3PGFH

Crystal structure of maltose bound mbp with a conformationally specific synthetic antigen binder (sab)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
222
Chain Sequence
VQLVESGGGLVQPGGSLRLSCAASGFNFSSSYIHWVRQAPGKGLEWVAYISSYSGYTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARTPWWYWSGLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Maltodextrin binding protein/de novo protein
molecule keywords Maltose-binding periplasmic protein
publication title Allosteric control of ligand-binding affinity using engineered conformation-specific effector proteins.
pubmed doi rcsb
source organism Escherichia coli
total genus 43
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2010-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pgfH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pgfH01
1F45A 4KGLA 3MRLA 5BMFL 5E2VH 4P23A 1BOGA 4K8RC 1T0NA 2QTEA 2JCCF 4BKLA 1URLA 1JNHA 1BAFH 1KBGH 4MSWA 4Y1AD 2E6JA 1P6FA 4MXVF 3FO0H 3BH9A 4BSVB 2VLKA 4FG6C 1M7IB 2YD5A 1FFOA 1MF2H 3SDAB 3VXNB 2B20A 3GJFB 3U7AA 2E27L 4NBYB 1LEIB 4NNYB 1FDLL 4I4WB 3EOBA 1F5WA 1FZJB 2ZCLL 1WV7T 2QADC 1C08A 3H3BC 5I6XB 3MNWB 4WU7A 4WEBL 3VFVA 4NRZB 1N4XL 3S4SB 3ULVH 4Y4HC 4KUCF 2R4RH 4WHCA 4I5BA 1BGXH 2AXHA 4M5ZH 1OTUC 5KVDH 3RA7H 4MA1C 4EN3D 1U8NB 2FLRT 3BXNA 5DO2C 2I9LB 1J0YA 1WFNA 4U3CA 1YEIH 4L4VE 1F4HA 5I74C 4LFHG 2JCCE 2RBLA 1M6OB 3S4SG 1CQKA 3IXTB 3CVIH 3VXOA 3UTTA 3KLHC 4P2RD 2R1WB 5ALCL 5I0ZA 4P23C 5C9JA 4WRLA 3UXFA 5GRUH 5FUCE 2ATPA 3PNWB 2ICWB 2NW2A 1HNFA 1S7TB 3X13A 3LQMA 1I9RH 4KKCC 1B0RA 3MLUL 3RX7A 3O3UN 4XHQA 1S7WB 3B9KB 1IGYA 1H15A 3C60A 4S1SH 1SM3H 2VDOH 2BCKB 5JTWA 1OD7A 1QBML 2NY6B 2IBBA 5D96B 2Y36L 5FO8B 1Q9KB 3V6OE 3S7GA 3GEWB 1S5IH 4LRNH 4X9HA 3TJHC 4MLSA 2F54B 2AJZB 6CGTA 3EO9L 3VFUA 4GG6B 1IM3A 4OCXL 5D2NE 5L2KB 3ULUH 2F74A 4XNQA 3FCTB 5IB2A 1A6WL 4ODTL 1HKLL 4XXDA 5KSVB 3U0PA 1IBGH 3OF6A 3E6HB 3TJEL 3LOWA 5JQHC 3P9MA 2W0LA 2KL6A 2ATKB 3V4PH 1QSFE 1FZMB 4HWBL 3NTCH 3O45A 4WHTB 5ENWB 4ZAKA 1MJUL 1ZGLA 1F00I 4UIMA 1QOKA 4FQLL 4UNTA 3MYZA 2DLFH 4KV5F 3T77A 3LRSA 3VFRA 3BVNA 3O4LA 3SKJL 4RRPG 3EDDA 5C0IB 3T4AA 2CIKA 3C5SA 3DROB 4J8RB 4NQVB 2Z8SA 3U30B 3KJ6H 2H3NB 1UCBH 5HGHB 4QRUB 4KK9D 4O58H 5D1XA 3ULVF 4NWUL 2BHUA 5CD5D 4NNXA 3KPNB 3MV7D 1TETH 4CADA 1RHFA 2W0FA 4QRPA 5F21B 5CEZD 1AKJD 4PV9B 1EFQA 1J12A 4YO0B 4YNYA 4M5YH 3KHQA 3K2MC 3T3PF 2DF3A 4V1DE 3F6IA 4OV5B 2Z31D 5SWSE 3PDDA 4ODUB 3C87A 5D1ZB 3ES6B 4MJIE 4PJCA 2DQUL 3QP3A 3FRUA 3BMVA 3HAEG 2OBGA 2R8SL 4NN6C 4XP1H 4PJ8A 4LLDA 1KC5H 1B90A 5DR5H 4JFDD 4KV5E 3RWJA 2V5YA 2DWDA 3KNBB 3WNLA 5BXFA 4ZAKC 4EI5B 1DVFD 5HHOE 3DVNB 2UWEF 3IVKB 3G6JB 3TT3L 1MFCL 4OZHA 1DQQB 1MVUB 2CMRL 4OFIA 3ULVE 1T1YA 2X4UA 3FOMB 1FNEA 1N8ZA 5E6IB 4MZ3A 1P84J 4M8VA 3RWGA 4CBPA 2VL5B 5D1XC 1Q9WB 3L7EA 3WFDL 1KBGL 4Z7NF 2YKLL 3T3PE 5I1GL 4JY5H 2RAMA 1A64A 3FO0L 4MZ2A 3VU2A 2RGSA 4H8WH 1A14H 2NR6C 5L9DH 3RWHA 5C0CB 4GMSL 1NGZA 2QLVB 2PN5A 1ZSDB 3V52H 1K2DB 4LCCA 3OKDB 3MLVH 4U1JA 5F7HA 2O5YL 3EDFA 2YD8A 4ODXA 2YUVA 3OG4B 2EDOA 4QYOA 2UWEE 1R3LA 2H32H 4GS7B 1IAII 2NY1C 5EUOF 5IMOB 5JR1L 2R69H 4RCAA 4P5TD 4RAUA 5KVDL 3RA7L 4HKJA 1ULVA 3GM8A 2PUQT 1RHHB 2E8ZA 4PJEA 4F3FB 1YECL 4I0PB 1FAIH 2ILLA 3WN5A 3K74B 4LAJH 5IMLB 1D6VL 3CVIL 4Z7NE 2H2SC 1CFSA 3VWKD 3BZDA 4NC2B 3U79A 1AIFA 1DBJL 4JFFD 4RFEB 4NHCL 1MVFA 3HZKA 5GRUL 4CMMA 5DTFB 4PY8J 1ZHBA 2H41A 1EEYB 1YMMD 4YEEA 5EPMB 1DLHA 1FG9C 4OSUL 5J89A 1QSZA 3FMGH 4OCNC 1RZJC 4CVXB 3VDCA 4HBQA 2DQDL 4XVTH 5BVPL 1RK1A 4ERSH 4DVBB 3WO3B 3CPLA 4LCCC 1AQKL 2QEJA 5EUOE 1JNLL 5F96L 4ZMAT 4L3CB 3VXSB 1BZQK 4Y16B 4IDJH 1RJZA 3P11H 3MJ7B 2VZUA 3RVWD 4LRNL 1S5IL 4JM4H 4Z95L 3U7YL 1I4FA 1MLCB 4I48A 2JJTC 4OKVB 3KXFA 32C2B 3G04A 5HGDB 2X89D 1AGCB 3RKDC 1J05A 2CKBH 4PJ9A 4GG8B 1CE6A 4IOFC 3DIFA 3TBWA 1CZ8L 1YJDC 2VABA 1J8HB 3UBXI 4CVWA 3WN5C 2PYFA 4Z76A 4UAOC 1WWWX 2HFEA 3KLAB 4MNGA 3V6ZB 1KLGB 5HHXH 3EJZD 1MNUL 4Q0XL 3V4PL 1MCWW 4AEIL 4J4PC 3NTCL 3MLRL 4P2QE 4L4TD 4R97B 4JVWA 5D7KE 1Z0MA 3LEXB 1NLDL 3H2WA 1FSKB 1L6XA 4NDMA 3MNZA 4O02L 2VLLB 2G75B 1F3DH 1G0DA 5EBMB 3O3EB 2YN5A 3KJ6L 1UCBL 1HSAB 3VD9A 2XTJD 4HMEA 4JRYE 4O58L 4AEHH 4OCSH 3G5VB 5IVZA 4Z0XB 4M3KB 4RZCA 3WUZA 3QIBB 1OAXL 4ZPVA 3B9VA 4M8QA 1N6UA 3REVB 1G6RA 3OMZA 2ZOLA 4PJ9C 5DHYA 3KPMA 2DMKA 1QZ1A 1FH5L 3FO9B 1N7MH 3QEUA 1JZ4A 1IJ9A 1KN2H 3LKPB 1JNNL 3PWJB 3X3GL 3VFSA 1A1OB 4WFED 5FV1L 3RHWF 1PVHA 5I71C 2J8UA 4XCCL 4LCWE 5FUZH 2FIKB 2WSKA 4R7DA 1PKQA 4YAQA 1YN6A 4C4KT 5CJXA 1SY6A 4XCEA 3SPVB 1JGLL 2IPKA 1U3HB 3S36X 2D31B 5FM5M 3KS0H 1P69B 1WFUA 4NKDB 1H3WM 5HYSA 4LP5A 3LEYL 5HY9B 3RWIA 5DLMH 5D8JH 4CN4A 2GTWB 4XX1G 4JG0H 4BQ6A 1OAQH 3QCUH 4XP6H 4M7KH 3O6FB 5B39A 2P24A 3S37H 1BQUA 1CG9B 4OLZL 2GK2A 3SE8H 4ZDHA 2PW1A 3O6MH 3NCJL 5EH1A 5IB3B 2PO6D 5JZ7C 5GZOC 4K23H 1U8OB 2XQYG 2JKXA 3MROB 3ARDA 4S2SA 4XNUH 1T0MB 3WMSA 5D72H 1QNZL 2F15A 3VXMD 4YWGH 2Z0BA 1D5XA 3AU1A 3O2DL 3SQOH 1QR1B 5ICXA 4PRAB 1YNKH 4N8CH 2R69L 4WFHE 1WCBA 4YIQB 5GRZA 4EXKA 1HQRB 4PJ5A 2DIJA 2A73A 5F44A 1H0DA 3FN9A 2P5ED 4WY7L 4QKXB 3P4OB 4GBXB 3BSZL 5H35B 4YE4H 5CEZH 3UYOD 4UQ3B 