1NANH 4H5SB 2G9HA 1VEOA 1T66D 3W82A 5IHZB 3PHOA 1M05B 1QLRA 3ZO0A 1FVCA 3VA2C 5DVMA 5TDOB 4YGAB 1A02N 1L4IA 1D3CA 2NX5D 1I8MB 5DUMH 2V6HA 1FO0B 5H2BA 4IBLT 4G6JH 3OKNA 3QDGD 3B83A 3U36A 3SGJA 4P2OB 1XGTA 4R3SA 4PRPA 1LK2A 1Q0XL 5JOFA 3QULA 4NRYA 1EX0A 5GS0H 4R8WH 8CGTA 4P5TB 5DEGB 5FGBC 3VXOB 3CFJA 4Q97A 5IBUB 4X6DE 4HG4J 2BZDA 3U6RA 4JFPA 4F7EB 4JGMA 2NW3A 3GMRB 2R9HC 2NLJA 3HC3L 1F4WH 4QLRA 2EH7L 1EHLL 1YA5A 4DJMA 3DXAA 1MFBL 1MEXL 4ELMB 3MRFB 3VRJA 4AT6B 4HT1H 4FQJL 4RGNC 2LABA 4XX1G 3DX6A 4RFNC 1AP2B 3QDMD 4M5YH 5C1MB 5IVXA 3V4UH 4WVRA 3GSRA 2DQEL 2RCSL 1DANT 1UFUA 5BS0E 3G6JF 5AG8A 4DKEL 4G6KH 1KBGL 4G43A 5BVJB 5I74B 5EOCJ 1WAAF 2FHCA 5INDA 5D96C 4P3DA 1JMXA 4NNYA 4YPGA 4HF5H 1PKQA 4KDTC 5A2KH 3T0EC 3EZ8A 4FHBD 4KU1A 1GGBH 4PB0H 3FHQA 2EDEA 1GOFA 3GGWA 4L4TA 1UZ8B 5IROC 4DK3A 3TJEL 3GBLA 1YMMD 2F5AH 1F8TH 4XPGL 3DI3B 5BZWB 3LRSA 4RFOH 4JFED 3LKOA 3SEPA 3V5DB 4FABH 3BJ91 2DLHA 2AJSL 1OLLA 1YECL 2OR8A 1ZOXA 3MA7A 2EYSA 3MCLH 1RUKH 3WUWG 5I30H 2NY4C 4OBRA 4JRXA 4X83A 4LPVA 5F9WB 2UWEE 3WDJA 3CFCL 1Z9SA 2DD8H 1VHPA 5EO9A 5L8LB 4I2XB 1XGQB 4L3CB 3BGFB 4G7YH 5D6DA 3NPSC 5F3HB 1FZOA 4Z77A 1L9NA 4P4KC 1IEBB 2IC2A 3ZTJH 3L3HB 4MYWB 2GTWA 3SGKC 4X6DA 1I3GH 1AGBB 3C5ZC 4LSUH 5C09A 1U8LA 1S8DB 3MR9B 4JPWH 1JHLL 1GAFL 1S78C 1W72A 2QQNL 4OD1H 6CGTA 1NCCL 1FZKA 3HLAA 3ARGC 2I26N 5J6HA 3KPRD 1UWGL 3BP4B 3DUUB 3TA3C 2YPLA 4K7PL 3Q6GL 4UIMA 4AEHH 2DWDA 1E4KA 1NCBL 1NDMB 4U7SA 2EDDA 5B4MD 5BS0A 3U83A 3FB7B 1CFNA 4GKSB 5I1AB 5TDNB 2VDQL 1K85A 2XZZA 4NZTL 5DMJB 5CS7A 4M8QA 1RZKH 2EDLA 2VDML 3GSVB 4S2SA 4H88H 3QR2A 3BPNB 4Q0XH 4A6YB 3M1BB 5T1KA 5AD0A 2OZ4L 1EXUA 4DZ8B 1SVZA 2R39A 3TWCH 1U0QA 2DQUH 3TIEA 1LE5A 3W39B 1N2RA 2CMRL 4HWZA 4PJGE 5GGTL 4X4XB 3I85A 3EGSB 5HBBA 4TPRL 1S7SA 2BFVH 2AGJH 5KVDH 3PV6A 3BHBA 3MXWH 4RMUA 4QYOB 4FZEH 1OSZB 2EDJA 4UV7H 4YDLB 1XFPA 1D5XA 4PP2A 3GMPB 4QXGH 1II4E 4ZPVA 2EE9A 1K4CB 4HFWB 4DUWA 4LKXA 5SX4H 1GH7A 2BNRE 3T4AB 2A9NH 2H1PH 3OF6A 2UWEA 4JJHA 1MRCL 3KXFE 5KOVC 1NGPL 2CDFA 2FBJH 2CPCA 2AJ3A 5HDLA 4B7LA 2NYYC 1J1OH 2AJZB 1AHWC 3IXTA 4KRNA 1P7KA 4PJBE 4DQOL 3X3FH 5B39G 3S5LB 3S4SA 1RMFH 1T1ZB 2ZNXA 2GJ6D 4CMMA 3MJ7B 5ADOL 1HZHH 3KYMB 4Z95L 1CL7I 5GRVL 4FQIL 1VFOA 5F7DB 4Y2DA 4AEIH 3VDCA 2CJUH 3SJVB 5CD5C 3LB6D 4BUGA 3QI9D 3S96A 1TNMA 3O81A 2YUZA 3S37H 4NO3A 1EVTC 2LVEA 3MROA 1H5BC 4WI8A 3UTSB 4JM4H 2P5WD 2X4UA 5HI5D 5TQ2L 4X4YA 1KPUB 4L9LC 5EU3B 1KXTB 2OCFD 2VO5A 3RJDA 1MCKA 3BP7A 2C3VA 3G5YA 1S5IH 2CD0A 5TDPA 1WZKA 2BNUA 5DJDB 1YEIL 4PTUA 4LRIC 1ZV5A 4PRNB 4D94A 1SMAA 1MHHB 2BXZA 4PJGA 5ITBL 4RNRB 3BPLB 3NIFE 1OF2A 5D8JH 1KG0B 4X7FC 4F7CA 4D2NA 4LKCA 4MA8H 1ZT1B 1TJHL 4YEFA 4P9ML 6FABL 4JFYA 5F88B 1BD2B 3EO9L 1AQDB 3QUXB 4LCCA 5IBTH 4HUWA 3QCUH 5CSZB 5J11B 5B8CA 3LKNA 3IF1B 4LSVH 2VABB 2N7BA 2ZSWB 4K23H 4Z0BL 1WSST 2PO6A 4MZ2A 4DZBA 3BX7C 3Q6FA 1DVFD 2ITDA 1WWWX 4ONHA 1RFDH 1CYGA 4FZ8L 4EBQL 1NSNL 5DQ9A 2BRQA 3ARBC 4MSWB 2DM3A 4Z7UB 3UTTB 4WHCA 2FX9H 1CI5A 4D9LL 1E27A 4XCNA 3A6CH 4PJBA 1QLFB 2VQ1A 4CGTA 5KS9F 2HG5B 4J3TA