1I1AA 2R56L 3BKCH 4WW1B 4HX1B 3TBTB 5IGXH 2B7DT 4N0CC 3MRJA 3QXDA 5KSAD 1QSVA 3IDMB 2KUTA 2EIZA 2APXA 3WLBB 3MACH 4HHAA 4OZGF 4Y1AE 4L3AA 4JJHA 3H42L 3AAZA 3BP7A 1O0VA 3QPQC 4F33A 4V2CB 1KJVB 5E24E 1NH6A 2DKUA 4NSKB 3F7QA 3QO0B 3UMTA 4OD3L 4G42A 3ARDC 2CLRA 5D7JB 3RVXD 4GAYA 5DGQA 1FL3B 2FJHA 1F58H 3LZFL 4FG6D 3UO1L 3ZTNL 3RL2A 5I1EH 2GITA 1WISA 3DVGA 2ZPKH 4TQEL 3MUZ1 4JFXB 2HN7A 2V7NB 3S3PA 2FR4A 4X7SL 5DJ8A 3NPZB 2FB4L 2VXTH 3MUGA 3IFLL 5JW5A 4N5UA 3V4UL 1JN6B 1H5BA 2HYMA 1KJMB 5E94B 4X6CA 5EZLB 4DWHA 3UBXB 4OZGE 3QUYC 3RVVD 2DQHL 1I1AC 1D5ZB 5E2UL 4U6XA 1VGKA 5KVGL 1NSNH 5E6ZA 3QNXA 4F8TA 2JIXB 3QNZA 2BY1A 4DQOL 3F6LA 1YEJH 4HIJA 3NN8A 4XP5H 5FYKL 3UP1A 4NO0B 4JO2L 1XZ0A 4POZC 3JWOH 1NGPH 3QG7L 4LDEB 3UBXG 4PJDF 5B21A 3QDMB 4G9DA 5CWSA 1R3JB 3RAJL 4I3GA 1E27B 1KLUB 4KKCD 3VXUB 4AEHL 1BBJA 2AK4A 1FVDB 3D9AL 4N0FA 3IFNH 4FQHB 1A2YA 3FQUA 3VD7A 5TDOB 2ICWJ 1LO5A 3HMXA 2VSDA 3TT1L 3F7RA 2NXZB 3CFJB 3CJJA 3Q5YA 3FO1A 3ROLA 2F9BT 2E6QA 1J5OL 3NFNB 4L1HA 4G80A 4UIKH 5GISH 4CMHB 3PGCB 1N7ML 2VISA 5JDSA 1EEZA 2W65B 4HIEB 1KENL 4HK3N 2YPLB 4DGVH 1I85A 1BPVA 4PJDE 4HGKC 5D5MA 5FM5O 3UTTD 3ECBB 3G9AB 1EK3A 3MLWH 2LE9A 5T3ZD 2ED8A 3BQUD 1LDPL 5C2BL 5C70A 5J11C 3QIUD 2RFXA 4KK6D 4L8DA 4LQFH 5I1LA 5D8JL 2FCBA 3HE7D 3DXAB 2DB8A 2BVQA 3MV7E 4U1MB 3OX8B 1NEZA 3SDDA 1KXVC 5CEZE 3TA3B 2VH5L 2ZUYA 1HILA 1FNGB 1HHKA 1OSZA 2NY3D 2W9EH 2OR7A 4FQXD 5TPWH 1ZHKA 3WHXA 2G5BB 1GC1H 1AD0B 3PDOA 5ESAB 5F9OH 2FHBA 3HC0A 3VFOB 4CU8A 3IJSA 2B4CC 4X80L 5JDJA 1WBZB 3QWRD 4OQTA 3J8F7 4NKIH 4TSBH 5EWIL 5HHPA 4JFDE 1OWWA 3TCXA 1I85C 4N8CL 4XAWL 2XWBB 1N26A 1A7NL 1JPFB 4PRBB 2VDML 1NL0H 2IADB 1NUNB 3HCVA 1KB5B 4PD4J 2HT2D 4QY8A 1HHJA 2BHYA 3GKWH 3O8XB 3CFIC 5KS9A 1MI5D 4ISVA 2FZ3A 3PGFL 5EBLB 1EHLH 3K7UA 1UXSB 4R90L 5T1KA 3W39A 4W68A 3HZYA 5DURD 3H9SA 3EYQD 1LNUA 1SVZA 2V2WA 3EYSH 3MACL 1H9VA 4MQXC 3D39D 5IFAH 2DQGL 5TE6H 2EDYA 5E9DA 5IQ7L 2FEDD 1CDCA 3SDDC 3TFKD 1YY9D 5T1DH 3QO1B 4L4VB 5C0GA 2PF6A 3PUCA 3EUUA 2JCCB 1SYSB 5FOBA 1MWAA 4U1KB 4KZEL 3T0ED 2QHLA 3OPZH 2VL4A 1U3ZA 3NIGF 3IJHB 1C5DA 3L3OA 3F7PC 5FEBA 3G5YA 4Y4FA 3MRFB 4HXBH 2E8YA 1LO3L 5EG6C 3G08A 5ACLA 2VXTL 1T04A 3HFMH 2A9MH 4MXWH 1I7UB 1CFTA 1UZ8B 2GCYB 1AI1L 4Q74A 5C0BD 2XG5A 1IEAB 1BF2A 2X4OB 3U0TA 1RUPL 2VLJA 4O5LH 3KPRD 1F4AA 4JFPA 4GUPA 4Q6IC 4QHUB 4UU9B 4YHZH 1S3KH 3BEWA 5CZVL 2QJDA 4J12A 1EVUA 4ZYKA 4U1IA 1MCRA 5CP7A 5MP6L 3OXSB 5D2NB 2AEQH 4EBQH 1XIWB 2FJFA 3QZWB 4QEGA 2XZQH 5F1IA 3NIGE 2D4DA 4YGVB 3DSNA 4M1DH 2AK1H 2XPGB 4KTYA 3ZYJA 4NRYA 3MZGB 1FVEA 2P8MB 3STLB 3MCLH 5I8KL 1GGIH 4UT7L 1QSFB 4MQ7A 4K9EC 1IC4H 5ERWA 4MA7H 4XNXH 4F9PA 2D7QA 4QNPF 3LKNB 2BOCB 3F62A 5T1MA 2VLRD 4LLYA 4GFTB 3MGTA 3RZCA 4FRWA 1J0IA 1T3FA 1L6ZA 4XNZB 3PV6A 5KN5A 3KYNB 4ZXBB 4IOFD 2NZ9D 1H3PH 1XR9B 2P47B 3MLSL 4DK3A 4P59L 4LLMA 4L4TE 5BZWA 4A2LA 1JZ3A 3KLDA 3CGTA 1T4KB 4V1DB 1TQCC 2PCPB 4MJIB 1R24B 4KZDL 4PRPA 4NCC2 4J4PD 3A6CH 1K5NB 3UDWA 1X6NA 3UYRH 3TYFA 3WIHL 3HMWH 1NQBA 3P40A 2XTJE 2CRIA 3MUY1 3N0PB 4JPVH 3QXVA 4QNPE 1B9ZA 4PIRF 3CSYB 1T21A 3QJFA 5EOQH 4OZ4A 3HI6H 3JTTA 1DUYA 1A1NA 3VCLA 5HHOB 3P77B 4APQA 2F53E 2NZIA 4HUVA 1LO0L 4Y4KC 4CUCA 2CQVA 3INUL 3BKMH 2C4FT 4HPOH 1GC1L 5JO5A 3N1GC 3RZCC 5JLZA 3LVEA 3I50H 3OKOB 3UTSA 4OI8A 2QR0B 3V79C 3L3GA 3PQYD 4WFEE 4ONFH 2BY0A 2I5YL 3M8OH 4ZUVA 3EGSA 4B5EA 2GJZA 2WNGA 2YC1A 1RI8A 3QFDA 5HYQB 5E4EC 1F4YH 5L0QC 4Y89A 5EC1B 2HFFB 1XFPA 5JHDD 3T0DA 3RWCA 1F4WH 3Q6FB 2W38A 5FYLD 3GKWL 3NH7H 4F9LA 2IQAB 2N7BA 4HUXA 1S9YB 5IESH 5J13B 1U8PA 4GAFB 1EHLL 4ZSOE 4JO4H 3DNKA 3UDWC 5A2LH 2PW2A 3T8XB 2UWEB 3AS2A 1C16B 2J6EH 5HD8C 4LPYA 5IFAL 2L7JA 3KDMB 2C1OB 2UUDH 4D9LH 2J1KA 4APQC 4LSPH 4OKDA 3GUTA 2X4QA 2XY2A 4OLUH 5E8DL 3BD5A 1I1FB 3QHZH 3FOLB 5T5FL 1FO0H 4PB0H 4JY6B 3UEZA 1ZEAL 1NC2D 1QBAA 5T3ZH 2I9TB 4CKVX 5E2WL 3VXME 1OT1A 1OHQA 3KPSD 4TUJA 5I9QC 1Q94B 5IQ9B 4YHLL 1TZIB 4ZFGL 3RTQA 1W0YT 5GZOD 3UJTL 4GRLC 5IHZB 3EHBC 3EYFB 3UYPA 3SY0B 3VWJA 5MEPA 4WFGD 4XI5C 3V5KB 2P5EE 4LLVA 3AFLA 3GSQA 3HG1D 3HFML 5I17A 2ESVA 3H3PH 3MMEA 2IANA 4F9LC 3U2SB 3AGVA 1WVZA 5EUOB 2WW8A 2ADJA 3LRGA 4DN3H 3WNOA 1MCIA 4ETYA 1OTSD 1FRGH 1S7UB 1U8HB 1S9KC 4YHZL 1S3KL 3B2VH 4OTXH 4H26A 4BZ1H 1YEGH 1U2HA 3OAUL 2AJSH 3AB0B 3IU3B 5I1CH 4WI6A 2CSPA 1CK0L 1VFOA 1ZLUK 4I0KA 1NCWH 1J1XL 1LK3H 1DQLH 3FONA 5DFVD 4LDOB 4OT1H 4RDQF 2XZQL 1BWMA 3HN3A 4EZMA 3PV7A 1ZLVH 2VXQL 3LH2H 3BO8A 4X5WA 1IAIL 4C55A 4CVZB 4ZPTB 1X5LA 3S8WA 4PJGB 1N59A 1TLKA 3GSUA 4IMLB 3FQXA 3MRCB 4WI5A 1GGTA 4NZDA 3RTQC 4QHNA 1T7WA 3U0WH 1IC4L 3QFJE 5CJBA 4DZBB 1AHWA 5JIKA 1I8IA 4PGDA 3VWJC 3W0WA 5CEXB 5DVKA 1DBML 3RY4A 4KK5C 2XV6B 2FWOB 2NY0C 4JRYB 5BS0D 4MHHI 3IETA 4HK0B 1H3PL 3C6SB 4WUKH 1F42A 1PZ5B 4PRDB 4RMTA 4S1RH 3GIVB 3BN3B 4MD0A 4K3GA 3RDTB 5IFHH 4JZNA 3ARUA 2ZSWA 2CRMA 3NCEB 4OIIL 5IOPB 3QUYD 3OL2A 3L3KA 4ZFOA 3B9AA 3J7HA 3ALWA 4KKBD 2R39A 1I3UA 4R8WL 4LHUD 3LQAH 5SV4A 1U41A 3CH1A 1AGEB 4MX7B 4PREA 4TOYL 4LKCA 4FXGA 3QUZA 2PXYA 2Y07L 3ZYZA 5FYJL 1RD6A 2XYCA 1M1SA 4UILH 4KPHL 5E5UB 4OCRH 4JKLA 4CU7A 5HVFB 3QA3B 3ZYIA 2X10A 4LCWB 3ZKXB 5CP3A 2CRYA 1ONQB 4QCIA 5JPMA 4FQ2L 4CGTA 1MY7A 4MGXA 4GAJH 1AHWC 1FVCA 5E00A 4D3CH 3T4YA 2VJXA 3CFKB 3SO3C 5GPRA 2H32B 5EUKA 3S98A 4MMZC 5CINH 5I19H 2CXKA 1ZVHA 5AYUH 4ZNCD 3GJEB 1A4KA 1UB5A 5I75B 1EX0A 1OSPL 2KDGA 4HS8L 2R0LH 3FFCA 5C0ND 3CUPB 1DANT 1O7SA 1UB6A 4FNLL 3UTTE 1LO2L 1FP5A 5LXGH 1XGRB 1IFHH 1P84K 3G5ZA 3OKLA 1DEEB 4LP4A 4MD4B 4DAGL 1DFBH 2HJKA 3QCVH 3NA4A 5IB1A 1C12A 3EOAA 2PXYC 5T5NF 4JO4L 1NDGA 1V7NL 3TNMB 3ZTJG 2CGRL 4JRXD 3IF1A 3I2CH 3X14B 3WFBH 4X7TB 4M7LL 4M4RA 4X4MA 1G7PA 4FFZL 3ARBA 4JVPA 1PBYA 3P9LA 4ZUTB 5CD3A 4LSPL 3H9HB 5IV2B 2Q76B 4L8SA 2A77H 4OLUL 2A38A 5KG9B 3BDYH 4MJ4A 1MCPL 5E8PB 1J0JA 3BP5B 3H6JA 1R5IA 1MFDH 1N0LA 2OL3H 1YEKH 5KAQF 3K8KA 2CKBB 4Y1AB 1GOFA 4ETQB 2X41A 3RQ3A 4PY7B 4NN5B 1O7VA 1NFDA 2Z92A 1CT8A 1QFUL 2X7LB 4Y5VA 1ZT4B 4PJ7F 5I2IA 1XGTA 1VENA 2Q7NA 5F1KC 1BQHA 1AFVL 3NA9H 4TN9A 1L7TL 3MRKB 4P48A 1FIEA 3PDGA 1YPZA 2A9NL 5DD5H 1TPXB 4HBCL 2BVPA 1JFQH 3C09B 2AV7B 3B2VL 3D39E 1IAOA 1KJ3H 2EXWC 3O4LE 4EN3B 1IGCH 1GZQA 1YEGL 1YYLL 4GW1A 4Z6AT 1K3IA 2OCFD 3ARBC 4NOFA 3S5LA 3RVTC 3DV6A 1LK3L 1DQLL 1CFNA 4NHUA 4UB0L 4W6XB 1U6AH 4L8SC 3X11B 3WFZA 2XZAL 1U8IA 4GKNB 3T0EE 2DLTA 2CLZA 2R15A 4WUUA 1IGIL 5FYLH 5L7XL 3SQBA 1AO7D 1MY5A 5JNYA 3RL1B 4NYLA 4PJ7E 5DMYA 4JY4B 4OUUA 4UTBL 1MHCB 4DN4H 3CVHA 3D18B 3MV9D 4Z5RB 1RU9H 1KB5L 3MJ8A 5LQBH 1NBVH 3IYLW 4Y5VC 4U1HB 5C09D 2DYPA 4RMSA 1R5VB 5C0BE 4ODVH 3MTRA 2N4IA 2ZZUT 1KYOJ 3GSXB 5A3ID 4BSVA 1OGAD 3KPRE 1B4JL 1M7IA 4NQSB 1HOCB 1Q1JH 1DLFH 4WUKL 1DBBH 3OSKA 3VXNA 5HYJA 2UZIL 4YHML 1MQKH 2EC9U 4M6OH 4XAKD 4NNYA 5JXAL 1HSBB 4I4WA 5TE7H 4J1UB 4R2GC 2AGJL 3DO7A 4UQ2A 4YUEL 4PJEF 3U4EA 3WHE0 3S4SA 4XTRD 4MNQD 5DRWB 4UNVA 1MAMH 1WEJL 4ZODA 2Y9RT 5EU3B 3UZQA 4X8JB 3GSOB 5IBTH 1B0GB 3DSFL 1AXIB 3BAEH 4PR5B 4UILL 3FB8B 3O0RL 3V7AE 2LTQC 5DMGD 2AP2A 2I9LA 4PJDB 1I7ZA 4YH6A 4TULL 3JXAA 3MPCA 4P4RA 4PPTA 2OMNA 4MDJB 2R1WA 4D3CL 1HH9B 4AQ1B 1B3JA 3L95B 5JXED 3SDXA 1D5MB 2DBLH 4ZQKB 4JKPH 2ICWA 1FCCA 4HWNA 3QUKB 1ADQA 4M00A 1AJ7L 2ERJB 4FZ8H 4NPYB 3HNTH 4EUPH 3MV7B 2FX8H 4X8XA 3B9KA 5HI5C 1EHXA 5JOPE 5SWQA 2WANA 4PJEE 3JV4B 4XWGL 1BF8A 5HTSA 4W6YB 1AKJB 5HHME 5C0RL 1RIVH 1Z9MA 5J12B 3RKPA 3N9GH 3FB5B 4M6ML 1UWXH 1RFDH 2EE2A 3EFDL 3WLWC 2ZUXA 2Z31B 5FUOH 1Q9KA 3H9ZA 5BV7C 1T1ZA 2X44D 2XT1B 4U31A 3M17B 1XR8B 3WD5L 1EV2E 3PF2A 1UKQA 4AY0A 4ODHH 1ETZB 1JHTB 2XXMB 4JFDB 5EZJA 4AMKL 1DZBA 4GG6A 1A3QA 3OZ9H 2R2CA 4BUHA 2ZCHL 1UQSB 5AUMA 1DVFB 2A83B 3ROOB 1VACB 5KSVA 4NKMA 1BJ8A 4LARL 1KV3A 1EAPB 4NZUH 1KGCD 2VQ1A 4RRPA 2CPCA 5F72S 1PEZA 1IT9L 1VEMA 4TSAH 4HH9B 1RZIA 1N5AA 4ZUWB 4YGAB 5ENWA 3KXFE 3OJDB 3SDYH 2G5RA 4Y4KD 3UJIH 3LS5L 4XMKH 3B9KC 4KC3B 3RZCD 1EBAA 1IQWL 1LK2A 3O11B 4M02A 3UPRB 1A9BB 3KYOB 5FA3A 2KZWA 3BGMA 4J8RA 3WYRA 5JHDE 2H3NA 5C2UB 2NY6C 1CTNA 4MWFA 3QT2A 1MCQA 4W6WB 1S7SB 3RWFB 4YLQT 3HAEA 4PFEA 2YXMA 5I66B 5AEAA 3OKMB 5J9PB 3C5JA 3WS3B 1NCTA 4PV9A 4YO0A 2A74A 5KBNC 1G9NL 1FNSL 3GRWH 2F58L 2P4AB 3EOTH 1ZA3B 4K2UL 4P5TB 3ARTA 4OV5A 3Q48A 4NKOB 2FO4B 5D1ZA 1B6DA 3I3BA 4XMPL 4E5XB 3JWDL 2OI9C 3U4AA 4OD2A 1Z3GH 4X5LA 5ID1B 4NZTH 1TVBB 1YYML 1U6AL 2A6IA 1B4RA 4JCLA 1CU4L 3VWKB 1OF2A 2CDGB 2XA8H 1TENA 3DVNA 5E99L 3IRPX 2DLGA 3G6JA 3GMLB 3MRQB 2L4OA 4DN4L 1DQQA 1MVUA 4GW4A 4JGJA 3VFWA 1JPSH 4FXKB 5DMKA 3GJFK 4WFGE 2VITA 5TH2B 3WUWB 2BERA 1INDH 1CXEA 3U30C 3QRGH 1SEBB 4KDTA 2UYLB 5LAXA 3RIFF 2J8UE 2Z93A 1B2WH 35C8H 3TPUA 4GRLD 4YJZL 1I1RA 5LGHH 1PKQE 4ELKB 4XI5D 3OJVC 1NC4D 2ED9A 3GMOB 1Q1JL 3D48R 4DEPC 4RWYL 4P46D 1XF5B 1ZSDA 2GFBA 1JGDB 1K2DA 5D1ZC 1T1XA 1J11A 4XCFH 4KVCH 3BH8B 3EYOB 2IQ9H 3WHE1 4G43A 2DTSA 3KPTA 1G1CA 4PJXF 1NCCL 1KJ2H 3MA9H 2MJWA 1VERA 4HIXL 4X4ZA 3GSNH 4U6YA 4KMTL 3SE3A 2P49B 2IAMD 4BFEA 5IB5B 1PD6A 4F58H 4Z18A 1A7BA 2C3XA 4F3FA 4I0PA 3P9WB 1S7RB 3MJ6A 4L5FH 4L4TB 1HEZA 1QYGH 2O93L 4RFEA 6FABH 4P2OB 4KDTC 5DTFA 2E6PA 1LMKA 2Q8AH 3WFEL 1MAJA 4HG4K 1TJIL 4PJ5E 4H1LH 4JFHE 2GSIB 1Q72L 3K1DA 4CVXA 3BP4A 5CLWA 3SJVA 4KK5D 2X09A 4DVBA 2F53B 4NM4L 2NY0D 4XPGL 1YQVH 3C9NB 3N9GL 4PJXE 4L3CA 2HTLC 3VXSA 1OP5H 1OP3H 2XN9A 2PYEA 3MJ7A 2D03L 4NCDA 1MLCA 2QBWA 2FYYB 1BOYA 2PKDA 4LVNB 3L3DA 4GG8A 5IHUH 3KG5A 4NQED 1BJ1H 1CBVH 3TWCL 4I0PC 2WBJD 4ODSH 3LQZB 3KLAA 3ZDZF 5SV3A 3CDGB 3DMMB 4NZUL 5H94A 1NDMB 4AENA 4Y2OA 4TSAL 4ZSOB 5LJYH 1EDQA 1TJGL 5FB8B 4G9FA 2QQLL 3MRNB 2WP3O 3F5WB 2MHAA 3IDXH 2ZKHH 4XWOD 2QHRL 4PD4K 1KG0B 4HIHA 4K71C 3EO0B 1D7FA 1F6FB 3U83A 3TVMB 1TCMA 2I26N 2B5IB 5EBMA 3O3EA 1RPQA 3NCMA 1HSAA 1ORSA 4OGAD 1IM9D 1W0WB 4HQQH 3CZFB 4Z0XA 3JZ7A 3LCYA 4IIQB 5IVXB 1IC7L 1YN7B 1JYWA 3VXMB 1T22B 3KWWB 4I77H 1U58B 5GGRB 3EO1B 4LAQH 2OR9L 3H7BB 3U4BL 3REVA 2C9AA 4JRXE 4K7FB 5EBWB 3EOTL 4X5XB 3ZDZE 3CH8A 1I9JH 3FO9A 3E6FB 5LWYH 1NAMH 1QRNA 2P5EB 3LKPA 3IFOB 2F19H 1SVCP 1EO8H 4UZGA 2FH6A 4CNIB 3V6FA 3FFDA 3QEHB 4ODWB 4N0RA 4A6YA 2JK5B 4YBQC 1IRAY 4M7JL 5L2JA 3VGAC 4CDHA 5KSAB 1QLEL 2FIKA 3QUMA 4OCYL 5MEQB 4L9LA 4XBPB 1JYNA 4ZOAA 3G9VA 3SPVA 1I1CA 4R97C 4EQ3A 3T2NH 4UBDD 1KCKA 4RISH 4BFIA 2D31A 2DM7A 3LN4B 4LKXA 2QKIB 2B0SL 4NKDA 2EDLA 4OAWB 1FNAA 3MLZH 4XVJH 2GTWA 3PWNB 3Q5TA 4IJ3C 43C9B 4P3WA 5EFIA 4WO4C 4OB5L 3O6FA 4EQ2A 1JGEB 5LGHL 1OAKH 5CIPH 5GJTL 2QV2A 1JMZA 4IHOA 2M26A 3PP4L 3QFJB 2ARWA 2VN7A 1U8KA 2QADB 1U8OA 1Z9OA 4UINL 25C8L 1T0MA 1YA5A 3QH3B 3HNVH 4Y4HB 5F7EH 3IDJB 4XCFL 5KS9F 3WJJA 3ET9F 1A6AA 3LKOB 5GRJL 4MA1B 4PRAA 1C7SA 2EXWD 1P4BL 2AI0H 1KJ2L 2DTMH 4J6RH 1FFNA 3ARBD 1AO7E 4L9LC 3GSNL 2AXGB 5I74B 3DX9B 5F7DA 3FO2B 3B9EA 3C5ZC 5IR1B 3GI8H 4YHIB 1T7ZA 4P23B 1FYTA 1T0NB 5K9OB 3IDMA 3X3FH 4BKLB 1F8TL 4KI5C 3MBED 3GNMH 4DW2H 3ZLQC 1ZS8B 1IL1B 4MSWB 5C09E 3WLBA 2DQEH 2M8XA 1OM3H 3PXHA 4RDQG 4P4KD 2VLKB 2Q8AL 1OGAE 4KRNA 4MD5A 5ITFB 2LQRA 2AXJA 2FATH 2VR4A 4HT1H 4XAKE 5KS9E 3EOBB 4L1DA 3FZUC 15C8L 3LKRA 5D7JA 4WU7B 1ZLSH 3LIZL 3RX8A 3VFVB 5HI3D 5F7WC 3H9SE 2UZXB 2JELH 3ZT7A 4MNQE 2X4SB 1I8MA 1JF5A 1KCVH 3WJJC 4I5BB 1TMCB 4PTUA 3C8KA 5E9DE 4JFXA 2YBRB 3BXNB 2M1KA 4QHMA 3U1SL 4LPCA 3VXRD 1ZVSA 1BBDL 3BHBA 1RIHH 4XVSL 1UVQA 3BKYH 1JN6A 3ALPA 2OXGA 1FO0B 5E94A 3VXOB 3UTTB 3UBXA 4ODSL 2VDQH 2EH7H 3F7YB 4U1GB 4JPWH 2COQA 1D5ZA 1JGVH 4PJIF 5C9JB 4WUUD 3BQUB 1BFVL 4OBRA 4WTXA 2WWMC 2ATPB 4PLNC 2VXSH 4XMLL 4MS8C 4Y2DD 3S36L 3FAWA 2NW2B 3LPGA 3X13B 4NO0A 4PB9L 4TUKH 1MFBH 1B0RB 5F3BA 1IGYB 1WZKA 3IDXL 1HKFA 4H20L 1I8LA 2AJVH 3B2UC 4QXWA 1QFHA 3U7WH 1GPOH 2VLJE 4GRWF 5E7FA 5J56B 4RIRB 2XACC 4GAGL 5I1HH 2ZSVA 1U42A 3ALXA 3WDJA 4FTVD 2EYTA 5DD1L 5C0FB 1FVDA 5HYJD 1DSFH 2D3VA 5FF6A 4FQHA 3OAZH 1ZGLM 1FPTL 1MCWM 5IIEB 1KB9J 5TDOA 4RMRA 1GL4B 4YPGB 3WLWD 3VFNA 2H26B 1K6QH 3CFJA 4PJIE 3MQIA 2F74B 5IB2B 4YDVA 2EO1A 4XXDB 4ZD3L 3P9MB 2W65A 1KGCE 4F57H 4KMQA 5E56A 5C7XL 3O45B 4ZAKB 1NMBH 2XQYK 4LLUA 1A3RL 4PBWD 3OKKA 2GHWB 3T77B 2AXFB 3D39B 5T5NG 4GRWE 3BVNB 3O4LB 3T4AB 1UCTA 5DQJA 2CIKB 2RHEA 4WI4A 5M94B 3MRMB 4YDKH 4MXQD 5TF1H 1HWHB 4AK1A 3MRIB 3TNNA 2VZOA 2X9WA 3HB3C 4AG4H 2ITDA 3U9PH 4XVJL 1CD9B 3DXAA 3T0EB 5AAMA 4U1MA 1FFQA 2W0FB 1KFAH 2EECA 3LSOB 4QHKI 2MCG1 4YNYB 3TA3A 1CDIA 4O2CA 1RQ5A 2XKUA 4PJ7B 4RGND 5EU4A 5KAQG 5GS3A 4NZJA 2A6JB 2G5BA 3Q5OA 4UT9H 3LS4L 2DDQH 4HFWA 3FN0H 1RURL 5GS0H 1CN4A 3ZKSD 4GXUN 4X6FB 2NY1B 3DPBA 3BZFA 5C0BB 3RWJB 1UACH 5B4MC 2P44B 3KPRB 5ACMA 1G7IB 1JPFA 2Q3ZA 4PRBA 4GXVH 5KSBA 4M1CC 1P4LA 2IADA 3K4DA 3HPLB 3MV8D 1T1YB 2X4UB 3O8XA 2PTTA 1FNEB 5CGYC 1N8ZB 1KOAA 4Y5XC 3GI8L 3UTSE 1A3LL 5I8OH 5AZEL 4TVSa 1UEMA 4QRQA 1ZWIA 3RWGB 2NPLX 3L7EB 3GNML 4DW2L 4GQ9L 4N1CA 4X9IA 3REWA 1PX4A 2VO5A 3TA3C 3QO1A 4L4VA 2GKIA 1NANH 4YQXH 1X5JA 4UI2A 1UM5H 1NGZB 2FD6H 1NGYB 1Q0XL 1IGFL 2WUBL 2JCCA 1JRHL 3MRPA 5KJRL 1MCFA 2KKQA 4LCCB 4U7MA 4U1JB 1TJHH 3IT8D 1I7RA 4M6AA 4NQCA 3V7AG 3C08H 2BSTA 1WWAX 4CN1A 3NZHL 2DLEA 2EIDA 1R3LB 1KCVL 3QI9D 5LGJA 5D7SL 4RAUB 3MRFA 3M45A 2CK2A 1AGFB 3HS0B 4UTAH 2B8OT 1E28A 3DTXA 3MLXH 4PJEB 3OKEA 3O9WA 1I7UA 1UZ8A 5HHMB 4E42B 3WN5B 2VDNH 3W5NA 2GCYA 4UAOB 3O8XC 4LPTA 2EDHA 2XA3A 3KPPA 1CFSB 1RZKH 4B50A 2AKRA 1JGVL 1AIFB 3DRQA 3V6OA 1WZ1L 4QXUH 5CJ5A 4LSTL 4ONHA 4S1QL 3MCG1 1X3DA 1ZHBB 3WSQL 3VGHA 1IQDA 1DLHB 4TUKL 4HC1H 3MCKA 4I3RH 1C7TA 2GAZA 3MJGX 1J1PH 1RK1B 2AJVL 2IANE 3IDIA 4YGVA 1E4WL 2VYRE 3CPLB 2DS4A 2Z8WC 3ARGA 4QRRD 2GUOA 5SWZA 5DT1H 1RJZB 1UZ6F 1UKSA 3VW3L 3JV5A 5FUCC 1V3LA 5T1LD 1I4FB 3PWUB 4H0GA 4U33A 3KXFB 5J7CC 3Q6GL 43CAA 4P9HC 4PJ9B 5HHQA 2WUCL 3OKYA 2HTLD 3LKNA 2BOCA 3DYOA 2WAHA 4NQEE 3GMRA 4KQ4L 3O9WC 5GGTA 5A2KH 2FX9H 4XBGA 1HDMB 1NBZA 5JHDB 1UJ3C 2HFEB 3L6FA 3KYNA 5CSBA 4ZXBA 5I71B 2VDPH 2AJXH 3V6OC 4JVUA 1VADB 2BVTA 1L9NA 4HF5H 2A6KA 4LCIH 3FQNA 4JQIH 4RA3A 2BRQA 4OF8A 4D9QD 2YZ1A 3W0WE 5CKGA 5SWSA 2VC2H 2PCPA 4MJIA 2Y4SA 3MNZB 1UZ6E 1MHPH 3MGOB 4LSSH 1I9IH 4JJ5A 4YDKL 1K5NA 3VG0H 3ARGC 2PNDA 3I02A 1JL8A 4MVBC 3U9PL 2NY5L 1JPST 2NXYD 1NC2B 3CSYA 3M1BA 1NCDH 1L4IA 4P49A 1KFAL 3SJVD 3MRBB 5IT2L 4M8QB 4XT1C 4KK8C 4FMKA 1G6RB 1CVSC 3CD4A 5DHYB 1PY9A 2P8PA 3RU8L 3RVUD 1MLBB 4N0UA 4KKNA 3P0YH 3OKOA 3RNKB 3VFSB 4PG9B 4XNZC 1V3JA 5BO1H 4OD1H 5I1JL 3DURB 5HPOA 3WKML 1UYWH 3W9EB 4ZXBC 4WEMB 2J8UB 4WW2F 5GS2H 4R7DB 5HYQA 1PKQB 4YAQB 1F02I 1YN6B 1CVRA 1RZ8A 2UV3A 1MJ8H 3SGKA 2HFFA 4ZS7H 3HE6D 1T83A 2IPKB 4JFEA 2ID5A 3Q6FA 4HK3J 1S9YA 1VFAA 2EDKA 1CLYH 1UH3A 3WXWH 1CFBA 3RWIB 1KYOK 1ACYH 4G9FD 1V7ML 2UWEA 1C16A 1FFRA 5B39B 3GI9H 2C1OA 2G2RB 3O41A 3QEGL 1T66D 1WFTA 2PW1B 5GGVH 3SDCD 4YQXL 3O3BB 1NFDF 2IC2A 3FOLA 3ARDB 4S2SB 4EUPG 3WL9B 3ULVC 4WO4D 4G5ZL 1F3RB 4RQQA 3T04D 4FQJH 4U3XA 5CCKH 1BVKA 2HFTA 3VXTA 4UUJB 4O4YL 3I6GA 5IQ9A 3RGHA 1TZIA 5GGVY 2NMSA 5ICXB 2IPTL 1FFPA 5E1HB 3BD3A 3QQNA 4MAYA 1WCBB 4DUXA 5IHZA 5F70A 4X4ME 3NFSL 4PJ5B 5CBEA 2CUHA 3EYFA 4LSVL 2A73B 4UTAL 1R5WB 3BT2L 1H0DB 1QRND 3K2UH 4H5SA 2FECI 4K8RL 3ZYOA 5BVJA 3GBMH 3SGKC 1HIMH 1HINH 1T83C 3VXQB 3QUYB 1I1AB 4HZLA 3K81A 3WXVH 1X7QA 3U2SA 5EUOA 4PJXB 4LHUB 1TFHA 3QXDB 4UNUA 1ZVYA 5DJDA 2EIZB 1AP2A 5HDLA 4JO1H 1CGWA 4HHAB 1S7UA 3R0NA 2DJUA 1GIGH 3AAZB 3C5ZD 2FLBT 3BP7B 3GKZA 3VGGA 4LIQH 4EDWH 1NFDE 3WNMA 3ABZA 3FT2A 4U6VL 4YXLH 4Z0BH 5GGSA 4LHUG 3P73A 3U6RA 1LP9F 3L7FA 4KI5D 1MRFL 4UT6L 1J1PL 3BESR 1AXSA 4N0YL 2XRAH 1EJOL 2CLRB 5FHBL 4GAYB 4ACPA 2CDEB 1W72L 4CVZA 5AWNH 4Q6YA 4ZPTA 4KJPD 3FTGA 3RL2B 1YEFL 3MRCA 3A0OA 3K80A 4KU1A 3TN0D 1QFWH 3UTPE 1QVOA 1TNMA 2GITB 3DVGB 3OB0K 1XEDA 1RMFL 3ULUC 4P2QA 2FR4B 4MAYC 3FZUD 3FHQA 1JHLL 4DZBA 5I1IH 3JSSA 4ZFZA 3EIFA 3MUGB 5JW5B 3VXRE 4F7TA 4X99A 1CGTA 2NCMA 3HR6A 2AEIT 1BHGA 3DUSB 4U6XB 4WUUE 3D2UD 4JRYA 3QNXB 1LHZA 2J7LA 2V2TB 4M43H 4KHXH 4NWTL 3AXLB 5TQ0H 2ZCKH 3V0AC 3C6SA 5CUSH 4HIJB 1C1EH 2P1YA 1YEHH 3GIVA 3NN8B 2BJMH 1XZ0B 3RDTA 1RUMH 2BMKB 4S1DD 1C5CH 4JRXB 7FABH 5J11B 3V9FA 2EZ0C 1AGEA 3MBXH 4G9DB 4N1HB 4CJ1A 5DWUL 4BFBD 2R29H 4GRMB 1S9XA 5LCVH 1KPUA 3RWDA 3L5WA 3STBA 2BRRL 4RNRA 3SDXF 2YMXL 3QJHB 4NO5B 4N0FB 3BRGC 4FTVE 3C2AL 3QA3A 4U6TA 5EU6D 5ELIA 3CK0H 1A2YB 3FQUB 5HYJE 1MRDL 1NCDL 3IJYB 1ONQA 4QWWC 2ZWLT 5F97E 4G6FB 1F4XL 2E5EA 2XI9A 3FO1B 4HJJH 5DQDL 3THML 5KVFH 3DETD 4HGMA 4G80B 4PV8A 4XBEH 3DUHA 5K9QI 5JDSB 2MWCA 2VISB 2Y6SC 4X4YA 3P0YL 2H32A 1EEZB 4XB8A 5BO1L 1P9MA 1YDPA 3GJEA 4KRPD 5KSUB 5E1AA 4KROD 1JWUB 3HC3H 1IMHC 3W9DA 3HRZB 4IMKA 3HA0A 3CUPA 4P3CL 2B39A 4NUJB 1XGRA 1MJ8L 1RUQH 5TQ2H 3O6KH 1DEEA 1FHGA 3SDXE 1RULH 2RFXB 2JB5L 3S35L 3DVIA 5DC0A 5EC2B 1DE4A 1QSED 2B2XL 1EAJA 5I1LB 3C8DA 4H8WC 5IG7B 3DHMA 2ZP0T 3TNMA 3GHBL 4JRWA 4YZFF 3X14A 2R9HD 4YPJA 1NEZB 1OPGH 3R06A 2J4WL 3TYGH 3WO4C 3VD3A 5D70L 2D0HA 1AO7B 1OSZB 3AREA 1ZHKB 4RGNE 5GGVL 5HDQL 2O5ZH 4ZUTA 2BVUA 4MB3A 3WHXB 3H9HA 5IV2A 2Y06L 1CICC 1FL6A 1I3RB 4H1LG 4NZRH 3IJSB 5E8PA 1G7JB 2VDKH 3BP5A 1VFUA 2VUOA 4LSUH 1ZANL 1P9MC 2BDNH 2CKBA 2WP3T 5KVEH 4Y1AA 4ETQA 1KIQA 3LMJH 3SE9L 5ADPH 2CDFA 2VKWA 4PY7A 1XAUA 1OGAB 5DJ6B 4GKZA 2X7LA 4IMKC 1ZT4A 1T1WB 3K2UL 3HCVB 4F7CB 3D1MC 1HHJB 4XPFL 5EA0H 5KS9B 1YZZA 2HVKA 4FQIL 4ISVB 2FZ3B 3MRKA 4E0RA 2PTUA 4G6JH 3V8CA 4YZFE 3W39B 1FIGH 4Q6IB 3HZYB 3H9SB 1SJXA 1UWEL 4MNQB 1LNUB 4M1CD 4HD9A 3EAKA 1MEXH 1KUMA 2I25N 5E9DB 4EN3A 3HNSH 1NEUA 3MO1A 3FQRB 1EXUB 4K94H 1RAMA 3AREC 5EULV 2I07A 5FOBB 5DZNA 4KHTL 2BFVL 3X11A 5CLTA 4OZGA 4P2RA 2VOTA 4MA8H 2DMBA 2YD2A 3CSPA 3G6DL 5AWNL 1YNLL 4NJAH 3SE4A 1KN4L 3L3OB 4XNYL 3RL1A 1EGJA 4H25B 1MHCA 3D18A 2HVJA 3EDEA 4MQSB 4NN5C 4LSRH 5F1SA 1KSRA 3G08B 5I1IL 1NAMB 1T04B 2AJYH 4NUGH 4U1HA 1MFEH 5ESQA 2EDJA 1BLNB 1R5VA 2BNQD 1CE1H 3T1FA 3U0TB 2VLJB 4XCYA 1QPXA 1U3JA 4HZAA 3VRJA 1VDGA 4JFPB 4GUPB 4GLRH 9CGTA 1RZJL 5IP4A 4NQSA 1M7DA 3NAAL 5DJYB 4PS4H 3IDNA 1EZVX 3MFFA 5CP7B 5F1NB 3ZE1F 4EN3C 4G8FA 4NC1E 1HSBA 5D4QA 4J1UA 4I3SL 4NC0B 1LO4L 1TQCB 4AIXA 4PJIB 1IGMH 3MBXL 4P9ML 5DRWA 1DUZB 3A67H 4UV4L 5EU3A 4NRYB 1I3VA 2R29L 2DQIL 3GSOA 1FVEB 1B0GA 1ZK9A 4JKWA 4QHLB 5E2JA 1VFMA 3CFCH 4I13B 2W07A 4MQ7B 3SE4C 2ENSA 1YJDL 1LD9A 2EDWA 1B88A 4M3JA 5ERWB 2CK0L 1CDGA 1XCQB 4Y4KB 2YD1A 1C5BL 2IGFH 4GRWB 4LLYB 1HH9A 3MGTB 3RZCB 3VE0B 4XBEL 1T3FB 2R0KL 3K8LA 4OCWL 4ZQKA 3PV6B 5KN5B 3RHWK 1E4XH 4YX2H 3MODL 1T6VN 4Z7WF 1JPTL 3ZE1E 4NPYA 2DN7A 5E4EB 5L0QB 3JVGA 4BH8A 2R0WH 1AKJA 4LLMB 5BZWB 5K9QG 3R8BB 4OZFH 3E3QC 2ZNXA 4D9QE 2Z31A 3N1MC 3CSBA 2Q8BL 4PRPB 3P4NB 3M17A 2V9RA 2ADFL 3TYFB 3DYPA 3WE6A 3W5MA 3ARYA 5E08H 4BQ9A 5FIEA 5C8JB 1T21B 3UTZB 5B3JF 2JJVA 1DUYB 1A1NB 3JTTB 3SJVE 3VCLB 4APQB 2A83A 3L5IA 1VACA 3RPKA 1R3HB 4EJ1C 5HJ3A 4HUVB 3ARGD 1J1OH 4G8GD 4HPYL 3EZJB 1TIUA 1EAPA 2XN9E 4OLVH 2PYEE 3QG6A 3HPJB 4PGBA 4Z7WE 5JLZB 3L5JA 4H0HB 3UTSB 4IRSD 3DHJA 2ADIA 4ZUWA 5F93C 3NCFB 5DD6B 1OD9A 4PGCB 5I9QB 2Z91A 3L3GB 1NJ9A 5EO1B 4ZUVB 5KVEL 3EGSB 1INEL 2YC1B 4GRLB 2Q7YA 3QFDB 2F5AL 3KLSA 4HXAH 3UPAA 1GGCH 2P8LB 1MIMH 1FGNL 3JVGC 1AQDB 1NC4B 3B83A 3KYOA 1A9BA 1GRWA 4Z8FH 3FT4A 4QHKJ 5IK3B 4HCRA 5ADOH 4G7VH 3MOBL 2Z31C 4HUXB 2BK8A 3BE1H 3SGEI 3QCTL 5C0JA 1U8PB 1KCUH 3GMMA 4RFOL 5B3JE 2XKNB 2CO7B 2PW2B 3WS3A 1DQMH 4G9FE 3N85L 4DZ8A 1G6RL 1MCOH 1AD9A 3CFBA 1ZA3A 4P5TA 1JE6A 5HGBB 4E5XA 3GUTB 2X4QB 1MJ7H 2IBGA 5DVMA 1NBQA 1RUKH 2W0KA 4KI5F 3VWKA 1X4ZA 1HZHH 1DJSA 4JFFA 3H3KA 1FE8H 4BZ2L 2HH0L 1SY6L 3MRQA 2P48B 5EZOL 3BGFC 1R6VA 3CIQA 4GSDL 1YMMA 5TE4H 5INCA 3VWJB 5MEOA 1QRNE 5TH2A 1V8HA 3GSQB 3NIFF 2ESVB 1KEML 2IANB 3L3IB 3TBYB 1QBLL 4WTWA 2NY0B 2MCPL 1CE1L 2ADJB 4AQOA 3GIZL 4XPBH 3OB8A 4HWEH 5FO9B 3IB4A 3JWOC 4XX1E 3SHSA 2EH8H 1YEEH 2EDQA 3GMOA 1NMAH 4H26B 5T3XE 2OZ4H 3KR3H 3F58H 2X89A 4NQEB 4KI5E 1MREL 2EDFA 2IWGA 5J0BA 3BH8A 1J86A 4OI7A 2WBJB 3RX5A 3A67L 4Q9BA 5L8KB 3M07A 4LBEB 3VWKC 5FGRA 1KB9K 3FQXB 3DX6B 1PDKA 3VI4F 2NTFA 1OL0A 3CXHJ 4JG1L 1QHPA 3NIFE 1JZ8A 1V3MA 4L4TA 5J6HA 1I8IB 4PGDB 1INQB 1H3XA 3PWPD 3W0WB 3SO3B 2IGFL 5DMJB 4N1EA 3MLPA 2R1YA 4X0KA 2YK1L 3QWOB 4UDUA 4EOWH 1TITA 3IU4L 4S10A 4JDZA 3VJ6B 3IETB 2V7HB 4GO6B 1IM9B 1TQBB 3CMOL 4MD0B 3RVWC 2E27H 4JZNB 3E0GA 1CR9L 2ZCLH 3QQ4A 4ZFOB 4KRMB 2O5XH 1FYTE 4WEBH 3QDJD 3CH1B 1N4XH 1LEGB 4PREB 2H8PA 4FXGB 5T33L 5ILTH 3VI4E 1SMOA 5E8OA 1AC0A 2FYYA 1NUDA 4DKFL 4U2ZA 5JW4N 1FV1A 5F71A 3VGDA 2Z4QA 4HUMB 4QCIB 1BD2D 4JPIB 1QEWB 5J4MA 1FVCB 5ALCH 5E00B 3JV6B 2X70A 4OJFH 2AJUL 2D7OA 1K4DA 4POYA 1P5UA 2UVEA 4P5KA 5EUKB 5K59F 2RR3A 4ZSOA 4QWWD 3MLUH 1UB5B 2XTJC 2Y5TB 4I18A 3RY5A 1JIBA 3F5WA 5E0QA 2V9QA 4I9WD 3LD8C 3CLFH 3QUXD 3EO0A 1UB6B 1GGCL 1QBMH 1BX2A 4TVPE 3PHSA 3DUUB 4YK4C 2PR4L 3G5ZB 3TIDB 3OKLB 4HWZB 2PO6A 2HJKB 1A5FL 1WWBX 4PYGA 1W0WA 1C12B 3EOAB 4WW2B 3CZFA 5JPNB 3QDHA 1KCUL 4GMTL 1VEPA 1YN7A 1ZLUH 4OLWL 1NDGB 1QSEE 3KWWA 3VXMA 5GGRA 1EJ6A 3EO9H 3EO1A 3HMXL 2K9UA 4K7FA 3B8YA 1PAMA 1A6WH 4ODTH 1HKLH 1KPVA 3ARBB 4OGXH 4NFCA 1GGYA 2C4FU 3UTOA 1NFIB 2B4CL 3E6FA 1NCNA 3TJEH 2C3WA 5K59E 5CD3B 2P5EA 5DC9B 4L8SB 4CNIA 3CLEL 4R0LA 1AE6L 1I7TB 3QEHA 4ODWA 1QFWI 1EMTL 4HWBH 2JK5A 1R5IB 3LN5B 1MJUH 3DOSA 3X12A 4N68A 5DJZA 3TO4D 4XBPA 4I18C 1CICD 4LPUA 1NFDB 1P4IL 1CT8B 2NY7L 4QOKD 4Y5VB 4H0IA 3QDAA 1XGTB 4PBVC 2VMFA 2CH8A 2B5IC 4NWUH 5GHWL 2PO6C 3MA7A 1JGEA 1Q0YL 1DQDL 1UH2A 4JAMB 4R96A 4TRPL 3MUHL 5M7QA 3QPXL 2BVPB 4FS0A 4BUGA 1OWRM 1Z0NA 2IALA 5TDNA 5D1QA 5KANG 5DZLA 1GZQB 2BNUA 4R2GB 5C3LD 3VXRB 5KSBF 2R8SH 4OM1L 4KJYB 1CFNB 4NHUB 4OQTL 1CFVH 4R0LC 2V17H 1U8IB 1KT2B 4WUUB 2LTQB 4N9GA 5JNYB 2BOBA 1ZOXA 4NYLB 4FABL 4OUUB 1MCSA 2AXGA 3CVHB 4U7SA 4Y2DB 5E5RB 1MUJB 2UY7A 5HVGB 2CMRH 1CD0A 4NQXA 1SHMA 1BM3L 2I24N 3DGGA 3NABL 4YHIA 2AQ3A 2HKHL 3C6LD 5K9OA 4PRHD 2WZPD 1GH7A 5ITBL 3WFDH 4C57C 5LBSL 1ZS8A 1IL1A 2DYPB 2YKLH 5I1GH 4X4XB 3WNKA 2W9DL 4EOWL 3RVXC 2D7MA 3GO1L 1F90H 4FTVB 4OCLC 5KSBE 4GMSH 2KPNA 5HYJB 5ITFA 4W4NA 1DL7H 4L9DA 5D1QC 2VLME 1MWAL 5FYKD 3DO7B 3SDAD 4UQ2B 2O5YH 2O5XL 3U4EB 5BV7B 4ZUSA 3K1KC 4NO3A 4PJAF 2C26A 2X4SA 3KPLA 2J6EA 1G7QB 5ILTL 5B8CA 4K9EL 5JR1H 1Z9LA 3RVVC 3JBG7 1NAKL 1N5YL 2YBRA 4D9RE 3OAYK 2EEDA 3EW3B 1I7ZB 1YECH 3DX8B 4XPHL 2APVA 2QQKL 4OQ1A 4P4RB 2A1WL 1FO0A 1VGEL 1D6VH 1KIRA 3QULA 3F7YA 4MXVE 2OTUB 1DBJH 4OJFL 4MA3B 4NHCH 3BQUA 4NQCE 2L7UA 3SDXB 3QIUA 1BVLA 4L3ED 4WWKC 4RBPK 2HJFA 1BQLL 1QQDA 4OSUH 3MC0A 1F6LL 3HE7A 3B9DA 5SWQB 2DQDH 4JQVA 5C07D 2OTWB 3RWEA 5BVPH 1EUTA 5FK9A 3ZE0F 4PJAE 3CLFL 1UT9A 5JOEA 1AQKH 4FQXA 4RGNB 1JNLH 5F96H 1G7HB 4HJGB 2YN3A 4RIRA 1T1ZB 2E7MA 4LCYB 5C0FA 4Z95H 3U7YH 3TBVB 2OP4H 3PP3K 5B8CC 1VFBA 3T0VA 1J18A 1ZA6A 2KQNA 3QWRA 5DRZB 1N64L 2P46B 5IIEA 1JZ7A 3WIIL 4YPGA 5EZJB 4G6KH 1CZ8H 2H26A 3LHPL 1S7XB 1KXQE 5AUMB 4U1NA 3HI5L 4NKMB 2OI9B 1UADC 4OGXL 1UA6L 4G8GE 1QKZL 1A7PL 5SWZE 5L2KD 4RAHA 5E70A 1XF4A 4U1GC 2VQ1B 1MNUH 3BQUC 4Q0XH 1GCFA 1MI5A 1FN4A 5F3HA 1RZIB 3QIUC 1YC8A 1N5AB 4AEIH 3BJ91 4KK6C 4TYUA 5I1DA 3MLRH 4DKAA 3ZE0E 1YEDB 3S34L 1EA9C 1DANU 1Y0LB 3HE7C 1NLDH 2AXFA 3D39A 5C6WH 1LK2B 4JQVC 1S9VB 1NLBL 4O02H 4OF3A 1FNLA 3HTLX 5F7MC 3DI3B 5FA3B 3MRMA 3BGMB 4O9HL 1Z6JT 3KJ4C 4U1SA 2NY3C 4FQXC 3MRIA 4MWFB 4X7FC 3DWTA 4GLRI 3VD5A 1PSKL 3LDBB 2DQTL 2VZ3A 3HAEB 1GHFL 3RPIB 1OAXH 3T0EA 4JHAL 1JF6A 1T6WA 3C5JB 3LSOA 3BN9C 3SKMB 2A74B 3ME0A 4PJ7A 1OLZA 4DEPB 2VDLL 4FZEL 5JW3L 3CFEA 1FH5H 4LLQA 2A6JA 3DARA 1JNNH 3X3GH 4OGZA 2MOVA 4OD2B 5IBLD 5FA4B 4PG2A 4XNMA 3PJSA 3TCLA 4EIGB 4X6FA 3KYAA 2HT2C 1CFVL 2A6IB 4XCCH 1NPUA 5C0BA 2V17L 3DO3A 5EIVA 5JIPA 1OF2B 1T80A 1KCLA 2J88L 3V8OA 2EDTA 3KPRA 2AJ3A 1G7IA 3EYQC 5I1AB 4DGIL 4GW4B 1JGLH 2JF1A 1RZFL 4IRZL 4N0UE 2FX7L 3HPLA 4NP4L 3VFWB 2LV4A 5DMKB 5B38G 5E6YA 2FEDC 3HLAA 2VITB 4FQCL 1E4XI 3TFKC 3LEYH 5JHLL 1YY9C 4XGZA 4NJ9H 5LAXB 3L5XL 5DD0L 2Z93B 5E6ID 3TPUB 3T0EC 4OLZH 1F90L 3NCJH 5D9SA 5T1LB 3ULUF 1B6UA 1NGYA 4JFEE 3LQAC 1DL7L 2GFBB 1E6JL 3EFFB 1T1XB 5C0CD 1QNZH 3Q1SL 2VLRA 1DN2A 3O2DH 4PG2C 4G43B 3UTQA 2ZNWA 2JJTA 1U92B 3HS0A 1AGFA 4U6YB 4WY7H 3RFZC 3BSZH 2VE6A 1JGUL 4E42A 2VR9A 12E8L 2R56H 4JLRB 3PIQB 1Q8MA 1HEZB 2OL3A 3PWPE 1UM4L 5C0EA 5DJ2A 1CL7H 4LSQL 1XGUA 3PWVA 4ZUUA 4MMXC 4R4ND 4J4PA 3H42H 3ULUE 4QXGL 3RZWA 1OAUH 2VQUA 1K8DA 3K3QA 3BP4B 3ARFC 4K71B 3R1GL 3SJVB 2WQRA 4R26L 4NT6B 4OD3H 2DI8A 4PTTA 1H8SA 4WDIA 5FDWA 3WFHA 4NOBA 3LZFH 3UO1H 3ZTNH 2XN9B 2IH3A 2PYEB 4Z7WB 2HT4D 3MRHA 2CXGA 5FDYA 2P45B 2OP4L 4HKBB 3PWUA 3AMLA 4TQEH 4TNWK 4O2FA 4HV8A 1GAFL 4X7SH 3PQYA 2FB4H 3L3DB 3IFLH 1IGJA 2KZ1B 2NZ9C 4G6KL 3V4UH 2LVCA 1MSPA 4HS6B 1BD2E 5CEYB 2DQHH 1HDMA 3MRDB 1KIPB 5E2UH 5JHDA 1H8NA 5CSZA 5KVGH 3FJTA 3HE6B 1J8HD 4NGHL 4LMQE 4K3JH 1SBSH 5H94B 4J3UA 4AENB 4DQOH 3VGAB 1XGPA 3DBXA 1VADA 2NYYD 2HFGL 4WCYH 5FYKH 4P99A 4JO2H 3GJFH 3QG7H 5D71L 4G9FB 1HHIB 3PE9A 4ZFOL 5F9AC 2MHAB 3BYYA 1YUHA 4HIHB 3PHOB 3U46B 3MGOA 3RAJH 3U9UA 3SDCB 5DYOB 1ORSB 3VA2C 4IJ3B 2H9GB 3D9AH 4WO4B 5C6PB 3GBNL 1NC2A 2FL5A 4PLJD 3MRBA 1S8DB 2P5WA 1OQOA 3S3SA 3TT1H 3KPSA 3V0WL 4K3DL 1WBYA 3QIBD 5DHVH 1ZTXL 1MLBA 1J5OH 3VDAA 5AAWA 5A1AA 1GXEA 1J0HA 1QRNB 2OSLB 3RNKA 3R4DA 4PG9A 4AYFA 3HG1A 4HUUB 1KENH 3V6FB 3FFDB 2KH2B 3DURA 1O5DT 3W9EA 4A6YB 4HJ0D 2DLHA 2YUXA 5L2JB 3UC0L 2QSCL 2GT9B 1M71B 3QUMB 3SOBL 3EDKA 4L9LB 1DN0B 4YFEA 3C5ZB 3GZKA 1LDPH 5C2BH 5ICZA 3ZL4L 2K7QA 5CMAA 4BFIB 2HWZL 4XP9L 4LKXB 3OWEA 2VXVL 1U3HD 3DI2B 4NJ9L 5JIIA 4EUPA 3GBLA 1IAIM 5EFIB 1IKFH 1U8QA 3BPNB 2VH5H 5DMIL 2G2RA 4U7KA 1NGXA 4XRCA 3S37X 2MQ0A 4OZFB 4IHOB 3TO2B 1MQ8A 1U8KB 3O3BA 3D25A 4FQQB 3WL9A 4X80H 3DYMA 5IMMB 1NCAL 1WIPA 1KEGL 2XFXB 5EWIH 2NY4D 5CJOL 1OARL 1A6AB 5IW3A 4UUJA 5HI4D 3PABA 1HYSC 1ZV5A 4OZFG 3MRGB 1FL5A 3DRTB 4XAWH 2FEEL 3OHXB 5MEND 4U49A 1BIHA 5BS0A 1BVZA 1FFNB 1A7NH 2VDMH 3IDYC 1R5WA 1OTSC 5F7DB 3P30L 2VDRL 3VXQA 3PGFH 1LILA 3QUYA 4BK5A 2QSQA 4R90H 1FYTB 4PJXA 1BWWA 2R0ZL 4LHUA 4GBXD 2O61A 4PRHE 1CL7L 5DFVC 1U8LA 5HDBF 3FB7B 4G6AC 2DQGH 4JDTL 5IQ7H 2BY2A 2FSEA 1QO3B 1OAUL 2R4SL 4M48L 3VG9C 4MD5B 2YOCA 1MRCL 4XC3H 2AV1A 2HLFD 4KZEH 3LKRB 1W2KT 5FYKE 4K7PY 3UROR 2CDEA 3HZMA 1I8MB 1GSMA 1JCKA 2FGZA 2RB8A 3GM0A 3GRWA 2A6DB 1VEOA 4PTUB 3CVHL 3MXVL 3C8KB 5D1QD 1NBYA 3W2DL 3WJLA 1LO3H 1SJHA 4KJWD 3AS1A 3TBSA 4QHMB 5J6GB 2DKSA 1ZVSB 3BHBB 4KROB 3F12A 4HLJA 4OFKA 1UVQB 3IAPA 4TUOB 4LHJB 2YRPA 4OLXL 5F7KC 1II4E 4OFYD 1AI1H 3HZVA 2JJUA 5CS7A 3LEVL 5BZDA 1KTDA 3EYVA 5HDBE 3DUSA 1RUPH 2WBKA 4P2RE 3OKNA 4KKBC 2ICCA 4OGYL 4NNPH 4YXHH 2DQCL 1SBSL 4K3JL 4LEXL 5CZXD 2V2TA 3AXLA 4WCYL 5CZVH 5BJTA 4L3EE 2BMKA 5MP6H 1MJJA 5F3BB 3QISA 4JRXA 2GY7B 5C07E 5BV7L 4WWKD 4GRMA 2X05A 3QDMD 5BRZD 1MCNA 5I8KH 3ZE2F 2ZSVB 2Q87A 3QJHA 4NO5A 4UT7H 4ENEC 2EYTB 1OTTD 5FF6B 3CC5A 2M2DA 3VXUD 3ZT6A 3IJYA 1V05A 3WJLC 3VFNB 3E3QE 2YPKA 5EOCJ 1N2RA 3S6CA 1X4XA 4J3SA 4YDVB 3WS6A 4YC2B 3T0WA 3P0VL 5C0NC 4AT6A 2ZJSL 1ADQL 5KSUA 3P4MA 5IW6B 5AZ2L 3QQ9C 1JWUA 3MLSH 4P59H 4LLUB 5DK0A 3QHFH 3HRZA 1VKXB 5DRXA 3IS1X 3OKKB 3MXWL 1P7KB 3D87B 4W4OA 4NUJA 5FXCH 4RSVA 4TSCL 5IMKB 4Y5XB 5DQJB 1VA9A 1I75A 2VWEC 4KZDH 1TTFA 4JPKL 5EC2A 3TNNB 3O2VL 3WIHH 3ARPA 3RIFK 5I76A 2ZOKA 2ITDB 3OJMB 1H3VA 1KELL 1RSFA 2OJEB 4H1LA 1EPFA 5JUEL 5IG7A 1WIOA 1IKFL 3NACL 4U4BA 4XB7A 5HYIA 4O2CB 1AO7A 4YHKL 1LO0H 3INUH 5EU4B 3O3AB 1A7QL 3MV9A 5HHNB 2MQ3A 2OMBA 4BFGA 4Y7MA 4PRID 4E41A 2C1PA 4HFWB 1I3RA 3WS6C 5A16A 1G7JA 3BN9D 3MJ9A 3NIDF 5D7LD 2F5BL 3BZFB 2I5YH 5C09A 3JUZA 1PLGL 4G7YL 4HW6A 3GSVA 1A1MB 3CXHK 5TGBA 3QIWC 1OGAA 5DJ6A 3NBNA 1U8JA 5KSBB 3O6LL 1T1WA 1P4LB 4F7CA 1IAKB 4W4OC 1K85A 1RJYA 2PTTB 1TTGA 4FFVD 4QRSA 4QRQB 4LASL 2IPUK 1ZWIB 5KZCB 4Q6IA 2X1QA 5A40E 4MNQA 2J5LB 2W60B 3PHQB 3DX7B 1CF8H 4PY8I 3BI9X 5KOMC 2H1PL 3REWB 5ETUA 3FQRA 1EXUA 1EZVY 1T20B 5E8DH 3IXAA 1DBAL 4XC3L 3MRPB 3OXRB 4WV1A 5T5FH 4O00A 3NIDE 1ZEAH 4P3DA 1F11A 1FBIL 4X9GA 1I7RB 4NQCB 5E2WH 2BSTB 5JXEA 5JORA 5ACZA 4YHLH 2X42A 4ZFGH 3K4AA 1BQSA 2XXCB 4H25A 4IEFB 5LGJB 3UJTH 3AUVA 4JN1H 5GS1A 5A3IC 5TDPA 1E28B 3DTXB 4CW1B 1NAMA 2W92A 1IZJA 3OKEB 3O9WB 1MPAH 1F13A 3NCYP 4PJAB 3UAJC 3TV3H 1UJ3B 5I1KL 3KPPB 1BLNA 4LU5L 2AKRB 5DUML 4KVNL 1WT5A 3BPOC 3DRQB 4JFFE 5A2FA 4ONHB 4NNPL 4YXHL 4XTRC 1ES0B 3OBAA 1IQDB 5DJYA 3VMNA 1JWSA 4HGWB 1D5IL 1YMME 3OAUH 4O51B 4N8VG 5F1NA 1CK0H 3MCKB 5F8QC 2GAZB 5DMGC 1J1XH 4PJIA 5EU5A 3T08A 2EYSA 4WV1C 4M4PA 3IDIB 5TF0A 1DUZA 1EHAA 2VXQH 3ARGB 4G8GB 2GUOB 5SWZB 3TIEA 4NO2A 1XIWD 1IAIH 4LMQI 4F7EA 4F7MB 1FORH 4QHLA 5CIPA 1G9MH 5JXEC 2YSSA 1X6LA 3ARFD 1FYHB 4IRSB 3VA6A 3GGWB 2IEPA 43CAB 4JFYA 1XCQA 3SKOA 4Y4KA 5HHQB 4LQ1A 1QSFD 5GS1C 1OAYL 2CIIB 3RGVC 2YD4A 3GMRB 3LKQB 3VE0A 4GW5B 5GIRB 1AGBB 2P7TA 1DBMH 3BKJH 3KYMB 4XBGB 1DBKL 1NBZB 1V3KA 5F7YC 3L6FB 5E5MA 1CXLA 5IM7A 1WT5C 2XQBL 3QQ3A 2QSVA 5IEKA 4DFHA 4FMFA 4TNVF 4OZIF 4YBLC 4QT5A 5K9JL 2A6KB 2IFFL 4OIIH 1E4KC 3QHFL 2IH1B 5JQ6L 3FQNB 3T0BA 3SGDH 4KDWA 4PUBL 4R8WH 4JR9L 5AG8A 3TEUA 5DRNA 5SWSB 4TOYH 3PG2A 1MCKA 2XNAA 1R0AL 4FP8L 1WUNT 2Y07H 3D3VD 4NIKB 2JTDA 2IG2L 4JJ5B 5FYJH 3P4NA 4V1DD 4KPHH 4W81A 1T0PB 1VB9A 5F6HI 3I02B 1HCVA 1JTOA 5C8JA 3M1BB 3UTZA 3HRPA 2WLZA 4FQ2H 2DM2A 3A6BL 1KPRA 1R3HA 2P8PB 4D0CB 4MCYA 4N0UB 4XP4L 3SBWA 4YDJA 2BSRA 5HHOD 3HPJA 5DHXB 1FGVL 3QXUA 5GSRB 5LKNA 4OZIE 3CFDB 4M03A 5DD6A 5HVHB 4PGCA 4OFDA 4KUZL 3QDGD 5EO1A 1OSPH 3EKCA 3VRIB 2DM4A 4HS8H 4YBHA 5IJKA 3V4VH 1EUUA 4M93C 2NX5A 4GRLA 4EDXA 1CD1A 4WU5B 1F3JA 1CXKA 3O81A 4LOUD 4FNLH 5FO7B 2P8LA 1RZ8B 1LO2H 2DQJL 1AQDA 1M05B 1G6VK 1NC4A 2E7BA 1KCRL 5IK3A 4JFEB 3BZ4B 2IBZX 4P46A 4DAGH 3MLTB 1G9EA 1VFAB 3WDHA 3GHEL 2WQ8A 5I15H 4DCQB 2N1KA 1V7NH 2XKNA 1MFAH 4HKXB 2CGRH 5F88A 1CF8L 2DKMA 4QTIL 5ID0A 1IARB 4M7LH 5HGBA 3O41B 4FFZH 2AEPL 1WITA 3B6SB 2IAMA 1WGOA 1ZXQA 2DWEB 3OR7A 1HXMB 5C0AD 1MCPH 2BNRD 3SBWC 2C3VA 2JB6B 4RQQB 4A6YL 2EICA 3PWPB 3UJJL 3V95A 1BVKB 1CLZL 2ZUSA 3VXTB 2DLIA 2P5WD 3QUML 3I6GB 1X5HA 3CU1A 5IJKC 1FFPB 5MENE 1Q9LB 4MAYB 5T3XL 1QFUH 2OX5A 5CBEB 4JN1L 3QEQD 4H5SB 3T3MF 5BVJB 5I16A 4Z7VF 1AFVH 1A0QH 1HYSD 1MPAL 4C56D 1L7TH 4HZLB 4P46C 2IMNA 3BP6A 3FL7A 3L3IA 3O3DA 3TBYA 1X7QB 2JJWA 3TV3L 5JOFA 5DJDB 2MMXA 4G3YL 2A9NH 1AP2B 5DJ0B 3V2AR 4YHOL 1BIIB 4HBCH 5FO9A 4Z78B 2IF7A 4HAFA 5DK2A 4F37F 2VZTA 3S35X 3HKFA 4EIZC 3V7MA 3FT2B 1YYLH 3L3JB 1A47A 3S88L 5DGRA 5GGSB 3P73B 3U6RB 3L7FB 5BOZG 4NQEA 5ESVA 2IAMC 4UB0H 1BD2B 5D6DA 1ZAGA 4ELMF 1AXSB 1CD8A 2XZAH 4G6AD 2WBJA 1M7XA 2BSED 4U6HA 1IGIH 1JTPA 3SEPA 5L7XH 1A7RH 4KAQL 1XCTA 3FTGB 4LBEA 1FORL 5F89A 4JO3L 1G9ML 1DR9A 3DX6A 4UTBH 3T3ME 1QVOB 2WIMA 4S0SD 4Z7VE 1KB5H 3PL6D 4P2QB 5I0DA 1ZT7B 4L8BB 4ZFZB 4HS3A 4NBZB 1XF2A 3SKUD 1INQA 2H6PA 4F7TB 3UCRA 2MPAL 4X99B 3NGBC 3QUXB 2EDRA 1PQZA 3BKJL 3TZVD 5EORH 5ALBL 2QL1A 3QWOA 3WNPA 1MIEL 3PGDA 3VJ6A 1B4JH 3SO5A 2V7HA 3CXDL 2AW2A 1IM9A 1ND0B 3RY6A 4RMVA 4HUNB 3EZ8A 5H8DA 2UZIH 3IGAA 4YHMH 2DQFB 5JXAH 5E7BA 4ELME 4F2MA 4OLYH 1CLOL 2AGJH 4RAVA 4YUEH 3EOYG 2F8XC 5CILL 4B0MM 1LEGA 4Y19D 1WEJH 2GJ6D 5D6DC 2W1NA 5L6YL 2AEWA 3RWDB 1S9XB 2WBJC 1KPUB 3DSFH 3L5WB 5BRZE 1KLFA 3O0RH 4RNRB 3UZEA 2VUYA 4H88H 4KTDL 4BK4A 4P57A 5C86A 4TULH 1WAAA 4DVRL 3WO4B 2N56A 4JPIA 3GMPA 5DF0A 1QEWA 3Q3GB 4TVPL 4JM2A 5GS0C 1X4YA 1CICB 3JV6A 4KY1L 1JTTA 4JEGB 4XWOC 4ENED 4PV8B 4DOHE 1A6UL 4QF1B 5J8OA 4X4YB 1PG7W 2LU3A 1ZLWK 3AY4C 4ALAL 3JV0A 4JE4B 2Q1EA 1YDPB 5DEFA 5JIHA 3D0LB 1AJ7H 3KYKL 3VGEA 5C6TL 5E1AB 2Y5TA 3SCMC 4OGAC 1A6ZB 3V4VL 3RY6C 1TQBC 3W9DB 4XWGH 4BSWA 5C0RH 4TTDC 4WFFD 5JMOC 3QR2A 2OQJA 4WI3A 1L0YA 3DUUA 1AXTH 4LEOA 4M6MH 3EFDH 3ETBF 1CDUA 2LAAA 5AG9A 5T3ZE 1JPGB 3TIDA 4HWZA 3DJ9A 5DJXB 3X17A 3QQ9D 3AROA 1QA9A 3WD5H 4M1GL 4WW2A 5JPNA 5I15L 5FHAL 1DE4B 2GSGB 3ZDYF 5K9KB 1MFAL 4HC1A 4AMKH 1JYVA 5E8EB 4LRIA 1S7VB 3LN9A 5HXMA 2ZCHH 1Q38A 3LB6D 3R06B 1Z9SA 5L8LB 1VESA 1Y6KR 3MUJA 3AREB 1UM6L 4JB9L 4XPAL 2DD8L 1NFIA 4LARH 4WHDA 1QBBA 4JM2C 5IBUB 1YMHA 1T5WB 1FL6B 4PRIE 1IT9H 1I7TA 2DI9A 3OTTA 4HFUL 4UBDC 5IHBA 5EU7E 1SEQL 4OF7A 3LN5A 3C6LB 3D85A 4PRHB 2ORBL 3MBEA 4M9OA 5D7LE 4J2XA 3LS5H 2RIKA 1KIQB 1CIUA 1FLRL 2CDFB 5IBUG 5DEGA 1IQWH 1N0XL 4P4KA 4GKZB 1U93B 4MJ5A 2HRLA 2X9YA 4HMCA 1NUFA 2YA1A 1RZKC 1A0QL 5CGTA 5FCUL 3BMWA 3HUJF 3ZDYE 2HVKB 4OM0L 4L29A 4NM8L 4E0RB 1MI5E 1WIUA 2RCSL 1IILE 3QIWD 4WW2C 1RZ7L 4JAMA 4B53A 1G9NH 5DD3H 3IAQA 1FNSH 2F58H 4K2UH 4LRIC 4YR6A 3MO1B 4WI7A 4XMPH 3JWDH 3RUGA 3VXRA 5HDOA 5DQ9A 2I07B 2LABA 1WC7A 4OF6A 2G9HA 4WWID 4KJYA 1YYMH 1JK8A 2XY1A 4OZGB 4P2RB 1CU4H 8FABA 1KT2A 3OR6B 1X5YA 3L1OL 5GQBA 1A7RL 1I3GL 5MI0C 5E99H 3MBEC 5DHVB 1WLHA 4Y2DA 1MUJA 1LP9A 2HVJB 4L3EB 1QTYT 3HUJE 4E41D 1SYVA 4P4KC 2E9JA 5IKCB 5C07B 1OCWL 2FBJL 2DRUA 1F97A 5ESQB 2Y25A 4X4XA 1W0VA 3T1FB 4XCYB 1TCRB 2HRPH 1AGDA 1IZKA 3VFGL 3VRJB 5EORL 1HHGA 2GIYA 4IOIB 5HI3C 2ARJQ 2FH8A 1M7DB 4FTVA 3ZO0A 1L0XA 1PYWB 4WEUD 2VSCA 3IDNB 4RWYH 4XVUD 5JW4Q 3UAJD 3MFFB 3RI5F 4G8FB 1ZT1B 3MOQA 4M6NH 4OLYL 4XCNA 1I8KB 4LF3A 5FCSH 4MAUL 3WEXB 1RUAL 2HKFL 1LE5B 4HIIB 4TTGA 1G7QA 1NCCH 5I73C 4ONGL 4HIXH 4P9HL 3ELAT 4H88L 3QNYA 4GQPH 4KMTH 4RX4D 2ICES 1LD9B 4QRTA 4MJ6A 4Y2DC 3DX8A 2FRGP 4JHWL 1H3UA 1FLTX 1LWRA 2OTUA 2VLRE 1A6PA 4MA3A 5I30L 4FFWC 2FGWL 3TPKA 3QXWA 3QRFM 3C60C 3WFEH 1ACZA 4PGZA 4NQUA 1TJIH 3RGVD 3BRDA 1Q72H 1A7OL 2OTWA 1MH5A 4BH8B 3T65B 4O2EA 3DECA 1HNGA 4NM4H 4XPGH 5EIIB 1LEKA 1AXTL 1VHPA 3E1F1 1G7HA 4HJGA 2D9CA 4U0RC 5DI8A 3D3VE 4LCYA 2D03H 5D7IA 5GGSY 3TBVA 1EFXD 1T03L 3WE6B 5J3HD 5DRZA 2C3GA 5E2TL 2G60H 3TWCH 4JREC 2WMPA 1S7XA 5FGSA 1M4KA 1FG2B 5GGTL 5HJ3B 4CU6A 4XC1H 1D6EA 1RVFL 3QG6B 3MV8A 4PGBB 4BQ8A 1XF3A 5AD0A 2ADIB 1TJGH 4MXQC 1AY1L 4JANA 2Z91B 1JUFA 1J10A 1NJ9B 2QQLH 1YEDA 3QDGE 3CU7A 3PQYE 4KTEL 4QGTA 5E2VL 3BGFB 2NLJA 2QHRH 1Y0LA 2Q7YB 4HKZB 1S9VA 1BAFL 3RBSA 1CDJA 3FT4B 3LRHA 3BEVA 4RGNC 5FGCE 4KH2A 4PGJA 5FYLE 3U82B 4NQDA 5C0JB 4HEPG 4LNVA 5INDA 3RPIA 1IC7H 1MF2L 3GMMB 4AIZA 2V5MA 3SKMA 2OR9H 3U4BH 5DD3L 4DZ8B 5CHNA 4LVHB 1AD9B 3ESVF 3CFBB 2VTFA 1J88A 2ZG1A 3QI9A 4HH8A 3B5TA 3ULVL 3K4ZA 1VPOH 1KTKE 2R4RL 1HE7A 4PJ8C 2ITCB 1BGXL 3GMQA 4M5ZL 5FA4A 3FRPG 4YHYC 2DICA 4AJ0A 5C0AE 2BNRE 5B38A 4M7JH 1YEIL 1Z5LB 1QLEH 4OCYH 5EOTB 4JFFB 3BWUC 1WBXA 1TVHA 2P5WE 3KPSE 3ZTJH 5I1AA 5J57B 4FFYH 1YMMB 4OI9A 5JA9A 5INCB 3QEQE 5EO0A 5MEOB 2B0SH 4MQTB 4WI2A 4ZFFA 4PJFA 3HG1E 4C56E 1I9RL 4PJGF 3MNVA 3LKSA 3GSWA 4OB5H 3LDBC 2NX5D 4QRRA 1J8KA 3W11D 4S1SL 2HRPL 4IS6A 1SM3L 3SGDI 5GJTH 2VDOL 3JTSB 2HG5B 4N5ED 2O26U 2EKSB 5T1LA 3PP4H 4IRJD 3QI9C 4UINH 2DJSA 25C8H 3EFFA 2BVOA 4M6NL 3LAFA 4AM0B 1JV5A 4AZ8A 2LAGB 4LPVA 3MR9A 5GRJH 1P4BH 5HHVH 1U92A 3ULUL 2GY5A 2CJUH 2F8OA 5FFLA 1IBGL 4LLAA 1J7VR 2NTFB 4IDLA 4XHJD 4PJGE 4JLRA 5J6HB 3PIQA 4NCC1 4NC1C 1OGTB 3S97C 4X83A 1F8TH 4KQ3H 1FZOB 3ZKND 3V0VA 5ICYB 2DLFL 3TLRA 2R1YB 4X0KB 2C7UB 4K3EH 4UDUB 1L7IH 2XTJB 4JDZB 5BS0E 5BW7A 4NFDA 3BW9A 4P2OD 2EDNA 3LD8B 1ED3B 3LPFA 2BP3A 5I8EA 3QQ4B 4NT6A 4YK4B 1K4CA 4Z7UF 5KW9H 15C8H 5CKAA 1TETL 3LIZH 2YRLA 4FQPA 2H8PB 4GH7B 2YRZA 4Y19E 4Z7WA 5SX5K 2F53D 3N1PC 2GJ6E 4M5YL 4OZIB 2A0LD 1EGJH 3FQTA 5E8OB 4HKBA 3TM6A 2D7NA 4ZO9A 3HI1A 3U1SH 2D9QB 4PJBA 1BBDH 1FV1B 2G60L 4XVSH 1UXWB 2Z4QB 4N8PA 1E4JA 2X2YA 4HS6A 4XP1L 1EBPA 1KC5L 5CEYA 5DR5L 3G5XA 1P2CA 3MRDA 2X70B 1KIPA 2XG4A 1BFVH 4XC1L 3HE6A 1K4DB 4XMLH 4M7LT 4XXCA 4P5KB 3S36H 4J3TA 4PJHA 3TC9A 4YEFA 3BPLB 4PP2A 5J1AA 4PB9H 3DMMD 4C83A 4I18B 5BW7C 2WK2A 2HJLA 5GS0D 1HHIA 4Z7UE 4KFZC 3O4OB 4H20H 1HI6B 5D2LA 5F6HJ 2NXYC 5F7UA 1L9MA 3VI3F 3E2HC 3PHOA 4WFFE 1BX2B 3U46A 1TTUA 4MJ2A 3MV11 3SDCA 5DYOA 4I8DA 3BDBA 2PO6B 4HLZH 4JY5L 3RVUC 4GAGH 5IFJB 3SCMD 2H9GA 4H8WL 5DD1H 3NFPA 4WO4A 5H37H 1A14L 3TVMD 4QXTA 5L9DL 3ISWA 4Z77A 1FPTH 4TTDD 3BZEA 2NY4B 1S8DA 1ZGLP 3V52L 1VSCA 2EE3A 1Q9OB 2OJZH 3MLVL 4K94C 1NGWB 5MENB 2X1PA 3FQWB 3ILQC 2VWEE 1KPVB 3QXTA 1OLLA 5C71A 4ZD3H 4XZUB 1VPOL 1NGQH 4NRXB 2OSLA 4JHBA 5C08A 5J1TC 1ITCA 3UZVB 4FA8A 4HUUA 4LVEA 4R0LB 3T2QA 3HE6C 4OV6F 4XXCC 5GGUB 5C7XH 5CJXC 3X12B 2GT9A 1M71A 4YDLC 3T2PA 4BELD 5DJZB 4R6UA 1FAIL 1A3RH 3VI3E 2VIRB 4MYWB 1DN0A 1ZHNA 1EEUA 4JM2D 4BM7A 5MERB 1EIBA 3C5ZA 1J87A 4JZJA 3VFMA 3BWAA 3ULSA 1U8MB 4FFYL 1DQJB 5EO9A 1S78C 1T66C 1MCBA 3BDXA 4YHPA 1T7YA 3SDCC 5F9JA 2OLDA 3MA7B 4K8RD 3FMGL 4XVTL 5ABDE 3KPQB 4R96B 5CBAB 2ADGA 4ERSL 4OZFA 3TN0A 4Z7VB 2IALB 5TDNB 3TO2A 5D1QB 3P3YA 2P42B 3LS4H 2BNUB 1I9EA 4IDJL 1RURH 3P11L 4FQQA 4HDIA 4JM4L 4R4FH 3L3HB